4EDXA

Nerve growth factor in complex with fab from mouse mab 911
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNHLNWYQQKPDGTVKLLIYYISRFHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQSKTLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation of a high-fidelity antibody against nerve growth factor using library scanning mutagenesis and validation with structures of the initial and optimized Fab-antigen complexes.
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Beta-nerve growth factor
total genus 51
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2012-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4edxA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4edxA01
4JO2H 1R6VA 1L6ZA 4H88H 1RZ8B 1TQBC 3MBED 1SM3H 2BFVH 4O02H 3IYLW 3ARED 5D8JH 1YEGL 4POUB 3ABZA 4BYHA 1SEQH 4P57A 4TOYH 1BBJB 2ORBL 2B2XL 2XTJB 3PGCA 3PL6B 1AR1C 4JANB 1MFCH 3LKRB 1NFIB 1SYSA 2EDFA 2ZJSH 4OBRA 3WKML 1F97A 2W9EL 1KENL 3DLQR 2YC1B 3LD8B 1VEPA 5TDNB 1KN2H 1DN0B 3CFDA 4FTVB 1CDBA 3VG0H 2WBJB 3DWTA 3PDOB 5F3BA 5FGBA 1VEOA 5EC1A 2ZP0T 1J0IA 2L4OA 3VXNB 1JF5A 4Y5XC 1OAKH 3NFSL 1I85C 3MMEA 4KJYA 2FD6L 2QTEA 5B4MC 4IRZL 3SKUD 2GCYB 1Q38A 3HNSH 3QDAA 4U1SA 5E6YA 1T04A 5D6DA 3OKDB 1AQKH 5C0DA 1U91B 1A7OH 4O2EA 4P4KB 4FS0A 1YN7A 4OZHF 2FO1A 4GAJH 4U4BA 3OBAA 1B0WA 4IRJB 1EXUA 2EDJA 3NABH 2DLTA 1NLDH 4EUPB 3OXRA 1NANI 3B9KC 1LEGB 5IP4A 1OAKL 3NFSH 1AGFB 3IKCB 4NQDD 4IIQB 4U3CA 3X3FL 3MYJB 5JR1H 3VXSD 4G8EB 1HSAB 5DJCB 1QEWB 3HA0A 3TO4D 3QIWC 1YEJH 1RK0A 4JRXA 5FFLA 3THML 2VABA 3KPRD 3ULVD 4NNXB 4JAMA 1T7XA 4QRTA 2XIDA 3O4LB 3QUXC 4TNVF 2Z35A 1DQJB 3CX5J 5DJYA 2FO4B 4G3YL 1QR1B 1CI5A 4LCCB 2C3WA 5F7MC 4QXUL 4JGUA 1J1OL 4Y2DD 4CW1A 3QA3A 4UZGA 1XAUA 2OK0H 5B38A 3QPXL 4M9OA 4PJ5D 2R23B 2CGRH 1M4KA 3NIFF 2X1WL 3OR6B 4JR9H 1BFOA 3GSUB 4X9FA 1OPGL 3OKNA 1E4XH 3RWGA 5BV7B 1FL3A 4LSPL 1G7LA 2FATL 3NZ8A 4NHUA 1A22B 3V52H 1DCLA 1U8PA 2LAGB 1ONQA 3CGTA 3HC3L 4J8RB 5CKAA 3SDCB 3AREA 1QRNA 3AS1A 4UT9H 1OQXA 5ADPL 5J6HB 3STBA 5DWUH 1LO4H 1CVSC 2GY7B 1B0RA 1RK0B 3FTGA 4JRXB 1CS6A 3L3HA 4ZAKD 2I5YL 2Y25A 3BO8B 4TNWK 1RUAL 1KEMH 1RIVL 4WENB 4WO4D 1GSMA 4PTTA 5B39G 1OAZH 1FZOA 1RULL 4G6JH 3CZJA 1F2XK 1YNTB 4MAYB 1XEDA 2R15A 5D2NA 5IWLC 1NCWL 4ODTH 25C8L 5KSAA 4HV8A 1MJ8L 5KVGL 1EXUB 4KHXH 2NX5B 3MFGB 1WFTA 4R4NC 3V79C 4C56A 5IHZA 2BVQB 1KG0A 4B7LA 4YZFF 4XNUL 2OP4L 2ZUSA 1SEQL 4N0UE 2WINB 1NEZB 5C0BE 1NAKL 1BZ7B 2ADJB 4YHMH 5F9JB 4GKSA 4KI1A 3REVB 5JLZA 1BAFL 2ZCKH 2RBLA 2FEDC 2NPLX 2OR9H 3V4VH 1NGWA 3IFPB 4CAGA 5DFVD 4KTEL 4Z76B 4BH7B 5INDB 2R29L 1MREH 1N3NA 1R3JB 4MAUH 4NOFA 3RTQA 2WW8A 1UH3A 3HR5A 5FEBA 4PLJC 4MWFA 5DEGA 4OKVA 4F9PC 2HLFD 2MTPA 4LVHB 4M6OL 3WLBB 5D1XD 1B6UA 3ULUD 1OAUL 4XGZB 2OTUB 3WD5H 4KU1A 4I3RL 1OP3H 2XWTB 3O6FA 5D1ZC 4JFFB 5HYSA 1E28B 3PHQA 4I5BB 4NZDA 3SCMB 3KPPA 5M95B 4TNVK 5SV3A 3CVHB 3QEQE 1VSCA 3QNZA 3QBTB 4PRAA 3D39E 5KG9A 1RIHH 4Y5YB 4OB5L 4P3CL 1D6EA 3RIAK 3MOAH 3MV11 1NQBA 5F7KC 5T33L 3R1GH 1BVLB 2R0KH 4MAYD 4WI5A 5MEPB 3QZWA 3BWUC 3QUXB 3O3DA 2W9DL 1FZJB 3SGEH 1A6PA 1FNFA 3VD4A 3MRJA 3GZKA 3VW3L 4I3SL 4Q9CA 1P84K 3V0WL 3QDME 1OL0A 3K2UH 3RUGE 2P7TA 3JWDH 4F7EB 1G7HA 4Z7UE 1CDJA 3S34L 4B53A 5BO1L 5FCUL 4L4TB 1NBZB 4UOW0 3K8MA 1CGVA 4QO1A 3L1OH 1NMAH 2IAMD 5C1MB 3TN0B 4OZ4A 3VGHA 1QSED 2IBZX 5DD0L 3FB6A 1U8MB 2FX9L 3BMWA 3BUTA 1VGEL 1PY4A 2VDRL 3ZDXE 1UWEH 2PO6B 1MUJA 3I75A 4LPXA 2HVKA 1T3FA 1C5DB 2DF3A 2JB6A 3DXAD 1JZ4A 3L3HB 1FVDA 2DQHL 5IB2B 4CMHC 4H1LH 4NT6B 5CJQH 3R0MA 2A2QT 5EN2B 4MA1B 3AMKA 3TT1L 2NY4B 2ZOLB 5KJRH 4ZFZB 2W65B 2AK4E 2C4FT 2D4FA 4FP8H 3IXAB 4MAYC 5FO8A 3R8BB 3FFCB 5BZDA 5FYKU 5I1KH 5DHVB 4DN4L 5C08B 4ZDHA 2R23A 3EFDH 4DVRH 1I3UA 2AKRA 5I15L 2VLKD 2YKLH 1JI2A 3OKEB 2UY7A 3PQYB 4D0BA 4Z0BL 5TE7L 4FZ8H 5CBAA 1ZSDA 2PXYC 3SY0B 5GRJL 3ZTNH 1R5VB 1XCTB 2BVEA 3C8DA 5BXFA 2YD9A 2EZ0C 2YRLA 1YA5A 4RGNC 1JYWA 4L3CB 3S3PA 4PLKC 3KPNB 5CJBA 2FD6H 4MSWB 1H3XA 3UTZA 1QVOA 4OIIL 3Q1SH 2DM4A 4R90H 5DGRA 2HJKA 3T2PA 1JHTA 3HZKA 4X7TB 4XWOD 1U8NA 1A1MA 1G1CA 1AI1H 4UDTA 4IBLT 5FYJD 3RI5K 1A3LL 3V5HA 3MUZ1 4K9EL 1YQVH 4JN2B 5EZIL 3VXRE 3DYMA 1F4XH 5BW7C 5ITBH 1M7DA 1UQSB 2BHZA 1RJCA 3QXAB 3UBXG 5IOPA 1C7TA 3OKDA 5A2IH 3T0EB 2GJ6D 4BSJA 4P23A 4OUUA 3MLRH 5L2KE 3QEUA 1UQSA 1PG7H 2BRRL 1DZBA 4NSKA 3HI6H 2WBJA 4M7KL 3PDOA 4PJXF 4WWKA 3P73B 4NBZB 1HKLL 4CUCA 3MRDA 5T33H 1MLCA 1BFVL 4L8SC 2HN7B 4HJ0C 5HVGB 3VWKC 5TDNA 1RUML 2FJHA 3F65A 1AGEB 3G5YA 3KPOA 4AEFA 4QXWA 4Q9QL 3NIFE 4YFDB 3HKFA 4E42A 2ZUWA 3KHQA 3VWKD 1JPTH 4PJHA 2G9HA 1J8HA 5E1HB 1XF4B 2WBJD 4M1DL 5J56B 1ZVHA 2QQKH 2D0GA 4O51B 2CIKA 2MHAB 3B9KB 1ORSA 1MCIA 3VFTA 2NY3C 4RAHA 4XTRC 2NYYC 2BERA 3HS0B 5FB8B 4LVOC 2PYEB 3UYRL 3OR6A 2PNDA 5FO9B 4PRPE 1ZANH 4Y19E 4M1GL 4GAFB 5FM4A 4PRDB 4Y1AB 2AV1B 4KAQH 4UT6L 3QEGH 2ICWA 1N5YL 1UKTA 4NQEA 5JUEH 5DD5H 1H3PL 2WIIB 1WGOA 3O6ML 1U93B 1AR2A 4TNWF 4HGMA 3B43A 1MIML 4M93B 3L9RB 5EB9A 4N0RA 1I85A 5FGCB 3G6AA 1IRAY 1BIIA 1NGQH 3QUZC 1AKJD 3C60B 4LSSH 3JWOL 4KZDL 2X7LB 3KR3L 1NC4B 3NZ8B 4M48L 3BN9D 5CUSL 1OAYH 5D7JC 3CD4A 2A73A 1BX2B 3E2HB 3VXMA 3S88L 1ZMYA 3QEGL 1XF2B 2Q3AA 3IGAB 5KSAD 4N9GA 4D3CL 3QXTA 3MSPA 4ZPTA 4UTBL 3GSQB 3UAJD 1X5FA 1U3ZA 4U0QB 4PJ7B 3HUJA 1O7SA 4HUMB 3FQXB 3H9ZA 3M17A 3X14A 3CFEA 4NQXB 4XCCH 1JWUA 1ZGLP 4LPYA 5H2BA 4QRQA 3TCLA 4LSSL 2VLMD 4TSCH 1OTUC 3RGHA 5EBGA 1HHGB 1OP5H 2ITCB 3O0RH 4PRHA 2DIBA 5J6GA 3SE8L 5E7BA 5DVLA 1AGBB 2ZUXA 4NQTA 1CFQA 4P49A 5ETUB 2IANA 1QR4A 1KACB 1S9YA 3MV8B 4GRLA 4S0SD 5CSZB 3Q3GB 3OAYK 2IANE 3EO1A 1FLRL 3L6FA 2PYFB 1AXSB 1G7JA 1AGDA 2A9ML 1MAML 4WJ5A 4EN3C 1YNKL 5T5NF 5J06A 4GAYB 4KV5E 3SCMA 3SE3C 4HFWA 1KB9J 2Z8SA 2NY5H 2XZCH 1JPTL 4P57B 2D31A 3V6BR 3UJTL 4NCC2 5MI0B 4GOSA 1PY9A 5EU4A 3MLRL 5IV2A 4HAGA 5FUZH 3Q0HA 1CLZH 3IJHB 1YMHA 4Z9KB 1WC7A 3HPJA 3ET9F 5C09E 5C0BD 2EYSB 1TVHB 1OQOA 2DQIL 4TQEL 4GSDL 1KLUA 4N0CD 3TJHD 3BEVB 5J6GB 5E03A 3I50H 3PG2A 1F6AA 2G5BB 5E2WL 3QG6A 1HHGA 3HN3A 2JCCE 2NTFA 4I0PA 5FCSH 1OOAA 1U92B 5D6CA 5M7QA 1ACZA 4QHMB 1IGML 2YA0A 1NCAH 4PJEE 4NGHL 3RWEB 4LK4A 3DV4A 4YIQA 4JHBA 3BPCB 5GPRA 1IC5L 5I9QB 2ZUQC 4LVOB 3MLVL 3DUUB 1U8IB 2DQIH 2WIMA 3T2OA 5ERWA 4ODHH 1MIEL 1BZ9B 2O5XL 4K23L 1ZT7A 5DJ8B 1S3KL 4U1NB 4YDIL 4NM8L 3GSVB 5I8CA 1MCRA 3O8XC 4HF5L 4Y4HC 1CIUA 1OAYL 4ZAKB 4XP9H 2AVGA 3RFZC 3U2SA 4N0FA 3MREA 3S34H 1HXYA 4Z5RA 1TJHH 4NQDA 1MCNA 2ZKHL 4LQFH 2A74B 4V1DD 3GFUA 3LQAH 1MHHA 4DFHA 4NKIL 4M7JH 3PIQB 3PNWA 2DLIA 3X3GL 5JDJA 1FORH 5BZDB 4LLMB 3T2NH 3VFGH 2GUOB 3ZTNL 1G1YA 4AIZB 3QUYA 1T03H 4UV7H 2YUVA 4ODSH 5LWYL 4RDQG 3DYOA 1PEWA 4YNYA 1DEEB 3UTQB 4GLRH 5FYLE 1IGFL 3ARFA 3O2WH 2NZIA 2DQHH 3GM8A 4UOJA 1CGSL 3T1WA 4P2OA 4NYLA 2KZ1B 5HSFA 3SGKA 4CMHB 1L7IH 1DEDA 2VAJA 2W0KA 2FZ3A 3ULVL 5F88B 1SBSL 3DRTA 4KRLB 5CZXC 3VXRA 3T08A 5I1DA 1J9CT 5IBUB 1ZWIB 1JGDA 2C4XA 3HAEG 3MJ7B 3FJTA 4BQBA 1FFOB 3RX7A 4U1NA 2BSSA 4FQHA 2X1QA 1DVFB 3TP4A 2ZCHH 3G5YB 3BE1L 3C2SA 1J87A 2H6PA 1RI8A 2C7UB 4X8JA 5KVMC 4P5MB 5HI4C 4IMLB 1CICD 5BRZA 1RZGB 32C2B 4X99A 5KVFL 5JHDB 2BRQA 4HG4J 1PG7L 2UWEF 1NJ9B 3PWUB 4PJEF 4NZJA 2UVEA 3IF1A 2W38A 3JVGC 4PD4K 3U0WL 4ZUTB 3ZDYE 4RISL 5HTSA 2AI0H 2WWKT 3ILQD 4IMKC 4DKFH 4NZUL 1T1XA 3RTQC 2XOTA 3U4BH 4JB9H 2UWEE 3DX6A 3VFUA 1A3LH 4HKXB 4DJMA 5D2LE 5F7UA 2Z92B 2NY5L 3JWDL 3C5SB 5DK0A 3D3VA 1UXWA 5DRWA 4GH7B 4NDMB 5J3HC 2I24N 1NGQL 1AO7A 2J6EL 5IW1B 2V2XA 4CVZB 2BY0A 3PWPE 3TNNA 3CSBA 4OKVB 3ROOA 5EO0A 2ED7A 1T4KB 3W0WE 1J0ZA 4F3FA 5IQ9A 4BUHA 1ZSDB 3ARBD 2HG5A 4BH8A 2VLKE 4DUWA 4LBEA 2FEDD 1AIFA 1CLYL 1UWXH 2YOCA 4K7FA 4DEPB 5DJ0B 3OJDB 3T2NL 1HYSD 2CDFB 1U3HB 4RMTA 3FB7B 4NZTL 1IM3B 4C4KO 2DTMH 5E9DD 3K4AA 2R0WH 2JIXB 4NJAL 4LHUG 3DTXA 4MA3A 3MROB 1XIWC 2EH7L 1V3LA 4NM4L 3TA3C 1F4HA 1UB6A 1TNNA 1AQDB 5HGBB 2RHEA 2GK0A 2J7LA 3STLA 3M1BB 2JK5B 1OGAB 5GS1B 4WO4A 3ROLA 4ELKB 4M9PA 3WXVH 3FO9B 3FQUB 5ESQB 2A73B 1A6UH 2IQAB 3ZE1E 1C1EH 2VC2H 5F70A 2YPLE 4YGAB 4MXQD 3V8CA 4QCIA 3DIFB 2NXZC 4JG0L 4HWNA 5ESQA 2D9CA 2OR7A 1Z5LB 1JWSA 2AJUH 3RVXC 5ACLA 4FG6C 4NHCL 3WS6A 4ODBD 5DQ9B 3ARWA 1BOGB 1P4IL 2JK5A 1F11B 1U93A 2APTA 2FBJL 4M62H 3CXHJ 1X44A 4GBXB 3WJJC 3KJ6H 5DEZA 1XGYL 4Y1AA 4IRZH 2N7AA 5EOCL 1ZAGA 1KIQA 3C09C 3CDGB 3RDTB 4DZ8A 1MCQA 4QHNB 5JORB 5F1IB 3TJEH 1QNZL 1X5GA 3QA3B 4E41B 2FB4L 5L8JB 1P9MC 4P2RE 2HH0H 5IB5B 1BQSA 1FBIH 3QYCA 4OF6A 5FUZL 5CEYB 4U6HA 4ZSOE 2EDYA 3R4DA 8CGTA 1UKSA 3QHFL 1BVLA 5TFSH 4FNLH 2CLRB 3IAGC 1MRFH 3C6LC 5E2TL 1OW0A 4QF1B 4W4OA 2CKBA 3X3FH 1H3UA 1KUMA 3G5ZA 3KPMA 1G9ML 4M1CD 3JWDC 2YZ1A 5GGSB 4NRZA 1TCRB 3GJEB 1FFNB 5I1IH 5DUPH 2FB4H 1UZ8A 1H0DB 1A64A 5FKAB 5ICXA 3QDGA 4YQXH 1M71B 5EU5A 2MQ0A 1YDPB 1I9RL 5DEGB 3IDIA 4LASH 1MLBB 1AXSA 1G7JB 5GHWH 3RVTD 4YHZL 1TCRA 3AGVA 3VH8G 1JGUL 3B9DA 4R26L 4BKLB 5HHME 2A83B 5FM8A 4CU8A 1NCCH 1MCJA 2J88H 2P8MB 5LXGH 3FT2B 4PJXB 5KZCB 2NX5E 1C08A 3LMJH 4OGYH 3SBWA 4ETYA 3FQRA 4WFGD 5KVDH 2A83A 5F6IC 4LSQH 3GMMA 4M7LH 1X5JA 5AYUH 4HIHA 5I1CH 1YMMD 3NA4A 3NFPA 4ODUB 4BQ6A 5IF0B 1KXVC 2AABH 3DURA 4XAWH 4R0LC 4KI5D 1OM3L 4NQVA 5KVEL 3VD9A 3GNMH 3ARZA 4CJ0A 2HA1A 2A0LD 3HZYA 4HIJA 2B4CL 5DVOA 3P9WB 1A6ZA 4P5TC 5E94A 5EZLA 1KB5B 3CFIC 1K4CB 1U42A 5ACZA 1T2JA 2CUHA 1HXMB 4JM4L 5IHBA 5FUCC 3CFBA 3OKEA 3OX8A 2VXSL 3IXTB 2HFGL 1NDGB 3KR3H 1A4JB 3EDJA 3MNZB 4X80H 2XNAA 3CAFA 4RDQF 2V7NB 3O6KL 2HTKC 3QIWB 4M8QB 3HLAA 2AV7B 4JN1H 4ZXBC 2GUOA 1MAJA 1OSZA 2PW2A 1MPAH 1G7IA 1O0VA 1QRNE 1Z3GH 4Y4HB 2Z93A 5C09A 3FQNB 3AAZB 4GBXC 2BNRE 2EIBA 3GBNH 5CP7B 2RR3A 4RMWA 3VGBA 3BRGC 2IADA 2DBLH 4U05A 2V5YA 4YHML 3N85H 5EN2A 3G04A 1J0JA 1S78C 4LIQE 4OF8A 5DJAB 3WIFB 2PR4H 1A4JA 4EXKA 3C09B 2D0FA 2Q87A 1UB6B 1ZEAL 4MNQB 3L5WA 4ISVA 4Z7VA 1Q72L 4XPTH 2JJSC 1WCQA 5IW3A 1UVQB 4JO1L 2F54A 4JDZB 5GJTH 4AENA 4XPFL 5LQBH 2GJZB 2F58L 2EECA 4LSDA 4ZSOB 1J0KA 1JWMA 1PKOA 3SDCC 5T3XH 4EUPH 2R2CA 2V17L 1IC4L 2V9TA 3JV4B 5E5UB 4BZ1L 5I18L 3U83A 3C2AL 1FJ1A 3W9DA 4JM2F 4JFPA 4QXGH 3PV7A 5DYOA 2FECL 2WUCL 5BVPH 2EC8A 1BAFH 5EBLA 3KPQA 5C0AA 1TDQA 4RISH 5INCA 3VU2A 3MA7B 2XN9B 4Z7UB 2QQNL 2EEBA 2W9DH 1C8PA 3DI2B 3QCUH 2CDGA 3HI5H 3QIBC 1CD9B 4RNRA 3LY6A 1AP2B 3RUGF 3WJLC 1CD1A 1G6RA 1HZHH 4S1SH 3WFHA 2EH8H 4AG4L 1FIGL 3G9AB 1JHKL 2A6JA 3DGCR 2R1YB 4PY7A 5C0CE 1TIUA 2DQGL 2Z8VC 1K3ZA 5IEHA 3ARSA 2W0PA 1HQRB 4R7NB 2FHCA 4XMPL 1YYLH 1DANT 5IG7A 2CKNA 3K8LA 3IJSA 4NJ9L 2V2TA 2EYTA 5D7JA 5HBBA 2YC1A 2ED8A 1BWMA 2YD8A 3GUTA 3FRPA 2VIRA 4LEOA 4P46B 3HCVA 4MJ6B 4NZUH 5L0QC 1EHAA 3CSPA 3ARYA 5HYJE 2DQCH 4FQQB 4KRPC 2YD5A 1CIDA 3RTQB 1R5VA 2Y07L 3U0TB 4HKXA 1JFQH 5DMYA 4QLRA 4LFHG 4X6CE 4UU9B 1HQRA 3UYOD 4PJCF 2I26N 3G6JA 1FGNL 4GW1A 2JTDA 4H88L 1DQLH 3DSFH 2X05A 3STZB 2RIKA 3WFHB 1T7WA 3V5DA 1INEH 1HKLH 3QHTC 2HJFB 1QNZH 4YPGB 1BBDH 1U58A 4JY4B 1AP2A 3ARDC 1JTOA 1P5UA 4NKMB 5TGBA 5GS0H 5F3HB 4PRIE 4ZPTB 2CPCA 3BP5B 4W4NA 2VO5A 5D72H 5DVMA 5TFSL 1OF2B 3LRSA 3RWHB 1HSBA 2C1PB 5C0GB 1BPVA 3RX8A 2VSDA 2NW2A 5FHBL 3RQ3A 5CCKL 3WJLA 3BH8A 2DL2A 2YR3A 1ZK9A 3FMGL 4OGXH 1JVKA 4NKOA 3RY6C 2ESVA 2P48B 3QDGE 3V7MA 1FO0A 1MCOH 2FH6A 5DURB 5SWQB 5EOCH 3WNPA 4GW4B 1YEKH 4L1HA 3FO0L 5JW4R 3GEWB 4Y4FD 2PO6D 4JGJA 1SY6L 4LLUB 4H26A 1CL7I 3TBSA 2C1OB 2VDPL 3CC5B 5JDSA 5CGYD 2M2DA 4MQSB 1XMWA 4KUZH 4Y1AD 1JUFA 4Q97A 1ZHKA 2ZCHL 1CDIA 2C1OA 1CE6A 3B9KA 4GSDH 2MHAA 3AU1B 1PGRB 5ESAB 3VXUE 5I18H 5DJ0A 3JXAA 4PJ7F 1OSZB 1U95B 2XPGB 4PS4H 1NFKA 4HS8L 1NAMA 2BSRA 3BN9C 2OI9B 3UDWA 3CCHB 5F1NB 5HHVH 1I9EA 5GGVY 2G9HB 3AS0A 4PRPB 4P2RD 2AI0L 3EYSH 1DQQA 1QFWL 4FFVD 2IH3B 1L9MA 5GGVH 2VB5A 1MFAH 4DWHA 1IGJA 1DDHA 1RURH 2FYYA 3BAEL 1QO3B 2VXTH 1RJZB 4XPAL 3UO1L 1XGUB 4BSWA 3RKDD 4NO0B 5K9JH 3BJ91 1YEEL 1CGWA 1MVFA 2V2TB 3KYNB 3FQTA 3FCTA 3IDIB 2YPLA 1U8HA 3HI5L 2XTLA 4PP2A 4NQVB 1OTSD 5BV7L 4XPHH 4I4WA 1I3VA 5HGDB 3JZ7A 3T3MF 2E8YA 1J8HE 1J1XH 4GRLD 3S96A 1FGVL 3OHXB 2FWOB 2Z31C 4ZYKA 1I3GL 1MFAL 1K5NB 4YWGH 3GBNL 2X70A 3T4YB 2QHRH 3UZQA 1OP3K 4HIIA 2GTZB 1I9JH 2R4SH 3ARTA 2LU3A 3TBYB 4KKAD 1IGJB 2ENYA 2P8LA 5IV2B 3QUKA 3KS0J 5EZOH 1INEL 5EOTA 4U7MA 1E6OH 1X4ZA 3DMMC 4GUPB 4LSQL 1I7RB 1U8KA 4XX1G 5GGRY 4EDXB 3ZDXF 4PLNC 1RULH 4G6JL 4G5ZH 3VXRB 4YDLC 2O5YL 1S9WB 1D5BA 1JTPA 3U0PA 3MRIA 3L5WB 3PQYD 4ISVB 4KAQL 4UT6H 2JE8A 3I6KA 5K9KA 4UV4L 1ES0B 5AD0A 3SDXE 5DTFA 1NCUA 2KBGA 2X4OA 4IOIA 4XCYB 5MHSE 4HC1A 3PDDA 4U6HB 4NO5A 2OX5A 4X7SL 2EDDA 2A77H 2AJZB 1I9IH 1KTDA 1NCWH 2D7QA 4PJGF 5IHUH 5C09B 5FF6B 4BZ2L 2F53A 3WLWC 3W81A 2AK1H 4KC3B 4JM2A 4Z7WE 3ZO0A 5L7XH 4G8FA 1YEDB 4NM8H 1MHEB 2BJML 2EZ0D 2NQCA 3TO2B 1AD9A 2NY3B 4OCLC 1C5DA 3AROA 3N1GC 1I7UA 3DETD 2FJFB 2AJYL 2ZG2A 3IJYA 2HMIC 4D8PB 3NAAH 4ZUVA 2F53D 5F97E 1RUMH 4WU5A 3QPQD 1ZLUK 5JW3L 4JR9L 4MQXC 4YHOL 2LVCA 3ZTJG 5IUSA 1QSEB 3FT4A 5MENE 1ETZB 5DMIL 4HIJB 4EOWH 2DIJA 1KYOK 3EFFB 5IKCB 5GGUA 1CFNA 1GCFA 3FONB 4WY7H 4LLWA 5JW4Q 3ETBF 5SX5K 3LEXB 4ONGH 4AIXA 1YPZA 3KPSB 3MRMA 3C6LD 1F6AB 4G8IA 4FQ2H 4R8WL 4A2LA 4NP4L 3RZCC 3EAKA 1QSFD 3BSZH 3Q6GL 2R9HC 1R3IL 3O6LL 4UQ3A 4LPVA 3V9FA 4QRRE 3BGMB 4P46D 1E4XL 1S9WA 4PGEA 1WC7B 3HPJB 1RJLB 1GH7A 3GRWH 1F00I 1WZ1L 4PJBE 4NIKB 2YEZA 1XF4A 5JIHA 3EYQC 1DQDL 1WWCA 5FECB 1XF3A 3VMPA 2MSPA 1K4DA 5EZOL 1A47A 5KTEH 4OSUL 1V5JA 3SCMD 5JXEA 2PUQT 3IFLH 4LMQI 3GRWA 5IT2L 1UEYA 2E7MA 1I8MB 4PLOB 1FQ9C 4MQ7B 5MEQA 5LG1A 1UXSB 3Q3GA 3LAFA 3VWJA 1FNSH 4Q6IA 4KI5C 4ETQB 3ZHDA 1XZ0A 2FBOJ 2I07B 3JWNC 3SE9H 2Z91B 5FHBH 4KJQD 5C07D 4C56E 1BD2A 2VNCA 3PWLA 4XMKH 3HMWL 5MI0C 4WGVB 2VDLH 1EJOH 5J8OA 4PJCE 4HWBH 4OZHE 3CXDH 1JGDB 3U7WL 3GBML 4XNYL 4WI8A 4KRPB 1IGYB 3JSSA 4OGAC 1QKZL 5T1KD 1QSFB 4RFNB 1H8SA 4HPOL 2O5YH 1Q0YL 5JTWA 2IPUG 4XHJC 1XF2A 4HEME 1DQLL 4P3DA 3L95A 4BM7A 5C0JB 4IMLA 4HJJH 3V7AG 3VRJB 3TH4T 4F7MA 1S5IL 2ZG1A 43CAB 4RGND 3RI5F 4OQTA 2BMKB 4WNQB 3WFBL 4NBXB 1T83A 4RFOL 1V3MA 1XGQA 4D0DB 2UVFA 1I1RA 5DD3H 2P5WD 3WNKA 4FXKB 4L9LC 3CCHA 1MVUA 4QCIB 2BNUA 3BKMH 1INDH 5EO1A 1VESA 5E56A 3UBXB 1NFDB 4JY6A 3KPRE 3W9EA 4RA3A 4LCCC 2PO6A 3BXNA 2JCCB 2E9BA 5GS1A 1BFOB 3GSUA 3DNKA 3BDYH 1I3GH 1JYXA 3TIDA 3QNXA 3H8NA 5BZWB 1S7QA 3VWJC 5AD0B 4Z8FL 4CNIA 3LB6C 3DXAA 5FK9A 1GAFL 4PY8J 5EO9B 3EYSL 4Q9QH 3FB7A 4HQQH 4P2OD 4OZGB 4EKXA 3BYTA 3QUZA 4XAKD 1KC5H 2XKNB 3FFDA 3GI8L 4X6FB 3RPKA 1JWSB 1HH6B 3T2QA 1IQDB 1G0DA 3W11D 3GSOB 1DQTA 4RA0C 3VH8B 3EJJX 1MJUL 4OZGE 5EUOF 5H8DA 4HJGA 3O9WC 5D9SA 3PABA 4F33B 4MHHG 4MGXA 1BP3B 5GIRB 1ZHBB 3U9PL 5HPMA 1KGCE 2NY6D 3LEVL 1X4YA 1PYWB 3TBTA 1AGEA 3H9SE 3C6SB 5E8PA 4YHYC 4DUXA 4ZFGH 3C08L 1F3JB 3U7AA 4XNMA 4MNGA 3GDBA 1YMMB 3S35L 2CUIA 3QI9D 3V0AC 2QADB 1YC8A 2OQJB 4TSAH 2VLJE 1MNUL 2DDQH 2Z92A 4RX4A 4UTAH 1FORL 3D48R 4APQA 3WDHA 3V0VA 1JN6B 3BPCA 1OTUD 1FPTH 4J3OC 2WLYA 1DBBL 4LAQL 1KELH 4ZS7L 1B2WH 1EEYA 4PGDB 1ZA3A 1GOGA 1RVFL 3N1FC 4RWYL 1RUPL 2ADFL 4F9LA 3BD5A 4U1IB 2YPLB 1S9YB 2IANB 3F7QA 5FGSA 1EFXA 1PW3A 5DJDB 3RVVC 5EC2B 3LEYL 4PRNA 2HT4D 5HVHC 1Z9LA 3MV7D 2EC9U 5SWSB 3DSNA 1LP9B 4PJ9C 5F1SA 1BFTA 5C0ND 5GRXG 1SBSH 3NN8B 4K94H 4X6DE 3FHAA 4GG6B 4HD9A 2B7DT 3CNKA 4YHKH 1QQDB 4X6DA 1XGTA 2FL5B 3L5HA 3TNMB 3DX6B 2IGFH 3HZVB 5D1ZB 4GKZA 4OCMC 3TH2T 4MWFB 3EW3B 3QNYA 3D2UA 4UBDD 1CL7H 3TVMC 3HRZB 4OF5A 4TSBL 5JO5A 1FCGA 4Y5YC 1ROWA 5CS7A 3TYFA 2VZ3A 1RUKH 3HNTL 1D5MA 2PYEE 1LK2B 3WUWG 2F19L 2VDOL 5DT1L 4S2SB 4KZEH 1L0XA 3DMMB 2DN7A 1ZHNB 1YJDL 5HHQB 5I1KL 4WCYL 5DJAA 1MFEL 4JFDE 5EBLB 4BFGA 1U3YA 2EDRA 5EZJB 1FLTX 2OJZH 4L29A 5IVXF 3PL6C 4Y4HA 4KQ3L 1MJ7H 2CQVA 3WNNA 4DCQA 4DN3H 1LO0H 1MCDA 3LQZA 2BOCA 3CFJB 1TMCB 4MAUL 4G8GA 4JFDB 5ICZB 6FABH 4ZSOA 3MFFB 3I75B 3BVNB 1T2XA 2HAZA 4G6AD 3U2SB 4PG9B 2B1HL 1F5WA 3P3YA 3BZEA 3O3UN 1OGAA 3IRPX 3K3QA 2AJXH 2VL5B 4U1MB 2C3VB 2VXVL 5C7XL 2IADB 1A2YB 1QTYT 1R3KB 1QFWH 1GAFH 5LBSL 1KJ2H 3CUPB 2GT9A 4QWWC 4RMRA 4OZHA 3RNQB 4G42B 4ZUSA 4WW2F 1KPVA 5IMLB 4IRJC 4TUKH 2JELL 4NN5B 5C0EB 3HLAB 5MEPA 1TJGH 3QG7L 1KCUL 1DUYA 4J3VA 1FNAA 1T89C 3QIBA 3UDWC 2L0DA 1HHHA 4M48H 3QG6B 3PP3K 3U6RB 4LLQA 4JRYB 1CFVH 5ADOL 1R3HB 1ZLWK 5ESVB 3MJ8B 3IU3A 1IAIM 5BO1H 4A2MA 5EORL 2DWDA 1KYOJ 2ADGA 1P53A 2AXJA 1A3QA 2YXFA 4FHBD 1I1FA 4NGHH 5D5MA 4YBQD 3GSNB 4ZD3L 3IDGA 1IC7H 3W39B 3O8XD 4PJCA 2G60H 1DBBH 4XCEA 3O4LE 4WFFD 1WSST 3MRLB 3D3VB 4PRHD 3RZCB 1WBXB 5EIIA 2I07A 4KKNA 1I8IA 2R39A 1IE5A 3SPVA 4FFVC 4WW2B 4XC3H 3RWDB 5E2VH 5JHDE 1A6VL 2DJ4A 3CSYA 4OGXL 4JPKH 4XVTL 3HZMB 4ODXB 3BWAB 1CD1B 3HC4L 3BGAA 3PWUA 5BV7C 3QFJB 3LKRA 5DVKA 2CJUH 2Y1VA 4YHLL 5SWZD 4W6WB 4KGLA 5BXFB 1GOHA 3K1KC 1TJIH 4PUBH 1NDMA 1IGTA 1T04B 3ESVF 4KJWC 2WBWB 1NAKH 3MA7A 4Z7UA 4Z77A 3JUYA 4RBPH 1BOYA 4GG8A 2R0LL 1CYGA 2DLFH 3FRUB 5LVEA 1KNOB 2VLKB 1D5ZB 5IVXE 2FX7L 2BHYA 3V5HB 1BF8A 3LS5H 3X12B 2VN7A 4JRYD 5HD8C 4FQJL 4MJIB 3RNKB 5L2KD 4ZDHB 4LCIH 5EFIB 1J8HD 3MRFB 2ICES 3VJ6A 5I1DB 4FQLH 5JOFB 2C3GA 3ISWA 1XR8A 2DKMA 3WXWH 1HI6B 1NBVL 3GIVA 4PB0L 1QKZH 5F89A 2FLBT 1KXQE 5F7NC 3GBLA 1UCBH 3BJLA 1K8DA 4OV6F 4YHZH 4OF7A 5DD6B 2H41A 2X4QA 4IDJL 3T3PF 2DQTL 5E4IA 3GHEH 1A02N 1BQHB 2EDKA 5EO9A 3D18B 3BP6A 4YBHA 2K9UA 3C9NB 5K59F 4KI5E 3ARDD 5ID0A 3ULUE 2JELH 3QHZL 2YN3A 4I3GA 3F7YB 4WO4B 3CLFL 3WSQL 3M1BA 4Y0GA 1A6TA 3LKSB 1AXIB 2KDGA 4G6ML 4FABH 4ZO8A 4WUUD 4MZ2A 1JZ3A 5CZVH 5DUMH 5EO1B 3UBXA 1RZKL 4JM2B 1IMHC 5BVJA 2CKBH 3DOSA 2X7LA 2JLLA 1F4YL 5HYJD 4JZJC 1LNUA 3MX0A 1ZE3C 1DFBL 4BQ9A 3BAEH 3ULUC 1KCVL 4C55A 1MI5B 2HKHL 4KVNH 4MQXD 1DP0A 3GIVB 1NCCL 2WIIA 5JOEA 1A4KB 4EUPA 1A7RL 4MB4A 4ZNEE 3VGFA 5FV1L 1GGCL 1T1ZB 1GPOL 4KK9D 4YHNB 1VPOH 1T5WA 2PTUA 1MF2L 5HYJA 2EICA 4MB3A 4O00A 1IGYA 2E7BA 1DBJL 3D3VD 2JJTC 1N5AA 2YZ8A 4YFLF 4LF3B 1K2DA 5FM5M 4Y8DC 3U4AA 2ORBH 3EYOB 3P4MB 2WZPD 1T21B 1FZMB 4R9HA 1SM3L 4XX1E 3JVGA 5E95B 3IJHA 3PHOA 3ULVF 5IGXH 1B4RA 3MRHB 1L9NA 3BEWA 1EFXB 3CPLA 3M8OL 1ZVSA 4QGYA 3QDGB 5JXAH 2YKLL 2X40A 3IFPA 4RFEB 3LKPB 3CFDB 3QIBB 1FRGH 2DLEA 1DBKH 3DX9A 3O11B 3RPIA 1EEYB 2MKWA 2BXYA 3GJFK 4MS8C 2HJKB 3LKPA 2PTVA 4KPHL 4JFFA 2XQYK 2VAAA 4EBQH 2IH1B 4XP9L 4JKPH 4ZFFB 3K4ZA 1IC4H 2P49B 1D6VL 3ZL4L 5HYQB 1RJZA 5KS9A 4AEIH 2CH8A 3K0WA 3VE0B 4U1KB 3WKMH 3K4DA 5L0QB 3MLVH 1AXTL 5F1IA 1N5AB 2P42B 4TPRL 5EPMA 4MJ2A 3PL6D 1O5DT 4JFDD 1EEZA 1PX3A 3CZFB 2EC9T 1B4JL 4XP5L 3H7BB 5I73B 2YUWA 4LEXL 2ZWLT 1XF1A 2D7PA 2H6PB 5I8EA 3PJSA 2FX9H 3UROR 4EJ1C 4M8VA 3HHRB 1KPRB 2Y36L 4WI3A 4F80A 4D9RE 4XXDB 5LGHH 2ZOKA 4DAGH 2P5EB 2WUBH 5ABDE 4NCC1 1FHGA 4EEEA 4CJ1A 3QJFB 3I9GL 3TVMD 3VFMA 2MKLC 2DTML 4HEPG 5C6TH 4ZFOL 3ULVC 4KFZC 4U3HA 1P5VA 4JZJB 3QJFA 2BOCB 3CFJA 3VFMB 4LCCA 3LQZB 3HC4H 4P3WA 4MCYA 5FO9A 1YEDA 4C83A 2HKFH 2ZNWA 5CGTA 3TNMA 2P5WB 4IJ3C 2VE6B 3LDBC 3QCTH 1OLZA 5FO8B 3TZVB 4KKCC 3Q6FB 4WTXA 5I1LA 4L29B 1AJ7L 2YRZA 5IMMB 4HUKB 4K3JH 5C70A 2VDRH 3FRPG 3EZJB 5SWSA 4IOIB 4XCYA 1Y6KR 3VWKB 2G60L 1MHHB 4PJBF 4Y4KC 3VFRA 1NDMB 1ACYL 2NTFB 4I0PB 2JIXD 5ANME 4H8WL 1RUAH 1IM9B 1Q9WB 2VXSH 3PGFL 3QFJA 2CIIB 3R06A 3NZHH 4S1DD 4AM0B 4HT1H 3S5LG 1P1ZB 3BZDA 3X12A 1S7WA 1HOCB 4GW1B 1DLHA 2GFBA 5E2UH 1ZVYA 3DVGB 3MBEC 5TQ0L 1T6WA 4TULL 1CBVH 5KJRL 1SY6H 3LV3A 3IETA 4XAWL 1P7QD 4L4TD 1DN2A 3QAZC 4JREB 4P9HL 2J8UF 2XKSA 1CTNA 3OGCB 1M7IA 1WLHA 4H25A 3G5VA 5C0FB 3W39A 3GSNA 1YUHB 4PJDA 1N3NB 3NIGE 1F3DJ 3OKKB 3KYMA 4KKAC 3HE7D 4JN2A 1R3HA 2JF1A 4U3XA 3VFGL 1ZGLA 4PV8A 3ARXA 4KHXL 5GRVK 5CBEA 3W11C 3BQUB 4UT7L 4Q6YA 3SQOL 3N50A 2YK1L 4ZO6A 5KOMC 4PY7B 3REVA 1CR9H 3RWDA 3W0WD 1CGTA 3B8SA 4PGDA 2VMFA 4UBDC 3C60C 1NMBH 3NGBB 1DBAH 4X9BA 5D96C 4OCXL 2Z31B 4ZTOL 4GRLC 3M07A 1F3RB 1U8QA 1ERNA 4NRYA 1S7QB 4GO6B 5IK3A 5I1EL 4P2QD 3QNXB 1H3TA 3DYPA 1ZHLB 4F57L 1FN4A 2IPTH 1AFVL 3VFOA 4M1DH 1MCPL 2J4WH 3E6HB 3OSKA 2DIAA 3HNVH 3R1GL 1G9NH 4PLJD 3ARGA 3VXME 2HLFC 3D0VB 1W8OA 1UJ3C 1MI5A 3GSOA 2EE6A 1HKFA 4MXVE 4HWZB 5I76A 2GIYA 4PGZA 3CDCA 5L9DL 1BM3L 2ITCA 1J8KA 4G6FD 1LNUB 4FFWC 4M5YL 4KMLB 2BCKB 4UTAL 3CFEB 4NQXA 3QWOB 4KVNL 3QEHB 2NY4D 5C0JA 2O26U 2NX5A 4MCYB 5TH2A 2I9TB 1OF2A 1FFPB 2ICCA 1MI5D 2AV1A 4N0CC 5I0ZA 1Z6JT 3R0NA 4MNQE 1DTUA 5JR1L 1AKJB 3C60D 3ULSA 1G0YR 2HKHH 4BQ8A 4PJGA 4PP1C 4F37F 3ZE2E 1JYNA 4CW1B 5FF6A 1IARB 2ESVB 5CEZE 2EDOA 3RBSA 1DQDH 4KJQC 3FOMA 5F7EL 3SJVE 1JPSH 2FJGA 3WSQH 3U9UA 5IFJB 1BQUA 5DD1H 2DLHA 4EVNA 4F7MB 4UNVA 1PSKL 3MLTB 4IOSD 2OK0L 1X3DA 4ETQA 4NHUB 5HYIA 3BSZL 3Q6GH 1G9MC 1SJHB 2Y9RT 4I2XE 3BDBA 1W2KT 4KHTL 4Z0BH 5TE7H 4QT5A 5I16A 4XMLH 3D9AH 3ALXA 5D2NE 1MEXH 5FUOL 2BNQA 3HE6B 1FCCA 3DRQB 3EYQD 1BLNA 4U1KA 1P6AB 4JN1L 3OAYH 4ZOEA 3GO1L 2R2HA 4AK1A 1YEGH 3CDYA 5C92A 3LPGA 2V17H 4BZ1H 2R1XB 4QRTB 2BHUA 4LCYA 4ONHB 4AEHL 2A6KB 1H15B 2L7UA 3O8XB 2APBA 4OF3A 4L4VD 2AJSH 5CUSH 3NAAL 4DTGL 3FT2A 4JPVH 4LPTA 4Y19B 3UTPE 5D2NC 2DMKA 3GK8H 2X9YA 3BT2H 5EC2A 5BOPA 4UTBH 4JO3L 5EU3B 3E0GA 5IIEA 2Z8WC 3MV8A 4GRLB 4PGCA 2HLAB 4CDGC 4OGYL 4L3CA 1I1YA 3QDJB 4JFQB 4H0IA 5FKAA 5ICXB 4YXLL 1RFDL 4NN6C 4NO0D 2HRPH 2MWCA 1CDHA 4LHUB 5I71C 3NCYP 5DJXB 3B8YA 4GRWH 3TCXA 1RJYA 1RIUH 5AAMA 4YE4H 3IDJB 1CG9A 1UJ3B 2FJFA 3IB4A 5TJWK 2LTQB 4HKZA 4OCYH 5DHYA 1ACYH 1EHNA 2A38A 3SO3B 3ZKQD 4TVPE 5HYEA 2APWA 1BQLL 1JHTB 5IJVB 3C6SA 4XB7A 5C6WH 3UJIH 1CICB 1N4XH 1CDGA 1DVFC 3BXNB 5L88L 2UZYB 4G42A 4ZUSB 4U1GC 3REWB 5C0CA 4JFYB 4OZHB 3RNQA 2FATH 3HG1A 3JV4A 4TQEH 4PJGE 2EKJA 4J3TA 5CEXB 4GMSL 3E8UH 3NCEB 3LS4H 3DVNB 5E8OB 2Q6WA 4K7PX 2X1PA 3KPRA 4LQFL 3VRIB 4U1MA 2P24B 3P40A 4JDVA 5FYKE 1D5BB 3RWCB 2P5ED 4IOFD 5I6XB 5LBSH 1N64L 3BVNA 4X98B 4R2GD 4EUPG 2VTFA 1HILB 1PZUB 5LGHL 1A7RH 4N90E 4Y16A 1MFDL 3FQNA 1MJ7L 4LVHC 3AMLA 1MWAH 3PXHA 4J3WA 5GGTA 3UTTB 1NCDL 1T0PB 3GKWL 2BNUB 1S7XA 3E6FA 4Y4FA 2QSTA 1W72H 1U3HD 1QPXA 1B3JA 1D9KA 1UB5A 2FX8H 4LHUD 2OTWB 1X6LA 3BIKB 2HT2D 1ZHNA 3BHBA 1JZ2A 4L8CB 5JOPE 4L4JA 3GJFB 1JGVH 3LKNB 5DTFB 1NC2D 4LLDA 3ZYJA 1JHLH 5IB1A 1BJ8A 3DX7B 1XZ0B 1UWGL 4E5XB 1SBBA 2YHGA 2GSGB 1MCPH 3HTLX 2H9GA 1RK1B 3KXFE 1AI1L 4EN3D 3EO0B 5HHNA 1JL8A 4WI2A 2ZZUT 3O6FC 5D1ZA 5LGJB 1CK0L 5T5FH 2IAND 2DLGA 1OY3B 5IQ9B 3GMOA 1OT2A 1IFHL 4L4TA 1VFBB 3SDAB 2CRZA 4OCXH 3JWOH 1NBVH 2A9NH 1OSPH 4XCEB 1A14H 5HY9A 3WN5A 1M7XA 1XIWB 3WFEL 2NY2D 1JZ6A 3O2WL 4E9LA 4KMTH 2V2WB 4OLWL 1QLRB 1WZMA 4HUVB 3LIZL 4LCUA 5F3BB 4NC0B 4UQ3B 4ENED 3L5JA 2F74A 2V5TA 3DV6B 1NGWB 5GGSY 4HK0B 5IBLD 5KSBE 4F57H 1FBIL 5ECJE 5SV4A 3UTZB 4FQJH 1M71A 5EU5B 4QXTB 3MXWH 4PJ7E 3CH1A 4MJ5A 4U1JB 5D1XA 1FL5B 1JGLL 1E27A 3PV6B 1TFHA 1V7ML 4MLIA 2Q8AH 4ZO9A 3UTOA 1XGPB 1IKNA 2EDQA 5A2KH 5CCKH 2DJUA 3DGGB 2I60H 4W81A 5FA3B 3I85A 3EKCA 2XN9D 3OAZK 4HS8H 4CDHA 4HIEA 2KQNA 2O5ZH 2XICA 3P11H 3TBSB 4UI2A 5DVNA 1FP5A 4ZFOB 4I2XA 5HJ3A 4MS8D 5GS0L 4R96B 4JFEE 2AKRB 4NO2A 5IFJA 1FZOB 3IS1X 4OI9A 2UYLB 1N4XL 4JFEA 3QXDB 1JPFB 5JW5B 1OW0C 1KF9B 3KPSA 1G6RL 5IB5A 1JWMB 1KPVB 2NNAB 4XPHL 1CFNB 4EI5D 3NCBB 5K9QG 1FNEA 4O2CB 5C07E 5EBMA 3HI6L 3QQ9D 5C6TL 4HX1B 3O3BA 5E2JA 4HC1H 4M4PA 3BPNC 3K7UA 4PJ5A 1BVZA 3P4NB 3ARDB 5CD5D 1L0YA 4RGNB 4CNIB 3V6FA 4UUJB 2R9HD 1LK2A 3WFCL 5ISZE 5F9AC 3B9AA 5ID0B 2P47B 4D9QD 4H8WH 5DHXB 3RWFA 2CUMA 3WS6C 3K81A 3S98A 4JB9L 5IJKC 2E9WA 4OZFH 1B0RB 1X5ZA 5AZ2L 1MVUB 3QXDA 1RURL 1IGFH 4JAMB 5D1XC 4X6CF 4WIQA 1U8PB 4M43L 1SJEA 3BPLB 1HDMB 4RAUB 5GGTL 1MPAL 3WO4B 1VHPA 1E4JA 1Z2KA 2K7PA 5FA4B 4KMTL 5B21A 4ZNEA 4PRNB 1WBZA 2H3NB 4HS6B 4OCYL 2VQTA 2D9QB 3L3OB 3SDAC 1AC6A 4F7TA 3T8XB 5HHMB 3ZKXC 4JY4A 5B4MD 2VLKA 3IT8D 1C12A 1JPGB 3QDMA 3ZLQC 5C0BB 1PDKA 1UJTA 2XZAL 2A9NL 4P5TB 1Y0LA 4XMKL 4PJDF 4JZOB 3CK0H 5SWSD 4LAJH 1TETH 1A0QH 1M05B 4N1EA 1R5IB 3QQ4B 1S8DA 1WK0A 5JQ6H 3CSGA 4DKEH 1IGIH 3NCYS 5ICYA 3JV6A 2LU7A 1LP9A 1NLBH 2WQRA 1YMMA 1GGTA 3BZ4A 1Q0YH 2F19H 4WTZG 2CMRH 4YDJA 4LU5H 5CIPA 4ZXBB 3ECBA 4CN1A 3OTTA 4OD2B 1A6WH 3QCUL 3B2UC 1L7TH 3OHXA 4HJGB 5HI5D 4O2EB 4P4KA 3OAUH 3MACL 4LSVH 4EI5A 3BEWB 1CFSB 2IPTL 2VQ1A 5A16B 4FQXB 1GJIA 3QEQB 1U8OA 1GZQA 3LB6D 4M93C 4LDOB 4KTDH 4XVJH 3F7VA 3OR7A 1PX4A 1UENA 3O45A 3QUZB 3L3OA 4X4YB 1A9BA 3U4EB 3KYNA 4MA7H 4WFHE 4Z7VB 5ADOH 2Q8AL 3FT3B 4NOBA 3MJ9H 2OQJA 1QYGL 2V7HA 1YYLL 5ALCH 3HE6A 3ZYIA 4PG2C 4ONGL 2H2SD 5E9DA 5HPMB 2F54E 3MRNB 5EU6A 3QQ3A 2BVOA 3CVIH 3F58H 3B5TA 4UIKH 5ILTL 2XI9A 1OPGH 3QXVA 4QNPF 4M7JL 3HI1B 4MD5B 4NC2B 1KJVA 4BK5A 5JW3H 5ID1B 5H94B 5ALCL 2RQ8A 4RIRB 3C08H 4EQ3A 2IQ9H 2WWMD 1DBJH 4X5WA 4TULH 1CBVL 4UQ2A 4U6YA 1FO0H 5EU6D 2P5EA 5GRUH 4GAGH 2CXKA 1TTFA 3MLUL 1NMCC 1E4XI 3DVNA 3NPSC 4MDIB 5D1QC 1MHPL 4RRPA 4ZFGL 4M3KB 1WISA 4N5ED 3CMGA 1GC1C 3AAZA 3BPLC 5DRZB 3CLEH 3VXQB 2Q76A 5I6XC 1CF8H 4BUGA 3OJ2C 1SYVA 1IJ9A 4RWHA 3O4OC 4WHDA 4XC1L 2UUDH 1S5HB 3WNLA 4I0KA 3FQRB 3O9WA 5IFHH 3RHWK 3JTTB 3MRKA 4PB0H 1MQ8A 3VE0A 4L8DA 2PKDA 1I1AD 3NCJL 1Z3GL 4QOKA 1MCCA 4HUXB 3VXMD 3MLWL 4YXKL 3ZL4H 1OP5K 3HRPA 5FA3A 4I13B 3RL2A 3K80A 1I7RA 1KJ3L 3O2VH 4IRJA 4RGOH 1WTLA 4BH8B 2V5SA 4TSCL 1RU9H 3F12B 4YIQB 3CH1B 4MJ5B 4U1JA 1FNSL 1AE6H 1K4DB 4JFXA 4D2NA 1ADQA 2ZPKL 3G9VA 4Z7QF 1F90L 3QZWG 3F5WA 4X0KB 5F8QC 4XVJL 1XGRA 5KANG 4RFOH 1R5WA 3PWNA 5CINL 2X4SA 4D9LL 2GK2A 2F9BT 3EDEA 4XP1L 2XACC 5KTEL 5DUBA 4P2QA 4YXLH 3IVKB 2J2ZA 4LSTL 4HBCH 3TT3L 3PWNB 2X4SB 1MHCB 1R5WB 2VDML 2VXVH 3LEXA 3QO0B 3RWJA 5T3ZL 1N8ZB 5MEOA 3IJSB 5C07A 3OGCA 5C0FA 5IG7B 1UCTA 3CDGA 1T1WB 2XQYG 5T1DH 3VGEA 5CZXD 3L3IB 2Y5TB 1HEZA 1FFNA 2H2PC 3RVXD 2E6PA 3IGAA 3HAEB 5IMKA 1VERA 2DD8L 4FOMA 3EHBC 4L4VE 1S7WB 4POYA 4E5XA 3OPZH 3ZDZE 5JW4N 1J1XL 2DL9A 5D5MB 1BVKA 1EZVY 3IFOA 4EOWL 5AUMA 1MH5B 4J4PA 2DI9A 3MRQA 4P0DA 4PJAB 2ESVD 1IM9A 2GJ6E 2X4NA 1DUYB 1DVFD 3QFDA 1FH5H 4JEGB 5F1NA 4GQPH 3HUJE 4QTIH 1HH6A 3FO9A 1JRHI 3L3DA 3VD5A 1P4BH 4AY0A 1V3KA 1UEMA 1XR9A 1KTRL 1NMCB 1FG2A 3EIFA 5DURD 5JOPD 3GRWL 3WN5C 1QUNA 3D39A 3MNZA 4GAGL 2OCFD 3CC5A 5JQ6L 2YXMA 2G5RA 5K9KB 5DQ9A 1EBAA 3NACL 4M7LL 4JY5L 1UZ6E 4PJIB 5KN5A 2VKWA 1BQHA 3F7RA 4JO4L 4EBQL 1U3HA 3QRGL 2EO1A 5B8CC 5J9PB 4MNQD 5T1LA 4OFYD 5B8CA 5C0CD 1B88A 5DD6A 3T1FB 1K8DB 4RCAA 3NH7H 2QR0B 4GW4A 4XAKE 4AT6B 1HHIB 2DQUL 3ULUL 5J9PA 1IILE 4C58B 4DVRL 4UMGA 3MRFA 4TUJB 1G9EA 2FJHB 5T1LD 3LQMA 1S7VB 4UV7L 4F58L 4ZS7H 3CIQA 5CJ8A 1M1SA 3ILQC 4DQOL 3P4LA 1BHGA 2B1HH 4H8WC 3KG5A 3CFBB 2GTZA 5TDOB 3RTQD 5KW9H 1DBAL 4JJ5A 3OR7B 1I7TA 4TSBH 4O2CA 5FIEA 1TZGL 3L3JA 4ZO7A 1AIFB 4LBEB 4PJ5E 4PV9B 4I9WD 4KQ3H 1WAAE 5GS3A 3QZWB 4OCNC 4QTHA 4KQ4H 2VLME 4Y4KB 1TZIB 2X4UA 5JPMB 1FZKA 4YDLB 1T66C 3MOQA 5E6IA 2FSEB 2NXZD 2W60A 2CR3A 4I0PC 4P5TD 3N9GH 1UGNA 1NC2A 4MA7L 2KZWA 4G7VL 4PRAB 5DQJA 1Q8MA 3T65B 4PBWD 3TA3B 4HPYH 5IESH 1NCTA 5F44A 4WWKD 3QQ4A 2D31B 4HJ0D 4MYWB 4OLEA 4P23B 4M02A 4LPUA 4RFEA 3UZEA 4LCYB 4OB5H 5JPMA 1JPGA 3QDMB 5C0BA 4TUOA 1ITBB 2VXQH 1NAMB 3L3JB 1J5OH 1PKQE 1JF6A 3OG6B 4L4TE 5K93A 2PF6A 4Q0XL 2KPNA 4W70A 3VFNB 2RJMA 2BNQB 5I75C 1QSVA 2NY4C 5DUBB 1JF1B 3D39D 1E4KC 2KKQA 3DHMA 4MSWA 4XBPB 3S7GA 5CP3H 3HE6D 1GPOH 2D4DA 4S1SL 5C08E 2VE6A 3E6FB 1NSNH 4PBVC 1A4KA 2DQGH 4HGWB 1KCVH 1PEZA 3AXLB 1FFOA 3MGOB 5ITFA 5BJTB 1V7NH 4LRIA 3TV3L 1F4YH 1Q9OB 2EDLA 3I02B 3WNOA 4FTVE 4Y2DA 4XCFH 2OL3H 2YA1A 3V2AR 5B8CB 4P2OB 3QO1B 4NQUA 3FB6B 4POZD 3GBMH 4XNYH 4ZOBA 4P99A 4M1CC 1SMAA 2VZ1A 5E8NA 5D7SH 1A14L 5I66A 3MJGX 2RAMA 4ZUUA 25C8H 1S9XA 4PUBL 3PJSB 2UZIH 4LPWA 3TT3H 4R4FL 1MHEA 3RAJH 4RGOL 4XVUC 2J6EA 3RWEA 4NO3A 3UTTA 1EO8L 1FYTD 2WK2A 3I02A 4CRPA 3RWGB 2XZQH 2BDNL 2EIZB 5GZND 3S88H 2DQTH 4PJIF 4HMEA 3NPSB 2O93L 2EDBA 4DK3A 3T0EE 1UG9A 4UNTA 1KLFA 5DEFB 3CVHH 3L7EA 1LD9A 1DQML 2Z4QA 4X6DF 3U0PB 1LE5A 1JE6A 3BT2L 3QNZB 4JZNA 2X4TA 3IDNB 1A5FL 2V2XB 5CD3A 2Y5TA 2ESVE 3NBNA 4JKPL 3UPAA 4PJHB 3OMZA 1U8IA 1YYML 2CDFA 3FN0H 3RKDC 4AEHH 4QHMA 1PKQB 4KTYA 4GMTH 2MOVA 3V6OE 1T1WA 3STZA 1FZJA 4UB0H 3KPOB 3OXRB 2RFXB 4Q9BA 2VR4A 3BP4B 5TDPB 1HNFA 4NQCA 5FOJA 1AHWA 5E4EB 4WWKB 3C5JB 3C5ZD 2CDGB 2DQEH 3IFOB 1H3WM 4XRCA 4WEBH 4FTVD 3W0WA 1H5BC 1OLLA 4V2CB 5SWZE 4X0KA 3PGDA 3VXPA 1TTGA 4JRXE 5IOPB 5DWUL 5JPNB 1OSPL 1I9RH 4YXHL 3GSWA 3LPWA 3O6FD 4PJ7A 1LEKB 3QUXD 4R7NA 5CSBA 5J3HD 2HFFA 5JUEL 5FOBA 2QQNH 5JIPA 3TLRA 2H9GB 3FZUC 1TITA 5D2NB 3L1OL 3BZ4B 4PRHE 3MO1B 5EUOA 4NUJA 3RWJB 4F2MB 1SVCP 1P4LA 3PWVA 7FABL 4R3SA 5FDWA 2GITB 4X4ME 1RY7B 5EOCJ 1P2CA 3MC0A 3MRBA 2IH3A 3LKNA 3OV6A 2AGJH 4OCSL 2HFGH 1S78D 3L7EB 3V0WH 5C0IA 2PETA 3WUWA 3CMOL 1FAIL 1MAKA 3OGOE 4NQCB 1D9KB 2BZDA 5JW4M 2R0ZL 3AB0B 5E8EB 2B5IB 4IRSC 1HK6A 3SDDD 3F6LA 4N0YH 2Y6SC 2YD2A 4JO4H 5BS0A 1G7LB 4LPCA 4QHNA 5JORA 3QCTL 1CE6B 2VLJD 1OM3H 4JCMA 4Z95L 3RL2B 4JG1H 2QR0A 1JGVL 2ATPB 3WIHL 5IQ7H 4UUJA 2VXUH 4QRRB 2DI7A 3ZT6A 2QADC 4DW2L 5GSRA 1P4BL 3BKML 1BIIB 1NEUA 1S9KC 5MERB 1VEMA 3K74B 1EHLH 4X83A 1IAOB 3MUY1 5TF1H 1YEIH 1EAJA 1H5BA 1FG9C 2ENSA 2YN5A 2LV4A 3GIZH 4FABL 3O9WD 2I9LB 1FIEA 4JE4B 3OJVC 1CGYA 3QH3B 2BDNH 3L9RA 4G7YH 4NKOB 3OXSB 4YE4L 2ICWB 5J13C 1VADA 4WUUA 2EYRA 4YHLH 5J1TC 4PP1D 3BUYB 2B20A 1P7KA 1F02I 4YXKH 1T22B 3GHBH 4CVXA 2E9JA 5HGBA 1KJ2A 2GK0B 4PJAA 3STLB 1AY1H 2XA3A 3SE3A 1AD0B 1QBLH 2ZJSL 2GI7A 3FOLA 5DK2A 1J7VR 1KCSH 4J3UA 1MY7A 3T3ME 4PJXA 5DJXA 5FDWB 4ONOA 4WHCA 4F7PA 1ZTXL 3VFNA 4OD3L 2AJ3A 3HZYB 5TQ2H 3P0YL 1A5FH 3UP1A 2YUXA 3CFKB 4GRMA 4GKZB 4DVBB 1A8JH 4WWKC 2X89A 5I1GL 2WNGA 5I1EH 1X5HA 2JB5H 1ZT1A 3D0VA 1NGXA 3X13B 5F9OL 4ZXBA 35C8L 3L5IA 3BESR 4KPHH 1T20B 4I2XB 1C5CL 2ICEA 4WTZA 3E6HA 2HYMA 1A7BA 5E9DB 3QIUC 3MLPA 3FKUS 2VDQH 1RPQA 3U0WH 4LASL 3BQUD 1T2QL 2V9QA 4HG4K 4TUKL 5I1JL 4LGRB 2DJSA 2UZXB 3MZGB 3O6FB 1KJ2L 5DXWA 1XF3B 1U8JA 4LSPH 5DC0A 4X4YA 1BM3H 3VA2C 4DGYL 3VFUB 5I8OL 3DUHA 3U30C 4J6RH 4JFHD 4U31A 4G9DB 4LMQE 1G9MH 4P48A 3E3QC 5HVFB 1HQ4B 3HMXL 3QXAA 3EBAA 4XBGA 3IDUA 1PSKH 3TO4A 2XZQL 5GZOD 3VWJD 3CFCH 4G8GE 4HUVA 1DR9A 4IOFC 1LO3L 3MJ6A 1FH5L 1BMGA 3H9SA 1CF8L 3S35H 1G84A 1XFPA 32C2A 4X99B 4M1GH 4GKNB 1T5XB 3BIKA 4P2QE 1BBJA 1A6AB 1BX2A 3V4UH 4HXAH 3I9GH 2VLRB 1J18A 1S8DB 1QFOA 4KTDL 1YNLL 1JNHB 2E7CA 3F7PC 1CR9L 2VL5A 3PABB 4L3EE 1A6VH 1DLFL 4TTDC 4JVUA 4XXCA 1RUQH 4NN5C 1I8KB 3IFLL 5HDLA 1J1PL 3B6SB 2VZTA 3R06B 5T3ZD 2XYCA 4RMSA 5KSBB 3QUML 2AQ2A 3L7FB 5IFAL 3SGJA 5DMKA 1S9XB 5CWSB 3Q1SL 5HDBF 1MJ8H 3K1DA 4X4XA 1PZ5A 4YFLI 5EOQL 3VFVA 1YZZA 3H9HB 4OGAD 3VFPB 1KCKA 3BFOA 3RY5A 4YNYB 5HDOA 1HN1A 1S7XB 4YDVB 5DRNB 1HDMA 4RAUA 1MI5E 2BCKA 4K9EH 5T5FL 1KTDB 3HG1B 3O3EA 5KVGH 2BRRH 5ID1A 1IAMA 4MA8H 4ODHL 3SDXB 4PRBA 1L7IL 5ITFB 4OZIF 3AS2A 5HHXH 3H7BA 2Y4SA 1FO0B 2AXHA 1X5AA 3UTSB 1BEYL 4XP6H 3WFDL 5GSVB 3FN0L 4R7DB 3K46A 4QHLA 1NMBL 3MGTB 3T0BA 3OX8B 5A3ID 2VZUA 3ROOB 2XZZA 3VGAB 1CFBA 4C59B 1AQDA 4GQ9H 5AWNL 4JLRA 3SCMC 1QRND 4D9RD 1XGTB 2PYED 4NDMA 2AERT 3PP3H 2VDKH 4WI4A 3G5XA 3FRUA 1AC0A 5D1XB 2J8UE 2WSKA 4MMZC 3KPTA 4CVUA 1AGFA 3LDBB 1BZQK 4IHOA 3QIUB 2AEWA 1LEGA 3MGAA 4ZUWA 1T1XB 2J12B 3OWEA 1AH1A 3V8OA 5DK3A 3DSFL 5ENWA 2XN9E 4OKDA 1J1OH 3W2DH 2DMBA 4M6NH 2XY2A 4X4MA 2QHRL 2WV3A 3KYMB 1SHMA 3D6GA 4G3YH 2HTKD 4WI6A 1VB9A 2Y7QA 3LN5A 3U30B 4P2QB 5C0DB 2JJVA 4PJ8A 4JQXA 5F9WB 2R1XA 4IHOB 4LDEB 1YEFL 3DVFA 3F5WB 3J7HA 1V05A 2IQ9L 3GKWH 3GMRB 3FAWA 1YY9D 4JZOA 3T0EA 1NMAL 3ARPA 3LN5B 4WO4C 1M7DB 2Y72A 2W92A 5DMGC 3QT2A 4F8QA 1EGJH 2YSSB 3Q5OA 2NXZB 3PWJA 4PREA 5HGHB 4Y5XA 2OZ4L 5HHMD 3KYOB 2F74B 1HHHB 4P4RB 4HWUA 4IMKA 3WFZA 4D3CH 3OAZH 4N8PA 4WW1A 2VH5H 3U9UB 5A40E 3JBG7 5CGMA 4Y88A 3AREB 5J6HA 5DHVA 1XGRB 1PD6A 3H9SD 5TPWL 1SYVB 1IEAA 5C0AB 3Q6FA 3ZYZA 5D1QD 3OKNB 3D2UD 1AD0A 3PGFH 3NGBC 4RWYH 5DA0B 4KVCH 5D96B 3RVUD 3VFVB 3INUH 3UC0H 2ITDA 4JKKA 4MAYA 4LKCB 4QRPB 2HTLC 5EA0H 1FLRH 1NAML 3T1FA 1KEGH 5C3LD 3O2DA 3F7YA 4YK4B 1NFDA 4JY6B 3W9EB 2QSCL 1HYSC 2B5IC 4IRSB 4OIBA 1WJ3A 2P8PA 2PXYB 1OWRM 2VZSA 1AGCA 3QIUD 1KCSL 4HUUB 1S9VA 1UT9A 3TIEB 4NNXA 1QG3A 2Q6WB 1ZTXH 1JZ7A 5TE4H 3LS5L 3TZVD 1JNHA 1S7UA 3QUZD 1A7NH 3G04B 1B0GB 2F58H 5I8OH 4HX1A 4ERSL 2AEPL 3EOYG 3FQUA 1IAIH 1CXHA 5I1GH 3KPLB 3VGAC 1CQKA 5HHQA 4OLYL 2OMBA 3MRJB 2NLJA 5TQ2L 5CINH 1G7PA 5F3HA 3TWCH 1KIPB 2VISB 2H26B 1FFPA 1VFAA 3RNKA 5GGQL 1W72A 1YN7B 3S9DB 3HRZA 4I18A 4G9FE 3T4AB 4K9EC 4LVEA 2Z31A 1J88A 3PWPB 2Y06L 2VITA 5GRZA 3CVHA 3KJ4B 1HEZB 2FL5A 1GZQB 4FQXA 3MYJA 5IVXA 4IIQA 3C5ZA 1NCDH 1ZA6B 1WAAA 2GJ6B 2QHLA 1HSAA 5DJCA 3MA9L 2BVOB 2COQA 3DURB 5CMAB 2X42A 5CIPB 1DUZB 4U1LA 5B22A 2ZKHH 4YDIH 5F96H 2A6IB 5I73C 4OLVH 1NGXB 5CLTA 1ZT1B 4FQXD 1UWGH 4KDVA 1KXTB 4ONHA 4EI6B 4MD0B 3PHOB 3DVGA 1FZMA 4ZYKB 1LK3H 2PCPB 4LNVA 4ZOAA 1Y0LB 1J12A 3QPXH 2R69L 3RZCD 4EI6A 4W4OC 4XGZA 5JHDD 5B38G 1AO7E 4FQPA 4Y5VA 1I3RA 5CZVL 4OZFG 3KAAA 2IPKA 5IM7A 1Q0XH 2FIKB 4OIIH 3G5VB 4H25B 1T0NA 1CLOL 4N8VG 3RVWD 4KWUA 4Z95H 1XGUA 4BSWB 4PJ9D 4JRYE 5GGSA 5BW7A 4WUUB 2GJ6A 4HS3A 1T83C 3SN6N 5J4MA 3WS3A 1KIRB 4HKBB 3TZVA 2XY1A 5F93C 4WCYH 2VQUA 3H42L 1PG7W 3E3QE 4UT7H 4R4BB 1KENH 1DL7H 2QL1A 4JKMA 2BVQA 3UTTD 4Y4HD 3KLAA 3T3PE 1U41A 4GMSH 4E41A 4X5XB 4ZQKB 1GGBL 4R7DA 4LOUC 4R6UA 2XKUA 4YBQC 3ZSTA 4OZFB 4Y8AA 2AQ1A 3NCFB 3VWKA 3MLXL 4HH9B 2EIZA 1RZ7L 5B38B 2VDPH 5HHOD 1IEBB 3B5GA 5BS0B 1EIBA 3FQWA 2J4WL 2NXYB 1OVZA 2ILLA 1CICC 3QHFH 5E00B 5HI5C 1PLGL 2DLFL 5IB4A 5DR5H 4JKLA 4XH2A 2V7NA 3O0RL 4ZG1A 3FB5B 3PNWB 1F90H 5E8OA 1FVDB 4QRSA 3CLFH 4RMUA 4S1RH 3FQWB 1RMFH 3B2VL 4X8XA 3BD3A 1FYHB 3REWA 2E6QA 3IKCA 1WT5A 4ZS6D 3EOBA 4WFEE 5E5MB 1J0YA 4WDIB 1BECA 2UZIL 3S36L 3WHXA 1JGEB 3LCYA 3MGOA 2UUDK 1BJ1J 1MLCB 4XB8A 1EO8H 3MRPB 3T77B 1JYVA 3CU7A 3C8KA 1CE1H 5IB3B 1RIHL 4MD4B 4N0UA 2P4AB 3A6CH 2VERN 5DDHB 1FL5A 4I3SH 1KELL 5FGBC 2VDLL 2FNBA 1CLYH 4HLZH 1J8HB 4LCWD 1A21A 3PQYE 3PP4H 1G6RH 1T1YA 4ODVH 2VXTL 3C8HA 4KUCF 3G6JB 2D7TL 2GSIB 4KVCL 3I50L 4MJ4A 4JQVC 2WAHA 1Q9LA 4NJAH 2J8OA 1NSNL 1FDLL 2IF7A 3ARGB 3KYOA 3WFCH 3IFNH 5FYKD 1NAMH 4ZFOA 3UEZA 2X41A 4PTUA 4LIQH 5IR1A 5I9QC 2CO7B 1FNHA 1QVOB 3BDXA 4PRIB 4BK4A 5SWZA 4HWEL 1NFIA 1SYSB 1N6QH 5EWIH 4NQCD 5HY9B 3GMRA 3A6BL 1H9VA 3LV3B 1ADQL 3MV7E 4XCFL 3MRLA 3PXJA 1DJSA 5IROA 3GMOB 2A6KA 4QNPE 4KXZI 4PJ8B 5T3XE 1A7NL 3IS0X 1ZOXA 3FO1A 3S35X 4F7CB 3VDBA 4E41D 3VXNA 5EC1B 2MNUA 5F9WC 1E6OL 4PTUB 3CU1A 5IR1B 4HK0A 4WFGE 4KMQA 1F6FB 4JFZH 3BQUA 4PV8B 3RIFK 4Q2ZA 4RQQA 3UJJL 3ZSSA 2OZ4A 1F4WH 3MBXH 3WL9B 1Q9WA 2GSIA 2RFXA 5C9KA 5C08A 4ELME 3O6KH 1T1YB 4JANA 4U7KA 5IKCA 2CLZB 4ZUWB 3SJVB 3PGCB 3PL6A 1ED3B 1UA6L 4HK3N 3VFWA 1MREL 4UDUA 1XT5A 1BGXL 5F6HI 4HULB 4EVNB 1T89A 3HUJB 4MVBD 1BQHG 3T77A 4ZUUB 3MV9A 4G7VH 3FOMB 5CZKA 1LE5B 2EXYC 4MNGB 5CJOH 2YS4A 2HRPL 2OI9C 4FZEL 3N9GL 3AREC 1WEJL 4AM0A 15C8L 1GGIL 1YNTA 5CKGA 4G9FB 1W72B 5DZNA 4DOHB 3GGWA 5GIRA 4LP4A 1RZ7H 3DMMD 4X6CA 3OB0K 1YJDH 4MNGE 1KT2A 1NC4A 4XP5H 4P3CH 5E9DE 4LKCA 4QRPA 1XH3A 2ITDB 4NFDA 1WBYA 1NBYB 2VXQL 3BKJL 1KPRA 4J23A 4HGWA 2X4QB 5DR5L 4GQ9L 1OARL 3LVEA 2NW2B 1J05B 2DWEA 3JUZA 2WP3O 1EFQA 1OAXL 1FL3B 1FYTA 1FSKB 1Y18B 5BZWA 3EDKA 4WW2C 5T5NG 3O3DB 5HHPB 3EJYC 2EDXA 3WHE0 3SGDH 3OKLB 3FZUD 4O5LL 3SKMB 1JGLH 3D18A 3RWCA 3IDMB 1FNGA 2ERJC 1REIA 5CILL 4YC2C 4FFZH 3SDDB 2L7JA 1X5YA 5FYLH 4GW5B 5MHSD 1KBGH 3MNVB 2K3TA 1FIGH 1WIUA 2YPLD 4YEEA 5D6DC 3THMH 4XXCC 1KB5A 4NRYB 1U8QB 3PWLB 4GG6A 4OI8A 1TZHA 3MRQB 3B4NA 1A3RH 1HINH 2WQ8A 2DKUA 4NQCE 1X6NA 4QXUH 3ZKSD 1EDQA 3H9SB 2YD3A 3DV4B 1T5XA 2P5EE 3L3GA 2H8PA 4AIOA 3SO3C 1FAIH 5AZEL 1TVBA 3P30L 1W8NA 1GGBH 1FGNH 2DM2A 3KJ4C 4Q7DA 2CD0A 4YX2H 1WCBA 3FO2A 5EG6C 3TF7C 4N0YL 1WQVT 1J1PH 5TQ0H 4AZ8A 3T0ED 1G9NC 2BNRB 3ARQA 4GRMB 3TO4B 4DVBA 1U3HC 4OM1H 3FO1B 4PJ8C 2Q7YB 1KLUB 5B39B 4ZOCA 3HC0A 3ZKXB 4I4WB 4MNHA 1U8JB 3D5OF 1LO4L 2ZCLL 3V0VB 5CGYC 1CLCA 2R0WL 3FCTB 1J0HA 2EDTA 4Y16C 4NKDB 1K2DB 1FE8H 4J2XA 4HIXH 4KV5F 1QFHA 1H0DA 1NANH 4NKQB 4KK6C 4QOKE 3RHWF 1AGDB 2W9EH 1LK3L 4OM0L 3DX9B 3L3GB 3SE4C 4N1HB 4P9MH 1R3LB 4XPTL 2VDNL 2AJVL 3IU4H 5D7KD 1FJ1B 3W9DB 3U7WH 4HBCL 4JFZL 4X6EB 2OL3A 4WU7A 2WLZA 3UTTE 1ZVSB 3VG0L 2R2BA 3VH8A 2DQUH 1BZ7A 4GFTB 5I74B 1JNJA 2BSRB 4WHTA 3FB5A 4F7PB 2CXGA 1UB5B 3FFDB 4X6FA 3ZHLA 4JZNB 2A1WL 4PJDE 5ESAA 1RZJH 5IBUG 4L8DB 5BVPL 5HHOE 4YEFA 2R0LH 5DK2B 1MWAB 1UFUA 3SGJC 4LP5A 2WUBL 4QHUB 4ZPVA 2NY6B 2VLJA 4YBLC 2YD1A 3QUYB 2C3XA 2ARJA 1T03L 1GGUA 1VADB 1SJHA 1FDLH 3UAJC 4ORGB 5BQ7B 2ARJQ 1NPUA 2V5MA 1F8TL 2OP4H 4KH2A 3FFCE 3TBWB 5F1OB 3VMNA 5KSUA 4OD1L 4HMCA 1MFNA 1ZLVH 2A74A 4IEFB 1AQKL 4LVNC 5I66B 1B90A 4X9GA 1H3GA 4NNPH 3DARA 4FA8A 2HVKB 4PJBB 3BZEB 2PXYA 2J8HA 4UOW1 1AY1L 1I8LA 3ALWA 4KQ4L 3VFPA 2APVA 5LXGL 4Y7MA 4JM2D 3ULSB 1I8LC 2NXYC 4BSVA 4LLYB 3MFFA 5ICZA 4EIGB 1GGYA 3CDFA 3UPRA 4OZ4B 2EIEA 4XP4H 4OD3H 3H2WA 2R56L 1CGUA 5E6ID 2FGZA 4QOKD 4YPGA 4CMMB 2AABL 4XBGB 1N26A 1CDCA 4WHYH 3WLWD 4Z77B 4NBYB 4G6KL 3WIHH 3QISA 5F6IB 4YQXL 3WUWB 1P6FA 1OAQL 2O61B 5JIKA 4TTDD 4AJ0A 3FT3A 4IRJD 3BRFA 2LE9A 4FTVA 4Q2ZB 4RQQB 2ADIA 3D2UB 1AR1D 1N6VA 4R0LB 4OTXL 3OB8A 5MEQB 4PJFA 5H35A 4OM0H 5E70A 3LQAC 5EFIA 1KCRH 3WFEH 4OM1L 3I2CL 5L2KB 3EHBD 5IW1A 1LP9F 2HFFB 1EGJA 4QGTA 4YX2L 5C07B 1U91A 2FR4B 3EJZC 1NGPH 2OZ4H 5I17B 4PJCB 4UINL 3VMOA 4LCWE 2BOBA 1RJLA 4G6AC 4PRIA 3VXPB 2ADIB 1Q1JH 4PIRF 5TE4L 1TPXB 3NIDE 4KGJA 3C5JA 3WYRA 4G43A 5L8KB 4EDWL 4L9LB 4XRCB 4DOHE 4HWBA 4Y4KD 3VDAA 4KJPD 5AG9A 5LKNA 4P9ML 5GZNC 2QKIA 1ZGLM 4ONFL 5EU6E 3BWAA 12E8H 1EK3A 2BVTA 1B4JH 2FBJH 4M62L 3RDTD 3H7LA 1MCLA 3HNTH 1QA9B 2UWEA 1IGCL 3O2DH 3TJEL 2X1OA 5HYFA 5IMLA 4IJ3B 5AYQA 1OWWA 1RIUL 4U2YA 4DKEL 3OXSA 1H8NA 4POZC 3TZVC 5IMMA 3RZCA 2AS5M 3MV9D 1MCSA 1XCQA 3ME0A 3IDNA 1TCMA 5FK9B 1X5LA 4Z7WF 5LAXA 1EA9C 2IEPA 3DO3A 4GBXA 1MRDL 2OJEB 3EDDA 1LGVA 4KZEL 4OIAA 3HG1D 5E8PB 5MERA 2W0FA 3MRKB 2XG5A 4LRIC 1DQQB 2XTJE 4H26B 4F33A 5CSGA 5A3IC 5HDBE 4PJAF 5AZEH 2IFFH 4O58L 4HFUH 1JPST 4LVNB 2HP4A 2FCBA 3L3KA 1QOKA 4LHQB 2APFA 4YHOH 1TTUA 4GMTL 4L3EB 4AH2B 1XGQB 2EYRB 4YUEL 2AJXL 1X9QA 5L8LB 5KSBF 4NRXA 4FQLL 5C71A 1AFVH 2YPKA 3DBXB 5DC4B 2MCPH 1T6VN 4AH2A 4OFVA 1JZ8A 4HUUA 1NBYA 4ALAH 2EIDA 4P2YA 5KSVB 1ORSB 5DMKB 3V4UL 5JA8B 5GSRB 5T1KB 2YBRB 2J1KA 2Y5EA 3OJDA 2D2OA 5FKPA 2VOTA 1HHJB 4G6FB 5DJZB 5EUOB 1QZ1A 2PTTB 2D7NA 1DQJA 3QDGD 4FQXC 5D7KE 1Q94B 1BZ9A 3LS4L 4PJ9B 4RAVB 3QUMA 3RAJL 3HZVA 4OD2A 3PE9A 2EDEA 1NFDF 3TT1H 5EZJA 3SKJL 1BVKB 2QSQA 3WIIH 2DDQL 3NN8A 1C7SA 1WITA 1D5XB 3OL2A 3SDDC 3CJJA 1T66D 4TYUA 4JPVL 1ADQH 1KC5L 2X70B 4TPRH 2E27L 1U58B 1N5YH 4P5TA 1TENA 1D6EB 1HQ4A 1MJUH 3BP4A 5DJ2A 4NQSA 5E5RB 5TDPA 2EYSA 1EAPB 5HYQA 1W0VB 3T8XA 4PP2B 4PJEA 4ZNCD 3LEYH 4MD0A 4P2RB 3U36A 3P4MA 4HZLA 4MA8L 1PJ9A 3UX9B 4DUVA 4X9HA 1KJMB 4OZIE 5EDXA 5HI4D 3G6DL 2Q86A 5DLML 1YNKH 1HIMH 4GAYA 4QY8A 1FFQA 1QD0A 3MRGB 5AG8A 1QHOA 5D71L 3WLBA 3VDCA 5DQJB 2Y7QB 1XCTA 4PRID 1NFDE 4M6ML 1JP5A 4QTHB 3VXSA 4JRYA 2W60B 2KUTA 4DGIL 5D7IF 4G80B 1S7RA 3QPQC 4AMKL 2VKXA 3ARBA 2GW5A 2HT4C 1D5IH 4HCRL 4P23C 4MDJA 1Q9KB 1IQDA 1HWHB 3FHQA 2FZ3B 3G6DH 2QQLH 3FL7A 2GJZA 3RDTA 4DZ8B 1FVEA 3P4OA 5JZ7C 4WU5B 5IVNA 5I1LB 1BEYH 4XP6L 2BSTA 1Z0NA 1A2YA 4F15B 4I18B 3MUJA 1MFEH 3RVUC 4HJJL 4L8BA 4L3AA 4JFED 1MRDH 2SEBA 5ACMA 4Q58C 2YRPA 5ALBL 3AFLA 3MNWB 1IAKB 1F4XL 2NR6C 4HXBH 2APXA 3TBTB 5IHLB 2D7TH 4JFPB 1FNEB 3SGKC 1FC1A 4YHIB 4A6YB 2N7BA 2NTSP 2R2EA 3BO8A 3BIBX 3GMPB 1CXEA 4NN7C 2MMXA 4ACPA 2LABA 2R8SL 3EOAA 3QIWA 4M8QA 2IQAA 3RWIB 4UT9L 1MFBH 3TFKC 2CDEB 4K2UH 1UM6H 4PB9L 4UQ2B 3QWQB 4D8PA 1LP9E 3BKYH 4OQTH 2IMMA 5ALBH 1IEBA 3MBEA 5I1JH 4I48B 3VCLA 2HJLA 3CZFA 4G8GD 1JTTA 5E94B 5EZLB 5GZOC 1H8OA 4RGNE 2R4RH 4Y2DB 2Z93B 3V5KB 1A7QH 1I8KA 4XI5D 5I30L 4QXTA 1RUPH 2ADFH 5T1MB 1ND0A 4HK3J 4MLSA 2FHBA 3NFPB 4ODUA 4WFHD 4JFHE 1NEZG 3OKYA 4P5KB 2GKIA 4Y2OA 4G43B 2B0SH 3IDJA 2R2BB 1VGKB 4MJID 4X7DC 3U48A 2GITA 5J89A 1BBDL 1MNUH 5DO2D 3VD7A 1P7QB 3PHQB 12E8L 5D7JB 4UIMB 3OQ3B 1KULA 4NC1E 2BNQD 4MVBC 5MEOB 4APQD 1XIWD 1JK8A 1HE7A 4FQ1H 4U1GB 4XCNA 1LEKA 1R24A 2EDHA 1KIUA 3RU8L 2GTWA 1UZ8B 4RZCA 4XVSH 3TWCL 2GSGA 3ZT7A 2HT3D 3IF1B 3KJ6L 3T0WA 1QHPA 4LLVB 3ZKNC 4CBPA 3O81A 3W0WB 1KPUA 4RNRB 1EFXD 1C16A 4I1NB 1KJ3H 4N8VA 4HCRA 1CZ8L 1QLFA 5IMOA 3TYGH 4Z7NF 4LLVA 3MRMB 4I9WE 5E08H 5CEYA 3RKPA 4JG1L 1YJDC 5DRZA 4UV4H 4XCCL 1PG7X 4Z18A 1E4WH 2YD6A 5F6HJ 4Q9RL 4U1HB 1GC1H 3F12A 4UIMA 4XC1H 1TETL 5C0RH 5IHUL 4NO0A 1FV1B 4OD1H 1HHJA 4NRZB 4JKWA 2WWMC 5JDSB 2VWEC 3LHPH 2X4TB 4PTTB 1EUUA 1KB9K 5F72S 3HB3C 3ULVH 3JWOC 4YWGL 5B3JE 3MJ9L 1LD9B 4JDTL 1KJ2B 5F9OH 5D7LB 3GHEL 3MV01 3LKSA 4C4KT 3DBXA 3RWIA 2HFEB 3DUSB 4JPIA 1PLGH 5ELIA 1NKOA 5CP7A 1GZPB 2A6DA 3OF6D 2XXMB 4N5UA 1IKFH 1UYWH 2OR8A 1D9KC 4U6VH 1OCWH 3MOBL 3ULVE 3BH8B 2E7LA 5T1DL 2AEQL 3UJIL 2XRAL 4JPIB 5FUCE 3RA7L 4ELKA 4EQ2A 3PP4L 4QHUA 1NCBH 1SJXA 5D7LA 3D3VE 3P4NA 2J6EH 4WNQA 3GNML 3N1MC 4IM8A 2B1AL 1RSFA 1A9BB 3QUMH 3DTXB 1N59A 1AGCB 4RGMB 2Z35B 4FQ2L 2F54D 3C6LA 5C9JA 1OTSC 1YEFH 1FV1A 2C9AA 5I30H 1IC7L 4HWZA 5I76B 1ULVA 5I2IB 4HT1L 2OLDA 4OV5B 1EMTH 3QQ3B 1I1AA 4X80L 4UU9A 1QFPA 3ES6B 4YDJB 1T4KA 4HIHB 4ZMAT 5J13B 4G5ZL 5E2VL 2G5BA 4O4YH 3B9EA 3QIBD 3MRGA 4HUNB 4PFEA 4XBPA 5J1AA 1C08B 3LRGA 2NR6D 1P2CB 1RJYB 1F42A 5DD5L 1LO2L 1C5BH 1KJMA 3VXOA 3CVHL 1MRFL 3T4YA 3TA3D 5A2JH 1WFUA 5E99H 3ARRA 1X7QA 2IFGA 4DN3L 5KG9B 3RIAF 3HE7A 1U8KB 3Q5TA 4G9DA 2LQRA 2J8UA 2VH5L 5MENB 1CU4L 1EZVX 3RUGA 3VXOB 4Z7OF 5IVZB 1U8HB 1I7ZB 2H2PD 1I9IL 2EKSA 1INDL 2OS7A 3GJEA 3OKKA 3P30H 5I1IL 4U1LB 5F7FA 1CXFA 1YEKL 1MCEA 9CGTA 3JV6B 4Y4FC 4KROB 1UCBL 4YO0B 3U82B 3P77A 2GJJA 1QO3A 2NY2B 2C7UA 2Q3ZA 2XQBL 4JJHA 3N0PB 4B50A 5FYKL 3D25A 4JFOA 3QUMB 4LFHD 1NLDL 4PGJA