4EDUA

The mbt repeats of human scml2 in a complex with histone h2a peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
211
structure length
211
Chain Sequence
DFHWEEYLKETGSISAPSECFRQSQIPPVNDFKVGMKLEARDPRNATSVCIATVIGITGARLRLRLDGSDNRNDFWRLVDSPDIQPVGTCEKEGDLLQPPLGYQMNTSSWPMFLLETLNGSEMASATLFKKEPPKPPLNNFKVGMKLEAIDKKNPYLICPATIGDVKGDEVHITFDGWSGAFDYWCKYDSRDIFPAGWCRLTGDVLQPPGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Histone recognition by human malignant brain tumor domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Sex comb on midleg-like protein 2
total genus 54
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2012-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4eduA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4eduA01
4C5GA 2E5QA 4HCZA 3P8HA 1OZ3A 3LYIA 4QQGA 4E7HA 4IKFA 5M9OA 3L2QA 4RG2A 3OYJA 3OYDA 5KE2A 4BDZA 2XDPA 2HQXA 3C4SA 4IUTA 3LGLA 5C6SA 4E7IA 2RHXA 3SD4A 5IN1A 2M16A 5D6WA 1XNIA 2FHDA 2R5MA 3OA6A 3KUFA 2D9TA 2RI5A 2RHZA 3LH0A 2MWOA 3UWNA 3NTHA 4PLIA 4BACA 5J39A 3QKJA 3OYNA 2RO0A 2VYTA 4PLLA 3OYFA 5KCHA 3F70A 2GFUA 2X4WA 3MEAA 4GY5A 1G5VA 5KH6A 4E7LA 2LRQA 3Q1JA 3FEOA 2K3XA 3FDRA 4CRIA 3QBYA 4E7KA 3MP6A 4II1A 5CIUA 4BDYA 4QQ6A 3S3OA 3O8VA 2MWPA 5KCOA 4BE2A 4BE1A 1WJQA 3CEYA 1WGSA 3S3MA 3MEUA 2RI3A 2X4XA 2E6NA 2EQJA 2O4XB 3MO8A 3PNWC 3NTIA 5D6YA 4A4FA 4C5HA 3DB4A 2M0OA 2P0KA 3OS2A 3OYLA 1MHNA 2DIGA 3OYHA 3OYIA 3L2WA 3S6WA 2BUDA 3H8ZA 2F5KA 1OI1A 3BDLA 2RJDA 2EQMA 3P8DA 3ZEHA 3OYEA 2RHIA 2M1HA 2G3RA 3LX7A 3OYCA 1N27A 4IUPA 4OVAA 3OYAA 2DIQA 2L3RA 2EKOA 4IUQA 3EAEA 5J26A 4ZTJA 2GF7A 4B9WA 4X34A 4Z02A 2JTFA 3OS0A 2LVMA 1OYXA 4NS5A 3S3NA 2X35A 4N4GA 4LD6A 4B9XA 5C0MA 3OY9A 3OYMA 2LTOA 3PFSA 3MEWA 2RHYA 2XK0A 3PMTA 2DAQA 2PQWA 4QVZA 3LLRA 3H6ZA 3OS1A 3OYGA 2EFIA 2X4YA 2BIVA 4C5IA 3ASKA 1OZ2A 2QQRA 1WJSA 4IUVA 2BKDN 2LDMA 3OMCA 2NLUA 3L2RA 2JZ2A 2R57A 2EQKA 2IG0A 3LGFA 3FC3A 2O4XA 3E9GA 4FU6A 4IURA 4UC4A 2RI2A 4Q5WA 5FROA 2B8AA 4QQDA 1SSFA 2QQSA 2L8DA 3PMIA 3OYBA 2K3YA 3META 4C5EA 4QW2A 5IAYA 3ME9A 3NTKA 2EQUA 5KE3A 2GFAA 3QJ6A 4PL6A 4N4IA 2LCCA 3UT1A 3E9FA 3L2UA 3OQ5A 5FRMA 3OYKA 4BD3A 2CKKA 2R5AA 3L42A 5D6XA 4A4EA 3FLGA 2HQEA 4FL6A 4A4HA 4ZTFA 3OMGA 2RJEA 2YRVA 2RJCA 4A4GA 1H3ZA 2L89A 1KHCA 1WJRA 4L59A 3MP8A 3DB3A 5FRNA 3QIIA 3L2VA 3OB9A 3GOXA 3M9QA 2RHUA 4IUUA 2RJFA 3MEVA 4N4HA 4E7JA 3DLMA 4EDUA 1RI0A 2WACA 2R58A 4BE0A 3MP1A
chains in the Genus database with same CATH superfamily
1NPPA 3MPUB 1Q86U 1R8OB 1YITQ 1VQ6Q 4P5NA 4XU0A 5EC7A 2V8KA 3LGLA 4GLMA 3NHNA 1M5Q1 2K3BA 4PJOF 4R0KA 1CKBA 3R6NA 2HBWA 3NFCA 5CKFA 2HL3A 1R0CB 1TSFA 2K5LA 1QW1A 5KYWB 4DA4A 4E7KA 4II1A 2JVVA 5KCOA 1BK2A 3CCJT 1M4ZA 3S3MA 3MJXA 3HP9A 3MO8A 2VV5A 4J9BA 2LCSA 3HPWA 1QVGS 2YUQA 2E1HA 2BUDA 5I21A 4RCCA 4HA8A 2AZSA 1KJWA 3ZFJA 5FWBA 3H0FA 3HFNA 3D7SB 3QDFA 2CZ1B 3RIRA 2A36A 2IVWA 2JTFA 2CP7A 1VQ7Q 3X25B 4LD6A 2VUBA 2K2MA 2DLPA 2XKOC 4OF1A 2J6KA 1MMDA 2PVOB 1VQ8A 4FSXA 3SWNB 2CREA 3RMSA 2BKDN 2RB6A 3G4ST 4UC4A 5KYUA 2XG8D 2QI2A 4O5VA 4PJNA 2QA4A 1QVFA 1KD1R 2EYYA 2CKKA 1HYOA 2CZ0B 5D6XA 4KGVB 3JCMf 1BCOA 1YWOA 1MNEA 1BIAA 4PJOE 1WJRA 1RAAB 2OTLQ 1VQNA 2O9VA 3GOXA 2HD0A 1JEGA 4PJOA 4N4HA 5LJ5d 3DLMA 2GTJA 3QG1A 1ABOA 2YWWA 5GMKe 3I35A 1JO8A 1C6VX 2EGAA 2H8HA 8AT1B 4FW1A 1WHJA 4KGXB 1WHHA 2EIFA 1RUWA 5GJVB 3EG3A 2DK3A 1W4SA 4ELZC 4NL3A 2FHDA 5FU6B 2KYBA 1IHVA 2JTMA 3HRUA 2RO0A 4CC3A 1M3CA 4RTYA 1GRIA 3Q1JA 1I5OB 4JJDA 4OMNA 1XJWB 4ESRA 4A53A 3RKXA 5GANg 2HAXA 4V2SA 1X69A 4MDXA 2WSEE 2RD1A 1BU1A 2XMFA 4C5HA 1D3BA 1Y07A 2RK1A 2DIGA 3CCMA 3JCMQ 4E7SA 4HKEA 1Q82U 3BY7A 3PVLA 1MUZA 2AK5A 4PFOA 3LX7A 2C0TA 3OYCA 1XOVA 2HDAA 4EMKC 2LVMA 2FO0A 1Q7YU 3JAME 1KK7A 4PFPA 3GNFB 2PTKA 3PMTA 1AHJB 4N0AC 4HCKA 2DERA 1YJNT 5GAMg 2DX1A 5LJ5h 4LUEA 1UUEA 3VRZA 1OULA 2KT1A 5IHNA 1UGSB 2IG0A 3E19A 5CAIA 2E41A 2AHJB 2QQSA 4O6JA 1GCPA 4QW2A 1TWBA 2EQIA 4LNPA 3JCMd 4NL2A 1VQ9A 1SKUB 2DJQA 3SFMA 3CC7Q 4A4EA 1AT1B 4R56A 4FL6A 2DL3A 2FL7A 4D8DA 2KSSA 2EJFA 1VQ8T 5A2QE 3CCUA 3L2VA 2HQHA 2RHUA 3FJPA 4C92C 4HCBA 2QEXT 2ZPEB 2WACA 2C0OA 4M7AE 3P8HA 4C0GA 1VQNQ 5CR2A 2OTJT 1T0HA 4L5GA 3M4GA 3MCAB 1P92A 1X27A 1R0BG 3SWNC 5KYWA 4JDSA 3MEAA 1NZ9A 3UA6A 4DOVA 5KH6A 3CMET 3FEOA 1FYNA 3TU4K 3S3OA 5DLOA 4QQ6A 5AT1B 3VYHB 1WXBA 3EGDA 3CPWA 3MEUA 2BZ8A 3FRNA 3OYIA 4PJOB 3QZ5B 1VQ4T 1GXIE 2GBQA 2VKNA 3V8LA 2CUBA 2RQRA 2V1RA 2EYQA 2ZAEA 4OVAA 2OAUA 2DIQA 4C8QB 3TQ7P 1I0CA 1ARKA 2ZPFB 3A8MB 1W6XA 2YUNA 3EFRA 5GAMj 3JV3A 4LN2A 3JB9D 2A3LA 2DL8A 2X4YA 4IIMA 2VB6A 2YRCA 3HSBA 3LW5E 4MZMA 1Z9ZA 2RQWA 5CO7A 1JB0E 4Q5WA 2KMTA 2Y4XA 2CH4A 2AKKA 2JTEA 2XI9A 2M51A 4M7AF 2GFAA 3QJ6A 4PL6A 1I4K1 1YNZA 2KROA 2DJZA 1VIEA 2KT8A 2FB7A 4XTZA 2YDLA 3VKIA 1MV3A 1PKSA 3ER0A 4L59A 4PJOD 1EX4A 5KYXA 1SRLA 2M9UA 4JZ4A 1RABB 2OTJA 1VQPQ 2DETA 1M8MA 3C0CA 2DPPB 4HCZA 3A5ZB 4E7HA 4EMKB 3M0PA 1PKTA 3I5RA 5KE2A 3EFOA 2M16A 3M0QA 4ZGDB 4WCIA 4M7AB 3I9QA 2E64A 1C1AA 2KK4A 4BACA 5J39A 3EG2A 3OYNA 3OYFA 4M75E 1JJ2P 2DBKA 4M7AC 5KYUB 1WQWA 1B3QA 3MKDA 1IRXA 5HY6A 4MMKA 5CKDA 2I0NA 2L3QA 1FX7A 2LCLA 2CSIA 2ZZDA 4Y91A 4BE2A 2E10A 2EGEA 2EYZA 4MZTA 1KSWA 2RA2A 2DA9A 2QTVA 2V8JA 2E6NA 4K11A 2FVUA 3GBQA 4XK8E 3EGUA 2BTTA 3L2WA 3LH5A 3BDUA 3CXCA 3I56T 3P8DA 1QVFS 5GMKj 3PVQA 3M0UA 2V26A 4BY6B 1PWTA 2ZPIB 1QCOA 1S1NA 4BY6C 3PIOA 1H641 4E2FB 3RERA 3EH1A 4M78F 1KIKA 2D6FA 2RM4A 1UTIA 2ZPGB 1AVZC 2LTOA 4OMMA 4KH0B 2HMAA 2XK0A 1OV3A 4XTWA 2L0AA 4A63B 1X43A 4FT4A 2DYBA 2LQNA 4F7UA 1OZ2A 4IUVA 1VQ7T 1XTDA 2F2WA 3LGFA 4FIBA 1YJ9Q 1BKBA 2YUOA 1QP2A 4IURA 1J3TA 1PNJA 1SSFA 4XTYA 1QWFA 1RLPC 1TUCA 1K1ZA 4YTLA 3NTKA 2EVRA 4C8QF 2LQKA 2R5AA 1VUBA 1PC0A 1Q81R 3SWNA 4A4HA 1TG0A 3GP8A 4JS5A 2DEUA 2LJ1A 1NLPC 2DL7A 1VQ7A 1KQSA 4DBHA 1I81A 3H0IA 3MEVA 1B34B 1VQNT 1YCYA 4C92E 1PRMC 3SB2A 2CGHA 1D09B 1JQQA 3OBWA 2KI7A 1S72T 1VQOA 1PSFA 1VQPA 1M8VA 2L3PA 9ATCB 3KFVA 3TSWA 3CC2A 1YITT 4JRQA 3JB9H 2GQVA 2RMOA 3JCMX 4L6V5 4DBQA 5GAMd 3CC2Q 1PSEA 2KDSA 2LT1A 3TVTA 2ZPHB 4QKUA 1YFNA 1WGSA 4LUDA 2EQJA 1BIBA 3DB4A 2EJGA 1GL5A 2LZ6B 2AKLA 3OYHA 2D0QB 3I56A 3AT1B 2EQMA 5GANe 2G3RA 3CCSQ 3E2UA 1SHGA 2L3RA 1QP3A 5J26A 1WX6A 2Y4YA 3GLXA 4DBRA 3TREA 5DM7R 2MK5A 1GBQA 3WVEB 2KQWA 2O31A 2X35A 3S3NA 2H3JA 1WXUA 3H6ZA 2EFIA 1K0SA 2BIVA 4CC2A 3V7CA 4EIKA 4KH1B 1R77A 2K5IA 1IZ6A 4JUVA 2EQKA 3FC3A 3TSZA 4HCCA 3E9GA 1U3OA 4RUGA 1VQMA 1VQ6T 3PMIA 1ZHIA 5DLQE 3CBPA 2NUTB 3UPUA 2O2OA 1M1FA 2LCCA 2GQIA 2DYIA 2K4YA 3I55T 3JB9J 4HT9A 3OMGA 5GAMh 1NYFA 3CPWS 1G2BA 2YXYA 3NPFA 1W1FA 1LVKA 2XD0A 3SHWA 1PD1A 2PVDB 1SG5A 2KY9A 1U1SA 1RI0A 2R58A 3MP1A 3CC2T 1IXDA 2GTOA 2KRNA 1OZ3A 1QKXA 3X26B 2JNGA 4C8QE 2OTLA 2ZGWA 2JMCA 2H3EB 3JSCA 2RHXA 1WHLA 4IIOA 2QASA 4Y28E 3KUFA 2D9TA 5LJ5j 3LH0A 4XU2A 2XDDA 4J7FA 2VYTA 3OW2S 4M75D 3RBBB 4LE9A 3QBYA 1ZA2B 3CMEA 3MP6A 1GFDA 4J9DA 1F1BB 1NYGA 2DZ9A 2YUPA 3CCQQ 1OQKA 3RESA 1KFZA 3S6WA 5AYFA 5I2SA 1VQMT 1VQ6A 4J6XA 2HSPA 5IH2A 3EAEA 3V7SA 3HRSA 3RMQA 3CCMQ 5C0MA 1YJWA 2DTHA 2RPNA 2ABLA 1M1KR 3OS1A 1VOMA 1OX8A 3ASKA 3CMEQ 1K8AR 3J81E 1WLPB 1G3SA 3I55Q 4LDXA 4M75G 5KYYB 4M78D 2K3YA 4CC4B 3GIBA 2ROTA 1OU9A 1U1TA 4PK4A 2L5QA 3L2UA 2DD4A 3HFOA 3OW2P 3RKYA 1KQSP 2A7YA 2KEAA 3M4YA 4M7DC 3GF5A 1TUDA 4RKUE 2AZVA 2CT3A 3RNJA 4HVUA 5CQXA 5CK9A 2JJ9A 2QEXQ 3JCMg 2DXTA 3OYJA 1VYUA 5CKEA 1TOVA 1YJ9T 3PGGA 4AFSC 2HKNA 3M53A 3SD4A 5D6WA 2R5MA 2FG0A 2E12A 1N6AA 1WPYA 1BI3A 3TCJA 4PLIA 4XTUA 3QPHA 5EG2A 1YCSB 1ZLMA 1G3TA 2NUPA 1ZBJA 3M56A 3PT9A 1VQPT 3FDRA 2D1XA 4OB0B 2JMAA 2VASA 2HZYA 2QGFB 4BE1A 3CC4A 4N0AA 5GAMf 3CC4T 3NTIA 4CI0C 4A4FA 2VGMA 4C92D 1UHCA 4DBFA 2QG9B 1RL2A 2F5TX 2YLCA 4B9WA 4EMGA 3NGPA 1Z9QA 2KE9A 4XAXB 3M54A 5HKCA 4AFZC 1WNLA 2X3XD 2P4RA 2PQWA 5GMKh 4MMLA 1YHQQ 2YT6A 1GCQA 2DVJA 4M78C 3U23A 5FROA 4QQDA 2WSFE 2RQTA 2NUTA 2XU8A 1TXQA 1UGPB 4JLIA 4M78B 3J7AF 3OQ5A 1B7TA 1K0XA 3HKSA 4AFQC 3A1PA 1M1KC 3JCMW 1N8RR 3JCMV 1KHIA 1QLYA 1KHCA 2L89A 2ZPBB 2GCXA 2CT4A 2EWNA 2RJFA 4ORZA 3EG0A 4M7DA 5CKBA 3H9NA 4QQGA 4C8QC 3PTAA 4J9FA 1AD5A 2DBMA 5A0DA 1ZUYA 2MPXC 2XDPA 3M0RA 4IUTA 1X6GA 1AWXA 3A8GB 2V8IA 4KUDK 4LD9K 2HCKA 4M75F 2K9GA 2WSCE 1H8KA 1AZEA 1V76A 1M90C 1Q81U 4E7LA 1Y0MA 1CSKA 2LP5A 4ZGEB 3THKA 3O8VA 5IHIA 4OGEA 2FPDA 4MZPA 1BI2A 4M75B 4JPBW 4OB2B 4FYXB 4M75C 2P4TA 2GNCA 2XIDA 1SRMA 1UE9A 3G6EA 2B86A 2QTXA 4Z88A 1LNXA 1QCFA 2RF0A 2DKGA 2DTIA 5GAMe 1NEGA 1S72Q 2LQWA 4BI4A 2JS2A 4Y92A 2HKQB 4C92A 3OY9A 3CCRA 2KVQG 4X1VA 3C94A 3EGXB 1UEBA 4QVZA 1UGVA 2OI3A 4VUBA 1D0XA 2QA4Q 2DD5A 1RLQC 1WJSA 3CCQA 3C12A 3CCQT 1Y96B 4JJCA 3T9NA 3CMAT 5KYYA 2CZ6B 2YSQA 4AG2C 1YHQA 4J9EA 3GPLA 2G6FX 4PJMA 4QVCA 1K76A 1IB8A 4WTOB 1YBYA 3E9FA 3HRTA 5HCKA 4M77B 4ZTFA 3BFMA 4AG1C 1AEYA 1MMAA 1H3ZA 1M9SA 2KGTA 3JCMP 5FRNA 4M77C 4BI3A 1NJIU 2K5FA 3VS1A 4F04B 3CCRQ 1KC8R 4JJBA 2E6ZA 1ZX6A 2QQBA 1N9SA 2P0PA 2BZXA 5GMKi 1YI2A 1OPKA 2FPFA 1VQ5A 3URGA 3G71Q 1QQJA 2PUOB 1YITA 5KYXB 1VQ5T 3DLLA 4FT2A 3ULRB 4OMLA 3QYGB 3F70A 3WVDB 3GNGA 3G7ZA 1BI1A 2FZGB 1IO6A 5CCAA 4M7AG 3VU3C 1XQHA 2A28A 1E7OA 2RI3A 3JCMc 1VYTA 4FYVB 3UA7A 2E4HA 2NUZA 4JS4A 1NJIC 2X51A 1LOJA 4A4KA 1UECA 2RN8A 3SDZA 4M7DG 3REBB 1N5ZA 3CCLQ 1JJ2A 3RUXA 2IPOB 4D8KA 3H0HA 4X34A 3LWIA 2BZYA 1HD3A 2DFUA 2AIRB 4HXJA 4OB3B 3CCLA 1AZGB 1AOJA 3CCST 1KQ2A 1B34A 2X4JA 3KXTA 4JLGA 3EHRA 2DAQA 4ME7A 1K4US 2XDBA 4C5IA 1M2VA 4E7ZA 2DEQA 2LDMA 5ECAA 4NOYA 3CC7A 4RCBA 1VQKA 3L2ZA 4J6YA 4M78E 2B8AA 3META 4F17A 1SF9A 2CP0A 5IAYA 3J80E 5GAN8 5LJ5e 5GAOr 2CP6A 3L42A 2M0YA 3FLGA 4MDWA 2F2XA 2QQ9A 4XTXA 4C0DC 4J83A 1ABQA 1ZSZB 2RJEA 5GAN3 4C0FA 1NJIR 2V1QA 3OBYA 3A8LB 1ZSZC 2EYXA 4DQ2A 4M77E 1K8AU 3UDCA 4RTWA 4JRPA 4M7DB 4RTVA 3CBMA 4EDUA 4J5YA 1K9AA 3LYIA 2K2VA 4KUIA 3EGDB 3OS5A 4KRTA 1DJ7B 3I55A 1QKWA 1M90R 3RR6A 1U5SA 3CD6Q 5CVIA 2JN0A 5LJ5f 4BB7A 3V7RA 3QKJA 3SEMA 5KCHA 2YLBA 2CP5A 2EYWA 1WZOA 4QT7A 4E6RA 5CIUA 2MCNA 1JXMA 4BDYA 2XICA 2CUDA 2HL5C 2X3WD 1NG2A 2QK0A 4XQ3A 3CPWP 3CQTA 2F5KA 4M7AD 4JJNK 2ATCB 2RJDA 1PD0A 3NMZC 4C92G 1WHGA 2EKOA 1TH7A 2K7AA 4M75A 1D1BA 4M77G 1TTHB 3JB9I 3QUIA 1M2OA 1PG5B 5D7UA 3PIPA 4DOWA 3CCJQ 1FMVA 4FW2A 1VIFA 3EG9A 1T3LA 1YJNA 1QMCA 3VS0A 4OMQA 5GAOl 1WI7A 1M27C 4PFZA 4TVRA 2CZ7B 1WQ7A 1NLOC 3WXMB 2VXFA 4LDVA 1K73C 4J6WA 1M1GA 4JRKA 3VS4A 2ZCFB 4Z89A 1I1JA 1SEMA 4D6WA 1Q7YR 2JM9A 3OB9A 3CC7T 4GLKA 2DL5A 3UATA 2MIOA 5I2MA 4LDUA 4XU3A 4M78G 2EJ9A 4C8QD 1X2KA 2DL4A 4LDYA 5GAN2 2NWMA 3CMAQ 3OYDA 1PHTA 3TEEA 1HK9A 2E5KA 2E3IA 2KBTA 3EG1A 2OTJQ 3JB9G 4F14A 1Q7YC 2PNIA 5KYNA 5IXFA 5LL6S 2ED1A 1MNDA 1WHKA 1HXDA 4Z8AA 2YRDA 2K3XA 1HJDA 1JU5C 4B6MA 2O01E 2QXFA 2LNHB 3G71A 1SSHA 1WJQA 5LJ3e 2RK2A 4HVVA 3G4SQ 4JRIA 2VC8A 1KQSS 5D6YA 1UHFA 5IT9E 1MHNA 1T0JA 4FCYA 3HHTB 1K73U 2GGRA 5LJ3g 1OI1A 1WIEA 3BDLA 3FB9A 3PE0A 1D0YA 4F7UB 1Q86C 3ZEHA 2LQ8A 4J9HA 1JBMA 4BUGA 4ANJA 4KULA 2DILA 3CCVT 4M77A 2FRWA 1YJWT 3CCVA 3OSVA 1WFWA 1K8AC 4B9XA 3OYMA 2JM8A 2FZKB 2W0ZA 5CQYA 3OYGA 1KD1U 1TU0B 2DZCA 7AT1B 5GAOm 4RTXA 1A0NB 3H41A 4PJOG 2JZ2A 2RNAA 3QHSA 2O4XA 1FMWA 3VUZA 4LXCA 3CMAA 3CPFA 4EMHA 3M55A 2DRMA 1X2QA 5FRMA 1ZUUA 1JJ2S 2JW4A 5FU7C 4BD3A 2HSEB 4RG8A 3CCUT 1RAHB 2KXCA 1UJYA 1YWPA 2CYZB 3MP8A 3DB3A 3VUBA 4F16A 4M7DE 3EFOB 2J06A 1BYMA 3JCMb 1CKAA 2RQUA 4E7JA 1OPLA 3LWHA 1YI2Q 3VS3A 3CCJA 2QGGA 3CD6A 2J6OA 1ZSZA 2DXUA 3CD6T 2KAFA 3QWYA 2HQXA 4XTVA 2CP2A 4E7IA 5CKHA 5IN1A 1U06A 1G83A 3A8OB 1QCNA 1VQMQ 1N9RA 3M0SA 4J9CA 1KD1C 2LRQA 1WA7A 4CRIA 1YJNQ 5I22A 2J7IA 1G8XA 1OX9A 3A98A 4EPCA 1PCXA 3CEYA 2COZA 1KQ1A 3PNWC 3QO3A 2EAYA 2M0OA 2P0KA 3OS2A 5LJ5g 3OYYA 1KG1A 5HK0A 1C0MA 1AWWA 1W2BA 1TUGB 4J9IA 5HK3A 2RHIA 4IUPA 2Z0WA 2KNBB 4ZTJA 4LDWA 4FYWB 2GF7A 2VWFA 6AT1B 1RAGB 2KXDA 4OMPA 1MGQA 3BE3A 3LLRA 1X75C 4ZN3A 3QWXX 1VA7A 2A08A 4X9CA 3QDRB 3C95A 2NLUA 1X01A 2ENMA 1YN8A 1X6OA 1Q86R 1VQ9Q 4DEYA 1BCMA 5DY9A 1IREB 1ZQ1A 4DEXA 4OB1B 1FMKA 2HBPA 1OEBA 1UGQB 1Y71A 4XU1A 3EG9B 4N4IA 1G3YA 3OYKA 1AWOA 4A54A 1N8RU 1VQ4Q 3VS6A 2QEXA 4C0ZA 2YRVA 3QZ9B 5LJ3d 3CCEQ 3M59A 2LNVA 2LJ0A 4C92F 5GANf 1V1CA 1EIFA 2L2PA 4RG2A 2I2LA 2DF6A 2KR3A 5C6SA 2JUFA 1D1CA 1E6GA 3G71T 4M4ZA 1D3BB 2DO3A 4PLLA 5FWCA 1M2VB 1QVPA 1RADB 1K9MR 1EZZB 4GY5A 3AHUA 3VYGA 5A0GA 2DVEA 2VGNA 2ECZA 4ELYC 1PRLC 1WXTA 1ZSGA 2K79A 4M7DD 3OYEA 3QXEB 1VQOT 2E70A 3OYLA 3EGXA 5FU7B 2LX7A 1X6BA 2F69A 3G6ET 1I8FA 3ZL7C 2EW3A 3VRYA 2CS7A 1VQLT 4OMOA 5GAOp 4Z02A 1VQ4A 3VS5A 1K9MU 3CCSA 3CCLT 1G3WA 3MHXA 5GANd 1WDXA 1UDLA 2DTOA 5FU6C 1WYXA 3OW2A 3FIFA 2XHCA 1QWEA 2NYSA 4QVDA 4F7UG 3FJ5A 1M30A 2QQRA 3JB9F 3CCET 2MF2A 1Y57A 5IHKA 2RQVA 3CC4Q 1W70A 2HNIA 5J3BA 1NPRA 3L1AA 2NUPB 5GAOn 5GANj 5GAOq 3N5BB 1YJ9A 3QYHB 2ESWA 2HQEA 2KRMA 1YJWQ 1VQOQ 1I5LA 1QVGA 5GMKm 4M7DF 4FSSA 2OX7A 5FLXE 3G4SA 2DM1A 1ZBXA 1MMNA 4IKFA 2FYKA 2E3HA 4PJJA 3ZBDA 1GBRA 1BBZA 1ACMB 3C4SA 5GAN7 1XNIA 3OA6A 1SPKA 3UWNA 3NTHA 2K6DA 4ATOA 2YHTA 8ATCB 1UFFA 2DXCA 1D0ZA 2DRKA 1YP5A 5GANh 1GCQC 2QAZA 3EH2A 1QVFP 4J8OA 1M3AA 3X20B 1S72A 2COWA 3CCMT 3M57A 1UGRB 1WHMA 4M77D 3I5SA 2DMOA 1U8RA 4C0DB 1OU8A 5L23A 1N8RC 4RTZA 3JRZA 5A0LA 1LJOA 4NS5A 1NE8A 4N4GA 3CCEA 2HEQA 4M78A 2A0FB 2VVKA 2RHYA 2JOYA 4E47A 1YHQT 1TS9A 2JT4A 2MYSA 5LJ3j 3V8JA 1VQKT 2R57A 1RI9A 3DKMA 2OTLT 5LJ3h 4HT8A 2BE9B 2RI2A 1BB9A 3RKWA 1KC8U 3I56Q 4AT1B 2EQUA 1JRIA 3UT1A 4OMFB 4C8QA 4EMKA 4AMCA 1RAFB 2PU9B 2F2VA 2RJCA 4A4GA 2F1LA 3G1JA 3CCVQ 1K9MC 2C06A 3QIIA 3IQLA 4F7UE 3M9QA 4KGZB 5FW9A 4X9DA 4BE0A 4C5GA 2E5QA 1FWZA 5I11A 3CBOA 3L2QA 3M58A 2CDTA 3VS7A 1YIJQ 2O88A 3E1SA 2M02A 2MI6A 2RI5A 2K57A 1Q95G 1FXXA 2IIMA 1KC8C 1YI2T 2X4WA 1G5VA 4PJLA 4PNOA 1W2BS 2JS0A 4RTUA 2MWPA 2QDYB 4ZNXA 1Q82R 1I07A 3V8KA 4M7AA 4WF2A 4C8QG 1W2BP 4R55A 3H8ZA 1MMGA 3OSSC 1RACB 2MAMA 1HSQA 2PVGB 1UG1A 1N27A 4RTTA 2LMJA 4IUQA 3EHQA 2EKHA 1H92A 2SRCA 3INZA 1VQ5Q 2LX9A 3OS0A 3M0TA 1Y7XA 1OYXA 2CP3A 2J05A 1VQKQ 3A8HB 2SEMA 3MEWA 4FM4B 1O75A 3QSUA 4PKCC 1VQLA 1LCKA 5GMKl 5GAN4 2EGCA 1NBEB 2MOXA 3KBGA 1JXOA 3OMCA 1UB4A 3L2RA 1VQ9T 4AFUC 1QVGP 2VXEA 4FU6A 1ZA1B 2L8DA 3CXCS 1D1AA 3RDVA 3M5AA 2P0QA 2KRSA 1SHFA 2A37A 2D8HA 2P84A 5KE3A 1Q81C 4J7IA 5GAN5 1Q82C 5IXBA 3JCMe 3P8BB 2OJ2A 2PZ1A 1EFNA 1MV0B 1YIJA 1H3HA 4C92B 5GJWB 2LC4A 1YIJT 2EPDA 4M77F 3R6OA 1NM7A 2AT1B 3HL8A 3CCUQ 4BI8B 2JXBA 2FEIA 1IHWA 5M9OA 4BDZA 4KT0E 2FZCB 2D8JA 2RHZA 2QDLA 2MWOA 3VV0A 4JZ3A 5L8RE 5GAN6 4FYYB 2QYZA 4F7UF 3BW1A 3X24B 2GFUA 4ZN1A 2C0IA 2FRYA 2BE7D 2CH4W 2CSQA 2DE0X 2PUKB 1ZUKA 3JCMh 1VYVA 4PJOC 2X4XA 2O4XB 2ROLA 2ED0A 2FPEA 3QJYA 1E6HA 3X28B 4GBQA 3OYAA 2M1HA 1RAIB 1M1KU 1B07A 1V29B 1LPLA 2EBPA 4OP0A 3UF4A 5LJ3f 2QA4T 2RH2A 1BI0A 1O9SA 3PFSA 1IGQA 4KBMB 2DXBA 3EFSA 1K73R 3CXCP 2MMPA 1M90U 4OGCA 2O9SA 4HVWA 2OAWA 2COYA 2X9HA 2L3SA 2E65A 2LJ3A 4RMOA 3OYBA 1M3BA 2W10A 1VQLQ 4C5EA 2QQAA 2Y90A 1T3SA 4J9GA 3ME9A 3O5ZA 3G6EQ 3JCMJ 1IGUA 1Y96A 4CC7A 1GFCA 2KYMA 3HTRA 1RAEB 3CCRT 1OOTA 1PM3A 2D0NA 3VS2A 4ZGJB 3VJPA 1AWJA 2J6FA 4IUUA 1VQ8Q 1UJ0A 2LT4A 3REAB 2DNUA 1NEBA
chains in the Genus database with same CATH topology
1NPPA 1Q86U 1R8OB 1EIFA 1N9SA 2P0PA 4P5NA 3OBWA 5GMKi 4XU0A 4RG2A 1S72T 1YI2A 1VQOA 1PSFA 2I2LA 1VQ5A 3URGA 2V8KA 1VQPA 1M8VA 5C6SA 3LGLA 2JUFA 2PUOB 1YITA 1VQ5T 1M5Q1 3DLLA 4FT2A 3G71T 3CC2A 4PJOF 1D3BB 1YITT 4JRQA 3JB9H 3QYGB 2GQVA 2DO3A 4PLLA 3JCMX 1QVPA 3F70A 3NFCA 5CKFA 3WVDB 3GNGA 4L6V5 4GY5A 3AHUA 2K5LA 3G7ZA 5GAMd 1BI1A 1QW1A 4DA4A 1PSEA 2KDSA 3VYGA 5CCAA 4M7AG 3VU3C 2LT1A 5A0GA 4E7KA 4II1A 1XQHA 2DVEA 2JVVA 2VGNA 2ZPHB 5KCOA 4ELYC 3CCJT 1M4ZA 4M7DD 1WGSA 3S3MA 2RI3A 3HP9A 3JCMc 2EQJA 2VV5A 3MO8A 3OYEA 3QXEB 1VQOT 1NJIC 1BIBA 3DB4A 2EJGA 2E70A 3HPWA 4JS4A 1LOJA 3OYLA 2D0QB 2E1HA 4A4KA 3OYHA 3I56A 2BUDA 5FU7B 3SDZA 2F69A 4M7DG 3G6ET 2EQMA 1I8FA 4RCCA 5I21A 4HA8A 5GANe 2G3RA 3ZFJA 2CS7A 3HFNA 1JJ2A 2L3RA 1QP3A 5J26A 3RUXA 2CZ1B 3RIRA 1VQLT 2Y4YA 4X34A 5GAOp 4Z02A 3LWIA 2IVWA 3OA6A 3GLXA 2JTFA 1VQ4A 3TREA 5DM7R 1K9MU 4OB3B 3WVEB 2KQWA 3CCSA 2X35A 3X25B 3S3NA 3CCLA 4LD6A 2VUBA 3CCLT 1G3WA 2H3JA 3MHXA 3CCST 1KQ2A 1B34A 5GANd 2X4JA 2DTOA 2XKOC 4JLGA 4OF1A 5FU6C 3KXTA 3OW2A 3FIFA 2DAQA 4ME7A 2XHCA 3H6ZA 2EFIA 2XDBA 2PVOB 2BIVA 4C5IA 3V7CA 4FSXA 3SWNB 4F7UG 4QVDA 1VQ8A 2DEQA 2QQRA 3RMSA 3JB9F 2BKDN 1QVGS 2LDMA 2RB6A 2K5IA 2MF2A 3CCET 1IZ6A 4NOYA 3CC7A 4JUVA 2EQKA 4RCBA 3FC3A 3G4ST 1VQKA 4HCCA 3E9GA 2HNIA 3L2ZA 4UC4A 4J6YA 4M78E 2B8AA 1VQMA 1VQ6T 5J3BA 1NPRA 3PMIA 1ZHIA 3L1AA 3META 5DLQE 3CBPA 5IAYA 5GAOn 2XG8D 2QI2A 4O5VA 5GAOq 2QA4A 3N5BB 1M1FA 3UPUA 5GANj 3J80E 2LCCA 1QVFA 5GAN8 1YJ9A 3QYHB 2CKKA 5LJ5e 2K4YA 5GAOr 2CZ0B 3L42A 5D6XA 3I55T 3FLGA 2HQEA 4MDWA 3JB9J 2QQ9A 4XTXA 4C0DC 3OMGA 4J83A 2RJEA 5GAN3 5GAMh 3JCMf 3CPWS 4C0FA 1BIAA 4PJOE 1WJRA 1I5LA 3OBYA 2XD0A 1QVGA 3A8LB 4DQ2A 1VQNA 3GOXA 4M77E 5GMKm 4M7DF 1K8AU 2PVDB 3UDCA 2HD0A 5FLXE 3G4SA 4JRPA 4PJOA 4M7DB 4N4HA 2KY9A 5LJ5d 3DLMA 3CBMA 4EDUA 1U1SA 1RI0A 1ZBXA 2R58A 4J5YA 3MP1A 3CC2T 3QG1A 1OZ3A 3LYIA 3X26B 5GMKe 2JNGA 4IKFA 2K2VA 4KUIA 4C8QE 2FYKA 3OS5A 3ZBDA 2OTLA 2ZGWA 3JSCA 1DJ7B 2EIFA 3C4SA 3I55A 5GAN7 2DK3A 2RHXA 1W4SA 4ELZC 4NL3A 1XNIA 2FHDA 4Y28E 2JN0A 3KUFA 2D9TA 5CVIA 5LJ5j 3LH0A 4XU2A 5FU6B 2XDDA 4J7FA 3UWNA 3NTHA 5LJ5f 4BB7A 3V7RA 4ATOA 2JTMA 3HRUA 3QKJA 2RO0A 2VYTA 3OW2S 2YHTA 4M75D 5KCHA 2YLBA 3Q1JA 2DXCA 5GANh 3QBYA 3CMEA 3MP6A 5CIUA 4BDYA 4A53A 3RKXA 5GANg 2HAXA 2XICA 4V2SA 4MDXA 2WSEE 2RD1A 2DZ9A 4J8OA 3X20B 1S72A 4C5HA 3CCMT 1D3BA 1Y07A 2RK1A 4XQ3A 2DIGA 3RESA 3M57A 1UGRB 5AYFA 3S6WA 3CCMA 2F5KA 5I2SA 4M7AD 1VQMT 1VQ6A 4JJNK 2RJDA 4M77D 3JCMQ 4HKEA 4J6XA 1Q82U 3BY7A 1U8RA 4C0DB 1N8RC 3LX7A 3OYCA 4C92G 2EKOA 3EAEA 3V7SA 1TH7A 1XOVA 4M75A 3JRZA 5A0LA 1LJOA 4M77G 4EMKC 3HRSA 3RMQA 3JB9I 3QUIA 2LVMA 4NS5A 1Q7YU 1NE8A 4N4GA 3CCEA 4M78A 3JAME 5C0MA 1YJWA 2DTHA 2RHYA 4DOWA 3PIPA 3GNFB 2JOYA 3PMTA 3OS1A 4E47A 1YHQT 1AHJB 1VIFA 4N0AC 1YJNT 5GAMg 5LJ5h 3ASKA 3J81E 1YJNA 1G3SA 5LJ3j 3V8JA 1UGSB 1VQKT 2R57A 2IG0A 5GAOl 3E19A 4LDXA 3DKMA 2OTLT 4M75G 5LJ3h 4HT8A 5CAIA 2E41A 2RI2A 4TVRA 2CZ7B 1WQ7A 2AHJB 2QQSA 4M78D 3WXMB 4O6JA 2K3YA 2VXFA 3RKWA 4LDVA 3GIBA 1KC8U 4QW2A 1K73C 1U1TA 2EQUA 1JRIA 2L5QA 4J6WA 3UT1A 2DD4A 1M1GA 3JCMd 3L2UA 3HFOA 4JRKA 4NL2A 4OMFB 3RKYA 3SFMA 1VQ9A 4A4EA 2A7YA 2ZCFB 4R56A 4FL6A 4C8QA 4EMKA 2FL7A 2KSSA 2PU9B 2EJFA 2RJCA 1VQ8T 4A4GA 4D6WA 5A2QE 3M4YA 3CCUA 4HT9A 4M7DC 1K9MC 2C06A 3QIIA 3L2VA 3OB9A 3GF5A 4RKUE 4F7UE 3M9QA 2RHUA 3CC7T 3FJPA 4C92C 4HCBA 2QEXT 2ZPEB 5CQXA 2WACA 4GLKA 4X9DA 4BE0A 5CK9A 4C5GA 4M7AE 2E5QA 3P8HA 3JCMg 5I2MA 4LDUA 2DXTA 4XU3A 4C0GA 1FWZA 4M78G 2EJ9A 3CBOA 4C8QD 3M58A 3L2QA 5GAN2 4LDYA 5CR2A 3OYJA 5CKEA 2OTJT 1YJ9T 3OYDA 3PGGA 3TEEA 3E1SA 1HK9A 3M53A 4L5GA 3SD4A 3JB9G 3M4GA 2MI6A 5D6WA 1Q7YC 3MCAB 2R5MA 2RI5A 2K57A 2E12A 1N6AA 1WPYA 1BI3A 3TCJA 4PLIA 4XTUA 3QPHA 1FXXA 1P92A 5EG2A 5LL6S 1KC8C 1G3TA 3M56A 3SWNC 1YI2T 4JDSA 2X4WA 3MEAA 3PT9A 1NZ9A 4DOVA 5KH6A 3CMET 1G5VA 1HXDA 1VQPT 4PNOA 3FEOA 2K3XA 3FDRA 1W2BS 4OB0B 3TU4K 3S3OA 5DLOA 4QQ6A 2O01E 2QXFA 2MWPA 2QDYB 3VYHB 3G71A 4BE1A 3CPWA 1WJQA 4N0AA 3CC4A 5GAMf 5LJ3e 2RK2A 3MEUA 3CC4T 3V8KA 4JRIA 2VC8A 1KQSS 5D6YA 3NTIA 4CI0C 4A4FA 4M7AA 2VGMA 4WF2A 5IT9E 3FRNA 4C8QG 1MHNA 4C92D 3OYIA 4PJOB 3QZ5B 3HHTB 1K73U 4R55A 3H8ZA 5LJ3g 1OI1A 1VQ4T 1GXIE 3BDLA 3OSSC 3V8LA 3FB9A 1RL2A 4F7UB 2MAMA 1Q86C 3ZEHA 2EYQA 2LQ8A 2PVGB 2F5TX 2YLCA 1JBMA 1N27A 4OVAA 2OAUA 4BUGA 2DIQA 4IUQA 4KULA 4C8QB 2ZPFB 3A8MB 3CCVT 4B9WA 3INZA 4M77A 3EFRA 5GAMj 2LX9A 3OS0A 4EMGA 1YJWT 3CCVA 1Y7XA 3OSVA 1OYXA 4XAXB 3M54A 1K8AC 4B9XA 3OYMA 3A8HB 5HKCA 5CQYA 3MEWA 1WNLA 3JB9D 4FM4B 1O75A 2A3LA 2PQWA 4PKCC 5GMKh 3OYGA 1VQLA 3QSUA 2X4YA 4MMLA 1KD1U 5GMKl 2DZCA 5GAN4 5GAOm 3HSBA 3LW5E 3KBGA 4MZMA 3OMCA 1UB4A 3L2RA 4PJOG 2JZ2A 1VQ9T 3QHSA 5CO7A 2O4XA 4M78C 1JB0E 2VXEA 4FU6A 5FROA 2KMTA 2Y4XA 4Q5WA 3VUZA 3CMAA 4QQDA 2L8DA 2WSFE 3CXCS 3CPFA 3M5AA 2XI9A 2P0QA 2XU8A 4M78B 1UGPB 4JLIA 4EMHA 4M7AF 3M55A 5KE3A 2GFAA 3QJ6A 4PL6A 5FRMA 1Q81C 3J7AF 1JJ2S 3OQ5A 1I4K1 4J7IA 5FU7C 4BD3A 5GAN5 1Q82C 4RG8A 2DJZA 1VIEA 2FB7A 3HKSA 4XTZA 3JCMe 3P8BB 3CCUT 3VKIA 1M1KC 3JCMW 3ER0A 3JCMV 1KHIA 2L89A 1KHCA 2ZPBB 1YIJA 2CYZB 2GCXA 3DB3A 3MP8A 4L59A 3VUBA 4C92B 4PJOD 4M7DE 2LC4A 1YIJT 2M9UA 2OTJA 1BYMA 4M77F 3JCMb 2EWNA 2RJFA 3R6OA 4E7JA 3HL8A 3LWHA 4M7DA 4BI8B 5CKBA 2DPPB 3CCJA 3CD6A 4HCZA 3A5ZB 4QQGA 4C8QC 3PTAA 4E7HA 5M9OA 2DXUA 3CD6T 4EMKB 2KAFA 5A0DA 5KE2A 4BDZA 2XDPA 2HQXA 4XTVA 4IUTA 4KT0E 4E7IA 5CKHA 5IN1A 2M16A 4ZGDB 4M7AB 3A8OB 2RHZA 2E64A 3A8GB 2V8IA 2KK4A 2MWOA 4KUDK 3VV0A 4LD9K 5L8RE 5GAN6 1N9RA 4M75F 5J39A 3OYNA 3OYFA 4BACA 4M75E 2WSCE 4F7UF 4M7AC 3BW1A 3X24B 2GFUA 4ZN1A 1M90C 1WQWA 1Q81U 4E7LA 1KD1C 2LRQA 5HY6A 4MMKA 4CRIA 5CKDA 4ZGEB 1FX7A 2LCLA 4EPCA 3O8VA 4BE2A 2ZZDA 4Y91A 2PUKB 4OGEA 2E10A 3JCMh 4MZTA 3CEYA 4MZPA 4PJOC 2RA2A 1KQ1A 1BI2A 2V8JA 2X4XA 2E6NA 3PNWC 2O4XB 2FVUA 4M75B 3QO3A 4XK8E 2EAYA 2M0OA 2P0KA 3OS2A 4OB2B 3L2WA 5LJ5g 3BDUA 3OYYA 1KG1A 5HK0A 3QJYA 4M75C 2P4TA 3CXCA 3I56T 2XIDA 3P8DA 1W2BA 3X28B 1QVFS 5GMKj 4BY6B 3G6EA 2QTXA 2RHIA 2M1HA 5HK3A 1LNXA 3OYAA 4IUPA 2DKGA 2DTIA 2ZPIB 5GAMe 4ZTJA 1M1KU 1V29B 4BY6C 4LDWA 1H641 2GF7A 3PIOA 3RERA 4M78F 4OP0A 2D6FA 5LJ3f 2QA4T 4BI4A 2RM4A 2RH2A 1BI0A 2ZPGB 1O9SA 4C92A 3OY9A 3CCRA 2LTOA 2KVQG 3PFSA 3C94A 1MGQA 4KBMB 2XK0A 2DXBA 3EFSA 4XTWA 1UEBA 4QVZA 3LLRA 2MMPA 1M90U 4OGCA 4VUBA 1X75C 4FT4A 4F7UA 4ZN3A 1OZ2A 2DD5A 1WJSA 4IUVA 3CCQA 1XTDA 4X9CA 1VQ7T 3QDRB 3C12A 3C95A 2NLUA 1X01A 3CCQT 1Y96B 3LGFA 3T9NA 1X6OA 4FIBA 3CMAT 2E65A 1BKBA 2CZ6B 5DY9A 1QP2A 1IREB 1ZQ1A 4IURA 4RMOA 1YHQA 4OB1B 2HBPA 4QVCA 1SSFA 4XTYA 3OYBA 3GPLA 4C5EA 2QQAA 1UGQB 1Y71A 2Y90A 1YBYA 3ME9A 4YTLA 3NTKA 4XU1A 4N4IA 4C8QF 3E9FA 3HRTA 1G3YA 3OYKA 2LQKA 4A54A 2R5AA 3JCMJ 1N8RU 1VUBA 1Y96A 2QEXA 3SWNA 4A4HA 4M77B 4C0ZA 3BFMA 4ZTFA 3GP8A 4JS5A 2YRVA 3QZ9B 1H3ZA 1M9SA 3JCMP 3CCRT 5FRNA 1VQ7A 4M77C 4BI3A 1KQSA 4ZGJB 1NJIU 3VJPA 1I81A 2K5FA 4IUUA 3MEVA 1B34B 3M59A 5LJ3d 1VQNT 2LNVA 1YCYA 2E6ZA 3SB2A 2LT4A 4C92E 2CGHA 4C92F 5GANf 2QQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C5G A;  2E5Q A;  4HCZ A;  3P8H A;  1OZ3 A;  3LYI A;  4QQG A;  4E7H A;  4IKF A;  5M9O A;  3L2Q A;  4RG2 A;  3OYJ A;  3OYD A;  5KE2 A;  4BDZ A;  2XDP A;  2HQX A;  3C4S A;  4IUT A;  3LGL A;  5C6S A;  4E7I A;  2RHX A;  3SD4 A;  5IN1 A;  2M16 A;  5D6W A;  1XNI A;  2FHD A;  2R5M A;  3OA6 A;  3KUF A;  2D9T A;  2RI5 A;  2RHZ A;  3LH0 A;  2MWO A;  3UWN A;  3NTH A;  4PLI A;  4BAC A;  5J39 A;  3QKJ A;  3OYN A;  2RO0 A;  2VYT A;  4PLL A;  3OYF A;  5KCH A;  3F70 A;  2GFU A;  2X4W A;  3MEA A;  4GY5 A;  1G5V A;  5KH6 A;  4E7L A;  2LRQ A;  3Q1J A;  3FEO A;  2K3X A;  3FDR A;  4CRI A;  3QBY A;  4E7K A;  3MP6 A;  4II1 A;  5CIU A;  4BDY A;  4QQ6 A;  3S3O A;  3O8V A;  2MWP A;  5KCO A;  4BE2 A;  4BE1 A;  1WJQ A;  3CEY A;  1WGS A;  3S3M A;  3MEU A;  2RI3 A;  2X4X A;  2E6N A;  2EQJ A;  2O4X B;  3MO8 A;  3PNW C;  3NTI A;  5D6Y A;  4A4F A;  4C5H A;  3DB4 A;  2M0O A;  2P0K A;  3OS2 A;  3OYL A;  1MHN A;  2DIG A;  3OYH A;  3OYI A;  3L2W A;  3S6W A;  2BUD A;  3H8Z A;  2F5K A;  1OI1 A;  3BDL A;  2RJD A;  2EQM A;  3P8D A;  3ZEH A;  3OYE A;  2RHI A;  2M1H A;  2G3R A;  3LX7 A;  3OYC A;  1N27 A;  4IUP A;  4OVA A;  3OYA A;  2DIQ A;  2L3R A;  2EKO A;  4IUQ A;  3EAE A;  5J26 A;  4ZTJ A;  2GF7 A;  4B9W A;  4X34 A;  4Z02 A;  2JTF A;  3OS0 A;  2LVM A;  1OYX A;  4NS5 A;  3S3N A;  2X35 A;  4N4G A;  4LD6 A;  4B9X A;  5C0M A;  3OY9 A;  3OYM A;  2LTO A;  3PFS A;  3MEW A;  2RHY A;  2XK0 A;  3PMT A;  2DAQ A;  2PQW A;  4QVZ A;  3LLR A;  3H6Z A;  3OS1 A;  3OYG A;  2EFI A;  2X4Y A;  2BIV A;  4C5I A;  3ASK A;  1OZ2 A;  2QQR A;  1WJS A;  4IUV A;  2BKD N;  2LDM A;  3OMC A;  2NLU A;  3L2R A;  2JZ2 A;  2R57 A;  2EQK A;  2IG0 A;  3LGF A;  3FC3 A;  2O4X A;  3E9G A;  4FU6 A;  4IUR A;  4UC4 A;  2RI2 A;  4Q5W A;  5FRO A;  2B8A A;  4QQD A;  1SSF A;  2QQS A;  2L8D A;  3PMI A;  3OYB A;  2K3Y A;  3MET A;  4C5E A;  4QW2 A;  5IAY A;  3ME9 A;  3NTK A;  2EQU A;  5KE3 A;  2GFA A;  3QJ6 A;  4PL6 A;  4N4I A;  2LCC A;  3UT1 A;  3E9F A;  3L2U A;  3OQ5 A;  5FRM A;  3OYK A;  4BD3 A;  2CKK A;  2R5A A;  3L42 A;  5D6X A;  4A4E A;  3FLG A;  2HQE A;  4FL6 A;  4A4H A;  4ZTF A;  3OMG A;  2RJE A;  2YRV A;  2RJC A;  4A4G A;  1H3Z A;  2L89 A;  1KHC A;  1WJR A;  4L59 A;  3MP8 A;  3DB3 A;  5FRN A;  3QII A;  3L2V A;  3OB9 A;  3GOX A;  3M9Q A;  2RHU A;  4IUU A;  2RJF A;  3MEV A;  4N4H A;  4E7J A;  3DLM A;  4EDU A;  1RI0 A;  2WAC A;  2R58 A;  4BE0 A;  3MP1 A; 
#chains in the Genus database with same CATH topology
 1NPP A;  3MPU B;  1Q86 U;  1R8O B;  1YIT Q;  1VQ6 Q;  4P5N A;  4XU0 A;  5EC7 A;  2V8K A;  3LGL A;  4GLM A;  3NHN A;  1M5Q 1;  2K3B A;  4PJO F;  4R0K A;  1CKB A;  3R6N A;  2HBW A;  3NFC A;  5CKF A;  2HL3 A;  1R0C B;  1TSF A;  2K5L A;  1QW1 A;  5KYW B;  4DA4 A;  4E7K A;  4II1 A;  2JVV A;  5KCO A;  1BK2 A;  3CCJ T;  1M4Z A;  3S3M A;  3MJX A;  3HP9 A;  3MO8 A;  2VV5 A;  4J9B A;  2LCS A;  3HPW A;  1QVG S;  2YUQ A;  2E1H A;  2BUD A;  5I21 A;  4RCC A;  4HA8 A;  2AZS A;  1KJW A;  3ZFJ A;  5FWB A;  3H0F A;  3HFN A;  3D7S B;  3QDF A;  2CZ1 B;  3RIR A;  2A36 A;  2IVW A;  2JTF A;  2CP7 A;  1VQ7 Q;  3X25 B;  4LD6 A;  2VUB A;  2K2M A;  2DLP A;  2XKO C;  4OF1 A;  2J6K A;  1MMD A;  2PVO B;  1VQ8 A;  4FSX A;  3SWN B;  2CRE A;  3RMS A;  2BKD N;  2RB6 A;  3G4S T;  4UC4 A;  5KYU A;  2XG8 D;  2QI2 A;  4O5V A;  4PJN A;  2QA4 A;  1QVF A;  1KD1 R;  2EYY A;  2CKK A;  1HYO A;  2CZ0 B;  5D6X A;  4KGV B;  3JCM f;  1BCO A;  1YWO A;  1MNE A;  1BIA A;  4PJO E;  1WJR A;  1RAA B;  2OTL Q;  1VQN A;  2O9V A;  3GOX A;  2HD0 A;  1JEG A;  4PJO A;  4N4H A;  5LJ5 d;  3DLM A;  2GTJ A;  3QG1 A;  1ABO A;  2YWW A;  5GMK e;  3I35 A;  1JO8 A;  1C6V X;  2EGA A;  2H8H A;  8AT1 B;  4FW1 A;  1WHJ A;  4KGX B;  1WHH A;  2EIF A;  1RUW A;  5GJV B;  3EG3 A;  2DK3 A;  1W4S A;  4ELZ C;  4NL3 A;  2FHD A;  5FU6 B;  2KYB A;  1IHV A;  2JTM A;  3HRU A;  2RO0 A;  4CC3 A;  1M3C A;  4RTY A;  1GRI A;  3Q1J A;  1I5O B;  4JJD A;  4OMN A;  1XJW B;  4ESR A;  4A53 A;  3RKX A;  5GAN g;  2HAX A;  4V2S A;  1X69 A;  4MDX A;  2WSE E;  2RD1 A;  1BU1 A;  2XMF A;  4C5H A;  1D3B A;  1Y07 A;  2RK1 A;  2DIG A;  3CCM A;  3JCM Q;  4E7S A;  4HKE A;  1Q82 U;  3BY7 A;  3PVL A;  1MUZ A;  2AK5 A;  4PFO A;  3LX7 A;  2C0T A;  3OYC A;  1XOV A;  2HDA A;  4EMK C;  2LVM A;  2FO0 A;  1Q7Y U;  3JAM E;  1KK7 A;  4PFP A;  3GNF B;  2PTK A;  3PMT A;  1AHJ B;  4N0A C;  4HCK A;  2DER A;  1YJN T;  5GAM g;  2DX1 A;  5LJ5 h;  4LUE A;  1UUE A;  3VRZ A;  1OUL A;  2KT1 A;  5IHN A;  1UGS B;  2IG0 A;  3E19 A;  5CAI A;  2E41 A;  2AHJ B;  2QQS A;  4O6J A;  1GCP A;  4QW2 A;  1TWB A;  2EQI A;  4LNP A;  3JCM d;  4NL2 A;  1VQ9 A;  1SKU B;  2DJQ A;  3SFM A;  3CC7 Q;  4A4E A;  1AT1 B;  4R56 A;  4FL6 A;  2DL3 A;  2FL7 A;  4D8D A;  2KSS A;  2EJF A;  1VQ8 T;  5A2Q E;  3CCU A;  3L2V A;  2HQH A;  2RHU A;  3FJP A;  4C92 C;  4HCB A;  2QEX T;  2ZPE B;  2WAC A;  2C0O A;  4M7A E;  3P8H A;  4C0G A;  1VQN Q;  5CR2 A;  2OTJ T;  1T0H A;  4L5G A;  3M4G A;  3MCA B;  1P92 A;  1X27 A;  1R0B G;  3SWN C;  5KYW A;  4JDS A;  3MEA A;  1NZ9 A;  3UA6 A;  4DOV A;  5KH6 A;  3CME T;  3FEO A;  1FYN A;  3TU4 K;  3S3O A;  5DLO A;  4QQ6 A;  5AT1 B;  3VYH B;  1WXB A;  3EGD A;  3CPW A;  3MEU A;  2BZ8 A;  3FRN A;  3OYI A;  4PJO B;  3QZ5 B;  1VQ4 T;  1GXI E;  2GBQ A;  2VKN A;  3V8L A;  2CUB A;  2RQR A;  2V1R A;  2EYQ A;  2ZAE A;  4OVA A;  2OAU A;  2DIQ A;  4C8Q B;  3TQ7 P;  1I0C A;  1ARK A;  2ZPF B;  3A8M B;  1W6X A;  2YUN A;  3EFR A;  5GAM j;  3JV3 A;  4LN2 A;  3JB9 D;  2A3L A;  2DL8 A;  2X4Y A;  4IIM A;  2VB6 A;  2YRC A;  3HSB A;  3LW5 E;  4MZM A;  1Z9Z A;  2RQW A;  5CO7 A;  1JB0 E;  4Q5W A;  2KMT A;  2Y4X A;  2CH4 A;  2AKK A;  2JTE A;  2XI9 A;  2M51 A;  4M7A F;  2GFA A;  3QJ6 A;  4PL6 A;  1I4K 1;  1YNZ A;  2KRO A;  2DJZ A;  1VIE A;  2KT8 A;  2FB7 A;  4XTZ A;  2YDL A;  3VKI A;  1MV3 A;  1PKS A;  3ER0 A;  4L59 A;  4PJO D;  1EX4 A;  5KYX A;  1SRL A;  2M9U A;  4JZ4 A;  1RAB B;  2OTJ A;  1VQP Q;  2DET A;  1M8M A;  3C0C A;  2DPP B;  4HCZ A;  3A5Z B;  4E7H A;  4EMK B;  3M0P A;  1PKT A;  3I5R A;  5KE2 A;  3EFO A;  2M16 A;  3M0Q A;  4ZGD B;  4WCI A;  4M7A B;  3I9Q A;  2E64 A;  1C1A A;  2KK4 A;  4BAC A;  5J39 A;  3EG2 A;  3OYN A;  3OYF A;  4M75 E;  1JJ2 P;  2DBK A;  4M7A C;  5KYU B;  1WQW A;  1B3Q A;  3MKD A;  1IRX A;  5HY6 A;  4MMK A;  5CKD A;  2I0N A;  2L3Q A;  1FX7 A;  2LCL A;  2CSI A;  2ZZD A;  4Y91 A;  4BE2 A;  2E10 A;  2EGE A;  2EYZ A;  4MZT A;  1KSW A;  2RA2 A;  2DA9 A;  2QTV A;  2V8J A;  2E6N A;  4K11 A;  2FVU A;  3GBQ A;  4XK8 E;  3EGU A;  2BTT A;  3L2W A;  3LH5 A;  3BDU A;  3CXC A;  3I56 T;  3P8D A;  1QVF S;  5GMK j;  3PVQ A;  3M0U A;  2V26 A;  4BY6 B;  1PWT A;  2ZPI B;  1QCO A;  1S1N A;  4BY6 C;  3PIO A;  1H64 1;  4E2F B;  3RER A;  3EH1 A;  4M78 F;  1KIK A;  2D6F A;  2RM4 A;  1UTI A;  2ZPG B;  1AVZ C;  2LTO A;  4OMM A;  4KH0 B;  2HMA A;  2XK0 A;  1OV3 A;  4XTW A;  2L0A A;  4A63 B;  1X43 A;  4FT4 A;  2DYB A;  2LQN A;  4F7U A;  1OZ2 A;  4IUV A;  1VQ7 T;  1XTD A;  2F2W A;  3LGF A;  4FIB A;  1YJ9 Q;  1BKB A;  2YUO A;  1QP2 A;  4IUR A;  1J3T A;  1PNJ A;  1SSF A;  4XTY A;  1QWF A;  1RLP C;  1TUC A;  1K1Z A;  4YTL A;  3NTK A;  2EVR A;  4C8Q F;  2LQK A;  2R5A A;  1VUB A;  1PC0 A;  1Q81 R;  3SWN A;  4A4H A;  1TG0 A;  3GP8 A;  4JS5 A;  2DEU A;  2LJ1 A;  1NLP C;  2DL7 A;  1VQ7 A;  1KQS A;  4DBH A;  1I81 A;  3H0I A;  3MEV A;  1B34 B;  1VQN T;  1YCY A;  4C92 E;  1PRM C;  3SB2 A;  2CGH A;  1D09 B;  1JQQ A;  3OBW A;  2KI7 A;  1S72 T;  1VQO A;  1PSF A;  1VQP A;  1M8V A;  2L3P A;  9ATC B;  3KFV A;  3TSW A;  3CC2 A;  1YIT T;  4JRQ A;  3JB9 H;  2GQV A;  2RMO A;  3JCM X;  4L6V 5;  4DBQ A;  5GAM d;  3CC2 Q;  1PSE A;  2KDS A;  2LT1 A;  3TVT A;  2ZPH B;  4QKU A;  1YFN A;  1WGS A;  4LUD A;  2EQJ A;  1BIB A;  3DB4 A;  2EJG A;  1GL5 A;  2LZ6 B;  2AKL A;  3OYH A;  2D0Q B;  3I56 A;  3AT1 B;  2EQM A;  5GAN e;  2G3R A;  3CCS Q;  3E2U A;  1SHG A;  2L3R A;  1QP3 A;  5J26 A;  1WX6 A;  2Y4Y A;  3GLX A;  4DBR A;  3TRE A;  5DM7 R;  2MK5 A;  1GBQ A;  3WVE B;  2KQW A;  2O31 A;  2X35 A;  3S3N A;  2H3J A;  1WXU A;  3H6Z A;  2EFI A;  1K0S A;  2BIV A;  4CC2 A;  3V7C A;  4EIK A;  4KH1 B;  1R77 A;  2K5I A;  1IZ6 A;  4JUV A;  2EQK A;  3FC3 A;  3TSZ A;  4HCC A;  3E9G A;  1U3O A;  4RUG A;  1VQM A;  1VQ6 T;  3PMI A;  1ZHI A;  5DLQ E;  3CBP A;  2NUT B;  3UPU A;  2O2O A;  1M1F A;  2LCC A;  2GQI A;  2DYI A;  2K4Y A;  3I55 T;  3JB9 J;  4HT9 A;  3OMG A;  5GAM h;  1NYF A;  3CPW S;  1G2B A;  2YXY A;  3NPF A;  1W1F A;  1LVK A;  2XD0 A;  3SHW A;  1PD1 A;  2PVD B;  1SG5 A;  2KY9 A;  1U1S A;  1RI0 A;  2R58 A;  3MP1 A;  3CC2 T;  1IXD A;  2GTO A;  2KRN A;  1OZ3 A;  1QKX A;  3X26 B;  2JNG A;  4C8Q E;  2OTL A;  2ZGW A;  2JMC A;  2H3E B;  3JSC A;  2RHX A;  1WHL A;  4IIO A;  2QAS A;  4Y28 E;  3KUF A;  2D9T A;  5LJ5 j;  3LH0 A;  4XU2 A;  2XDD A;  4J7F A;  2VYT A;  3OW2 S;  4M75 D;  3RBB B;  4LE9 A;  3QBY A;  1ZA2 B;  3CME A;  3MP6 A;  1GFD A;  4J9D A;  1F1B B;  1NYG A;  2DZ9 A;  2YUP A;  3CCQ Q;  1OQK A;  3RES A;  1KFZ A;  3S6W A;  5AYF A;  5I2S A;  1VQM T;  1VQ6 A;  4J6X A;  2HSP A;  5IH2 A;  3EAE A;  3V7S A;  3HRS A;  3RMQ A;  3CCM Q;  5C0M A;  1YJW A;  2DTH A;  2RPN A;  2ABL A;  1M1K R;  3OS1 A;  1VOM A;  1OX8 A;  3ASK A;  3CME Q;  1K8A R;  3J81 E;  1WLP B;  1G3S A;  3I55 Q;  4LDX A;  4M75 G;  5KYY B;  4M78 D;  2K3Y A;  4CC4 B;  3GIB A;  2ROT A;  1OU9 A;  1U1T A;  4PK4 A;  2L5Q A;  3L2U A;  2DD4 A;  3HFO A;  3OW2 P;  3RKY A;  1KQS P;  2A7Y A;  2KEA A;  3M4Y A;  4M7D C;  3GF5 A;  1TUD A;  4RKU E;  2AZV A;  2CT3 A;  3RNJ A;  4HVU A;  5CQX A;  5CK9 A;  2JJ9 A;  2QEX Q;  3JCM g;  2DXT A;  3OYJ A;  1VYU A;  5CKE A;  1TOV A;  1YJ9 T;  3PGG A;  4AFS C;  2HKN A;  3M53 A;  3SD4 A;  5D6W A;  2R5M A;  2FG0 A;  2E12 A;  1N6A A;  1WPY A;  1BI3 A;  3TCJ A;  4PLI A;  4XTU A;  3QPH A;  5EG2 A;  1YCS B;  1ZLM A;  1G3T A;  2NUP A;  1ZBJ A;  3M56 A;  3PT9 A;  1VQP T;  3FDR A;  2D1X A;  4OB0 B;  2JMA A;  2VAS A;  2HZY A;  2QGF B;  4BE1 A;  3CC4 A;  4N0A A;  5GAM f;  3CC4 T;  3NTI A;  4CI0 C;  4A4F A;  2VGM A;  4C92 D;  1UHC A;  4DBF A;  2QG9 B;  1RL2 A;  2F5T X;  2YLC A;  4B9W A;  4EMG A;  3NGP A;  1Z9Q A;  2KE9 A;  4XAX B;  3M54 A;  5HKC A;  4AFZ C;  1WNL A;  2X3X D;  2P4R A;  2PQW A;  5GMK h;  4MML A;  1YHQ Q;  2YT6 A;  1GCQ A;  2DVJ A;  4M78 C;  3U23 A;  5FRO A;  4QQD A;  2WSF E;  2RQT A;  2NUT A;  2XU8 A;  1TXQ A;  1UGP B;  4JLI A;  4M78 B;  3J7A F;  3OQ5 A;  1B7T A;  1K0X A;  3HKS A;  4AFQ C;  3A1P A;  1M1K C;  3JCM W;  1N8R R;  3JCM V;  1KHI A;  1QLY A;  1KHC A;  2L89 A;  2ZPB B;  2GCX A;  2CT4 A;  2EWN A;  2RJF A;  4ORZ A;  3EG0 A;  4M7D A;  5CKB A;  3H9N A;  4QQG A;  4C8Q C;  3PTA A;  4J9F A;  1AD5 A;  2DBM A;  5A0D A;  1ZUY A;  2MPX C;  2XDP A;  3M0R A;  4IUT A;  1X6G A;  1AWX A;  3A8G B;  2V8I A;  4KUD K;  4LD9 K;  2HCK A;  4M75 F;  2K9G A;  2WSC E;  1H8K A;  1AZE A;  1V76 A;  1M90 C;  1Q81 U;  4E7L A;  1Y0M A;  1CSK A;  2LP5 A;  4ZGE B;  3THK A;  3O8V A;  5IHI A;  4OGE A;  2FPD A;  4MZP A;  1BI2 A;  4M75 B;  4JPB W;  4OB2 B;  4FYX B;  4M75 C;  2P4T A;  2GNC A;  2XID A;  1SRM A;  1UE9 A;  3G6E A;  2B86 A;  2QTX A;  4Z88 A;  1LNX A;  1QCF A;  2RF0 A;  2DKG A;  2DTI A;  5GAM e;  1NEG A;  1S72 Q;  2LQW A;  4BI4 A;  2JS2 A;  4Y92 A;  2HKQ B;  4C92 A;  3OY9 A;  3CCR A;  2KVQ G;  4X1V A;  3C94 A;  3EGX B;  1UEB A;  4QVZ A;  1UGV A;  2OI3 A;  4VUB A;  1D0X A;  2QA4 Q;  2DD5 A;  1RLQ C;  1WJS A;  3CCQ A;  3C12 A;  3CCQ T;  1Y96 B;  4JJC A;  3T9N A;  3CMA T;  5KYY A;  2CZ6 B;  2YSQ A;  4AG2 C;  1YHQ A;  4J9E A;  3GPL A;  2G6F X;  4PJM A;  4QVC A;  1K76 A;  1IB8 A;  4WTO B;  1YBY A;  3E9F A;  3HRT A;  5HCK A;  4M77 B;  4ZTF A;  3BFM A;  4AG1 C;  1AEY A;  1MMA A;  1H3Z A;  1M9S A;  2KGT A;  3JCM P;  5FRN A;  4M77 C;  4BI3 A;  1NJI U;  2K5F A;  3VS1 A;  4F04 B;  3CCR Q;  1KC8 R;  4JJB A;  2E6Z A;  1ZX6 A;  2QQB A;  1N9S A;  2P0P A;  2BZX A;  5GMK i;  1YI2 A;  1OPK A;  2FPF A;  1VQ5 A;  3URG A;  3G71 Q;  1QQJ A;  2PUO B;  1YIT A;  5KYX B;  1VQ5 T;  3DLL A;  4FT2 A;  3ULR B;  4OML A;  3QYG B;  3F70 A;  3WVD B;  3GNG A;  3G7Z A;  1BI1 A;  2FZG B;  1IO6 A;  5CCA A;  4M7A G;  3VU3 C;  1XQH A;  2A28 A;  1E7O A;  2RI3 A;  3JCM c;  1VYT A;  4FYV B;  3UA7 A;  2E4H A;  2NUZ A;  4JS4 A;  1NJI C;  2X51 A;  1LOJ A;  4A4K A;  1UEC A;  2RN8 A;  3SDZ A;  4M7D G;  3REB B;  1N5Z A;  3CCL Q;  1JJ2 A;  3RUX A;  2IPO B;  4D8K A;  3H0H A;  4X34 A;  3LWI A;  2BZY A;  1HD3 A;  2DFU A;  2AIR B;  4HXJ A;  4OB3 B;  3CCL A;  1AZG B;  1AOJ A;  3CCS T;  1KQ2 A;  1B34 A;  2X4J A;  3KXT A;  4JLG A;  3EHR A;  2DAQ A;  4ME7 A;  1K4U S;  2XDB A;  4C5I A;  1M2V A;  4E7Z A;  2DEQ A;  2LDM A;  5ECA A;  4NOY A;  3CC7 A;  4RCB A;  1VQK A;  3L2Z A;  4J6Y A;  4M78 E;  2B8A A;  3MET A;  4F17 A;  1SF9 A;  2CP0 A;  5IAY A;  3J80 E;  5GAN 8;  5LJ5 e;  5GAO r;  2CP6 A;  3L42 A;  2M0Y A;  3FLG A;  4MDW A;  2F2X A;  2QQ9 A;  4XTX A;  4C0D C;  4J83 A;  1ABQ A;  1ZSZ B;  2RJE A;  5GAN 3;  4C0F A;  1NJI R;  2V1Q A;  3OBY A;  3A8L B;  1ZSZ C;  2EYX A;  4DQ2 A;  4M77 E;  1K8A U;  3UDC A;  4RTW A;  4JRP A;  4M7D B;  4RTV A;  3CBM A;  4EDU A;  4J5Y A;  1K9A A;  3LYI A;  2K2V A;  4KUI A;  3EGD B;  3OS5 A;  4KRT A;  1DJ7 B;  3I55 A;  1QKW A;  1M90 R;  3RR6 A;  1U5S A;  3CD6 Q;  5CVI A;  2JN0 A;  5LJ5 f;  4BB7 A;  3V7R A;  3QKJ A;  3SEM A;  5KCH A;  2YLB A;  2CP5 A;  2EYW A;  1WZO A;  4QT7 A;  4E6R A;  5CIU A;  2MCN A;  1JXM A;  4BDY A;  2XIC A;  2CUD A;  2HL5 C;  2X3W D;  1NG2 A;  2QK0 A;  4XQ3 A;  3CPW P;  3CQT A;  2F5K A;  4M7A D;  4JJN K;  2ATC B;  2RJD A;  1PD0 A;  3NMZ C;  4C92 G;  1WHG A;  2EKO A;  1TH7 A;  2K7A A;  4M75 A;  1D1B A;  4M77 G;  1TTH B;  3JB9 I;  3QUI A;  1M2O A;  1PG5 B;  5D7U A;  3PIP A;  4DOW A;  3CCJ Q;  1FMV A;  4FW2 A;  1VIF A;  3EG9 A;  1T3L A;  1YJN A;  1QMC A;  3VS0 A;  4OMQ A;  5GAO l;  1WI7 A;  1M27 C;  4PFZ A;  4TVR A;  2CZ7 B;  1WQ7 A;  1NLO C;  3WXM B;  2VXF A;  4LDV A;  1K73 C;  4J6W A;  1M1G A;  4JRK A;  3VS4 A;  2ZCF B;  4Z89 A;  1I1J A;  1SEM A;  4D6W A;  1Q7Y R;  2JM9 A;  3OB9 A;  3CC7 T;  4GLK A;  2DL5 A;  3UAT A;  2MIO A;  5I2M A;  4LDU A;  4XU3 A;  4M78 G;  2EJ9 A;  4C8Q D;  1X2K A;  2DL4 A;  4LDY A;  5GAN 2;  2NWM A;  3CMA Q;  3OYD A;  1PHT A;  3TEE A;  1HK9 A;  2E5K A;  2E3I A;  2KBT A;  3EG1 A;  2OTJ Q;  3JB9 G;  4F14 A;  1Q7Y C;  2PNI A;  5KYN A;  5IXF A;  5LL6 S;  2ED1 A;  1MND A;  1WHK A;  1HXD A;  4Z8A A;  2YRD A;  2K3X A;  1HJD A;  1JU5 C;  4B6M A;  2O01 E;  2QXF A;  2LNH B;  3G71 A;  1SSH A;  1WJQ A;  5LJ3 e;  2RK2 A;  4HVV A;  3G4S Q;  4JRI A;  2VC8 A;  1KQS S;  5D6Y A;  1UHF A;  5IT9 E;  1MHN A;  1T0J A;  4FCY A;  3HHT B;  1K73 U;  2GGR A;  5LJ3 g;  1OI1 A;  1WIE A;  3BDL A;  3FB9 A;  3PE0 A;  1D0Y A;  4F7U B;  1Q86 C;  3ZEH A;  2LQ8 A;  4J9H A;  1JBM A;  4BUG A;  4ANJ A;  4KUL A;  2DIL A;  3CCV T;  4M77 A;  2FRW A;  1YJW T;  3CCV A;  3OSV A;  1WFW A;  1K8A C;  4B9X A;  3OYM A;  2JM8 A;  2FZK B;  2W0Z A;  5CQY A;  3OYG A;  1KD1 U;  1TU0 B;  2DZC A;  7AT1 B;  5GAO m;  4RTX A;  1A0N B;  3H41 A;  4PJO G;  2JZ2 A;  2RNA A;  3QHS A;  2O4X A;  1FMW A;  3VUZ A;  4LXC A;  3CMA A;  3CPF A;  4EMH A;  3M55 A;  2DRM A;  1X2Q A;  5FRM A;  1ZUU A;  1JJ2 S;  2JW4 A;  5FU7 C;  4BD3 A;  2HSE B;  4RG8 A;  3CCU T;  1RAH B;  2KXC A;  1UJY A;  1YWP A;  2CYZ B;  3MP8 A;  3DB3 A;  3VUB A;  4F16 A;  4M7D E;  3EFO B;  2J06 A;  1BYM A;  3JCM b;  1CKA A;  2RQU A;  4E7J A;  1OPL A;  3LWH A;  1YI2 Q;  3VS3 A;  3CCJ A;  2QGG A;  3CD6 A;  2J6O A;  1ZSZ A;  2DXU A;  3CD6 T;  2KAF A;  3QWY A;  2HQX A;  4XTV A;  2CP2 A;  4E7I A;  5CKH A;  5IN1 A;  1U06 A;  1G83 A;  3A8O B;  1QCN A;  1VQM Q;  1N9R A;  3M0S A;  4J9C A;  1KD1 C;  2LRQ A;  1WA7 A;  4CRI A;  1YJN Q;  5I22 A;  2J7I A;  1G8X A;  1OX9 A;  3A98 A;  4EPC A;  1PCX A;  3CEY A;  2COZ A;  1KQ1 A;  3PNW C;  3QO3 A;  2EAY A;  2M0O A;  2P0K A;  3OS2 A;  5LJ5 g;  3OYY A;  1KG1 A;  5HK0 A;  1C0M A;  1AWW A;  1W2B A;  1TUG B;  4J9I A;  5HK3 A;  2RHI A;  4IUP A;  2Z0W A;  2KNB B;  4ZTJ A;  4LDW A;  4FYW B;  2GF7 A;  2VWF A;  6AT1 B;  1RAG B;  2KXD A;  4OMP A;  1MGQ A;  3BE3 A;  3LLR A;  1X75 C;  4ZN3 A;  3QWX X;  1VA7 A;  2A08 A;  4X9C A;  3QDR B;  3C95 A;  2NLU A;  1X01 A;  2ENM A;  1YN8 A;  1X6O A;  1Q86 R;  1VQ9 Q;  4DEY A;  1BCM A;  5DY9 A;  1IRE B;  1ZQ1 A;  4DEX A;  4OB1 B;  1FMK A;  2HBP A;  1OEB A;  1UGQ B;  1Y71 A;  4XU1 A;  3EG9 B;  4N4I A;  1G3Y A;  3OYK A;  1AWO A;  4A54 A;  1N8R U;  1VQ4 Q;  3VS6 A;  2QEX A;  4C0Z A;  2YRV A;  3QZ9 B;  5LJ3 d;  3CCE Q;  3M59 A;  2LNV A;  2LJ0 A;  4C92 F;  5GAN f;  1V1C A;  1EIF A;  2L2P A;  4RG2 A;  2I2L A;  2DF6 A;  2KR3 A;  5C6S A;  2JUF A;  1D1C A;  1E6G A;  3G71 T;  4M4Z A;  1D3B B;  2DO3 A;  4PLL A;  5FWC A;  1M2V B;  1QVP A;  1RAD B;  1K9M R;  1EZZ B;  4GY5 A;  3AHU A;  3VYG A;  5A0G A;  2DVE A;  2VGN A;  2ECZ A;  4ELY C;  1PRL C;  1WXT A;  1ZSG A;  2K79 A;  4M7D D;  3OYE A;  3QXE B;  1VQO T;  2E70 A;  3OYL A;  3EGX A;  5FU7 B;  2LX7 A;  1X6B A;  2F69 A;  3G6E T;  1I8F A;  3ZL7 C;  2EW3 A;  3VRY A;  2CS7 A;  1VQL T;  4OMO A;  5GAO p;  4Z02 A;  1VQ4 A;  3VS5 A;  1K9M U;  3CCS A;  3CCL T;  1G3W A;  3MHX A;  5GAN d;  1WDX A;  1UDL A;  2DTO A;  5FU6 C;  1WYX A;  3OW2 A;  3FIF A;  2XHC A;  1QWE A;  2NYS A;  4QVD A;  4F7U G;  3FJ5 A;  1M30 A;  2QQR A;  3JB9 F;  3CCE T;  2MF2 A;  1Y57 A;  5IHK A;  2RQV A;  3CC4 Q;  1W70 A;  2HNI A;  5J3B A;  1NPR A;  3L1A A;  2NUP B;  5GAO n;  5GAN j;  5GAO q;  3N5B B;  1YJ9 A;  3QYH B;  2ESW A;  2HQE A;  2KRM A;  1YJW Q;  1VQO Q;  1I5L A;  1QVG A;  5GMK m;  4M7D F;  4FSS A;  2OX7 A;  5FLX E;  3G4S A;  2DM1 A;  1ZBX A;  1MMN A;  4IKF A;  2FYK A;  2E3H A;  4PJJ A;  3ZBD A;  1GBR A;  1BBZ A;  1ACM B;  3C4S A;  5GAN 7;  1XNI A;  3OA6 A;  1SPK A;  3UWN A;  3NTH A;  2K6D A;  4ATO A;  2YHT A;  8ATC B;  1UFF A;  2DXC A;  1D0Z A;  2DRK A;  1YP5 A;  5GAN h;  1GCQ C;  2QAZ A;  3EH2 A;  1QVF P;  4J8O A;  1M3A A;  3X20 B;  1S72 A;  2COW A;  3CCM T;  3M57 A;  1UGR B;  1WHM A;  4M77 D;  3I5S A;  2DMO A;  1U8R A;  4C0D B;  1OU8 A;  5L23 A;  1N8R C;  4RTZ A;  3JRZ A;  5A0L A;  1LJO A;  4NS5 A;  1NE8 A;  4N4G A;  3CCE A;  2HEQ A;  4M78 A;  2A0F B;  2VVK A;  2RHY A;  2JOY A;  4E47 A;  1YHQ T;  1TS9 A;  2JT4 A;  2MYS A;  5LJ3 j;  3V8J A;  1VQK T;  2R57 A;  1RI9 A;  3DKM A;  2OTL T;  5LJ3 h;  4HT8 A;  2BE9 B;  2RI2 A;  1BB9 A;  3RKW A;  1KC8 U;  3I56 Q;  4AT1 B;  2EQU A;  1JRI A;  3UT1 A;  4OMF B;  4C8Q A;  4EMK A;  4AMC A;  1RAF B;  2PU9 B;  2F2V A;  2RJC A;  4A4G A;  2F1L A;  3G1J A;  3CCV Q;  1K9M C;  2C06 A;  3QII A;  3IQL A;  4F7U E;  3M9Q A;  4KGZ B;  5FW9 A;  4X9D A;  4BE0 A;  4C5G A;  2E5Q A;  1FWZ A;  5I11 A;  3CBO A;  3L2Q A;  3M58 A;  2CDT A;  3VS7 A;  1YIJ Q;  2O88 A;  3E1S A;  2M02 A;  2MI6 A;  2RI5 A;  2K57 A;  1Q95 G;  1FXX A;  2IIM A;  1KC8 C;  1YI2 T;  2X4W A;  1G5V A;  4PJL A;  4PNO A;  1W2B S;  2JS0 A;  4RTU A;  2MWP A;  2QDY B;  4ZNX A;  1Q82 R;  1I07 A;  3V8K A;  4M7A A;  4WF2 A;  4C8Q G;  1W2B P;  4R55 A;  3H8Z A;  1MMG A;  3OSS C;  1RAC B;  2MAM A;  1HSQ A;  2PVG B;  1UG1 A;  1N27 A;  4RTT A;  2LMJ A;  4IUQ A;  3EHQ A;  2EKH A;  1H92 A;  2SRC A;  3INZ A;  1VQ5 Q;  2LX9 A;  3OS0 A;  3M0T A;  1Y7X A;  1OYX A;  2CP3 A;  2J05 A;  1VQK Q;  3A8H B;  2SEM A;  3MEW A;  4FM4 B;  1O75 A;  3QSU A;  4PKC C;  1VQL A;  1LCK A;  5GMK l;  5GAN 4;  2EGC A;  1NBE B;  2MOX A;  3KBG A;  1JXO A;  3OMC A;  1UB4 A;  3L2R A;  1VQ9 T;  4AFU C;  1QVG P;  2VXE A;  4FU6 A;  1ZA1 B;  2L8D A;  3CXC S;  1D1A A;  3RDV A;  3M5A A;  2P0Q A;  2KRS A;  1SHF A;  2A37 A;  2D8H A;  2P84 A;  5KE3 A;  1Q81 C;  4J7I A;  5GAN 5;  1Q82 C;  5IXB A;  3JCM e;  3P8B B;  2OJ2 A;  2PZ1 A;  1EFN A;  1MV0 B;  1YIJ A;  1H3H A;  4C92 B;  5GJW B;  2LC4 A;  1YIJ T;  2EPD A;  4M77 F;  3R6O A;  1NM7 A;  2AT1 B;  3HL8 A;  3CCU Q;  4BI8 B;  2JXB A;  2FEI A;  1IHW A;  5M9O A;  4BDZ A;  4KT0 E;  2FZC B;  2D8J A;  2RHZ A;  2QDL A;  2MWO A;  3VV0 A;  4JZ3 A;  5L8R E;  5GAN 6;  4FYY B;  2QYZ A;  4F7U F;  3BW1 A;  3X24 B;  2GFU A;  4ZN1 A;  2C0I A;  2FRY A;  2BE7 D;  2CH4 W;  2CSQ A;  2DE0 X;  2PUK B;  1ZUK A;  3JCM h;  1VYV A;  4PJO C;  2X4X A;  2O4X B;  2ROL A;  2ED0 A;  2FPE A;  3QJY A;  1E6H A;  3X28 B;  4GBQ A;  3OYA A;  2M1H A;  1RAI B;  1M1K U;  1B07 A;  1V29 B;  1LPL A;  2EBP A;  4OP0 A;  3UF4 A;  5LJ3 f;  2QA4 T;  2RH2 A;  1BI0 A;  1O9S A;  3PFS A;  1IGQ A;  4KBM B;  2DXB A;  3EFS A;  1K73 R;  3CXC P;  2MMP A;  1M90 U;  4OGC A;  2O9S A;  4HVW A;  2OAW A;  2COY A;  2X9H A;  2L3S A;  2E65 A;  2LJ3 A;  4RMO A;  3OYB A;  1M3B A;  2W10 A;  1VQL Q;  4C5E A;  2QQA A;  2Y90 A;  1T3S A;  4J9G A;  3ME9 A;  3O5Z A;  3G6E Q;  3JCM J;  1IGU A;  1Y96 A;  4CC7 A;  1GFC A;  2KYM A;  3HTR A;  1RAE B;  3CCR T;  1OOT A;  1PM3 A;  2D0N A;  3VS2 A;  4ZGJ B;  3VJP A;  1AWJ A;  2J6F A;  4IUU A;  1VQ8 Q;  1UJ0 A;  2LT4 A;  3REA B;  2DNU A;  1NEB A; 
#chains in the Genus database with same CATH homology
 1NPP A;  1Q86 U;  1R8O B;  1EIF A;  1N9S A;  2P0P A;  4P5N A;  3OBW A;  5GMK i;  4XU0 A;  4RG2 A;  1S72 T;  1YI2 A;  1VQO A;  1PSF A;  2I2L A;  1VQ5 A;  3URG A;  2V8K A;  1VQP A;  1M8V A;  5C6S A;  3LGL A;  2JUF A;  2PUO B;  1YIT A;  1VQ5 T;  1M5Q 1;  3DLL A;  4FT2 A;  3G71 T;  3CC2 A;  4PJO F;  1D3B B;  1YIT T;  4JRQ A;  3JB9 H;  3QYG B;  2GQV A;  2DO3 A;  4PLL A;  3JCM X;  1QVP A;  3F70 A;  3NFC A;  5CKF A;  3WVD B;  3GNG A;  4L6V 5;  4GY5 A;  3AHU A;  2K5L A;  3G7Z A;  5GAM d;  1BI1 A;  1QW1 A;  4DA4 A;  1PSE A;  2KDS A;  3VYG A;  5CCA A;  4M7A G;  3VU3 C;  2LT1 A;  5A0G A;  4E7K A;  4II1 A;  1XQH A;  2DVE A;  2JVV A;  2VGN A;  2ZPH B;  5KCO A;  4ELY C;  3CCJ T;  1M4Z A;  4M7D D;  1WGS A;  3S3M A;  2RI3 A;  3HP9 A;  3JCM c;  2EQJ A;  2VV5 A;  3MO8 A;  3OYE A;  3QXE B;  1VQO T;  1NJI C;  1BIB A;  3DB4 A;  2EJG A;  2E70 A;  3HPW A;  4JS4 A;  1LOJ A;  3OYL A;  2D0Q B;  2E1H A;  4A4K A;  3OYH A;  3I56 A;  2BUD A;  5FU7 B;  3SDZ A;  2F69 A;  4M7D G;  3G6E T;  2EQM A;  1I8F A;  4RCC A;  5I21 A;  4HA8 A;  5GAN e;  2G3R A;  3ZFJ A;  2CS7 A;  3HFN A;  1JJ2 A;  2L3R A;  1QP3 A;  5J26 A;  3RUX A;  2CZ1 B;  3RIR A;  1VQL T;  2Y4Y A;  4X34 A;  5GAO p;  4Z02 A;  3LWI A;  2IVW A;  3OA6 A;  3GLX A;  2JTF A;  1VQ4 A;  3TRE A;  5DM7 R;  1K9M U;  4OB3 B;  3WVE B;  2KQW A;  3CCS A;  2X35 A;  3X25 B;  3S3N A;  3CCL A;  4LD6 A;  2VUB A;  3CCL T;  1G3W A;  2H3J A;  3MHX A;  3CCS T;  1KQ2 A;  1B34 A;  5GAN d;  2X4J A;  2DTO A;  2XKO C;  4JLG A;  4OF1 A;  5FU6 C;  3KXT A;  3OW2 A;  3FIF A;  2DAQ A;  4ME7 A;  2XHC A;  3H6Z A;  2EFI A;  2XDB A;  2PVO B;  2BIV A;  4C5I A;  3V7C A;  4FSX A;  3SWN B;  4F7U G;  4QVD A;  1VQ8 A;  2DEQ A;  2QQR A;  3RMS A;  3JB9 F;  2BKD N;  1QVG S;  2LDM A;  2RB6 A;  2K5I A;  2MF2 A;  3CCE T;  1IZ6 A;  4NOY A;  3CC7 A;  4JUV A;  2EQK A;  4RCB A;  3FC3 A;  3G4S T;  1VQK A;  4HCC A;  3E9G A;  2HNI A;  3L2Z A;  4UC4 A;  4J6Y A;  4M78 E;  2B8A A;  1VQM A;  1VQ6 T;  5J3B A;  1NPR A;  3PMI A;  1ZHI A;  3L1A A;  3MET A;  5DLQ E;  3CBP A;  5IAY A;  5GAO n;  2XG8 D;  2QI2 A;  4O5V A;  5GAO q;  2QA4 A;  3N5B B;  1M1F A;  3UPU A;  5GAN j;  3J80 E;  2LCC A;  1QVF A;  5GAN 8;  1YJ9 A;  3QYH B;  2CKK A;  5LJ5 e;  2K4Y A;  5GAO r;  2CZ0 B;  3L42 A;  5D6X A;  3I55 T;  3FLG A;  2HQE A;  4MDW A;  3JB9 J;  2QQ9 A;  4XTX A;  4C0D C;  3OMG A;  4J83 A;  2RJE A;  5GAN 3;  5GAM h;  3JCM f;  3CPW S;  4C0F A;  1BIA A;  4PJO E;  1WJR A;  1I5L A;  3OBY A;  2XD0 A;  1QVG A;  3A8L B;  4DQ2 A;  1VQN A;  3GOX A;  4M77 E;  5GMK m;  4M7D F;  1K8A U;  2PVD B;  3UDC A;  2HD0 A;  5FLX E;  3G4S A;  4JRP A;  4PJO A;  4M7D B;  4N4H A;  2KY9 A;  5LJ5 d;  3DLM A;  3CBM A;  4EDU A;  1U1S A;  1RI0 A;  1ZBX A;  2R58 A;  4J5Y A;  3MP1 A;  3CC2 T;  3QG1 A;  1OZ3 A;  3LYI A;  3X26 B;  5GMK e;  2JNG A;  4IKF A;  2K2V A;  4KUI A;  4C8Q E;  2FYK A;  3OS5 A;  3ZBD A;  2OTL A;  2ZGW A;  3JSC A;  1DJ7 B;  2EIF A;  3C4S A;  3I55 A;  5GAN 7;  2DK3 A;  2RHX A;  1W4S A;  4ELZ C;  4NL3 A;  1XNI A;  2FHD A;  4Y28 E;  2JN0 A;  3KUF A;  2D9T A;  5CVI A;  5LJ5 j;  3LH0 A;  4XU2 A;  5FU6 B;  2XDD A;  4J7F A;  3UWN A;  3NTH A;  5LJ5 f;  4BB7 A;  3V7R A;  4ATO A;  2JTM A;  3HRU A;  3QKJ A;  2RO0 A;  2VYT A;  3OW2 S;  2YHT A;  4M75 D;  5KCH A;  2YLB A;  3Q1J A;  2DXC A;  5GAN h;  3QBY A;  3CME A;  3MP6 A;  5CIU A;  4BDY A;  4A53 A;  3RKX A;  5GAN g;  2HAX A;  2XIC A;  4V2S A;  4MDX A;  2WSE E;  2RD1 A;  2DZ9 A;  4J8O A;  3X20 B;  1S72 A;  4C5H A;  3CCM T;  1D3B A;  1Y07 A;  2RK1 A;  4XQ3 A;  2DIG A;  3RES A;  3M57 A;  1UGR B;  5AYF A;  3S6W A;  3CCM A;  2F5K A;  5I2S A;  4M7A D;  1VQM T;  1VQ6 A;  4JJN K;  2RJD A;  4M77 D;  3JCM Q;  4HKE A;  4J6X A;  1Q82 U;  3BY7 A;  1U8R A;  4C0D B;  1N8R C;  3LX7 A;  3OYC A;  4C92 G;  2EKO A;  3EAE A;  3V7S A;  1TH7 A;  1XOV A;  4M75 A;  3JRZ A;  5A0L A;  1LJO A;  4M77 G;  4EMK C;  3HRS A;  3RMQ A;  3JB9 I;  3QUI A;  2LVM A;  4NS5 A;  1Q7Y U;  1NE8 A;  4N4G A;  3CCE A;  4M78 A;  3JAM E;  5C0M A;  1YJW A;  2DTH A;  2RHY A;  4DOW A;  3PIP A;  3GNF B;  2JOY A;  3PMT A;  3OS1 A;  4E47 A;  1YHQ T;  1AHJ B;  1VIF A;  4N0A C;  1YJN T;  5GAM g;  5LJ5 h;  3ASK A;  3J81 E;  1YJN A;  1G3S A;  5LJ3 j;  3V8J A;  1UGS B;  1VQK T;  2R57 A;  2IG0 A;  5GAO l;  3E19 A;  4LDX A;  3DKM A;  2OTL T;  4M75 G;  5LJ3 h;  4HT8 A;  5CAI A;  2E41 A;  2RI2 A;  4TVR A;  2CZ7 B;  1WQ7 A;  2AHJ B;  2QQS A;  4M78 D;  3WXM B;  4O6J A;  2K3Y A;  2VXF A;  3RKW A;  4LDV A;  3GIB A;  1KC8 U;  4QW2 A;  1K73 C;  1U1T A;  2EQU A;  1JRI A;  2L5Q A;  4J6W A;  3UT1 A;  2DD4 A;  1M1G A;  3JCM d;  3L2U A;  3HFO A;  4JRK A;  4NL2 A;  4OMF B;  3RKY A;  3SFM A;  1VQ9 A;  4A4E A;  2A7Y A;  2ZCF B;  4R56 A;  4FL6 A;  4C8Q A;  4EMK A;  2FL7 A;  2KSS A;  2PU9 B;  2EJF A;  2RJC A;  1VQ8 T;  4A4G A;  4D6W A;  5A2Q E;  3M4Y A;  3CCU A;  4HT9 A;  4M7D C;  1K9M C;  2C06 A;  3QII A;  3L2V A;  3OB9 A;  3GF5 A;  4RKU E;  4F7U E;  3M9Q A;  2RHU A;  3CC7 T;  3FJP A;  4C92 C;  4HCB A;  2QEX T;  2ZPE B;  5CQX A;  2WAC A;  4GLK A;  4X9D A;  4BE0 A;  5CK9 A;  4C5G A;  4M7A E;  2E5Q A;  3P8H A;  3JCM g;  5I2M A;  4LDU A;  2DXT A;  4XU3 A;  4C0G A;  1FWZ A;  4M78 G;  2EJ9 A;  3CBO A;  4C8Q D;  3M58 A;  3L2Q A;  5GAN 2;  4LDY A;  5CR2 A;  3OYJ A;  5CKE A;  2OTJ T;  1YJ9 T;  3OYD A;  3PGG A;  3TEE A;  3E1S A;  1HK9 A;  3M53 A;  4L5G A;  3SD4 A;  3JB9 G;  3M4G A;  2MI6 A;  5D6W A;  1Q7Y C;  3MCA B;  2R5M A;  2RI5 A;  2K57 A;  2E12 A;  1N6A A;  1WPY A;  1BI3 A;  3TCJ A;  4PLI A;  4XTU A;  3QPH A;  1FXX A;  1P92 A;  5EG2 A;  5LL6 S;  1KC8 C;  1G3T A;  3M56 A;  3SWN C;  1YI2 T;  4JDS A;  2X4W A;  3MEA A;  3PT9 A;  1NZ9 A;  4DOV A;  5KH6 A;  3CME T;  1G5V A;  1HXD A;  1VQP T;  4PNO A;  3FEO A;  2K3X A;  3FDR A;  1W2B S;  4OB0 B;  3TU4 K;  3S3O A;  5DLO A;  4QQ6 A;  2O01 E;  2QXF A;  2MWP A;  2QDY B;  3VYH B;  3G71 A;  4BE1 A;  3CPW A;  1WJQ A;  4N0A A;  3CC4 A;  5GAM f;  5LJ3 e;  2RK2 A;  3MEU A;  3CC4 T;  3V8K A;  4JRI A;  2VC8 A;  1KQS S;  5D6Y A;  3NTI A;  4CI0 C;  4A4F A;  4M7A A;  2VGM A;  4WF2 A;  5IT9 E;  3FRN A;  4C8Q G;  1MHN A;  4C92 D;  3OYI A;  4PJO B;  3QZ5 B;  3HHT B;  1K73 U;  4R55 A;  3H8Z A;  5LJ3 g;  1OI1 A;  1VQ4 T;  1GXI E;  3BDL A;  3OSS C;  3V8L A;  3FB9 A;  1RL2 A;  4F7U B;  2MAM A;  1Q86 C;  3ZEH A;  2EYQ A;  2LQ8 A;  2PVG B;  2F5T X;  2YLC A;  1JBM A;  1N27 A;  4OVA A;  2OAU A;  4BUG A;  2DIQ A;  4IUQ A;  4KUL A;  4C8Q B;  2ZPF B;  3A8M B;  3CCV T;  4B9W A;  3INZ A;  4M77 A;  3EFR A;  5GAM j;  2LX9 A;  3OS0 A;  4EMG A;  1YJW T;  3CCV A;  1Y7X A;  3OSV A;  1OYX A;  4XAX B;  3M54 A;  1K8A C;  4B9X A;  3OYM A;  3A8H B;  5HKC A;  5CQY A;  3MEW A;  1WNL A;  3JB9 D;  4FM4 B;  1O75 A;  2A3L A;  2PQW A;  4PKC C;  5GMK h;  3OYG A;  1VQL A;  3QSU A;  2X4Y A;  4MML A;  1KD1 U;  5GMK l;  2DZC A;  5GAN 4;  5GAO m;  3HSB A;  3LW5 E;  3KBG A;  4MZM A;  3OMC A;  1UB4 A;  3L2R A;  4PJO G;  2JZ2 A;  1VQ9 T;  3QHS A;  5CO7 A;  2O4X A;  4M78 C;  1JB0 E;  2VXE A;  4FU6 A;  5FRO A;  2KMT A;  2Y4X A;  4Q5W A;  3VUZ A;  3CMA A;  4QQD A;  2L8D A;  2WSF E;  3CXC S;  3CPF A;  3M5A A;  2XI9 A;  2P0Q A;  2XU8 A;  4M78 B;  1UGP B;  4JLI A;  4EMH A;  4M7A F;  3M55 A;  5KE3 A;  2GFA A;  3QJ6 A;  4PL6 A;  5FRM A;  1Q81 C;  3J7A F;  1JJ2 S;  3OQ5 A;  1I4K 1;  4J7I A;  5FU7 C;  4BD3 A;  5GAN 5;  1Q82 C;  4RG8 A;  2DJZ A;  1VIE A;  2FB7 A;  3HKS A;  4XTZ A;  3JCM e;  3P8B B;  3CCU T;  3VKI A;  1M1K C;  3JCM W;  3ER0 A;  3JCM V;  1KHI A;  2L89 A;  1KHC A;  2ZPB B;  1YIJ A;  2CYZ B;  2GCX A;  3DB3 A;  3MP8 A;  4L59 A;  3VUB A;  4C92 B;  4PJO D;  4M7D E;  2LC4 A;  1YIJ T;  2M9U A;  2OTJ A;  1BYM A;  4M77 F;  3JCM b;  2EWN A;  2RJF A;  3R6O A;  4E7J A;  3HL8 A;  3LWH A;  4M7D A;  4BI8 B;  5CKB A;  2DPP B;  3CCJ A;  3CD6 A;  4HCZ A;  3A5Z B;  4QQG A;  4C8Q C;  3PTA A;  4E7H A;  5M9O A;  2DXU A;  3CD6 T;  4EMK B;  2KAF A;  5A0D A;  5KE2 A;  4BDZ A;  2XDP A;  2HQX A;  4XTV A;  4IUT A;  4KT0 E;  4E7I A;  5CKH A;  5IN1 A;  2M16 A;  4ZGD B;  4M7A B;  3A8O B;  2RHZ A;  2E64 A;  3A8G B;  2V8I A;  2KK4 A;  2MWO A;  4KUD K;  3VV0 A;  4LD9 K;  5L8R E;  5GAN 6;  1N9R A;  4M75 F;  5J39 A;  3OYN A;  3OYF A;  4BAC A;  4M75 E;  2WSC E;  4F7U F;  4M7A C;  3BW1 A;  3X24 B;  2GFU A;  4ZN1 A;  1M90 C;  1WQW A;  1Q81 U;  4E7L A;  1KD1 C;  2LRQ A;  5HY6 A;  4MMK A;  4CRI A;  5CKD A;  4ZGE B;  1FX7 A;  2LCL A;  4EPC A;  3O8V A;  4BE2 A;  2ZZD A;  4Y91 A;  2PUK B;  4OGE A;  2E10 A;  3JCM h;  4MZT A;  3CEY A;  4MZP A;  4PJO C;  2RA2 A;  1KQ1 A;  1BI2 A;  2V8J A;  2X4X A;  2E6N A;  3PNW C;  2O4X B;  2FVU A;  4M75 B;  3QO3 A;  4XK8 E;  2EAY A;  2M0O A;  2P0K A;  3OS2 A;  4OB2 B;  3L2W A;  5LJ5 g;  3BDU A;  3OYY A;  1KG1 A;  5HK0 A;  3QJY A;  4M75 C;  2P4T A;  3CXC A;  3I56 T;  2XID A;  3P8D A;  1W2B A;  3X28 B;  1QVF S;  5GMK j;  4BY6 B;  3G6E A;  2QTX A;  2RHI A;  2M1H A;  5HK3 A;  1LNX A;  3OYA A;  4IUP A;  2DKG A;  2DTI A;  2ZPI B;  5GAM e;  4ZTJ A;  1M1K U;  1V29 B;  4BY6 C;  4LDW A;  1H64 1;  2GF7 A;  3PIO A;  3RER A;  4M78 F;  4OP0 A;  2D6F A;  5LJ3 f;  2QA4 T;  4BI4 A;  2RM4 A;  2RH2 A;  1BI0 A;  2ZPG B;  1O9S A;  4C92 A;  3OY9 A;  3CCR A;  2LTO A;  2KVQ G;  3PFS A;  3C94 A;  1MGQ A;  4KBM B;  2XK0 A;  2DXB A;  3EFS A;  4XTW A;  1UEB A;  4QVZ A;  3LLR A;  2MMP A;  1M90 U;  4OGC A;  4VUB A;  1X75 C;  4FT4 A;  4F7U A;  4ZN3 A;  1OZ2 A;  2DD5 A;  1WJS A;  4IUV A;  3CCQ A;  1XTD A;  4X9C A;  1VQ7 T;  3QDR B;  3C12 A;  3C95 A;  2NLU A;  1X01 A;  3CCQ T;  1Y96 B;  3LGF A;  3T9N A;  1X6O A;  4FIB A;  3CMA T;  2E65 A;  1BKB A;  2CZ6 B;  5DY9 A;  1QP2 A;  1IRE B;  1ZQ1 A;  4IUR A;  4RMO A;  1YHQ A;  4OB1 B;  2HBP A;  4QVC A;  1SSF A;  4XTY A;  3OYB A;  3GPL A;  4C5E A;  2QQA A;  1UGQ B;  1Y71 A;  2Y90 A;  1YBY A;  3ME9 A;  4YTL A;  3NTK A;  4XU1 A;  4N4I A;  4C8Q F;  3E9F A;  3HRT A;  1G3Y A;  3OYK A;  2LQK A;  4A54 A;  2R5A A;  3JCM J;  1N8R U;  1VUB A;  1Y96 A;  2QEX A;  3SWN A;  4A4H A;  4M77 B;  4C0Z A;  3BFM A;  4ZTF A;  3GP8 A;  4JS5 A;  2YRV A;  3QZ9 B;  1H3Z A;  1M9S A;  3JCM P;  3CCR T;  5FRN A;  1VQ7 A;  4M77 C;  4BI3 A;  1KQS A;  4ZGJ B;  1NJI U;  3VJP A;  1I81 A;  2K5F A;  4IUU A;  3MEV A;  1B34 B;  3M59 A;  5LJ3 d;  1VQN T;  2LNV A;  1YCY A;  2E6Z A;  3SB2 A;  2LT4 A;  4C92 E;  2CGH A;  4C92 F;  5GAN f;  2QQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...