4EDUA

The mbt repeats of human scml2 in a complex with histone h2a peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
211
structure length
211
Chain Sequence
DFHWEEYLKETGSISAPSECFRQSQIPPVNDFKVGMKLEARDPRNATSVCIATVIGITGARLRLRLDGSDNRNDFWRLVDSPDIQPVGTCEKEGDLLQPPLGYQMNTSSWPMFLLETLNGSEMASATLFKKEPPKPPLNNFKVGMKLEAIDKKNPYLICPATIGDVKGDEVHITFDGWSGAFDYWCKYDSRDIFPAGWCRLTGDVLQPPGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Histone recognition by human malignant brain tumor domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Sex comb on midleg-like protein 2
total genus 54
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2012-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4eduA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4eduA01
4Z02A 2CKKA 3EAEA 3UT1A 2WACA 4IURA 3OS0A 4PL6A 3MEWA 4E7KA 4B9XA 2JTFA 3LYIA 1RI0A 2L8DA 4A4HA 4IUUA 3META 5CIUA 3OS2A 3L2VA 4BE2A 1OZ3A 3PMIA 4N4GA 2GF7A 2EQKA 2M0OA 4QQGA 5KCHA 5KE3A 5D6YA 2RHIA 2L89A 3OQ5A 3OYDA 3OYCA 2M1HA 1WJSA 3OYKA 4A4EA 2RHZA 4C5IA 2LTOA 2RHUA 3OYHA 5FRMA 2NLUA 4A4GA 2FHDA 3OMGA 1WJRA 3PNWC 2DAQA 3OYIA 3OA6A 3O8VA 3S3MA 3M9QA 4BE0A 2EQUA 2G3RA 1OZ2A 3LX7A 3F70A 3L42A 3MEVA 2LCCA 3E9FA 5KCOA 3LH0A 3FLGA 5KE2A 3OS1A 2R5AA 3OYNA 3FEOA 2EQMA 3NTIA 4BDYA 3ASKA 3L2QA 2RHYA 3C4SA 2BKDN 4E7LA 2GFUA 2BIVA 2HQEA 1XNIA 4BD3A 2X4YA 2X4XA 4E7HA 4IUQA 3MEAA 4IUPA 2JZ2A 2YRVA 3OYFA 4LD6A 3KUFA 2GFAA 2EKOA 4BE1A 1WJQA 3MP1A 3ME9A 2LDMA 3OYBA 2E5QA 4ZTJA 3CEYA 3L2UA 3MP8A 4C5GA 3OMCA 4CRIA 2O4XA 4PLIA 4QVZA 2MWPA 3BDLA 2K3XA 3L2WA 2PQWA 2R57A 2DIGA 3PFSA 4II1A 5D6XA 3OYJA 3GOXA 2DIQA 4BDZA 3OYMA 3H6ZA 2EFIA 2F5KA 4IUVA 2RJEA 3Q1JA 3S6WA 4B9WA 4IKFA 2RO0A 3MO8A 5KH6A 3DB3A 3MP6A 5J26A 3ZEHA 2D9TA 4FU6A 4NS5A 2LRQA 2RJDA 2R58A 4BACA 2XK0A 4GY5A 4OVAA 5C6SA 1SSFA 4ZTFA 1WGSA 3LGFA 4N4HA 4C5EA 2RJCA 5FRNA 2QQSA 5IN1A 1KHCA 3OYAA 2RHXA 4QW2A 2E6NA 4X34A 3NTKA 4QQ6A 1OI1A 2L3RA 1N27A 2P0KA 5FROA 3NTHA 3OB9A 3OYLA 3S3OA 2M16A 3S3NA 2B8AA 5D6WA 2HQXA 2IG0A 2RJFA 2X35A 3OYGA 1G5VA 2QQRA 3QKJA 4HCZA 3SD4A 2EQJA 1H3ZA 1OYXA 3MEUA 3QIIA 3FC3A 3DB4A 2VYTA 3QJ6A 4E7IA 2RI3A 4QQDA 5M9OA 3P8DA 3FDRA 3L2RA 3LGLA 4C5HA 5IAYA 4E7JA 3UWNA 3OY9A 2MWOA 5J39A 4A4FA 2BUDA 4EDUA 3E9GA 2K3YA 4L59A 2XDPA 3P8HA 4FL6A 5C0MA 4Q5WA 3DLMA 2X4WA 4N4IA 2O4XB 4IUTA 4RG2A 4UC4A 2RI5A 3OYEA 1MHNA 2RI2A 4PLLA 3PMTA 2LVMA 3QBYA 3LLRA 3H8ZA 2R5MA
chains in the Genus database with same CATH superfamily
1HXDA 4LDWA 1C1AA 4PL6A 2MCNA 4FCYA 2Y90A 1IHWA 2DETA 1BCMA 3G7ZA 1OX8A 4JRPA 2LTOA 3PIPA 4M4ZA 1GCQC 4M77F 1AWXA 5GAMf 4JLIA 1JJ2P 3VS5A 1Y96B 2RB6A 5IH2A 1B07A 3IQLA 1C0MA 3E9FA 1NM7A 4ZGEB 1VQ4T 4F16A 2CT4A 3RKXA 3A8GB 1Y57A 3NTIA 1D0YA 5CKEA 3QZ9B 2DYIA 3L2QA 3VS0A 2YUQA 3TU4K 4JS5A 3OYYA 3MEAA 1G3YA 3CMAA 4EMKA 3CPFA 5IT9E 1M5Q1 1K0SA 1GCPA 2LJ0A 1Q82U 2DFUA 5LJ5e 3CCUT 2HL5C 1JQQA 1FYNA 2E64A 4PLIA 2MWPA 2K3XA 3EFOB 2E3IA 1Z9QA 2D8HA 2SRCA 2HDAA 3P8BB 4IUVA 4B9WA 1SKUB 1QVPA 1B3QA 3E2UA 1RUWA 2RPNA 2B86A 2OJ2A 2ZGWA 3MHXA 3VRZA 3WVEB 3X24B 1E6HA 4MZTA 4QQ6A 1VQ5A 4F04B 1E6GA 2DKGA 3A8HB 3CCSA 3CCVQ 2D8JA 1XJWB 1OYXA 2DXBA 2QEXA 1CSKA 3V7SA 2VC8A 3I35A 3FDRA 2OTJA 1YIJA 4M7AD 3NGPA 4NL2A 4BI4A 1PKTA 1K9MC 2GCXA 2QTXA 3JB9I 5I2SA 3C12A 1BU1A 1B7TA 3A8LB 1YITQ 1BIBA 2M9UA 3EG3A 1YI2A 1KD1U 1F1BB 1SRMA 1OU9A 4M77E 3LWIA 4C92B 1VQMT 1MMGA 1RI0A 5GAOr 1M1KC 1HK9A 1UGQB 1VQOA 1UDLA 3EGDB 1YCSB 2HBPA 2FPFA 4A4EA 1MMNA 2K5IA 3OYHA 1N9SA 1BI3A 5LJ3d 2DJZA 3F70A 4E6RA 2P0PA 2J6KA 1JJ2A 2D0QB 4PJLA 2RM4A 1JU5C 1KD1R 5I2MA 4BD3A 4IUQA 3BY7A 3H41A 3GF5A 2DEQA 2DXUA 3KUFA 4C8QC 1G3TA 3MP1A 3ULRB 3CC4T 2E5QA 4ZTJA 3JV3A 3L2UA 2L5QA 4C0DB 5GMKi 1LNXA 1BI1A 3BDLA 3G6ET 4M78C 3CC2A 1AT1B 2DL8A 3Q1JA 4ZNXA 3H9NA 2CT3A 5KYUA 1M27C 2KRMA 3MP6A 3CCSQ 1SHFA 4N0AC 1D1AA 2BZ8A 1KHCA 2DL7A 2KMTA 2E6NA 4M78G 1QW1A 1WYXA 1BCOA 5CAIA 1AWWA 3S3NA 1OV3A 1UHCA 2QTVA 4FT4A 1YJNQ 2QQRA 2K2MA 5GANe 3OBWA 1WHMA 2YUOA 5M9OA 2YSQA 3JCMc 4C5HA 2KDSA 1W4SA 1W6XA 5FWCA 1FMWA 4XTWA 3JCMb 1MUZA 3VS1A 1AD5A 2BZYA 3CQTA 2HCKA 2RA2A 2CP3A 3OW2A 2QQBA 1MHNA 2NUPB 4BY6C 2H3EB 3EHRA 1UJYA 4B9XA 3KBGA 1M2VA 4F7UA 1XQHA 5KE3A 3FIFA 4J9EA 4M75B 4C92E 1H3HA 1YIJT 1VIEA 2NLUA 2DZ9A 5A0DA 5GAN7 3QHSA 1VQ5Q 3X26B 2EBPA 3S3MA 4Z89A 3H0FA 1R0BG 2EQUA 4BB7A 3L42A 3CCUQ 1KQ1A 2QA4T 2E10A 1NJIU 3O5ZA 1RLPC 4HVWA 5GAMh 2GFUA 2PUKB 3CC7T 4M7DA 4B6MA 1VQPA 1XNIA 2CSIA 3EGXA 2V1RA 1K73U 1PD0A 3MCAB 3UA6A 5FLXE 3VKIA 3ME9A 2LDMA 1VQ8Q 2RQUA 2DNUA 2P4RA 5LJ3f 1UHFA 3UA7A 3L2WA 1QVGP 4BDZA 3HP9A 5GAN3 2RJEA 3LH5A 4MZMA 1G8XA 1QQJA 3WXMB 1QVFA 1M1FA 3CCRA 2MK5A 5IN1A 4MMKA 4OMLA 3TSWA 2DM1A 2JMAA 4RTVA 3G6EQ 1VQLQ 3VYHB 5LJ5g 4P5NA 3FRNA 4AG1C 1OU8A 4YTLA 2RJFA 2K5FA 4D8KA 3CCQQ 1U8RA 3VYGA 2I2LA 3M5AA 1RI9A 3QUIA 3UWNA 1KQSP 1Y7XA 1RABB 3EH2A 1VUBA 5HY6A 1EIFA 2RI5A 5KYXA 1VQNA 3URGA 3VS6A 3REAB 3MEWA 4E7KA 3LYIA 1TTHB 2YUPA 2H8HA 1VYTA 4M7DD 5FU7C 1UG1A 1TUDA 2X3XD 3G71Q 3OMGA 2WSCE 1NPRA 3CBPA 2QQ9A 5L23A 5KE2A 4AMCA 2EQMA 2CZ1B 2YWWA 1BK2A 1Y96A 3CXCP 1R77A 4PK4A 4VUBA 3ZBDA 2QGGA 2BIVA 4HKEA 2HQEA 5GANf 3OYFA 4XQ3A 2P84A 3A5ZB 1QMCA 4C92A 4ESRA 1NG2A 4EMKC 2ZPIB 3VUZA 1X43A 2KK4A 4FSXA 2M0YA 4K11A 1M30A 3S6WA 4J9CA 3QPHA 3SFMA 1YJNA 1GFDA 1NYFA 4C5EA 3LGFA 4PJOB 4CC7A 5KYWB 1I1JA 1C6VX 4F7UG 5CKHA 3OYGA 1M3CA 2JVVA 1WXTA 1M90C 3FC3A 2VYTA 1M4ZA 4J9IA 1ZUUA 3T9NA 2FZKB 3P8DA 3CC2Q 2OAWA 1WI7A 3REBB 1RLQC 1WPYA 2J7IA 1WA7A 2GTJA 1RADB 3X25B 1X2KA 4LDXA 1GFCA 5CKBA 3OYEA 1X27A 2KXCA 3RDVA 2ZCFB 1UGRB 2L3SA 4AFUC 3UT1A 1BYMA 5IHKA 1WXUA 3HTRA 2JTFA 2V8IA 4JRIA 1T3SA 4N4GA 5KCHA 5GANj 2ESWA 1M90R 4FW2A 2K2VA 1VQ6T 2L89A 4BY6B 3OQ5A 3GIBA 1HD3A 5GAN6 1M1KU 2FZCB 4JZ3A 5I22A 1EZZB 2KSSA 4X9DA 5GMKm 3OS5A 3NHNA 2ZPEB 3CXCS 1UE9A 2FO0A 4MDXA 2XIDA 1LCKA 2CP0A 2MYSA 2DK3A 3FLGA 4M7DB 2C0TA 1VQ8T 2COZA 4RCBA 1IHVA 3PGGA 4JS4A 3RIRA 2RHYA 4M78F 1Z9ZA 4MMLA 1TU0B 1U3OA 3I56T 2H3JA 3SWNC 1ZQ1A 4RCCA 2O31A 2DTHA 2JS0A 1PD1A 1YITA 1YHQQ 2C0OA 3MP8A 3PIOA 4C5GA 2OTLT 4QVZA 2RQWA 2E3HA 2DIGA 3V8KA 3M4YA 5GAN4 4CC3A 3HFNA 2E70A 1K8AR 4J9BA 1N5ZA 1YJ9T 4ZGJB 4NS5A 4M78A 4LNPA 4M7DG 1JXMA 4M7DE 5LJ3h 1FWZA 1SEMA 4RKUE 1YHQT 3CCJQ 5GAOm 2RHXA 1CKBA 1I4K1 1ZBXA 1KQ2A 3OYLA 3NTHA 2LJ3A 1JBMA 2KR3A 3V8JA 3HRTA 1QKWA 4M77A 3DB4A 2KNBB 5IAYA 1E7OA 2VGNA 5J39A 1WIEA 1M8VA 1TUGB 2XHCA 1S72T 1IGQA 3DLMA 1J3TA 3CD6A 3EFSA 3CBMA 1QCFA 5GANh 1QLYA 4DBQA 4M7DF 4J83A 2J06A 3RKWA 3M0RA 1QVGS 1X01A 2LX9A 4IUUA 2DX1A 3PMIA 2K6DA 3DKMA 1W1FA 1QP3A 3CCVA 4F7UB 4HCCA 1R0CB 5GMKe 1WJRA 1ACMB 4QVCA 4OMPA 1W70A 2HKQB 3LX7A 4PJOG 1ZSGA 2EGCA 3V8LA 1I5LA 3JB9J 2LCCA 2OTLQ 4LUDA 1OOTA 3JB9G 1YNZA 3ASKA 4EMKB 2X3WD 2CZ7B 2BKDN 1UECA 1ZBJA 4LUEA 4BI8B 4IUPA 1X69A 2PUOB 1IZ6A 2VUBA 2GFAA 2EKOA 1RAFB 2FZGB 3OMCA 3KFVA 1BB9A 4FW1A 1K8AU 2RK1A 2MI6A 4II1A 4F7UE 2DVEA 2KGTA 5AYFA 3QYGB 1JB0E 3DB3A 1MV0B 1KC8U 4J6WA 2NUTB 2DEUA 2PZ1A 1KC8R 1TH7A 3UDCA 3OYAA 2QG9B 4E7ZA 1JEGA 2J6OA 2HBWA 2ABLA 1VQMA 4NOYA 5FROA 3S3OA 2LZ6B 4KULA 2XKOC 2AZSA 4C0DC 4R55A 3SD4A 1FXXA 1H3ZA 3SHWA 1PC0A 3CPWS 2L0AA 5GANd 2ENMA 2E5KA 3RNJA 3M57A 2DPPB 4Q5WA 1KQSS 4JLGA 1WNLA 2A36A 4IUTA 4JDSA 5A2QE 3HKSA 1VQKQ 3UPUA 2DL5A 2JNGA 3PTAA 3QWXX 3FB9A 2RNAA 2KRNA 1VQ5T 5LJ3g 1OZ3A 3EG0A 1PKSA 3RERA 3HFOA 2RHZA 2AK5A 2RHUA 3CC7A 2M02A 2BTTA 2FYKA 4KH0B 5DLQE 2MF2A 5EC7A 1VQKT 3QO3A 4BE0A 5GAOq 3OSVA 2OAUA 1H641 3C0CA 1K4US 1S72Q 2VXFA 4J5YA 1SF9A 2J6FA 1ZX6A 2X4YA 3CCQT 1SG5A 1LJOA 3ER0A 4LD6A 3CCVT 1GL5A 3QDRB 1UGVA 4WF2A 4XAXB 4JJNK 1AWJA 2F2WA 3EFRA 3M0UA 3PFSA 3GOXA 3H6ZA 2HSEB 4IKFA 2VWFA 2IVWA 3CCST 1S1NA 2EQIA 4FU6A 4M77C 3C95A 4BACA 2OTJT 4GY5A 4C8QB 2EKHA 2QQSA 4DBFA 1JRIA 1M9SA 4J8OA 1Q7YR 3INZA 1GXIE 2LCSA 1OI1A 1BBZA 1ZSZB 3CC4A 1MV3A 1Q7YC 1CKAA 3CC7Q 4C92D 4FT2A 2KAFA 2RI3A 1Q86R 3L2RA 3LGLA 3VS2A 3RR6A 2FRWA 2MWOA 1VQOT 2O2OA 4A4FA 1YP5A 2CDTA 4CC4B 2O9VA 4OMQA 3BE3A 2FPEA 4Y91A 2GBQA 1M3AA 2DD4A 1H92A 3QBYA 1FMKA 4V2SA 2EJFA 3VS3A 2EGAA 1M2OA 1O9SA 3VJPA 1N8RR 1HJDA 1U5SA 1YFNA 2M0OA 1G83A 2PVDB 1I07A 2MIOA 3JCMW 3A98A 1ZLMA 2RQTA 3JCMh 4DA4A 3CCEQ 2HSPA 2A08A 2P4TA 2LQWA 1WDXA 3QG1A 2CZ6B 2F5TX 2WSFE 1KG1A 1Q81R 1M1GA 4M75G 1G3WA 5FU6B 2K5LA 4LN2A 1WHHA 1ZSZC 2FEIA 4AFQC 4R56A 1D3BB 2CGHA 4TVRA 3EG9A 1D09B 1YJNT 3L2ZA 4KT0E 1AHJB 4BE1A 5LJ3e 2QA4Q 2DF6A 4QVDA 1U1TA 3CCJT 4PFPA 1YIJQ 3OYMA 3NMZC 3I55A 1K76A 3JCMP 1WX6A 3QWYA 1X6BA 1X6GA 1WHGA 1GRIA 2PNIA 4FYXB 1SRLA 4OGEA 2DL3A 1UTIA 2E12A 4M7AF 1PG5B 2W10A 2RJCA 1K73R 4HA8A 4M78B 2L3RA 1OX9A 4PFZA 3H0IA 2F2VA 2HQXA 2IG0A 2X35A 1NJIR 1KC8C 4C8QE 2YLBA 1QVFP 1PSEA 4C8QD 3CCMQ 4D6WA 3BW1A 1FX7A 2YHTA 2EYWA 4O5VA 5CVIA 1OPKA 5I21A 1TOVA 4M7AA 2XDPA 3P8HA 4LDUA 2O4XB 4PJOC 1KJWA 7AT1B 4XU0A 4M7AG 2IIMA 3LLRA 2R5MA 2CKKA 3EAEA 5CK9A 1KQSA 2CP6A 1Q95G 2PTKA 2LP5A 5GJWB 2K9GA 3SDZA 3OS2A 5CIUA 2LQ8A 2NUTA 1OPLA 2DERA 4M78D 5GJVB 1Q86U 1V1CA 2CYZB 1UGPB 1TWBA 4A4KA 2HEQA 4DOVA 2G6FX 1KFZA 1YI2T 2YRCA 3AT1B 3FJ5A 2MOXA 1UJ0A 2LNHB 1VQ7Q 1WFWA 5GAN2 5GAMg 2MMPA 3VU3C 3QSUA 2IPOB 4NL3A 4Y28E 4A54A 4M7AB 4EMGA 2X9HA 1IRXA 2QA4A 4XTXA 2R57A 3OYJA 4QKUA 3KXTA 4L6V5 4KRTA 4F17A 4M7DC 3QJYA 5KH6A 3VV0A 3CCLQ 2XMFA 2WSEE 5KYWA 2XK0A 1Q81C 4OMNA 4ZTFA 4ANJA 4EMHA 1D1BA 5CCAA 2DVJA 1NZ9A 2NWMA 3M58A 3CCEA 2KEAA 3MEUA 4E7IA 4PJJA 2A28A 3BFMA 2RQRA 3MPUB 1K8AC 1AZGB 1T3LA 2ED1A 4ELYC 4UC4A 1BI2A 2C06A 4XTUA 1AEYA 2JMCA 4ME7A 4X34A 4ZGDB 3CCET 4CC2A 4Z02A 1QCOA 1VA7A 5GMKj 1RAHB 2QYZA 1N9RA 2XICA 4M77G 2COWA 2M51A 3EFOA 3HSBA 2X4JA 1YJWQ 5D6YA 1WQWA 2I0NA 2DMOA 1XTDA 1K1ZA 3OYKA 1D0XA 2L2PA 2COYA 2CH4A 2ZPGB 4EPCA 5GAOl 3CC4Q 2DRMA 4RTXA 2EVRA 2YUNA 2CP2A 3MEVA 3SWNA 2DTOA 3LH0A 2XU8A 1D3BA 2DLPA 2AKKA 2F2XA 5KYYA 4IIOA 5CO7A 3H0HA 3I9QA 4O6JA 2CP5A 1AWOA 2W0ZA 4JPBW 4HVVA 3SB2A 1W2BP 1UGSB 4DBRA 5A0GA 2O88A 3JB9F 2GGRA 2LX7A 4CRIA 1M2VB 2YDLA 5D6XA 2DBMA 1TUCA 5IHIA 1Y0MA 3MO8A 4M78E 2KT1A 3ZEHA 2LRQA 5GAN8 4PNOA 2R58A 5ECAA 2KI7A 4J7FA 4AT1B 2K3BA 1PNJA 1AVZC 1UUEA 1YITT 4PJOA 2B8AA 1P92A 5GAMe 1JO8A 1G5VA 1NYGA 3CCLA 3QKJA 5LJ5d 2Y4XA 4HCZA 4GBQA 2KROA 4IIMA 1YWOA 1N8RU 2KYMA 4JZ4A 2GNCA 2AZVA 9ATCB 2NUZA 1VQ6A 2EAYA 1V76A 5GAMj 2CSQA 2VXEA 3JCMX 1AOJA 2O9SA 4M75F 4OB3B 3U23A 1VQNQ 3PMTA 2DL4A 3H8ZA 3LW5E 2ROTA 3OS0A 2A3LA 2JM8A 4BUGA 3OBYA 4JUVA 1NEBA 2EQKA 2F1LA 1VQ4A 2LMJA 3OW2P 4RG8A 1HSQA 3VRYA 2HAXA 2CREA 3JCMd 3I5RA 2D0NA 1VQMQ 3G6EA 1QCNA 2G3RA 3CC2T 1B34A 5LJ5h 2L3QA 1PM3A 2K79A 5KCOA 2VV5A 1YN8A 1WQ7A 4XTVA 3FEOA 3VS4A 1Q82C 1R8OB 1H8KA 2VGMA 1Y71A 1PSFA 3NPFA 2X4XA 1YJ9A 2QXFA 1UB4A 3QDFA 2YRDA 4OB2B 1ARKA 4E7SA 4J9FA 1VQ8A 4PJOD 2E4HA 2V8JA 3L1AA 1VQPQ 2HKNA 1X2QA 5KYNA 2D9TA 1VQ7A 2RH2A 2KY9A 4KGXB 4HVUA 4OVAA 4JJCA 1WGSA 5HKCA 2BZXA 2OTLA 1EFNA 3CCUA 2HL3A 3NTKA 3X20B 2J05A 3JCMe 3WVDB 1T0JA 1BI0A 1WHKA 1LVKA 4DOWA 3JB9H 2QI2A 1TSFA 1MNDA 3EG1A 1T0HA 3LWHA 3RUXA 4F7UF 4GLKA 2EYQA 2CH4W 5LJ5f 3UATA 1I8FA 5C0MA 3VS7A 1G2BA 3G71T 4N4IA 2XDBA 1GBRA 1ZUYA 2DTIA 2QGFB 3E19A 4FIBA 4PFOA 4C0ZA 4A4HA 3L2VA 3META 5CQXA 5HK0A 4EIKA 4OP0A 3EH1A 3CCMA 3OYDA 2MPXC 4XU3A 1G3SA 2M1HA 1WJSA 1Q82R 5IXFA 2E1HA 5CKDA 1N6AA 3A1PA 4A4GA 3CXCA 2KT8A 3PNWC 4HT9A 4RTUA 3OA6A 3V7CA 1KSWA 2ZAEA 1WLPB 1MMAA 5FW9A 2DE0X 4M75D 2RK2A 3CBOA 1IO6A 1MMDA 2MAMA 4BDYA 1FMVA 4LXCA 4Y92A 1VQLT 1YBYA 2GQVA 2EIFA 3GLXA 3GNFB 1IGUA 1QWFA 2DD5A 1XOVA 1ZUKA 1WJQA 5CR2A 4FYYB 2DYBA 4PJNA 4C92C 2KBTA 3RESA 2KE9A 2QEXT 2KYBA 1M3BA 2EFIA 1YJ9Q 2CS7A 4PKCC 3M4GA 4FM4B 2ZPBB 2HMAA 1VQ9Q 3M53A 4DEXA 1D1CA 2KRSA 2YT6A 4X9CA 3TREA 4QW2A 3CMAT 8AT1B 4KUDK 3D7SB 3SWNB 2EYZA 1ZA1B 3N5BB 2DA9A 3MJXA 2JW4A 1Q81U 2M16A 3JB9D 2AIRB 1I5OB 1GCQA 4QT7A 1NPPA 1U1SA 4QQDA 1O75A 1SSHA 1VQ4Q 2DXCA 2ATCB 1A0NB 2NUPA 8ATCB 1VYVA 4KGVB 3R6NA 2K3YA 4AFZC 2LQKA 4L59A 4ORZA 3TQ7P 2YLCA 3RMSA 4J9DA 2AKLA 4DBHA 4LDVA 1UEBA 1YWPA 2JN0A 2ECZA 5KYUB 4PJOE 4JJBA 4BE2A 3PT9A 4QQGA 1YJWT 3M0PA 1K9AA 3OYCA 3NFCA 3CPWA 2ROLA 1AZEA 4OB1B 4LE9A 1VQPT 4ZN1A 1ABOA 1BKBA 2K4YA 2OI3A 2QASA 1WZOA 2FL7A 5FWBA 3M9QA 5LJ3j 3G71A 3I55T 1K9MU 5LL6S 1LOJA 1ZSZA 1LPLA 2R5AA 1JJ2S 2VKNA 3EGXB 1YJWA 3PVLA 2EWNA 2JS2A 2FB7A 3V7RA 3M54A 2FVUA 3EGUA 4PJOF 1TXQA 2YRVA 1VQKA 3M0SA 2ZPHB 4AFSC 2CZ0B 3QZ5B 1OULA 3RMQA 1U06A 2PQWA 3I5SA 1QVGA 4M75A 1VQ9T 1QWEA 1RAIB 2E6ZA 3CCQA 5J26A 3AHUA 4DEYA 4FYWB 2DZCA 1QKXA 3GP8A 1VQLA 3JCMf 1OQKA 4OMFB 1NLPC 4OGCA 3EHQA 4M75E 3CCRQ 3UF4A 4C8QA 1WHJA 4XK8E 4J9GA 4R0KA 4A53A 1M90U 1VQ9A 1D0ZA 2FPDA 5GMKh 4M7AC 4ZN3A 2XDDA 1W2BA 4RUGA 4KH1B 3OY9A 3BDUA 4EDUA 5IXBA 3EG9B 2D1XA 4PLLA 2FG0A 2LVMA 2WACA 2K57A 3M56A 2QAZA 1GBQA 3JCMQ 4RMOA 2GF7A 3HRUA 2LCLA 4HCKA 1NBEB 2RHIA 1W2BS 3ZL7C 4C5IA 4XTZA 5CKFA 1PRMC 5FU6C 5DY9A 3QXEB 2FHDA 1I0CA 4JRKA 2DAQA 2RN8A 2LT1A 2OX7A 1YCYA 3GBQA 1I81A 5HCKA 2EYYA 4RTWA 4RTZA 5FU7B 3CCRT 3GPLA 2RD1A 4E7HA 1SHGA 2AHJB 4ELZC 1SPKA 2JZ2A 5IHNA 5I11A 5GAN5 3OW2S 1PHTA 4L5GA 4AG2C 2BE7D 5GAOp 3OYBA 3GNGA 3R6OA 3G4SA 2O4XA 3PE0A 4XU1A 2HZYA 5HK3A 2DO3A 1OEBA 3HPWA 4Z8AA 2F69A 2HQHA 2QQAA 4XTYA 2EYXA 4F14A 4LD9K 1PCXA 2GQIA 3J80E 1NJIC 4N4HA 4C0GA 4LDYA 4ATOA 2LNVA 3G4ST 4D8DA 2QDYB 2DJQA 3CCJA 4HT8A 4BI3A 2QK0A 1K73C 2JJ9A 2JUFA 4J6XA 2EQJA 1VOMA 1Q7YU 3QJ6A 3EG2A 4DQ2A 3I55Q 3JCMV 3A8MB 3J7AF 1ZA2B 4OMOA 4PJMA 4C92G 2LJ1A 3JCMJ 3E1SA 2RMOA 3HHTB 1ZHIA 2X4WA 4RG2A 3CD6Q 3RKYA 6AT1B 4IURA 4KUIA 1RAEB 2VVKA 2L8DA 3THKA 2VASA 4HXJA 2SEMA 2LQNA 4C0FA 2O01E 4WTOB 4XU2A 4MDWA 2RQVA 1DJ7B 2ZZDA 2ED0A 1TG0A 1MGQA 3O8VA 2LC4A 4RTYA 5DM7R 5KYYB 5A0LA 4C8QG 2Z0WA 2YXYA 3OYNA 2L3PA 5CQYA 4MZPA 2JT4A 1IB8A 3M0TA 3DLLA 1X6OA 4M75C 3I56Q 2LT4A 1N8RC 1KK7A 2QDLA 1YI2Q 4CI0C 3HRSA 3CMET 3CEYA 1YHQA 3J81E 2CP7A 2PVGB 2X51A 4X1VA 1VQ6Q 4KBMB 1EX4A 1KD1C 2A0FB 2DIQA 4N0AA 4GLMA 2DBKA 3I56A 2XG8D 1M8MA 2KXDA 1Q86C 2ZPFB 4C8QF 2RJDA 1TS9A 4FSSA 2K7AA 4KGZB 2NYSA 3JCMg 2EGEA 5J3BA 3EGDA 3A8OB 1SSFA 1NLOC 3M55A 5FRNA 1UFFA 3JSCA 1V29B 3TEEA 1KIKA 2KVQG 3MKDA 3OB9A 5AT1B 1VIFA 3CPWP 1RL2A 1PWTA 5LJ5j 1WXBA 2VB6A 1HYOA 4JJDA 4JRQA 1M1KR 4WCIA 1VQOQ 2PU9B 2V26A 3VUBA 3FJPA 2A7YA 2Y4YA 2V8KA 2GTOA 1BIAA 3JAME 4FL6A 5GAMd 1QVFS 2KQWA 2RI2A 5GANg 2EPDA 1K9MR 2EJGA 2JM9A 1KHIA 3QYHB 2DXTA 2P0QA 4C92F 1RAGB 2HNIA 2XI9A 5GMKl 2OTJQ 2CUDA 3M59A 2QEXQ 1X75C 2FRYA 1B34B 5FRMA 3CD6T 4OB0B 2XD0A 1VQNT 2HD0A 1RACB 3OYIA 5DLOA 2JTMA 1OZ2A 3RBBB 4FYVB 1MNEA 3OS1A 2JXBA 4J9HA 5EG2A 3TVTA 2C0IA 3X28B 1VQ7T 4M7AE 1PRLC 3TSZA 3C4SA 4E7LA 2AT1B 1RAAB 2DILA 2JOYA 5D7UA 1NE8A 1WHLA 4J6YA 4M77D 3G4SQ 4A63B 3JRZA 2JTEA 4E2FB 1K0XA 3CMAQ 3G1JA 4E47A 2F5KA 3CCLT 3TCJA 2RO0A 2D6FA 1Y07A 4OMMA 2PVOB 3PVQA 1S72A 3OSSC 3CMEQ 5C6SA 2V1QA 4RTTA 1NEGA 5L8RE 1VYUA 3HL8A 1IREB 5GAOn 3ZFJA 1N27A 2P0KA 2EW3A 3SEMA 3CMEA 2A37A 2E65A 5D6WA 1JXOA 2E41A 1ABQA 2EJ9A 3CCMT 3C94A 3QIIA 4J7IA 2CUBA 4Z88A 4E7JA 2DRKA 4M77B 5KYXB 1IXDA 3M0QA 2BUDA 3E9GA 4OF1A 2BE9B 4HCBA 1QP2A 2RF0A
chains in the Genus database with same CATH topology
1HXDA 2CKKA 1UEBA 4LDWA 3EAEA 4LDVA 3UT1A 5CK9A 1KQSA 1BYMA 4PL6A 2JN0A 2JTFA 4PJOE 2V8IA 3SDZA 5CIUA 3OS2A 4BE2A 3PT9A 4JRIA 4N4GA 2Y90A 4QQGA 5KCHA 5GANj 2LQ8A 1VQ6T 2K2VA 1YJWT 2L89A 4BY6B 3OQ5A 3GIBA 3OYCA 3NFCA 4M78D 3CPWA 3G7ZA 5GAN6 1M1KU 4JRPA 4OB1B 2LTOA 1Q86U 3PIPA 1VQPT 4ZN1A 2CYZB 2KSSA 4M77F 4X9DA 1BKBA 2K4YA 5GAMf 1UGPB 5GMKm 3OS5A 2ZPEB 2FL7A 3CXCS 3M9QA 4JLIA 2XIDA 4A4KA 4MDXA 4DOVA 5LJ3j 3G71A 1Y96B 2RB6A 3I55T 1K9MU 5LL6S 1YI2T 1LOJA 3E9FA 2DK3A 3FLGA 4ZGEB 4M7DB 2R5AA 1VQ4T 1JJ2S 1VQ8T 4RCBA 3RKXA 3A8GB 1YJWA 3PGGA 5CKEA 3NTIA 3QZ9B 4JS4A 2EWNA 3RIRA 2FB7A 2RHYA 4M78F 3L2QA 3V7RA 3M54A 4MMLA 2FVUA 5GAMg 5GAN2 3I56T 2H3JA 3SWNC 2MMPA 1ZQ1A 3OYYA 4RCCA 4JS5A 3VU3C 3QSUA 3MEAA 4PJOF 1G3YA 2DTHA 3CMAA 2YRVA 4NL3A 4EMKA 3CPFA 4Y28E 5IT9E 1M5Q1 4A54A 1VQKA 2ZPHB 4M7AB 1Q82U 1YITA 2CZ0B 3QZ5B 4EMGA 5LJ5e 3MP8A 2OTLT 3PIOA 4C5GA 3CCUT 2QA4A 4XTXA 2E64A 4PLIA 4QVZA 2MWPA 3RMQA 2K3XA 2PQWA 2R57A 2DIGA 3V8KA 3OYJA 3M4YA 5GAN4 3KXTA 4L6V5 1QVGA 3HFNA 3P8BB 2E70A 4IUVA 4M7DC 3QJYA 4M75A 4B9WA 1VQ9T 5KH6A 2E6ZA 3CCQA 1QVPA 5J26A 1YJ9T 3VV0A 3AHUA 4ZGJB 4NS5A 2DZCA 2WSEE 4M78A 3GP8A 4M7DG 2XK0A 1Q81C 4ZTFA 3JCMf 5LJ3h 1VQLA 1FWZA 4M7DE 2ZGWA 3MHXA 4OMFB 4OGCA 4RKUE 1YHQT 5GAOm 2RHXA 3WVEB 3X24B 1I4K1 1ZBXA 4MZTA 4QQ6A 3LLRA 1KQ2A 4EMHA 3OYLA 3NTHA 5CCAA 4M75E 1VQ5A 1JBMA 1NZ9A 2DKGA 3A8HB 4XK8E 4C8QA 1M90U 4A53A 3V8JA 3HRTA 1VQ9A 5GMKh 3M58A 3CCEA 4M77A 3CCSA 4M7AC 1OYXA 4ZN3A 3MEUA 4E7IA 2DXBA 3DB4A 2QEXA 2XDDA 3V7SA 1W2BA 2VC8A 2OTJA 3BFMA 3FDRA 1YIJA 5IAYA 4M7AD 4NL2A 4BI4A 1K8AC 3OY9A 2VGNA 5J39A 3BDUA 1K9MC 2GCXA 2QTXA 3JB9I 1M8VA 4EDUA 5I2SA 4ELYC 2XHCA 3C12A 1S72T 3DLMA 3A8LB 1BI2A 4UC4A 2C06A 1BIBA 2M9UA 4XTUA 1YI2A 3CD6A 3EFSA 4ME7A 4PLLA 3CBMA 2LVMA 4X34A 4ZGDB 5GANh 1KD1U 3CCET 4Z02A 4M7DF 4M77E 3LWIA 4C92B 2WACA 4J83A 3RKWA 2K57A 3M56A 5GMKj 1VQMT 1QVGS 1N9RA 1X01A 4RMOA 2XICA 2LX9A 1RI0A 4M77G 3JCMQ 4IUUA 5GAOr 1M1KC 3PMIA 2GF7A 3HSBA 1HK9A 1UGQB 3HRUA 1VQOA 3DKMA 2LCLA 2X4JA 5D6YA 1WQWA 2RHIA 1W2BS 1XTDA 1QP3A 2HBPA 3OYKA 4A4EA 4C5IA 3CCVA 4F7UB 2K5IA 2ZPGB 4XTZA 5CKFA 3OYHA 4EPCA 4HCCA 5FU6C 5DY9A 3QXEB 1N9SA 2FHDA 5GAOl 5GMKe 1BI3A 4JRKA 1WJRA 2DAQA 4QVCA 2LT1A 1YCYA 3LX7A 4PJOG 5LJ3d 2DJZA 3F70A 3MEVA 1I81A 3V8LA 3SWNA 2DTOA 2LCCA 2P0PA 3JB9J 1I5LA 3LH0A 2XU8A 1JJ2A 1D3BA 2D0QB 3JB9G 5CO7A 3ASKA 4EMKB 5FU7B 2CZ7B 2BKDN 3CCRT 2RM4A 3GPLA 2RD1A 4O6JA 5I2MA 4BD3A 4E7HA 4IUQA 3BY7A 2AHJB 4BI8B 4IUPA 3GF5A 4ELZC 2JZ2A 2DEQA 2DXUA 2PUOB 1IZ6A 2VUBA 5GAN5 3KUFA 2GFAA 1G3TA 2EKOA 3SB2A 3MP1A 4C8QC 3OW2S 4L5GA 1UGSB 5GAOp 3OYBA 2E5QA 5A0GA 3CC4T 4ZTJA 3JB9F 3GNGA 3R6OA 3L2UA 3G4SA 2L5QA 4C0DB 3OMCA 5GMKi 4CRIA 2O4XA 1LNXA 4XU1A 1BI1A 3BDLA 1K8AU 5HK3A 2RK1A 3G6ET 2MI6A 5D6XA 4II1A 4M78C 2DO3A 4F7UE 2DVEA 3CC2A 5AYFA 3QYGB 3HPWA 3Q1JA 1JB0E 3MO8A 3DB3A 1UGRB 3MP6A 4M78E 2F69A 1KC8U 3ZEHA 2QQAA 4XTYA 2LRQA 4J6WA 4N0AC 4PNOA 2R58A 5GAN8 4LD9K 3J80E 1NJIC 1TH7A 4N4HA 4J7FA 3UDCA 4LDYA 4C0GA 4ATOA 2LNVA 1KHCA 3G4ST 3OYAA 2QDYB 2KMTA 2E6NA 4M78G 1QW1A 3CCJA 4HT8A 1VQMA 4NOYA 4BI3A 5FROA 3S3OA 5CAIA 4KULA 1YITT 3S3NA 1K73C 2XKOC 2B8AA 1P92A 4PJOA 4C0DC 5GAMe 4FT4A 4R55A 1G5VA 3CCLA 2QQRA 2JUFA 3QKJA 2Y4XA 4HCZA 4J6XA 3SD4A 2EQJA 1FXXA 5GANe 5LJ5d 1N8RU 1Q7YU 1H3ZA 3CPWS 3OBWA 3QJ6A 5GANd 5M9OA 4DQ2A 3JCMc 4C5HA 2KDSA 3JCMV 1W4SA 3A8MB 4XTWA 3J7AF 3JCMb 1VQ6A 2EAYA 4C92G 3M57A 3JCMJ 3E1SA 2DPPB 2VXEA 1ZHIA 3HHTB 4M75F 4Q5WA 4JLGA 1WNLA 2RA2A 2X4WA 4IUTA 4JDSA 4OB3B 2QQBA 3HKSA 4RG2A 5A2QE 1MHNA 3OW2A 3PMTA 3RKYA 4BY6C 3UPUA 2JNGA 3PTAA 3H8ZA 3LW5E 4IURA 3OS0A 2A3LA 3FB9A 4BUGA 4KUIA 3OBYA 4JUVA 4B9XA 1VQ5T 2L8DA 3KBGA 5LJ3g 1OZ3A 2EQKA 4F7UA 1XQHA 1VQ4A 4C0FA 2O01E 5KE3A 4XU2A 3RERA 3FIFA 4MDWA 4RG8A 4M75B 3HFOA 1DJ7B 4C92E 2ZZDA 2HAXA 2RHZA 1YIJT 2RHUA 3CC7A 3JCMd 1VIEA 2NLUA 2DZ9A 5A0DA 1MGQA 5GAN7 3QHSA 2FYKA 3X26B 3O8VA 5DLQE 2MF2A 3S3MA 2LC4A 3G6EA 5DM7R 1VQKT 3QO3A 4BE0A 2EQUA 2G3RA 3OSVA 4BB7A 5A0LA 1B34A 4C8QG 5LJ5h 3L42A 5GAOq 2OAUA 3CC2T 1KQ1A 5KCOA 1H641 2VV5A 2QA4T 1WQ7A 4XTVA 2E10A 3OYNA 3FEOA 2VXFA 4MZPA 5CQYA 1NJIU 1Q82C 1R8OB 4J5YA 2VGMA 5GAMh 1Y71A 2GFUA 2PUKB 3CC7T 1PSFA 3DLLA 4M7DA 1VQPA 1XNIA 1X6OA 4M75C 2X4YA 2X4XA 3CCQT 1YJ9A 2LT4A 1K73U 1N8RC 1LJOA 3MCAB 2QXFA 3ER0A 5FLXE 1UB4A 4LD6A 3VKIA 3ME9A 3CCVT 2LDMA 3HRSA 4OB2B 4CI0C 3CMET 3QDRB 3CEYA 4WF2A 4XAXB 3J81E 1YHQA 1VQ8A 5LJ3f 4JJNK 2PVGB 4PJOD 3JCMX 3EFRA 3L2WA 2V8JA 4KBMB 3L1AA 3PFSA 1KD1C 3GOXA 2DIQA 4N0AA 4BDZA 3H6ZA 3HP9A 5GAN3 3I56A 2RJEA 2XG8D 4IKFA 4MZMA 2IVWA 3CCST 2D9TA 4FU6A 1Q86C 2ZPFB 4M77C 4C8QF 2RH2A 2RJDA 3C95A 3WXMB 1VQ7A 4BACA 1QVFA 2KY9A 3JCMg 1M1FA 4GY5A 5J3BA 2OTJT 4OVAA 3A8OB 1SSFA 3CCRA 1WGSA 5HKCA 3M55A 4C8QB 5FRNA 2OTLA 2QQSA 5IN1A 1JRIA 1M9SA 4J8OA 4MMKA 3INZA 3CCUA 3JSCA 1V29B 3NTKA 3TEEA 3X20B 1GXIE 1OI1A 2KVQG 3JCMe 3OB9A 1VIFA 3VYHB 3WVDB 4P5NA 3FRNA 5LJ5g 1BI0A 4YTLA 3CC4A 1Q7YC 2RJFA 2K5FA 1RL2A 4C92D 4DOWA 3JB9H 5LJ5j 2QI2A 1U8RA 3VYGA 4FT2A 2I2LA 2KAFA 2RI3A 3M5AA 4JRQA 3L2RA 3LGLA 3QUIA 2PU9B 3UWNA 3VUBA 3FJPA 3LWHA 2MWOA 1Y7XA 2A7YA 2Y4YA 3RUXA 1VQOT 4F7UF 4A4FA 4GLKA 2V8KA 2EYQA 1BIAA 5LJ5f 1VUBA 5HY6A 3JAME 1EIFA 4FL6A 1I8FA 5C0MA 3G71T 5GAMd 1QVFS 4N4IA 2XDBA 2RI5A 4Y91A 2KQWA 2RI2A 2DD4A 5GANg 1VQNA 2DTIA 3QBYA 3URGA 4V2SA 2EJFA 3E19A 4FIBA 4C0ZA 2EJGA 1KHIA 3MEWA 3QYHB 4E7KA 2DXTA 1O9SA 2P0QA 3LYIA 4C92F 4A4HA 3VJPA 3META 5CQXA 3L2VA 5HK0A 2M0OA 4OP0A 2PVDB 2HNIA 2XI9A 5GMKl 3CCMA 3JCMW 3OYDA 4M7DD 3M59A 4XU3A 5FU7C 1G3SA 2M1HA 1WJSA 3JCMh 2E1HA 4DA4A 1X75C 5CKDA 1B34B 2P4TA 5FRMA 1N6AA 4OB0B 3CD6T 4A4GA 3CXCA 2XD0A 1VQNT 3OMGA 2HD0A 3PNWC 4HT9A 3OYIA 3OA6A 3QG1A 2CZ6B 2WSCE 3V7CA 2F5TX 2WSFE 5DLOA 2JTMA 1NPRA 3CBPA 1OZ2A 1KG1A 1M1GA 2QQ9A 4M75D 3OS1A 5KE2A 2RK2A 5EG2A 2EQMA 1G3WA 2CZ1B 4M75G 3CBOA 3X28B 5FU6B 1VQ7T 4M7AE 2K5LA 2MAMA 4BDYA 1Y96A 3C4SA 4E7LA 4VUBA 1VQLT 3ZBDA 2BIVA 4HKEA 2HQEA 4R56A 1D3BB 1YBYA 2CGHA 4TVRA 2GQVA 2EIFA 2JOYA 1KQSS 3GLXA 3GNFB 5GANf 3OYFA 2DD5A 1YJNT 1XOVA 4XQ3A 3L2ZA 4KT0E 1AHJB 4BE1A 1WJQA 1NE8A 5CR2A 5LJ3e 4J6YA 4M77D 3A5ZB 4C92A 4C92C 3JRZA 4QVDA 4EMKC 1U1TA 3CCJT 2ZPIB 3RESA 2QEXT 3VUZA 2KK4A 4FSXA 3OYMA 4E47A 3I55A 2EFIA 2F5KA 3JCMP 2CS7A 4PKCC 3M4GA 4FM4B 2ZPBB 3S6WA 3TCJA 2RO0A 3CCLT 2D6FA 1Y07A 3QPHA 4OGEA 3SFMA 2E12A 4M7AF 3M53A 1YJNA 2PVOB 1S72A 3OSSC 5C6SA 4C5EA 3LGFA 4PJOB 2RJCA 5L8RE 4X9CA 3HL8A 1IREB 3TREA 4HA8A 4QW2A 3CMAT 4KUDK 4M78B 5GAOn 2L3RA 3ZFJA 3SWNB 1N27A 2P0KA 3N5BB 1Q81U 3CMEA 2M16A 2E65A 3JB9D 5D6WA 4F7UG 2E41A 2HQXA 2IG0A 5CKHA 2X35A 3OYGA 1KC8C 2EJ9A 4C8QE 2JVVA 2YLBA 3CCMT 3C94A 3QIIA 3TU4K 3FC3A 1M90C 2VYTA 1M4ZA 1NPPA 1PSEA 1U1SA 4QQDA 1O75A 4J7IA 3T9NA 4C8QD 4D6WA 3P8DA 3BW1A 1FX7A 4E7JA 2YHTA 2DXCA 4O5VA 4M77B 1WPYA 5CVIA 5I21A 4M7AA 2BUDA 3E9GA 2K3YA 2LQKA 4L59A 3X25B 2XDPA 3P8HA 4OF1A 4LDXA 2YLCA 4LDUA 3RMSA 2O4XB 4PJOC 4HCBA 5CKBA 3OYEA 1QP2A 4XU0A 4M7AG 5GAMj 2ZCFB 2R5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z02 A;  2CKK A;  3EAE A;  3UT1 A;  2WAC A;  4IUR A;  3OS0 A;  4PL6 A;  3MEW A;  4E7K A;  4B9X A;  2JTF A;  3LYI A;  1RI0 A;  2L8D A;  4A4H A;  4IUU A;  3MET A;  5CIU A;  3OS2 A;  3L2V A;  4BE2 A;  1OZ3 A;  3PMI A;  4N4G A;  2GF7 A;  2EQK A;  2M0O A;  4QQG A;  5KCH A;  5KE3 A;  5D6Y A;  2RHI A;  2L89 A;  3OQ5 A;  3OYD A;  3OYC A;  2M1H A;  1WJS A;  3OYK A;  4A4E A;  2RHZ A;  4C5I A;  2LTO A;  2RHU A;  3OYH A;  5FRM A;  2NLU A;  4A4G A;  2FHD A;  3OMG A;  1WJR A;  3PNW C;  2DAQ A;  3OYI A;  3OA6 A;  3O8V A;  3S3M A;  3M9Q A;  4BE0 A;  2EQU A;  2G3R A;  1OZ2 A;  3LX7 A;  3F70 A;  3L42 A;  3MEV A;  2LCC A;  3E9F A;  5KCO A;  3LH0 A;  3FLG A;  5KE2 A;  3OS1 A;  2R5A A;  3OYN A;  3FEO A;  2EQM A;  3NTI A;  4BDY A;  3ASK A;  3L2Q A;  2RHY A;  3C4S A;  2BKD N;  4E7L A;  2GFU A;  2BIV A;  2HQE A;  1XNI A;  4BD3 A;  2X4Y A;  2X4X A;  4E7H A;  4IUQ A;  3MEA A;  4IUP A;  2JZ2 A;  2YRV A;  3OYF A;  4LD6 A;  3KUF A;  2GFA A;  2EKO A;  4BE1 A;  1WJQ A;  3MP1 A;  3ME9 A;  2LDM A;  3OYB A;  2E5Q A;  4ZTJ A;  3CEY A;  3L2U A;  3MP8 A;  4C5G A;  3OMC A;  4CRI A;  2O4X A;  4PLI A;  4QVZ A;  2MWP A;  3BDL A;  2K3X A;  3L2W A;  2PQW A;  2R57 A;  2DIG A;  3PFS A;  4II1 A;  5D6X A;  3OYJ A;  3GOX A;  2DIQ A;  4BDZ A;  3OYM A;  3H6Z A;  2EFI A;  2F5K A;  4IUV A;  2RJE A;  3Q1J A;  3S6W A;  4B9W A;  4IKF A;  2RO0 A;  3MO8 A;  5KH6 A;  3DB3 A;  3MP6 A;  5J26 A;  3ZEH A;  2D9T A;  4FU6 A;  4NS5 A;  2LRQ A;  2RJD A;  2R58 A;  4BAC A;  2XK0 A;  4GY5 A;  4OVA A;  5C6S A;  1SSF A;  4ZTF A;  1WGS A;  3LGF A;  4N4H A;  4C5E A;  2RJC A;  5FRN A;  2QQS A;  5IN1 A;  1KHC A;  3OYA A;  2RHX A;  4QW2 A;  2E6N A;  4X34 A;  3NTK A;  4QQ6 A;  1OI1 A;  2L3R A;  1N27 A;  2P0K A;  5FRO A;  3NTH A;  3OB9 A;  3OYL A;  3S3O A;  2M16 A;  3S3N A;  2B8A A;  5D6W A;  2HQX A;  2IG0 A;  2RJF A;  2X35 A;  3OYG A;  1G5V A;  2QQR A;  3QKJ A;  4HCZ A;  3SD4 A;  2EQJ A;  1H3Z A;  1OYX A;  3MEU A;  3QII A;  3FC3 A;  3DB4 A;  2VYT A;  3QJ6 A;  4E7I A;  2RI3 A;  4QQD A;  5M9O A;  3P8D A;  3FDR A;  3L2R A;  3LGL A;  4C5H A;  5IAY A;  4E7J A;  3UWN A;  3OY9 A;  2MWO A;  5J39 A;  4A4F A;  2BUD A;  4EDU A;  3E9G A;  2K3Y A;  4L59 A;  2XDP A;  3P8H A;  4FL6 A;  5C0M A;  4Q5W A;  3DLM A;  2X4W A;  4N4I A;  2O4X B;  4IUT A;  4RG2 A;  4UC4 A;  2RI5 A;  3OYE A;  1MHN A;  2RI2 A;  4PLL A;  3PMT A;  2LVM A;  3QBY A;  3LLR A;  3H8Z A;  2R5M A; 
#chains in the Genus database with same CATH topology
 1HXD A;  4LDW A;  1C1A A;  4PL6 A;  2MCN A;  4FCY A;  2Y90 A;  1IHW A;  2DET A;  1BCM A;  3G7Z A;  1OX8 A;  4JRP A;  2LTO A;  3PIP A;  4M4Z A;  1GCQ C;  4M77 F;  1AWX A;  5GAM f;  4JLI A;  1JJ2 P;  3VS5 A;  1Y96 B;  2RB6 A;  5IH2 A;  1B07 A;  3IQL A;  1C0M A;  3E9F A;  1NM7 A;  4ZGE B;  1VQ4 T;  4F16 A;  2CT4 A;  3RKX A;  3A8G B;  1Y57 A;  3NTI A;  1D0Y A;  5CKE A;  3QZ9 B;  2DYI A;  3L2Q A;  3VS0 A;  2YUQ A;  3TU4 K;  4JS5 A;  3OYY A;  3MEA A;  1G3Y A;  3CMA A;  4EMK A;  3CPF A;  5IT9 E;  1M5Q 1;  1K0S A;  1GCP A;  2LJ0 A;  1Q82 U;  2DFU A;  5LJ5 e;  3CCU T;  2HL5 C;  1JQQ A;  1FYN A;  2E64 A;  4PLI A;  2MWP A;  2K3X A;  3EFO B;  2E3I A;  1Z9Q A;  2D8H A;  2SRC A;  2HDA A;  3P8B B;  4IUV A;  4B9W A;  1SKU B;  1QVP A;  1B3Q A;  3E2U A;  1RUW A;  2RPN A;  2B86 A;  2OJ2 A;  2ZGW A;  3MHX A;  3VRZ A;  3WVE B;  3X24 B;  1E6H A;  4MZT A;  4QQ6 A;  1VQ5 A;  4F04 B;  1E6G A;  2DKG A;  3A8H B;  3CCS A;  3CCV Q;  2D8J A;  1XJW B;  1OYX A;  2DXB A;  2QEX A;  1CSK A;  3V7S A;  2VC8 A;  3I35 A;  3FDR A;  2OTJ A;  1YIJ A;  4M7A D;  3NGP A;  4NL2 A;  4BI4 A;  1PKT A;  1K9M C;  2GCX A;  2QTX A;  3JB9 I;  5I2S A;  3C12 A;  1BU1 A;  1B7T A;  3A8L B;  1YIT Q;  1BIB A;  2M9U A;  3EG3 A;  1YI2 A;  1KD1 U;  1F1B B;  1SRM A;  1OU9 A;  4M77 E;  3LWI A;  4C92 B;  1VQM T;  1MMG A;  1RI0 A;  5GAO r;  1M1K C;  1HK9 A;  1UGQ B;  1VQO A;  1UDL A;  3EGD B;  1YCS B;  2HBP A;  2FPF A;  4A4E A;  1MMN A;  2K5I A;  3OYH A;  1N9S A;  1BI3 A;  5LJ3 d;  2DJZ A;  3F70 A;  4E6R A;  2P0P A;  2J6K A;  1JJ2 A;  2D0Q B;  4PJL A;  2RM4 A;  1JU5 C;  1KD1 R;  5I2M A;  4BD3 A;  4IUQ A;  3BY7 A;  3H41 A;  3GF5 A;  2DEQ A;  2DXU A;  3KUF A;  4C8Q C;  1G3T A;  3MP1 A;  3ULR B;  3CC4 T;  2E5Q A;  4ZTJ A;  3JV3 A;  3L2U A;  2L5Q A;  4C0D B;  5GMK i;  1LNX A;  1BI1 A;  3BDL A;  3G6E T;  4M78 C;  3CC2 A;  1AT1 B;  2DL8 A;  3Q1J A;  4ZNX A;  3H9N A;  2CT3 A;  5KYU A;  1M27 C;  2KRM A;  3MP6 A;  3CCS Q;  1SHF A;  4N0A C;  1D1A A;  2BZ8 A;  1KHC A;  2DL7 A;  2KMT A;  2E6N A;  4M78 G;  1QW1 A;  1WYX A;  1BCO A;  5CAI A;  1AWW A;  3S3N A;  1OV3 A;  1UHC A;  2QTV A;  4FT4 A;  1YJN Q;  2QQR A;  2K2M A;  5GAN e;  3OBW A;  1WHM A;  2YUO A;  5M9O A;  2YSQ A;  3JCM c;  4C5H A;  2KDS A;  1W4S A;  1W6X A;  5FWC A;  1FMW A;  4XTW A;  3JCM b;  1MUZ A;  3VS1 A;  1AD5 A;  2BZY A;  3CQT A;  2HCK A;  2RA2 A;  2CP3 A;  3OW2 A;  2QQB A;  1MHN A;  2NUP B;  4BY6 C;  2H3E B;  3EHR A;  1UJY A;  4B9X A;  3KBG A;  1M2V A;  4F7U A;  1XQH A;  5KE3 A;  3FIF A;  4J9E A;  4M75 B;  4C92 E;  1H3H A;  1YIJ T;  1VIE A;  2NLU A;  2DZ9 A;  5A0D A;  5GAN 7;  3QHS A;  1VQ5 Q;  3X26 B;  2EBP A;  3S3M A;  4Z89 A;  3H0F A;  1R0B G;  2EQU A;  4BB7 A;  3L42 A;  3CCU Q;  1KQ1 A;  2QA4 T;  2E10 A;  1NJI U;  3O5Z A;  1RLP C;  4HVW A;  5GAM h;  2GFU A;  2PUK B;  3CC7 T;  4M7D A;  4B6M A;  1VQP A;  1XNI A;  2CSI A;  3EGX A;  2V1R A;  1K73 U;  1PD0 A;  3MCA B;  3UA6 A;  5FLX E;  3VKI A;  3ME9 A;  2LDM A;  1VQ8 Q;  2RQU A;  2DNU A;  2P4R A;  5LJ3 f;  1UHF A;  3UA7 A;  3L2W A;  1QVG P;  4BDZ A;  3HP9 A;  5GAN 3;  2RJE A;  3LH5 A;  4MZM A;  1G8X A;  1QQJ A;  3WXM B;  1QVF A;  1M1F A;  3CCR A;  2MK5 A;  5IN1 A;  4MMK A;  4OML A;  3TSW A;  2DM1 A;  2JMA A;  4RTV A;  3G6E Q;  1VQL Q;  3VYH B;  5LJ5 g;  4P5N A;  3FRN A;  4AG1 C;  1OU8 A;  4YTL A;  2RJF A;  2K5F A;  4D8K A;  3CCQ Q;  1U8R A;  3VYG A;  2I2L A;  3M5A A;  1RI9 A;  3QUI A;  3UWN A;  1KQS P;  1Y7X A;  1RAB B;  3EH2 A;  1VUB A;  5HY6 A;  1EIF A;  2RI5 A;  5KYX A;  1VQN A;  3URG A;  3VS6 A;  3REA B;  3MEW A;  4E7K A;  3LYI A;  1TTH B;  2YUP A;  2H8H A;  1VYT A;  4M7D D;  5FU7 C;  1UG1 A;  1TUD A;  2X3X D;  3G71 Q;  3OMG A;  2WSC E;  1NPR A;  3CBP A;  2QQ9 A;  5L23 A;  5KE2 A;  4AMC A;  2EQM A;  2CZ1 B;  2YWW A;  1BK2 A;  1Y96 A;  3CXC P;  1R77 A;  4PK4 A;  4VUB A;  3ZBD A;  2QGG A;  2BIV A;  4HKE A;  2HQE A;  5GAN f;  3OYF A;  4XQ3 A;  2P84 A;  3A5Z B;  1QMC A;  4C92 A;  4ESR A;  1NG2 A;  4EMK C;  2ZPI B;  3VUZ A;  1X43 A;  2KK4 A;  4FSX A;  2M0Y A;  4K11 A;  1M30 A;  3S6W A;  4J9C A;  3QPH A;  3SFM A;  1YJN A;  1GFD A;  1NYF A;  4C5E A;  3LGF A;  4PJO B;  4CC7 A;  5KYW B;  1I1J A;  1C6V X;  4F7U G;  5CKH A;  3OYG A;  1M3C A;  2JVV A;  1WXT A;  1M90 C;  3FC3 A;  2VYT A;  1M4Z A;  4J9I A;  1ZUU A;  3T9N A;  2FZK B;  3P8D A;  3CC2 Q;  2OAW A;  1WI7 A;  3REB B;  1RLQ C;  1WPY A;  2J7I A;  1WA7 A;  2GTJ A;  1RAD B;  3X25 B;  1X2K A;  4LDX A;  1GFC A;  5CKB A;  3OYE A;  1X27 A;  2KXC A;  3RDV A;  2ZCF B;  1UGR B;  2L3S A;  4AFU C;  3UT1 A;  1BYM A;  5IHK A;  1WXU A;  3HTR A;  2JTF A;  2V8I A;  4JRI A;  1T3S A;  4N4G A;  5KCH A;  5GAN j;  2ESW A;  1M90 R;  4FW2 A;  2K2V A;  1VQ6 T;  2L89 A;  4BY6 B;  3OQ5 A;  3GIB A;  1HD3 A;  5GAN 6;  1M1K U;  2FZC B;  4JZ3 A;  5I22 A;  1EZZ B;  2KSS A;  4X9D A;  5GMK m;  3OS5 A;  3NHN A;  2ZPE B;  3CXC S;  1UE9 A;  2FO0 A;  4MDX A;  2XID A;  1LCK A;  2CP0 A;  2MYS A;  2DK3 A;  3FLG A;  4M7D B;  2C0T A;  1VQ8 T;  2COZ A;  4RCB A;  1IHV A;  3PGG A;  4JS4 A;  3RIR A;  2RHY A;  4M78 F;  1Z9Z A;  4MML A;  1TU0 B;  1U3O A;  3I56 T;  2H3J A;  3SWN C;  1ZQ1 A;  4RCC A;  2O31 A;  2DTH A;  2JS0 A;  1PD1 A;  1YIT A;  1YHQ Q;  2C0O A;  3MP8 A;  3PIO A;  4C5G A;  2OTL T;  4QVZ A;  2RQW A;  2E3H A;  2DIG A;  3V8K A;  3M4Y A;  5GAN 4;  4CC3 A;  3HFN A;  2E70 A;  1K8A R;  4J9B A;  1N5Z A;  1YJ9 T;  4ZGJ B;  4NS5 A;  4M78 A;  4LNP A;  4M7D G;  1JXM A;  4M7D E;  5LJ3 h;  1FWZ A;  1SEM A;  4RKU E;  1YHQ T;  3CCJ Q;  5GAO m;  2RHX A;  1CKB A;  1I4K 1;  1ZBX A;  1KQ2 A;  3OYL A;  3NTH A;  2LJ3 A;  1JBM A;  2KR3 A;  3V8J A;  3HRT A;  1QKW A;  4M77 A;  3DB4 A;  2KNB B;  5IAY A;  1E7O A;  2VGN A;  5J39 A;  1WIE A;  1M8V A;  1TUG B;  2XHC A;  1S72 T;  1IGQ A;  3DLM A;  1J3T A;  3CD6 A;  3EFS A;  3CBM A;  1QCF A;  5GAN h;  1QLY A;  4DBQ A;  4M7D F;  4J83 A;  2J06 A;  3RKW A;  3M0R A;  1QVG S;  1X01 A;  2LX9 A;  4IUU A;  2DX1 A;  3PMI A;  2K6D A;  3DKM A;  1W1F A;  1QP3 A;  3CCV A;  4F7U B;  4HCC A;  1R0C B;  5GMK e;  1WJR A;  1ACM B;  4QVC A;  4OMP A;  1W70 A;  2HKQ B;  3LX7 A;  4PJO G;  1ZSG A;  2EGC A;  3V8L A;  1I5L A;  3JB9 J;  2LCC A;  2OTL Q;  4LUD A;  1OOT A;  3JB9 G;  1YNZ A;  3ASK A;  4EMK B;  2X3W D;  2CZ7 B;  2BKD N;  1UEC A;  1ZBJ A;  4LUE A;  4BI8 B;  4IUP A;  1X69 A;  2PUO B;  1IZ6 A;  2VUB A;  2GFA A;  2EKO A;  1RAF B;  2FZG B;  3OMC A;  3KFV A;  1BB9 A;  4FW1 A;  1K8A U;  2RK1 A;  2MI6 A;  4II1 A;  4F7U E;  2DVE A;  2KGT A;  5AYF A;  3QYG B;  1JB0 E;  3DB3 A;  1MV0 B;  1KC8 U;  4J6W A;  2NUT B;  2DEU A;  2PZ1 A;  1KC8 R;  1TH7 A;  3UDC A;  3OYA A;  2QG9 B;  4E7Z A;  1JEG A;  2J6O A;  2HBW A;  2ABL A;  1VQM A;  4NOY A;  5FRO A;  3S3O A;  2LZ6 B;  4KUL A;  2XKO C;  2AZS A;  4C0D C;  4R55 A;  3SD4 A;  1FXX A;  1H3Z A;  3SHW A;  1PC0 A;  3CPW S;  2L0A A;  5GAN d;  2ENM A;  2E5K A;  3RNJ A;  3M57 A;  2DPP B;  4Q5W A;  1KQS S;  4JLG A;  1WNL A;  2A36 A;  4IUT A;  4JDS A;  5A2Q E;  3HKS A;  1VQK Q;  3UPU A;  2DL5 A;  2JNG A;  3PTA A;  3QWX X;  3FB9 A;  2RNA A;  2KRN A;  1VQ5 T;  5LJ3 g;  1OZ3 A;  3EG0 A;  1PKS A;  3RER A;  3HFO A;  2RHZ A;  2AK5 A;  2RHU A;  3CC7 A;  2M02 A;  2BTT A;  2FYK A;  4KH0 B;  5DLQ E;  2MF2 A;  5EC7 A;  1VQK T;  3QO3 A;  4BE0 A;  5GAO q;  3OSV A;  2OAU A;  1H64 1;  3C0C A;  1K4U S;  1S72 Q;  2VXF A;  4J5Y A;  1SF9 A;  2J6F A;  1ZX6 A;  2X4Y A;  3CCQ T;  1SG5 A;  1LJO A;  3ER0 A;  4LD6 A;  3CCV T;  1GL5 A;  3QDR B;  1UGV A;  4WF2 A;  4XAX B;  4JJN K;  1AWJ A;  2F2W A;  3EFR A;  3M0U A;  3PFS A;  3GOX A;  3H6Z A;  2HSE B;  4IKF A;  2VWF A;  2IVW A;  3CCS T;  1S1N A;  2EQI A;  4FU6 A;  4M77 C;  3C95 A;  4BAC A;  2OTJ T;  4GY5 A;  4C8Q B;  2EKH A;  2QQS A;  4DBF A;  1JRI A;  1M9S A;  4J8O A;  1Q7Y R;  3INZ A;  1GXI E;  2LCS A;  1OI1 A;  1BBZ A;  1ZSZ B;  3CC4 A;  1MV3 A;  1Q7Y C;  1CKA A;  3CC7 Q;  4C92 D;  4FT2 A;  2KAF A;  2RI3 A;  1Q86 R;  3L2R A;  3LGL A;  3VS2 A;  3RR6 A;  2FRW A;  2MWO A;  1VQO T;  2O2O A;  4A4F A;  1YP5 A;  2CDT A;  4CC4 B;  2O9V A;  4OMQ A;  3BE3 A;  2FPE A;  4Y91 A;  2GBQ A;  1M3A A;  2DD4 A;  1H92 A;  3QBY A;  1FMK A;  4V2S A;  2EJF A;  3VS3 A;  2EGA A;  1M2O A;  1O9S A;  3VJP A;  1N8R R;  1HJD A;  1U5S A;  1YFN A;  2M0O A;  1G83 A;  2PVD B;  1I07 A;  2MIO A;  3JCM W;  3A98 A;  1ZLM A;  2RQT A;  3JCM h;  4DA4 A;  3CCE Q;  2HSP A;  2A08 A;  2P4T A;  2LQW A;  1WDX A;  3QG1 A;  2CZ6 B;  2F5T X;  2WSF E;  1KG1 A;  1Q81 R;  1M1G A;  4M75 G;  1G3W A;  5FU6 B;  2K5L A;  4LN2 A;  1WHH A;  1ZSZ C;  2FEI A;  4AFQ C;  4R56 A;  1D3B B;  2CGH A;  4TVR A;  3EG9 A;  1D09 B;  1YJN T;  3L2Z A;  4KT0 E;  1AHJ B;  4BE1 A;  5LJ3 e;  2QA4 Q;  2DF6 A;  4QVD A;  1U1T A;  3CCJ T;  4PFP A;  1YIJ Q;  3OYM A;  3NMZ C;  3I55 A;  1K76 A;  3JCM P;  1WX6 A;  3QWY A;  1X6B A;  1X6G A;  1WHG A;  1GRI A;  2PNI A;  4FYX B;  1SRL A;  4OGE A;  2DL3 A;  1UTI A;  2E12 A;  4M7A F;  1PG5 B;  2W10 A;  2RJC A;  1K73 R;  4HA8 A;  4M78 B;  2L3R A;  1OX9 A;  4PFZ A;  3H0I A;  2F2V A;  2HQX A;  2IG0 A;  2X35 A;  1NJI R;  1KC8 C;  4C8Q E;  2YLB A;  1QVF P;  1PSE A;  4C8Q D;  3CCM Q;  4D6W A;  3BW1 A;  1FX7 A;  2YHT A;  2EYW A;  4O5V A;  5CVI A;  1OPK A;  5I21 A;  1TOV A;  4M7A A;  2XDP A;  3P8H A;  4LDU A;  2O4X B;  4PJO C;  1KJW A;  7AT1 B;  4XU0 A;  4M7A G;  2IIM A;  3LLR A;  2R5M A;  2CKK A;  3EAE A;  5CK9 A;  1KQS A;  2CP6 A;  1Q95 G;  2PTK A;  2LP5 A;  5GJW B;  2K9G A;  3SDZ A;  3OS2 A;  5CIU A;  2LQ8 A;  2NUT A;  1OPL A;  2DER A;  4M78 D;  5GJV B;  1Q86 U;  1V1C A;  2CYZ B;  1UGP B;  1TWB A;  4A4K A;  2HEQ A;  4DOV A;  2G6F X;  1KFZ A;  1YI2 T;  2YRC A;  3AT1 B;  3FJ5 A;  2MOX A;  1UJ0 A;  2LNH B;  1VQ7 Q;  1WFW A;  5GAN 2;  5GAM g;  2MMP A;  3VU3 C;  3QSU A;  2IPO B;  4NL3 A;  4Y28 E;  4A54 A;  4M7A B;  4EMG A;  2X9H A;  1IRX A;  2QA4 A;  4XTX A;  2R57 A;  3OYJ A;  4QKU A;  3KXT A;  4L6V 5;  4KRT A;  4F17 A;  4M7D C;  3QJY A;  5KH6 A;  3VV0 A;  3CCL Q;  2XMF A;  2WSE E;  5KYW A;  2XK0 A;  1Q81 C;  4OMN A;  4ZTF A;  4ANJ A;  4EMH A;  1D1B A;  5CCA A;  2DVJ A;  1NZ9 A;  2NWM A;  3M58 A;  3CCE A;  2KEA A;  3MEU A;  4E7I A;  4PJJ A;  2A28 A;  3BFM A;  2RQR A;  3MPU B;  1K8A C;  1AZG B;  1T3L A;  2ED1 A;  4ELY C;  4UC4 A;  1BI2 A;  2C06 A;  4XTU A;  1AEY A;  2JMC A;  4ME7 A;  4X34 A;  4ZGD B;  3CCE T;  4CC2 A;  4Z02 A;  1QCO A;  1VA7 A;  5GMK j;  1RAH B;  2QYZ A;  1N9R A;  2XIC A;  4M77 G;  2COW A;  2M51 A;  3EFO A;  3HSB A;  2X4J A;  1YJW Q;  5D6Y A;  1WQW A;  2I0N A;  2DMO A;  1XTD A;  1K1Z A;  3OYK A;  1D0X A;  2L2P A;  2COY A;  2CH4 A;  2ZPG B;  4EPC A;  5GAO l;  3CC4 Q;  2DRM A;  4RTX A;  2EVR A;  2YUN A;  2CP2 A;  3MEV A;  3SWN A;  2DTO A;  3LH0 A;  2XU8 A;  1D3B A;  2DLP A;  2AKK A;  2F2X A;  5KYY A;  4IIO A;  5CO7 A;  3H0H A;  3I9Q A;  4O6J A;  2CP5 A;  1AWO A;  2W0Z A;  4JPB W;  4HVV A;  3SB2 A;  1W2B P;  1UGS B;  4DBR A;  5A0G A;  2O88 A;  3JB9 F;  2GGR A;  2LX7 A;  4CRI A;  1M2V B;  2YDL A;  5D6X A;  2DBM A;  1TUC A;  5IHI A;  1Y0M A;  3MO8 A;  4M78 E;  2KT1 A;  3ZEH A;  2LRQ A;  5GAN 8;  4PNO A;  2R58 A;  5ECA A;  2KI7 A;  4J7F A;  4AT1 B;  2K3B A;  1PNJ A;  1AVZ C;  1UUE A;  1YIT T;  4PJO A;  2B8A A;  1P92 A;  5GAM e;  1JO8 A;  1G5V A;  1NYG A;  3CCL A;  3QKJ A;  5LJ5 d;  2Y4X A;  4HCZ A;  4GBQ A;  2KRO A;  4IIM A;  1YWO A;  1N8R U;  2KYM A;  4JZ4 A;  2GNC A;  2AZV A;  9ATC B;  2NUZ A;  1VQ6 A;  2EAY A;  1V76 A;  5GAM j;  2CSQ A;  2VXE A;  3JCM X;  1AOJ A;  2O9S A;  4M75 F;  4OB3 B;  3U23 A;  1VQN Q;  3PMT A;  2DL4 A;  3H8Z A;  3LW5 E;  2ROT A;  3OS0 A;  2A3L A;  2JM8 A;  4BUG A;  3OBY A;  4JUV A;  1NEB A;  2EQK A;  2F1L A;  1VQ4 A;  2LMJ A;  3OW2 P;  4RG8 A;  1HSQ A;  3VRY A;  2HAX A;  2CRE A;  3JCM d;  3I5R A;  2D0N A;  1VQM Q;  3G6E A;  1QCN A;  2G3R A;  3CC2 T;  1B34 A;  5LJ5 h;  2L3Q A;  1PM3 A;  2K79 A;  5KCO A;  2VV5 A;  1YN8 A;  1WQ7 A;  4XTV A;  3FEO A;  3VS4 A;  1Q82 C;  1R8O B;  1H8K A;  2VGM A;  1Y71 A;  1PSF A;  3NPF A;  2X4X A;  1YJ9 A;  2QXF A;  1UB4 A;  3QDF A;  2YRD A;  4OB2 B;  1ARK A;  4E7S A;  4J9F A;  1VQ8 A;  4PJO D;  2E4H A;  2V8J A;  3L1A A;  1VQP Q;  2HKN A;  1X2Q A;  5KYN A;  2D9T A;  1VQ7 A;  2RH2 A;  2KY9 A;  4KGX B;  4HVU A;  4OVA A;  4JJC A;  1WGS A;  5HKC A;  2BZX A;  2OTL A;  1EFN A;  3CCU A;  2HL3 A;  3NTK A;  3X20 B;  2J05 A;  3JCM e;  3WVD B;  1T0J A;  1BI0 A;  1WHK A;  1LVK A;  4DOW A;  3JB9 H;  2QI2 A;  1TSF A;  1MND A;  3EG1 A;  1T0H A;  3LWH A;  3RUX A;  4F7U F;  4GLK A;  2EYQ A;  2CH4 W;  5LJ5 f;  3UAT A;  1I8F A;  5C0M A;  3VS7 A;  1G2B A;  3G71 T;  4N4I A;  2XDB A;  1GBR A;  1ZUY A;  2DTI A;  2QGF B;  3E19 A;  4FIB A;  4PFO A;  4C0Z A;  4A4H A;  3L2V A;  3MET A;  5CQX A;  5HK0 A;  4EIK A;  4OP0 A;  3EH1 A;  3CCM A;  3OYD A;  2MPX C;  4XU3 A;  1G3S A;  2M1H A;  1WJS A;  1Q82 R;  5IXF A;  2E1H A;  5CKD A;  1N6A A;  3A1P A;  4A4G A;  3CXC A;  2KT8 A;  3PNW C;  4HT9 A;  4RTU A;  3OA6 A;  3V7C A;  1KSW A;  2ZAE A;  1WLP B;  1MMA A;  5FW9 A;  2DE0 X;  4M75 D;  2RK2 A;  3CBO A;  1IO6 A;  1MMD A;  2MAM A;  4BDY A;  1FMV A;  4LXC A;  4Y92 A;  1VQL T;  1YBY A;  2GQV A;  2EIF A;  3GLX A;  3GNF B;  1IGU A;  1QWF A;  2DD5 A;  1XOV A;  1ZUK A;  1WJQ A;  5CR2 A;  4FYY B;  2DYB A;  4PJN A;  4C92 C;  2KBT A;  3RES A;  2KE9 A;  2QEX T;  2KYB A;  1M3B A;  2EFI A;  1YJ9 Q;  2CS7 A;  4PKC C;  3M4G A;  4FM4 B;  2ZPB B;  2HMA A;  1VQ9 Q;  3M53 A;  4DEX A;  1D1C A;  2KRS A;  2YT6 A;  4X9C A;  3TRE A;  4QW2 A;  3CMA T;  8AT1 B;  4KUD K;  3D7S B;  3SWN B;  2EYZ A;  1ZA1 B;  3N5B B;  2DA9 A;  3MJX A;  2JW4 A;  1Q81 U;  2M16 A;  3JB9 D;  2AIR B;  1I5O B;  1GCQ A;  4QT7 A;  1NPP A;  1U1S A;  4QQD A;  1O75 A;  1SSH A;  1VQ4 Q;  2DXC A;  2ATC B;  1A0N B;  2NUP A;  8ATC B;  1VYV A;  4KGV B;  3R6N A;  2K3Y A;  4AFZ C;  2LQK A;  4L59 A;  4ORZ A;  3TQ7 P;  2YLC A;  3RMS A;  4J9D A;  2AKL A;  4DBH A;  4LDV A;  1UEB A;  1YWP A;  2JN0 A;  2ECZ A;  5KYU B;  4PJO E;  4JJB A;  4BE2 A;  3PT9 A;  4QQG A;  1YJW T;  3M0P A;  1K9A A;  3OYC A;  3NFC A;  3CPW A;  2ROL A;  1AZE A;  4OB1 B;  4LE9 A;  1VQP T;  4ZN1 A;  1ABO A;  1BKB A;  2K4Y A;  2OI3 A;  2QAS A;  1WZO A;  2FL7 A;  5FWB A;  3M9Q A;  5LJ3 j;  3G71 A;  3I55 T;  1K9M U;  5LL6 S;  1LOJ A;  1ZSZ A;  1LPL A;  2R5A A;  1JJ2 S;  2VKN A;  3EGX B;  1YJW A;  3PVL A;  2EWN A;  2JS2 A;  2FB7 A;  3V7R A;  3M54 A;  2FVU A;  3EGU A;  4PJO F;  1TXQ A;  2YRV A;  1VQK A;  3M0S A;  2ZPH B;  4AFS C;  2CZ0 B;  3QZ5 B;  1OUL A;  3RMQ A;  1U06 A;  2PQW A;  3I5S A;  1QVG A;  4M75 A;  1VQ9 T;  1QWE A;  1RAI B;  2E6Z A;  3CCQ A;  5J26 A;  3AHU A;  4DEY A;  4FYW B;  2DZC A;  1QKX A;  3GP8 A;  1VQL A;  3JCM f;  1OQK A;  4OMF B;  1NLP C;  4OGC A;  3EHQ A;  4M75 E;  3CCR Q;  3UF4 A;  4C8Q A;  1WHJ A;  4XK8 E;  4J9G A;  4R0K A;  4A53 A;  1M90 U;  1VQ9 A;  1D0Z A;  2FPD A;  5GMK h;  4M7A C;  4ZN3 A;  2XDD A;  1W2B A;  4RUG A;  4KH1 B;  3OY9 A;  3BDU A;  4EDU A;  5IXB A;  3EG9 B;  2D1X A;  4PLL A;  2FG0 A;  2LVM A;  2WAC A;  2K57 A;  3M56 A;  2QAZ A;  1GBQ A;  3JCM Q;  4RMO A;  2GF7 A;  3HRU A;  2LCL A;  4HCK A;  1NBE B;  2RHI A;  1W2B S;  3ZL7 C;  4C5I A;  4XTZ A;  5CKF A;  1PRM C;  5FU6 C;  5DY9 A;  3QXE B;  2FHD A;  1I0C A;  4JRK A;  2DAQ A;  2RN8 A;  2LT1 A;  2OX7 A;  1YCY A;  3GBQ A;  1I81 A;  5HCK A;  2EYY A;  4RTW A;  4RTZ A;  5FU7 B;  3CCR T;  3GPL A;  2RD1 A;  4E7H A;  1SHG A;  2AHJ B;  4ELZ C;  1SPK A;  2JZ2 A;  5IHN A;  5I11 A;  5GAN 5;  3OW2 S;  1PHT A;  4L5G A;  4AG2 C;  2BE7 D;  5GAO p;  3OYB A;  3GNG A;  3R6O A;  3G4S A;  2O4X A;  3PE0 A;  4XU1 A;  2HZY A;  5HK3 A;  2DO3 A;  1OEB A;  3HPW A;  4Z8A A;  2F69 A;  2HQH A;  2QQA A;  4XTY A;  2EYX A;  4F14 A;  4LD9 K;  1PCX A;  2GQI A;  3J80 E;  1NJI C;  4N4H A;  4C0G A;  4LDY A;  4ATO A;  2LNV A;  3G4S T;  4D8D A;  2QDY B;  2DJQ A;  3CCJ A;  4HT8 A;  4BI3 A;  2QK0 A;  1K73 C;  2JJ9 A;  2JUF A;  4J6X A;  2EQJ A;  1VOM A;  1Q7Y U;  3QJ6 A;  3EG2 A;  4DQ2 A;  3I55 Q;  3JCM V;  3A8M B;  3J7A F;  1ZA2 B;  4OMO A;  4PJM A;  4C92 G;  2LJ1 A;  3JCM J;  3E1S A;  2RMO A;  3HHT B;  1ZHI A;  2X4W A;  4RG2 A;  3CD6 Q;  3RKY A;  6AT1 B;  4IUR A;  4KUI A;  1RAE B;  2VVK A;  2L8D A;  3THK A;  2VAS A;  4HXJ A;  2SEM A;  2LQN A;  4C0F A;  2O01 E;  4WTO B;  4XU2 A;  4MDW A;  2RQV A;  1DJ7 B;  2ZZD A;  2ED0 A;  1TG0 A;  1MGQ A;  3O8V A;  2LC4 A;  4RTY A;  5DM7 R;  5KYY B;  5A0L A;  4C8Q G;  2Z0W A;  2YXY A;  3OYN A;  2L3P A;  5CQY A;  4MZP A;  2JT4 A;  1IB8 A;  3M0T A;  3DLL A;  1X6O A;  4M75 C;  3I56 Q;  2LT4 A;  1N8R C;  1KK7 A;  2QDL A;  1YI2 Q;  4CI0 C;  3HRS A;  3CME T;  3CEY A;  1YHQ A;  3J81 E;  2CP7 A;  2PVG B;  2X51 A;  4X1V A;  1VQ6 Q;  4KBM B;  1EX4 A;  1KD1 C;  2A0F B;  2DIQ A;  4N0A A;  4GLM A;  2DBK A;  3I56 A;  2XG8 D;  1M8M A;  2KXD A;  1Q86 C;  2ZPF B;  4C8Q F;  2RJD A;  1TS9 A;  4FSS A;  2K7A A;  4KGZ B;  2NYS A;  3JCM g;  2EGE A;  5J3B A;  3EGD A;  3A8O B;  1SSF A;  1NLO C;  3M55 A;  5FRN A;  1UFF A;  3JSC A;  1V29 B;  3TEE A;  1KIK A;  2KVQ G;  3MKD A;  3OB9 A;  5AT1 B;  1VIF A;  3CPW P;  1RL2 A;  1PWT A;  5LJ5 j;  1WXB A;  2VB6 A;  1HYO A;  4JJD A;  4JRQ A;  1M1K R;  4WCI A;  1VQO Q;  2PU9 B;  2V26 A;  3VUB A;  3FJP A;  2A7Y A;  2Y4Y A;  2V8K A;  2GTO A;  1BIA A;  3JAM E;  4FL6 A;  5GAM d;  1QVF S;  2KQW A;  2RI2 A;  5GAN g;  2EPD A;  1K9M R;  2EJG A;  2JM9 A;  1KHI A;  3QYH B;  2DXT A;  2P0Q A;  4C92 F;  1RAG B;  2HNI A;  2XI9 A;  5GMK l;  2OTJ Q;  2CUD A;  3M59 A;  2QEX Q;  1X75 C;  2FRY A;  1B34 B;  5FRM A;  3CD6 T;  4OB0 B;  2XD0 A;  1VQN T;  2HD0 A;  1RAC B;  3OYI A;  5DLO A;  2JTM A;  1OZ2 A;  3RBB B;  4FYV B;  1MNE A;  3OS1 A;  2JXB A;  4J9H A;  5EG2 A;  3TVT A;  2C0I A;  3X28 B;  1VQ7 T;  4M7A E;  1PRL C;  3TSZ A;  3C4S A;  4E7L A;  2AT1 B;  1RAA B;  2DIL A;  2JOY A;  5D7U A;  1NE8 A;  1WHL A;  4J6Y A;  4M77 D;  3G4S Q;  4A63 B;  3JRZ A;  2JTE A;  4E2F B;  1K0X A;  3CMA Q;  3G1J A;  4E47 A;  2F5K A;  3CCL T;  3TCJ A;  2RO0 A;  2D6F A;  1Y07 A;  4OMM A;  2PVO B;  3PVQ A;  1S72 A;  3OSS C;  3CME Q;  5C6S A;  2V1Q A;  4RTT A;  1NEG A;  5L8R E;  1VYU A;  3HL8 A;  1IRE B;  5GAO n;  3ZFJ A;  1N27 A;  2P0K A;  2EW3 A;  3SEM A;  3CME A;  2A37 A;  2E65 A;  5D6W A;  1JXO A;  2E41 A;  1ABQ A;  2EJ9 A;  3CCM T;  3C94 A;  3QII A;  4J7I A;  2CUB A;  4Z88 A;  4E7J A;  2DRK A;  4M77 B;  5KYX B;  1IXD A;  3M0Q A;  2BUD A;  3E9G A;  4OF1 A;  2BE9 B;  4HCB A;  1QP2 A;  2RF0 A; 
#chains in the Genus database with same CATH homology
 1HXD A;  2CKK A;  1UEB A;  4LDW A;  3EAE A;  4LDV A;  3UT1 A;  5CK9 A;  1KQS A;  1BYM A;  4PL6 A;  2JN0 A;  2JTF A;  4PJO E;  2V8I A;  3SDZ A;  5CIU A;  3OS2 A;  4BE2 A;  3PT9 A;  4JRI A;  4N4G A;  2Y90 A;  4QQG A;  5KCH A;  5GAN j;  2LQ8 A;  1VQ6 T;  2K2V A;  1YJW T;  2L89 A;  4BY6 B;  3OQ5 A;  3GIB A;  3OYC A;  3NFC A;  4M78 D;  3CPW A;  3G7Z A;  5GAN 6;  1M1K U;  4JRP A;  4OB1 B;  2LTO A;  1Q86 U;  3PIP A;  1VQP T;  4ZN1 A;  2CYZ B;  2KSS A;  4M77 F;  4X9D A;  1BKB A;  2K4Y A;  5GAM f;  1UGP B;  5GMK m;  3OS5 A;  2ZPE B;  2FL7 A;  3CXC S;  3M9Q A;  4JLI A;  2XID A;  4A4K A;  4MDX A;  4DOV A;  5LJ3 j;  3G71 A;  1Y96 B;  2RB6 A;  3I55 T;  1K9M U;  5LL6 S;  1YI2 T;  1LOJ A;  3E9F A;  2DK3 A;  3FLG A;  4ZGE B;  4M7D B;  2R5A A;  1VQ4 T;  1JJ2 S;  1VQ8 T;  4RCB A;  3RKX A;  3A8G B;  1YJW A;  3PGG A;  5CKE A;  3NTI A;  3QZ9 B;  4JS4 A;  2EWN A;  3RIR A;  2FB7 A;  2RHY A;  4M78 F;  3L2Q A;  3V7R A;  3M54 A;  4MML A;  2FVU A;  5GAM g;  5GAN 2;  3I56 T;  2H3J A;  3SWN C;  2MMP A;  1ZQ1 A;  3OYY A;  4RCC A;  4JS5 A;  3VU3 C;  3QSU A;  3MEA A;  4PJO F;  1G3Y A;  2DTH A;  3CMA A;  2YRV A;  4NL3 A;  4EMK A;  3CPF A;  4Y28 E;  5IT9 E;  1M5Q 1;  4A54 A;  1VQK A;  2ZPH B;  4M7A B;  1Q82 U;  1YIT A;  2CZ0 B;  3QZ5 B;  4EMG A;  5LJ5 e;  3MP8 A;  2OTL T;  3PIO A;  4C5G A;  3CCU T;  2QA4 A;  4XTX A;  2E64 A;  4PLI A;  4QVZ A;  2MWP A;  3RMQ A;  2K3X A;  2PQW A;  2R57 A;  2DIG A;  3V8K A;  3OYJ A;  3M4Y A;  5GAN 4;  3KXT A;  4L6V 5;  1QVG A;  3HFN A;  3P8B B;  2E70 A;  4IUV A;  4M7D C;  3QJY A;  4M75 A;  4B9W A;  1VQ9 T;  5KH6 A;  2E6Z A;  3CCQ A;  1QVP A;  5J26 A;  1YJ9 T;  3VV0 A;  3AHU A;  4ZGJ B;  4NS5 A;  2DZC A;  2WSE E;  4M78 A;  3GP8 A;  4M7D G;  2XK0 A;  1Q81 C;  4ZTF A;  3JCM f;  5LJ3 h;  1VQL A;  1FWZ A;  4M7D E;  2ZGW A;  3MHX A;  4OMF B;  4OGC A;  4RKU E;  1YHQ T;  5GAO m;  2RHX A;  3WVE B;  3X24 B;  1I4K 1;  1ZBX A;  4MZT A;  4QQ6 A;  3LLR A;  1KQ2 A;  4EMH A;  3OYL A;  3NTH A;  5CCA A;  4M75 E;  1VQ5 A;  1JBM A;  1NZ9 A;  2DKG A;  3A8H B;  4XK8 E;  4C8Q A;  1M90 U;  4A53 A;  3V8J A;  3HRT A;  1VQ9 A;  5GMK h;  3M58 A;  3CCE A;  4M77 A;  3CCS A;  4M7A C;  1OYX A;  4ZN3 A;  3MEU A;  4E7I A;  2DXB A;  3DB4 A;  2QEX A;  2XDD A;  3V7S A;  1W2B A;  2VC8 A;  2OTJ A;  3BFM A;  3FDR A;  1YIJ A;  5IAY A;  4M7A D;  4NL2 A;  4BI4 A;  1K8A C;  3OY9 A;  2VGN A;  5J39 A;  3BDU A;  1K9M C;  2GCX A;  2QTX A;  3JB9 I;  1M8V A;  4EDU A;  5I2S A;  4ELY C;  2XHC A;  3C12 A;  1S72 T;  3DLM A;  3A8L B;  1BI2 A;  4UC4 A;  2C06 A;  1BIB A;  2M9U A;  4XTU A;  1YI2 A;  3CD6 A;  3EFS A;  4ME7 A;  4PLL A;  3CBM A;  2LVM A;  4X34 A;  4ZGD B;  5GAN h;  1KD1 U;  3CCE T;  4Z02 A;  4M7D F;  4M77 E;  3LWI A;  4C92 B;  2WAC A;  4J83 A;  3RKW A;  2K57 A;  3M56 A;  5GMK j;  1VQM T;  1QVG S;  1N9R A;  1X01 A;  4RMO A;  2XIC A;  2LX9 A;  1RI0 A;  4M77 G;  3JCM Q;  4IUU A;  5GAO r;  1M1K C;  3PMI A;  2GF7 A;  3HSB A;  1HK9 A;  1UGQ B;  3HRU A;  1VQO A;  3DKM A;  2LCL A;  2X4J A;  5D6Y A;  1WQW A;  2RHI A;  1W2B S;  1XTD A;  1QP3 A;  2HBP A;  3OYK A;  4A4E A;  4C5I A;  3CCV A;  4F7U B;  2K5I A;  2ZPG B;  4XTZ A;  5CKF A;  3OYH A;  4EPC A;  4HCC A;  5FU6 C;  5DY9 A;  3QXE B;  1N9S A;  2FHD A;  5GAO l;  5GMK e;  1BI3 A;  4JRK A;  1WJR A;  2DAQ A;  4QVC A;  2LT1 A;  1YCY A;  3LX7 A;  4PJO G;  5LJ3 d;  2DJZ A;  3F70 A;  3MEV A;  1I81 A;  3V8L A;  3SWN A;  2DTO A;  2LCC A;  2P0P A;  3JB9 J;  1I5L A;  3LH0 A;  2XU8 A;  1JJ2 A;  1D3B A;  2D0Q B;  3JB9 G;  5CO7 A;  3ASK A;  4EMK B;  5FU7 B;  2CZ7 B;  2BKD N;  3CCR T;  2RM4 A;  3GPL A;  2RD1 A;  4O6J A;  5I2M A;  4BD3 A;  4E7H A;  4IUQ A;  3BY7 A;  2AHJ B;  4BI8 B;  4IUP A;  3GF5 A;  4ELZ C;  2JZ2 A;  2DEQ A;  2DXU A;  2PUO B;  1IZ6 A;  2VUB A;  5GAN 5;  3KUF A;  2GFA A;  1G3T A;  2EKO A;  3SB2 A;  3MP1 A;  4C8Q C;  3OW2 S;  4L5G A;  1UGS B;  5GAO p;  3OYB A;  2E5Q A;  5A0G A;  3CC4 T;  4ZTJ A;  3JB9 F;  3GNG A;  3R6O A;  3L2U A;  3G4S A;  2L5Q A;  4C0D B;  3OMC A;  5GMK i;  4CRI A;  2O4X A;  1LNX A;  4XU1 A;  1BI1 A;  3BDL A;  1K8A U;  5HK3 A;  2RK1 A;  3G6E T;  2MI6 A;  5D6X A;  4II1 A;  4M78 C;  2DO3 A;  4F7U E;  2DVE A;  3CC2 A;  5AYF A;  3QYG B;  3HPW A;  3Q1J A;  1JB0 E;  3MO8 A;  3DB3 A;  1UGR B;  3MP6 A;  4M78 E;  2F69 A;  1KC8 U;  3ZEH A;  2QQA A;  4XTY A;  2LRQ A;  4J6W A;  4N0A C;  4PNO A;  2R58 A;  5GAN 8;  4LD9 K;  3J80 E;  1NJI C;  1TH7 A;  4N4H A;  4J7F A;  3UDC A;  4LDY A;  4C0G A;  4ATO A;  2LNV A;  1KHC A;  3G4S T;  3OYA A;  2QDY B;  2KMT A;  2E6N A;  4M78 G;  1QW1 A;  3CCJ A;  4HT8 A;  1VQM A;  4NOY A;  4BI3 A;  5FRO A;  3S3O A;  5CAI A;  4KUL A;  1YIT T;  3S3N A;  1K73 C;  2XKO C;  2B8A A;  1P92 A;  4PJO A;  4C0D C;  5GAM e;  4FT4 A;  4R55 A;  1G5V A;  3CCL A;  2QQR A;  2JUF A;  3QKJ A;  2Y4X A;  4HCZ A;  4J6X A;  3SD4 A;  2EQJ A;  1FXX A;  5GAN e;  5LJ5 d;  1N8R U;  1Q7Y U;  1H3Z A;  3CPW S;  3OBW A;  3QJ6 A;  5GAN d;  5M9O A;  4DQ2 A;  3JCM c;  4C5H A;  2KDS A;  3JCM V;  1W4S A;  3A8M B;  4XTW A;  3J7A F;  3JCM b;  1VQ6 A;  2EAY A;  4C92 G;  3M57 A;  3JCM J;  3E1S A;  2DPP B;  2VXE A;  1ZHI A;  3HHT B;  4M75 F;  4Q5W A;  4JLG A;  1WNL A;  2RA2 A;  2X4W A;  4IUT A;  4JDS A;  4OB3 B;  2QQB A;  3HKS A;  4RG2 A;  5A2Q E;  1MHN A;  3OW2 A;  3PMT A;  3RKY A;  4BY6 C;  3UPU A;  2JNG A;  3PTA A;  3H8Z A;  3LW5 E;  4IUR A;  3OS0 A;  2A3L A;  3FB9 A;  4BUG A;  4KUI A;  3OBY A;  4JUV A;  4B9X A;  1VQ5 T;  2L8D A;  3KBG A;  5LJ3 g;  1OZ3 A;  2EQK A;  4F7U A;  1XQH A;  1VQ4 A;  4C0F A;  2O01 E;  5KE3 A;  4XU2 A;  3RER A;  3FIF A;  4MDW A;  4RG8 A;  4M75 B;  3HFO A;  1DJ7 B;  4C92 E;  2ZZD A;  2HAX A;  2RHZ A;  1YIJ T;  2RHU A;  3CC7 A;  3JCM d;  1VIE A;  2NLU A;  2DZ9 A;  5A0D A;  1MGQ A;  5GAN 7;  3QHS A;  2FYK A;  3X26 B;  3O8V A;  5DLQ E;  2MF2 A;  3S3M A;  2LC4 A;  3G6E A;  5DM7 R;  1VQK T;  3QO3 A;  4BE0 A;  2EQU A;  2G3R A;  3OSV A;  4BB7 A;  5A0L A;  1B34 A;  4C8Q G;  5LJ5 h;  3L42 A;  5GAO q;  2OAU A;  3CC2 T;  1KQ1 A;  5KCO A;  1H64 1;  2VV5 A;  2QA4 T;  1WQ7 A;  4XTV A;  2E10 A;  3OYN A;  3FEO A;  2VXF A;  4MZP A;  5CQY A;  1NJI U;  1Q82 C;  1R8O B;  4J5Y A;  2VGM A;  5GAM h;  1Y71 A;  2GFU A;  2PUK B;  3CC7 T;  1PSF A;  3DLL A;  4M7D A;  1VQP A;  1XNI A;  1X6O A;  4M75 C;  2X4Y A;  2X4X A;  3CCQ T;  1YJ9 A;  2LT4 A;  1K73 U;  1N8R C;  1LJO A;  3MCA B;  2QXF A;  3ER0 A;  5FLX E;  1UB4 A;  4LD6 A;  3VKI A;  3ME9 A;  3CCV T;  2LDM A;  3HRS A;  4OB2 B;  4CI0 C;  3CME T;  3QDR B;  3CEY A;  4WF2 A;  4XAX B;  3J81 E;  1YHQ A;  1VQ8 A;  5LJ3 f;  4JJN K;  2PVG B;  4PJO D;  3JCM X;  3EFR A;  3L2W A;  2V8J A;  4KBM B;  3L1A A;  3PFS A;  1KD1 C;  3GOX A;  2DIQ A;  4N0A A;  4BDZ A;  3H6Z A;  3HP9 A;  5GAN 3;  3I56 A;  2RJE A;  2XG8 D;  4IKF A;  4MZM A;  2IVW A;  3CCS T;  2D9T A;  4FU6 A;  1Q86 C;  2ZPF B;  4M77 C;  4C8Q F;  2RH2 A;  2RJD A;  3C95 A;  3WXM B;  1VQ7 A;  4BAC A;  1QVF A;  2KY9 A;  3JCM g;  1M1F A;  4GY5 A;  5J3B A;  2OTJ T;  4OVA A;  3A8O B;  1SSF A;  3CCR A;  1WGS A;  5HKC A;  3M55 A;  4C8Q B;  5FRN A;  2OTL A;  2QQS A;  5IN1 A;  1JRI A;  1M9S A;  4J8O A;  4MMK A;  3INZ A;  3CCU A;  3JSC A;  1V29 B;  3NTK A;  3TEE A;  3X20 B;  1GXI E;  1OI1 A;  2KVQ G;  3JCM e;  3OB9 A;  1VIF A;  3VYH B;  3WVD B;  4P5N A;  3FRN A;  5LJ5 g;  1BI0 A;  4YTL A;  3CC4 A;  1Q7Y C;  2RJF A;  2K5F A;  1RL2 A;  4C92 D;  4DOW A;  3JB9 H;  5LJ5 j;  2QI2 A;  1U8R A;  3VYG A;  4FT2 A;  2I2L A;  2KAF A;  2RI3 A;  3M5A A;  4JRQ A;  3L2R A;  3LGL A;  3QUI A;  2PU9 B;  3UWN A;  3VUB A;  3FJP A;  3LWH A;  2MWO A;  1Y7X A;  2A7Y A;  2Y4Y A;  3RUX A;  1VQO T;  4F7U F;  4A4F A;  4GLK A;  2V8K A;  2EYQ A;  1BIA A;  5LJ5 f;  1VUB A;  5HY6 A;  3JAM E;  1EIF A;  4FL6 A;  1I8F A;  5C0M A;  3G71 T;  5GAM d;  1QVF S;  4N4I A;  2XDB A;  2RI5 A;  4Y91 A;  2KQW A;  2RI2 A;  2DD4 A;  5GAN g;  1VQN A;  2DTI A;  3QBY A;  3URG A;  4V2S A;  2EJF A;  3E19 A;  4FIB A;  4C0Z A;  2EJG A;  1KHI A;  3MEW A;  3QYH B;  4E7K A;  2DXT A;  1O9S A;  2P0Q A;  3LYI A;  4C92 F;  4A4H A;  3VJP A;  3MET A;  5CQX A;  3L2V A;  5HK0 A;  2M0O A;  4OP0 A;  2PVD B;  2HNI A;  2XI9 A;  5GMK l;  3CCM A;  3JCM W;  3OYD A;  4M7D D;  3M59 A;  4XU3 A;  5FU7 C;  1G3S A;  2M1H A;  1WJS A;  3JCM h;  2E1H A;  4DA4 A;  1X75 C;  5CKD A;  1B34 B;  2P4T A;  5FRM A;  1N6A A;  4OB0 B;  3CD6 T;  4A4G A;  3CXC A;  2XD0 A;  1VQN T;  3OMG A;  2HD0 A;  3PNW C;  4HT9 A;  3OYI A;  3OA6 A;  3QG1 A;  2CZ6 B;  2WSC E;  3V7C A;  2F5T X;  2WSF E;  5DLO A;  2JTM A;  1NPR A;  3CBP A;  1OZ2 A;  1KG1 A;  1M1G A;  2QQ9 A;  4M75 D;  3OS1 A;  5KE2 A;  2RK2 A;  5EG2 A;  2EQM A;  1G3W A;  2CZ1 B;  4M75 G;  3CBO A;  3X28 B;  5FU6 B;  1VQ7 T;  4M7A E;  2K5L A;  2MAM A;  4BDY A;  1Y96 A;  3C4S A;  4E7L A;  4VUB A;  1VQL T;  3ZBD A;  2BIV A;  4HKE A;  2HQE A;  4R56 A;  1D3B B;  1YBY A;  2CGH A;  4TVR A;  2GQV A;  2EIF A;  2JOY A;  1KQS S;  3GLX A;  3GNF B;  5GAN f;  3OYF A;  2DD5 A;  1YJN T;  1XOV A;  4XQ3 A;  3L2Z A;  4KT0 E;  1AHJ B;  4BE1 A;  1WJQ A;  1NE8 A;  5CR2 A;  5LJ3 e;  4J6Y A;  4M77 D;  3A5Z B;  4C92 A;  4C92 C;  3JRZ A;  4QVD A;  4EMK C;  1U1T A;  3CCJ T;  2ZPI B;  3RES A;  2QEX T;  3VUZ A;  2KK4 A;  4FSX A;  3OYM A;  4E47 A;  3I55 A;  2EFI A;  2F5K A;  3JCM P;  2CS7 A;  4PKC C;  3M4G A;  4FM4 B;  2ZPB B;  3S6W A;  3TCJ A;  2RO0 A;  3CCL T;  2D6F A;  1Y07 A;  3QPH A;  4OGE A;  3SFM A;  2E12 A;  4M7A F;  3M53 A;  1YJN A;  2PVO B;  1S72 A;  3OSS C;  5C6S A;  4C5E A;  3LGF A;  4PJO B;  2RJC A;  5L8R E;  4X9C A;  3HL8 A;  1IRE B;  3TRE A;  4HA8 A;  4QW2 A;  3CMA T;  4KUD K;  4M78 B;  5GAO n;  2L3R A;  3ZFJ A;  3SWN B;  1N27 A;  2P0K A;  3N5B B;  1Q81 U;  3CME A;  2M16 A;  2E65 A;  3JB9 D;  5D6W A;  4F7U G;  2E41 A;  2HQX A;  2IG0 A;  5CKH A;  2X35 A;  3OYG A;  1KC8 C;  2EJ9 A;  4C8Q E;  2JVV A;  2YLB A;  3CCM T;  3C94 A;  3QII A;  3TU4 K;  3FC3 A;  1M90 C;  2VYT A;  1M4Z A;  1NPP A;  1PSE A;  1U1S A;  4QQD A;  1O75 A;  4J7I A;  3T9N A;  4C8Q D;  4D6W A;  3P8D A;  3BW1 A;  1FX7 A;  4E7J A;  2YHT A;  2DXC A;  4O5V A;  4M77 B;  1WPY A;  5CVI A;  5I21 A;  4M7A A;  2BUD A;  3E9G A;  2K3Y A;  2LQK A;  4L59 A;  3X25 B;  2XDP A;  3P8H A;  4OF1 A;  4LDX A;  2YLC A;  4LDU A;  3RMS A;  2O4X B;  4PJO C;  4HCB A;  5CKB A;  3OYE A;  1QP2 A;  4XU0 A;  4M7A G;  5GAM j;  2ZCF B;  2R5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...