4EDXA

Nerve growth factor in complex with fab from mouse mab 911
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNHLNWYQQKPDGTVKLLIYYISRFHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQSKTLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-nerve growth factor
publication title Generation of a high-fidelity antibody against nerve growth factor using library scanning mutagenesis and validation with structures of the initial and optimized Fab-antigen complexes.
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 51
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2012-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4edxA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4edxA01
3BZ4A 3MV8A 1WBXA 4M7ZB 4XVJL 1AI1H 1I8MB 4EIGB 4UUJA 4LSSL 5C8JB 4ZODA 1G7MA 2YKLH 2Q20A 4Y1AE 4FFVC 4YPGB 4Y19E 1A9BB 1VADB 3MV8E 4JN2B 5F1IA 5HYJA 3WXVH 4LVHC 4U4BA 4BSVA 3MBED 3QXAB 3O3BA 4I18C 1T1YA 5FYLD 5MHSD 1T5WA 2YPLB 4O4YH 1RZIB 2AV7B 2IQ9L 5I71C 5IHLB 4E9LA 1OAKH 1FNLA 5HYJE 4JKWA 4X9FA 2Z91B 1A3RH 3HAEG 1Q9LB 5GRXG 4FQQA 1BWMA 1EEZB 4BSWA 3MACH 1NCAL 1NSNH 3CUPA 5KSAD 2D31A 1HHIB 1UB5B 1CCZA 1MY5A 2HT3D 1BD2D 1E6JH 4QRRB 3C9NA 1AXSB 5SWSB 3RAJL 1DVFA 4FQCH 2WZPD 3IRPX 2GFBB 4MLSA 4F7CA 2JJSC 4NJ9H 3RY5A 3CFDA 3UTTB 5HHPA 3H3PL 1EFQA 1JF6A 4X6DB 1F8TH 4ETQA 5EZLB 3VXUB 5L0QC 3BD5A 4LLMB 3D3VA 5GS2H 3MCKB 5E03A 3S5LG 4QHLA 4G8FA 3O6FA 2BK8A 5HHXH 1A14L 3MJGX 2J2ZA 5M95B 1AIFB 2CDEA 2E8YA 1ZT1B 3D3VE 4JQIH 4BZ1H 4F58H 3LKPB 2I60H 5J1AB 2KL6A 2P7TB 4LASH 4LSUL 1RV6X 1Y0LB 1Z5LA 3KXFD 3T2NL 4M43L 2NY0C 2CQVA 1IKFH 4UILL 1U8IA 1JGUH 1M7XA 1MFEL 5HI5D 1LE5A 5DJAB 1WC7B 3S4SG 2JELH 2XKSA 4PG2C 5DSCB 3BW9B 3NFNA 4X6DF 5J12C 3QNXB 2HT2D 4D8PB 3SQBA 2FDBP 4R90H 3BXNB 4C83A 5FCUH 1ZT4B 5T3XD 4POZD 3OV6A 3TJEL 3ARGB 4MXQD 1NFDB 1N6VA 5IT2L 1GRWA 5JW4Q 3IVKA 4HCRH 4G8GD 1GPOH 3MZTA 3EHBD 4YX2L 1PLGL 3T8XA 2CIIA 3MOAL 1IFHH 1NMBL 1I1YA 4ZAKB 3BQUA 1TDQA 1UB6A 4Y5VB 4OUUA 4HJ0D 3BGFC 4HKBB 5D71H 2XTJC 5KS9B 1U3HB 2IH1B 1C5CH 1DLFH 3O41B 4K2UL 4RGND 4G80B 4LLVB 4YAQA 4Y4KB 5ALBL 3FQUA 5JPMB 5GZOD 2E9WA 5E6IC 3QEGL 4AEHL 2NY5H 1QP1A 1HCVA 15C8H 4CUCA 5EOCL 2NLJB 1CLYH 2X5PA 4FFZL 3V0WH 2OMBA 3VGEA 2ZKHH 1NGWA 1ULVA 2G5BA 3W39B 2DLFL 4AENB 1QLRA 3IFPB 3ZDXE 3Q2CA 5IB3B 4WFFE 3V6BR 1YPZB 2N1KA 4ZPTB 3SGEH 5C0NC 2CIKB 4WHTA 4Q9RH 1NC4D 5FA4B 1I7TB 3ULUH 4AH2A 4H26A 4HS3B 2YBRA 3OMZA 1PQZA 4V2CB 5E5MB 5DHVB 4HIXL 4XHQA 4D9LL 2DS4A 2X42A 3NGBC 3DNKA 4WO4A 2CR3A 3VD5A 2E7LA 4LL9A 3QFJB 4ACPA 5MI0C 4FZ8L 4P2RB 4JFQA 4OZFG 1A6WL 3E6FB 3ALXA 4K3DH 4XB8A 1KCUH 3OKDB 1XT5A 2X9XA 4IOFC 3ZHDA 4D2NA 5IB4B 2Q3ZA 3EW3B 5GRUL 4NFCA 1FL6A 3VFGH 1K6QL 4Y2DB 3QXWA 3ZSTA 2ORBL 2VZUA 1CFSA 4P3DA 4R7NB 4BKLA 3JV4B 4MD4B 3KJ6L 1JZ3A 4C4KO 1LDPL 1A4JA 3SCMD 4ERSH 1DQLL 1JWSB 3WKNA 3TO2B 1CG9B 4JJ5A 1JP5A 2LTQC 1LO3H 3KPLA 1UH2A 4EI5D 3EDJA 2DQHH 5HGBA 3BWAA 4LAQH 5KSUB 2BMKA 1DBBL 2VXUH 2GCYA 1KBGL 2G75B 1X7QA 4F7PB 3DURA 5ECJE 4U6XA 3L5WB 1KELL 2QHRL 4TSBH 5F6HI 4WW2A 4ISVA 3P9LA 2QQKL 5I1HH 1QRND 4Z7QF 1IL1B 4YHKH 2A1WH 2BVEA 5DQJA 4P46C 3KLHD 5JDSA 2ZP0T 4N9GB 4IMKC 3S9DB 3O45A 3EZJB 3RX5A 4JREB 4Y5XA 4WW1A 1BX2B 5E99H 3V0VB 2WQRA 1Z3GL 1KEML 4OLZH 1CE6B 1UKTA 3O2WL 1KC5L 5I1AB 3I50L 5EZIL 2ERJB 3FZUD 4NKIL 3ARDA 5BMFH 1XIWA 4FA8A 4UAOC 3O3EB 3HMWH 3QEUA 4HXBH 3L3HB 5I1IL 3H0TA 4Y5YC 2R4RH 5F44A 5IR1A 1G7LA 5GGSY 4P23C 32C2A 1GC1C 4LVHB 3VFNB 3PNWA 2DJUA 4I18B 2V9TA 5I19L 2VL5B 1FYTB 5EBGA 3QP3A 1AGBB 2FO4B 4F9PA 5TQ0L 1RIUH 2YPLD 5I71B 3L1OL 4NKDA 2DQUL 4YBQD 3EO0A 3B9KC 4JFZH 2GT9A 3RDTA 3WNNA 1JZ8A 4DW2L 2B5IC 3WFBL 4PRNA 4JM2C 2R2CA 1F90L 3JUZA 5TE6L 4R2GC 2OP4L 5IESH 4WENB 1A7QH 2F8VA 2DQJL 2AAVA 3HMXL 1U8KA 5IWLA 4QRRD 2YWZA 4OCLC 5GRYA 5SWSD 1BFOB 4F8QA 1MCKA 3FCTB 2Z93B 1T7XA 4QRQA 1WSST 1MRCH 3UTTD 4MB5A 3U9UA 4OGZA 4QO1A 4IMLB 4C4KT 3B43A 3UJJH 3I2CH 5L0QB 3MFGB 3D0VA 1MCOH 3VXUD 1ED3A 1UXSB 3MNWA 2X4OA 1J1OL 4FS0A 4JRXA 4YLQT 1UJ3A 3T0EC 1HSAB 5IMLB 3TT1L 2ZCKH 3GO1H 3FB6B 4N5ED 4YHLH 4XBPA 2OZ4H 1IC5L 4QT5B 5I18L 1TZHA 2PCPA 5A2IH 1KLFA 1S7WB 3CSBA 4MA7L 3MLWL 1CICA 4JRXE 4NP4H 3AREC 5I8OL 1J9CT 1D5XB 3SKOB 2NY0B 5EOTA 2Q7YA 3T4YB 3RWGA 1W8NA 4H1LG 2W1NA 3VA2C 2E6JA 4XNYH 4TSCH 5DD1H 3MXWL 3CFIC 5J12B 4HAGA 1FGVH 2PO6A 5EO0B 3VGHA 4KHTH 4M7KL 1IILE 2HT4C 3DVGA 3K0WA 4HIJA 4UV4L 5HYSB 2CJUL 3C8KA 4EVNB 4WI2A 4OCYH 3FB8A 4Z78A 4LRNH 2GAZB 1LO0H 3ARGD 5FKAB 1EFXA 3UDWA 3FRPG 2CGRL 1F4WH 3OB8A 1BFVH 4PGBA 1HHJB 3Q6FA 4KRPC 4PJDB 3MLYH 4R7DB 3IB4A 4U6YA 2AJXH 4M5ZL 1U2HA 3GRWH 2BP3A 4PBVC 4HG4J 4ZAKD 5I1CH 3UCRA 3BGFB 3L5XL 2XTJB 4G7YL 1S9WA 3SJVB 1U3HD 3BISA 4OD3L 1ZHKA 3TT3L 2R4SL 1A6TA 1HN1A 3WFHB 4Y4KD 4ODBD 5ERWB 5E6IB 3NCFB 3BAEH 4X6BB 3TIEB 4XPGH 1YYLH 3M8OH 2BZDA 1SBBA 4G3YL 4J3SA 1SYSA 3WD5L 3TVMB 4FQXA 2QJDA 2YA1A 5DD3H 1A7RL 4J23A 4KKLD 4WWKC 5C7XH 4GRWB 4OF3A 5HJ3B 1I3VA 5T1DL 4GFTB 4UNTA 1C1EL 4IOIA 3BO8A 4PD4J 4PGDB 3TWCH 3LMJH 2M1KA 4Q6IA 5AD0B 2VLME 3MUGB 4JY5H 2EDFA 4LP5A 3X3GL 1XF4A 1I7UA 3RUGA 4JHBA 3NGBB 2BCKA 4X4XA 3CXDH 2ICES 4KJWC 2ZUYA 5T1KB 5MI0B 4XHJC 1S5HB 5HD8D 3ROLA 3QFJD 1G6RH 4P2RD 4GRMA 2A77L 3D25B 2VITA 3GBNH 3T3PE 3RUGE 4UIMA 1A4KB 1HNGA 2X4SA 4L4TB 4BH8B 1AXTH 4JGUA 2BSED 4RX4D 5LGHL 3V7MA 4Y2DD 1AHWB 5C9JA 2A6JA 3L9RA 5KBNC 4Z7OE 5DRWA 3A6OA 4BFIA 3REVB 4RMWA 3N1PC 1R0AL 4YGAB 4IHOA 3QSKB 2LTQB 3B6SA 3FOLA 3DUHA 3SKNB 4K23H 3M45A 1FVCA 1BZ7A 4GAGL 1DBKL 4HFWB 2MPAH 3WIHA 3SE8L 1ZHLA 3HNTH 2VLJB 4H20L 2AXHA 4DOHB 1PVHA 4PRBB 2EYRA 5E6ZA 4P46B 3SGJC 4K7PL 1IT9H 4HDIB 2WWMD 3OSKA 4HIIB 3K81A 1PY9A 1EA9C 3UXFA 2EH7H 4K71C 2EYSA 5H37G 1P4IH 4QLRA 3CK0H 3BEWA 1MHCA 5K9JL 2GTWB 1DANU 4HGMA 1JNJA 3N06B 1KCRL 1ZT7B 1BVKB 4G8EA 4L9LA 4R8WL 4WI8A 1LO5B 4UAOB 5GRWA 4U1HA 3OGCB 3BP6A 1OSZB 3MRBB 4ZNEA 5KG9A 4WI9A 4Y5YB 4PJ9C 4L5FL 5F3HB 1T2QL 4NHUA 4FFVD 4JFYA 4Q9BA 2AJSL 4P23B 4BZ2L 4AEEA 5EIQA 3KDMA 5GIRA 4ZNEE 5I76B 5BZWA 1GOHA 4JM4H 2CUMA 5E9DB 1FYTD 1TFHA 3KNBA 3V8OA 2OX5A 2NY6B 3G5ZB 3B9KB 4YNYA 1OWRM 2Q86A 3TBSB 1RURH 3GZKA 2H26A 4G6KL 3A6CL 4X4YB 2B5IB 3LPWA 5B3JE 4JM2B 3HE7A 5GGVH 5E08H 4R2GB 1MCWM 1EAPB 4LGRB 4DUWA 4P5TC 5CGMA 1KCVL 2X4TA 4YDJA 5IV2B 5E56A 1AD9B 4JLRB 2OTUA 3RA7H 4P3CH 4Y16A 1YNKL 4S1RH 4EZMA 1AY1H 4MNGB 2R9HC 4LQFL 1FO0L 3VXNB 4OQTH 2MFNA 1BVZA 4N8PA 2FZ3B 2X4QB 1SM3H 4J3UA 4TUOA 2ICEA 2DQGL 4PS4H 1CYGA 3T0EB 3G9AB 2DMKA 1LP9A 2VDPH 5JHLL 4JANB 2VZOA 3WSQH 3FO1B 1G9NC 4YPJA 4E42B 2YXFA 5GSRB 3EOAB 4H88L 4P2QA 1UFUA 3AREB 3HI1A 4OFKA 4X6CA 3GUTA 4OIBA 1LP9E 5EBLA 1YNTA 3UTPE 4KZEH 2NY0D 3OB0H 4P2QE 4DZ8A 4RFEB 4FN0A 4MQ7B 5EZJA 2FECL 4X6CE 3P3YA 2WK2A 4CW1A 5I2IB 3L5IA 3H6JA 4PJGA 1D9KA 5ID0B 3TBYB 1XR9A 5C3TA 5KSBA 1F45A 4A2MA 4NHCH 3PL6C 3NCYP 2NXYC 3RWDB 4FQPA 3ULVH 1VB9A 3EDDA 4WCYH 5E8NA 3RU8L 4KRPB 2YSSA 4PJGE 5DRZB 3I9GH 4ZUSB 3SHSA 1I75A 5FO7B 3JTTA 5KSBE 2D0GA 1PZUB 1FC2D 4XAKE 3SDYH 3AM8A 4HPYL 3ILPB 5FK9A 3S96B 4QXGH 3HCVB 4OM1L 2SEBB 1S9YB 2XTJD 4NKMA 4DVRL 3DVFA 5C6TH 3S35L 3SJVD 2Y06L 4XVTL 4PJ5B 4UB0L 4JKPL 3V5KB 2K1MA 3QO0A 2DTMH 3L3OA 4GAYB 5E6ID 4GG6A 2H32A 4U3CA 1T20A 3EYSL 5CBEB 3F6LA 4RQQA 5EN2A 4PJAB 4KHXH 1DBMH 1QYGH 3E8UH 4FTVA 3ARQA 1XZ0A 2QQQA 4LEXH 3TVMD 3T4AB 3VMPA 4WWKB 4GG6E 5TF0A 1U6AL 1FNEA 4PJXA 1P9MA 1QBML 1XCTB 4H5SB 5C0ND 1FDLL 1V7MH 4QF1B 1U8PA 4FTVE 4JN1L 1QSEB 3PGDA 3WL9B 4LCCA 1R24A 1A7OL 2JJUA 3SY0A 5BZDA 4NC2B 4Z7WA 3WFCH 1A22B 4YHML 4HKZB 1TQCC 3C5ZC 4PJXE 2BY1A 3GK8H 4NYLA 5T1KD 5HGAA 4Y4FA 4Z7WE 2BHZA 3P11L 5E0QA 5IHUH 4GMSH 2EIEA 4DN3L 3S37H 4Q97A 1RULH 3QZWB 4KVNL 1MFBH 4DKEH 1F4HA 4IOFD 4PGZA 2F8OA 5IB5B 4L4TD 1KIPB 4PP2B 2KH2B 5CEXA 2DWEA 2QR0A 4LCIL 4XWGL 2YK1H 3DUUB 4QHMA 4U1MA 5F7FA 5DZNA 3VXMB 4QXTA 2HH0H 4MNQA 3BN9C 3TNNB 1VKXA 2AQ1A 3CPLB 5ETUB 3L5HA 3BFOA 5M7QA 4M02A 5HY9B 4MNQE 1IQWL 4NN6C 1A2YA 2Y5TA 4G43B 5IG7A 3GHBH 2C1PA 3PE9A 1FZKB 4F57L 2BNUA 2BNRB 5HYIA 5C0RL 4HUXA 2VLJD 3RVUC 2FIKB 1DEEB 3LS5H 5F7YC 4P46D 5FYKL 5EO1B 2EDEA 3MJ8A 3JUYA 1OARL 1QR4A 1JF1B 4D0DB 1F00I 5DJDA 4K71B 1YEJH 1OAXH 3RX8A 2OR9H 1CFVL 5FUOH 1CLOL 3OAUH 3U7AA 3HI6L 5CEZL 4YZFE 3KPQA 1CTOA 3NPSC 2EE9A 3WEXB 2CD0A 2YUWA 1HI6A 3FRUA 2HG5A 4QTIL 3DX9B 4ODWB 4F7TA 3RWIA 4DAGH 1XH3B 3RPIA 3O2VH 3V8CA 2D9QB 3OX8A 4ONGL 3RY4A 2YPKA 2GJJA 4JAMB 1CFQB 1SBSL 4UT9H 1H5BC 1FFOB 1NGQL 1RHHA 5FOBB 4P23D 3QUML 3AAZA 4HV8B 3FFDA 1DBAH 3MC0A 1EHLH 1T1ZA 1S7UB 1KLGA 4WTZA 1T83A 4OZGB 1AD0A 5I1JH 2DQIH 1Z0NA 5E9DD 1EO5A 3QQ4A 4IRZL 4EIZC 1G1YA 4XC3L 2DQCL 2Q8AH 1JUFA 2NY6D 3B9KD 3MA7B 4WVRA 5IBUB 4XCYA 1I3RA 5MEQA 2R2EA 4JQXA 1Z9MA 2X4PA 3QUYC 5D7IA 5L8LB 3U6RB 4JM2D 5ICXA 4HWBH 2VKWA 4FQIH 4R2GD 5AZ2H 4P5TB 4EN3A 5KW9L 1H0DA 1YEFH 1TTGA 4NQXA 3QBTB 1CFNA 2IANB 2JKXA 2VH5L 5D7IE 1JPSL 1NBVL 2X09A 3QPXH 4GKNA 4NZTL 5FECA 3TCLB 2APWA 1WJ3A 5INCB 2HN7B 3RVXC 4P9HH 3KYOB 3JWDC 4XVJH 1O5DT 1OTSC 4P4KC 5C0IA 5LKNA 4LSSH 4PLOB 2BSRA 2VR5A 4HC1H 2AEPL 4Y7MA 3T0ED 25C8L 4MA8L 3VRIA 3SGDI 4HS6A 2CLZA 1KJ2A 3VFMB 6CGTA 3QIWC 1MREL 4X6FA 1UZ6E 3ARED 4M6OL 1T22B 2IQ9H 3C6LB 3E6HB 3L3DB 4ODVL 2R2BA 3RVWC 3MUHL 3E2HC 1B0RB 1D5ZB 1JMXA 4U2YA 5D7LA 5HI4C 4ORZC 4NQEB 4HS8L 2AJVL 2IPKA 1TVBA 1NCAH 3IKCB 3VI3F 4NO2A 1BJMA 2HT4D 4MA3A 3U0TB 3RAJH 2QKIA 1CXFA 5D7LE 5HDBE 4ZUWB 2VDOL 2NW3B 3H3PH 2NXYB 3PL6B 2VXSL 2XFXB 3MREB 5T33L 4KRPD 2DDQL 3QH3A 3H8NA 3RWCA 4D0CB 1QVOA 4N0UA 4D94A 3ZYOA 3P77B 1TLKA 1AE6L 5E2JA 5EPMA 3PQYB 4U7MA 1A14H 3A6BL 5IQ9A 4NRYB 3MV11 3UTSA 4N8VA 43C9B 5J0BA 4N0UE 5BW7C 3L7FA 1DE4B 3DSNA 1A3LL 4PJ5D 4L3EA 5B39B 3WS6A 1NCNA 3LOWA 1FLTX 4LSVL 4LSUH 5FUCE 3O81A 3LQAC 1OPGL 3UTSE 1A1NA 4IRJC 4OLUL 4M43H 2CO6B 3GIVB 2C9AA 3TESA 2G9HA 3K8LA 1MFEH 3BMVA 4L3EE 1DL7L 2EIBA 3NIGE 1PEZA 2O61B 3UTZB 3FQXB 4WWKD 4KTEL 4ZUUB 4X5WB 1MCQA 1BZ9B 4I5BB 4MSWA 1IAOA 2R0WL 5IFHL 3TJEH 1QSED 3LQZB 4QRUB 1T0MB 4KRLB 4UV7L 3HR5A 3I3EA 2CRMA 3ARFB 1BJ8A 2J7LA 4TYUA 1TQCB 3C5ZB 2EIDA 1MIEL 4CJ1A 1UCBL 4YX2H 3WO3B 4NDMB 1PLGH 5L88H 3MOAH 4KJWD 1C5DB 2ATPA 3P4OA 2J12B 1NMBH 2VLKA 4XHJD 3ZE1E 1UEMA 4D3CL 1FG9C 4ZMAT 4X9GA 4E5XB 3I6KA 1G7PB 2OL3B 4RMVA 1A9EB 1BQLL 1G9MC 1CGYA 4K2UH 1JGEB 2HJKA 2VLKE 4C57C 3PJSB 3DOSA 5ALBH 3VG9C 3MJ9L 2JJWA 5D72L 3QEGH 3ARVA 1QD0A 1EZVY 3JV5A 1KG0A 3IRZA 1YJDC 5EOCH 3OAZK 3VXMD 4ELKB 4D9QD 3LRHA 4FFZH 2QEJA 5C0GA 5JQ6L 4Z76A 3HZKA 2DLFH 5B8CA 1QZ1A 5DJ0A 4E41A 3CFBB 4MWFB 3OG4B 4LLDA 4NN6B 1Q8MA 1OP5H 1FLRL 4S1SL 1BAFL 3ZE0E 2I5YL 3P4NB 2BY3A 2H3NB 4HIXH 4EQ3A 5IOPA 4E41E 2BNRD 4M00A 1A21A 2OI9C 1CGSL 2VWEE 4D9LH 5ENWA 4J1UA 3Q48A 1L9MA 1MJUL 3BEVA 4FZ8H 4XX1E 3WDJA 3NFPB 1GOGA 4JG0H 5F7KC 3ULUE 1A6WH 5GISH 2FJGA 3B5GA 1LILA 1CL7I 5JLZA 3WHE0 1T89C 2FJHA 1U3ZA 1UQSB 4XGZB 2VERN 2ZUWA 5GRUH 5DQ9B 3NPSB 3LRSB 1K6QH 1OF2A 1OGTB 5JMRA 2YD4A 5D7KE 3GB7A 2ORBH 1K5NA 2EYTA 3MRJA 5CJOL 5SWZA 3F62A 5TH2A 2ZUSA 5J4MA 3KJ6H 1T1WB 3DYOA 1LDPH 5LAXB 1PKQA 1CDGA 2PTVA 5J6GA 1DQLH 4A6YH 4ODXB 5SWZE 1ETZB 1GL4B 1Q9KB 1H5BB 5D6DC 1ONQB 4ZOEA 1DBBH 1PKQE 3NA4A 2CXGA 2XWBA 1YEDA 1KELH 3ABZA 1OTTC 3QDJA 3OJMB 1Q9WB 2QQKH 4ZFOL 1CQYA 4Z7UB 2D0FA 1EVUA 1C7TA 4HUWB 5D8JL 5F89A 1OCWL 3QXUA 2BVOB 2WWKO 1S7QA 3QUYB 2R29L 3MGOB 3QDJE 3U46B 12E8L 5BV7C 1FHGA 3I6GB 5DEFB 3SOBL 3H9HB 1FNGB 2VJXA 1ZVSA 5DMKB 1Z3GH 4JFHE 3C5SA 1KEMH 4P5TD 2XKUA 4LPXA 5ABDE 4I0PA 3ZSSA 4L8BB 2VAJA 1F11A 2IAND 3O2WH 1KC5H 3FT4B 2NW2A 3I50H 4K8RC 5JXEA 5EZIH 5B21A 4NKIH 1BJ1J 3CVHL 1RAMA 1YUHB 2R9HD 2X7LA 2Y7QB 4QGTA 3QB7C 5TJWK 2GJZA 1S5IL 4P4KB 4PD4K 1CU4L 3MPCA 1BQHB 5I1IH 4JO3L 5FA3A 4OF0A 1A5FL 4G8IA 3U9PL 4F7MA 5DUBB 3DJ9A 4JDTL 1R3HB 4JEGB 3STZB 3I75B 1Q9OB 3BN3B 2DWDA 3QIWB 2I9LB 5I19H 2AKRA 3BDYL 1TJIH 5TQ0H 1OL0A 5EU6B 3L1OH 2DQUH 2D7PA 3C6LD 4KUCF 4X99B 4H8WC 1X5IA 3E2HB 3NCYS 2PR4L 4LRIC 3ROOA 3WFBH 4PRHB 1F90H 4NQED 5TE6H 2OP4H 4BQ6A 4RGOL 5F1NA 3QEHA 2DQJH 5I8CA 3HMXH 3QJFB 3F7RA 3SO5A 3L3KA 3H3BC 4MJ2A 1X4YA 1VDGA 4HJJL 4W70A 5C0JA 4PTUA 1W72A 5BCAA 1AFVH 3PL6D 2NXYD 1AKJA 4YIQA 3T0AA 5BQ7B 1PEWA 4EJ1C 3LB6C 4HULB 1H15B 3UPRB 5CIPB 1U92A 3O6KL 1NJ9A 3CC5B 4DGIL 3UTOA 2AXGA 3PQYD 5DJ2B 3TT1H 4PTTB 4KJPC 4RAUB 4ZO8A 3VH8B 1K4DA 1IC5H 5I18H 4WTZG 1HH6B 1FNFA 1A1MB 1OD9A 4WNQA 2H9GB 3RNQA 4MA7H 3MLWH 5I8OH 3IU3B 5D93C 3WKML 3B83A 3BUTA 4KDTA 4IRJB 5EA0L 2OL3L 5M94B 5IHZB 4MDIB 3MRFA 2WWKT 4L4VB 1NKOA 2P5WA 5I16A 3MXWH 5IB2B 1R5WA 5ITFA 4M7KH 1CT8B 3LPGA 1CFBA 4PB0H 2CJUH 1U93B 2V2XB 1TZIB 2P5WE 3TM6A 4HX1B 5I15L 4AEFA 2MMXA 1HXMA 2CGRH 3ARFD 5J9PB 5EU5B 5CD3B 5MENA 3C5ZD 3NCJL 2FWOB 5GRVK 2AJUL 4GG8B 4M5ZH 3VD7A 5D1QA 1VCAA 1E4KA 3TBWA 4K94C 2GSGB 2CPCA 3BZFB 4KUZL 5DC4B 1N64H 5MENE 5JR1L 2DTSA 3L5XH 5IVOA 3MV7A 5DHVH 2IADB 2QBWA 4NO3A 3W2DH 4J6RH 4OD3H 4GUPA 3QXDB 9CGTA 3TT3H 2R4SH 5IVXA 1G7IB 3QWOB 3RVTC 5J6HA 4NT6B 3MV7E 4U6TA 1FFPA 2DLHA 2MCPH 5C0BB 5JIPA 4QOKB 4G3YH 1BOGB 3G5VB 5HVWA 1QHPA 5IVXE 3WD5H 3BN9D 1AO7B 1BLNB 3DGGB 1RY7B 1A7RH 1ZLUK 1K2DB 5F3BB 4OZIB 3CFKB 1IARB 1N26A 4JCLA 5T1DH 1RUML 4KU1A 5CBAB 1C1EH 5E00A 5F70A 1CI5A 1U9KA 2DI8A 4F7EA 5JZ7C 1NGPL 2EDQA 3RZCA 3ZDZF 5LQBL 2DOCA 2J1KA 5CILL 5F21B 3OR6B 4KK9C 2OI9B 3X3GH 3EOBB 1DDHB 2W38A 1IAIL 1M6OB 3RVUD 4XCNA 4R3SA 4GAFB 3D87B 3MZGB 1AR2A 4JFEB 2A77H 4X80L 3SPVB 1S7SB 2X1OA 4BQBA 1DBJL 4ENEC 2PN5A 2KZWA 3CX2A 4ZO9A 4Z5RB 1JWUA 3L3IA 4HD9A 4RA0C 2ZJSL 4OF8A 4OZIF 2I07A 3OHXA 1QFWL 4CMHC 3FQNB 3Q5TA 5EUKA 3TA3C 3QNYA 3DMMC 2O5YL 3QQ3A 4PYGA 4X9IA 2GY5A 3OQ3B 4R4BB 4Y89A 3FB5B 1VGEL 1AGFA 1TITA 1G0DA 3GSQA 1GJIA 3L3GB 3UJIL 1SY6L 3X13B 4TVPD 3QFDB 4I9WE 1RK0B 4GAGH 2DM4A 3MGTB 1DBKH 1AC0A 5BXFA 4LKXA 5HGHB 5KVGL 2Z8SA 3GSVA 4H20H 1OW0A 3STLA 1ZXQA 4K7FB 4AZ8A 4N8CL 7CGTA 1ORQA 3DPBA 2IALA 2EKSB 3RWFB 3IYLW 4Z9KB 4TTDC 3QUYD 5IROC 5BV7B 5FGCB 4RGMB 3UZQA 1DUYB 5IF0B 5IMKB 3BPLC 2V7NA 1CDBA 4U2ZA 3IS1X 3PDGA 1J0YA 1ZHNB 5K9JH 1X5XA 1JNLL 4KUCD 1HEZA 3IFNL 4LLAA 3ZE2F 1SEBA 5FYJL 3H9ZA 1R3IH 2ZUXA 4KK8C 4OGAD 4R8WH 5D5MB 3DWTA 1M7IA 1A6PA 3RVXD 1RJCA 3LKNB 1MUJB 3HC3L 4GW5B 4BFBD 4P4KD 1OTSD 2AV1B 4PLJC 1XR8B 4L5FH 3ZDYF 1TETH 4BQCA 3L3JA 3R1GL 1T2QH 3GJEA 2XWJA 2AJSH 2QTEA 1NFIA 2FHFA 4BZ2H 3T0WA 3VFVA 3MYJA 4M62L 5JNYB 3DTXB 3QQNA 3GMQA 5F9JA 3MV9B 3QIWD 5DEGA 1QSFB 4XX1G 3EDFA 1I9IL 5J57B 4Z0XA 3WHXB 4R97C 2H45A 4MCYB 3TGXA 2HA1A 4QCIB 5EU6D 3RTQC 4QRSA 1WIOA 2GUOA 2NQCA 2WINB 4IEFB 4XNUL 4G6KH 3A6CH 3RVWD 2AABL 5HI4D 1TZGL 4JCMA 5HBBA 4UQ2B 4KJQC 5FYJD 5HHNB 4PRHD 1J8HA 1EX0A 5D5MF 2X1PA 3KWWB 4RMTA 5ANMB 5ESVA 5LVEA 5KJRL 2OTWB 1KCVH 1XGYL 1CXHA 2F54A 4RAHA 3TN0A 1G0YR 5INDA 3GMRA 5DHYA 3VCLB 2E27L 3K46A 1J8HE 2GITA 4P2YA 3S34L 4S2SB 5BO1L 3FL7A 5FDYA 3HAEB 2PYFB 4LQFH 2BC4A 2NNAA 5D1XA 4PV8B 2F54E 3T0DA 1U8LA 5CSGA 1FNHA 4GO6B 1I8IA 4Q7DA 4ZQKA 5DRXA 1FV1B 3CLFL 4OQTA 1FYHB 1F6FB 2FSEB 2XN9A 4TVSa 5JHLH 2VN7A 5EZOH 2OM5A 3KPSB 4OLWL 4H88H 5E8OB 1NGZB 4N90E 1F6AA 5D93B 2XN9E 4N0FB 1KJMA 3LEXB 4IRJD 1G9ML 4EUPH 4L4VD 1RK1A 2VB5A 2YUXA 2VISB 3CZJA 2ADFL 3GJFK 1YEKH 1N5AB 3C87A 4X8JB 1UWXH 1HOCB 3BGMA 2MQ3A 2Z8RA 4FZEL 1ADQL 5E95B 3FAXA 3AVEA 4YHOL 2MWCA 3RU8H 5C9KA 1PGRB 4NO0A 4BA8A 3S4SB 4ZPVA 5GGSA 3NIDE 3CD4A 4WI4A 3VE0A 3MCLL 3GMOB 1I4FB 1T7YA 2E5EA 4DKFL 4OM1H 4QNPF 3ZKXC 2DYPA 3RGHA 4ZDHA 4DVRH 1N4XL 4XPAL 2V5SA 3S35H 1YYML 1S7RB 3S3SA 1MWAB 2Y06H 4HHAA 5T1MA 3ULVE 1DQQA 5GRVL 4UB0H 3F58L 4LF3B 1KJVA 3QEQA 4JKPH 4J3XA 3JWNC 1C5BL 2DICA 3FQWB 4HPOL 2ENYA 4G5ZL 2IPTL 3PWPA 4Q0XL 5C0EA 3EYSH 3FHQA 5C0BD 2CRIA 3L6FB 4QOKD 5IFJB 2E9BA 5I1DA 1JK8B 5F1OB 2JIXB 3QEQE 5FHAL 1AO7D 4NUGL 3VRLF 1HHKA 4B7IA 4HEPG 4U6HB 5C70A 1U6AH 1NKRA 3PWPE 4F33A 2VR4A 1QBMH 2X6MA 1QEWA 4N0YL 5H2BB 3UO1L 4JN1H 3LKQA 1J7VR 1A7OH 4JDVB 4N1CA 4QRTB 4YDVB 4YHMH 2ESVA 5AYQA 3DO3A 1XGTA 3FQRB 2RHEA 1ZSDA 3QISA 4B53A 2EKJA 4QHUB 3GSNL 3T65B 1E28A 3BGAA 4MJIA 1C12B 1F3RB 2ZCLH 1CZ8L 1GIGL 3QWRD 4NFBA 3KPMB 4XZUA 2ESVE 3P11H 3N85H 4JFED 4DN3H 1WCBB 3VG0L 4KVNH 3ZT6A 1ZGLB 4PJFA 3O11B 4HKJB 4MJIE 5EU4B 3GSRA 5CUSL 3RY6A 4LCIH 2K9UA 3HC4L 4PJ7B 4XWGH 3AGVA 5FM8A 4CMHB 4WEUD 4PJFE 3TA3B 3HG1B 3DMMB 3PDOA 2YZ8A 3O6FC 2V2TB 5EC2B 1RZGB 5BVJA 5FGSA 4OZFB 2ZOLA 4JFXA 4ZTOL 5ALCL 3MNVB 1FZJB 1RVFH 3BP4A 5IGXL 1Y6NR 1IQWH 3BESR 1CFTB 1II4E 1CK0L 4NWTL 4F57H 5E2VL 1HYRC 3A0OA 5DLML 2XZQL 1ES0A 1OTTD 4J4PC 2GYSA 5C0RH 1IGYB 1FL5A 2XKNA 1E6OL 4XVUC 3KPRA 3BHBB 5DVOA 1JPGA 3ISWA 2E6QA 5FYKH 4YC2C 3GMMA 4PR5B 1AP2A 4U3XA 2P46B 1OARH 1D5BA 1EUTA 1S7VA 1SQ2N 3LPFA 3BPLB 1CS6A 3KPRE 5EBWA 4NIKB 2FO1A 3FT3B 1CFVH 4GOSA 4R4NC 4GW1A 1CLOH 3HI6H 5CEZH 2AJZB 1S9VB 2PYEA 4K8RD 1X5LA 1HCFX 3GI8L 3CDGA 2O93L 4QTIH 5L7XL 1YECL 3QI9C 1KNOA 1WBZB 1JGVL 2GSIB 1NAMA 2PYEE 4U7SA 4WDIB 4N1EA 3O3AB 1W0VA 2XQBL 5EORL 1ZWIB 1CXLA 1I7RB 4KI5F 1SBSH 3QG6A 3MLZL 4O2CA 4ODUB 3QG7H 1NGQH 3QCUL 2J8UB 3QUMH 3T0BA 3C8DA 4U1NA 2A6IA 3V4VL 1PW3A 1PG7W 4Y0GA 1NDGB 3MV9D 1QSFD 2A74B 1F4YL 4P4RB 4R97B 4FQ1H 5D9SB 1N59B 4IRZH 4NO5B 1QR1B 1K8DB 2LFGA 4XC3H 3RTQB 2BFVL 2DQCH 5HHOB 1TPXC 3ALWA 1UH4A 4XPBL 3P9MA 3EO9L 1FVDA 4Q9QL 1QFUL 1UM4L 5F9AC 2B4CC 4U05A 1OD7A 5KW9H 1AGCA 3MBEA 4MX7A 3ARYA 2HJLA 2VH5H 2CLVB 1JPSH 1NBVH 3I3DA 1MHHA 3W9DA 3KLAB 4WO4C 3CSYB 2XNAB 4X7EC 3F12B 2DQFA 2J8UF 1T03L 3SN6N 4YR6B 5F7DA 1FORL 1E0OB 5FYLE 4Y2OA 5MHSE 3GI9L 3O3UN 1QSVA 2FD6L 5H35B 3LB6D 3VMNA 3UPCA 1XCQB 1BD2A 2AEPH 4CVXA 4M8QA 25C8H 4MA8H 1KPUB 2XICA 5LG1A 4TTGA 2Y07L 4KJPD 4HC1A 1MREH 3KPSD 5I1EL 5KOMC 5CSZA 4L8CB 2HVJA 1BD2E 2RCSH 4LPTA 1CVRA 4M6OH 5C08B 4LLQA 3C6SA 2LV4A 2IC2A 5HGDA 1I8LA 3CCHB 2W0FA 3VFUA 3VRJB 3GMPA 4HS8H 1N6QL 2AJVH 5DK2B 5JW4M 5I73C 1TCRB 4L1HA 3OKMB 1N6UA 4MLIA 1VFAA 4X0KB 4POYA 4WJ5A 3RL2A 1FAIL 5CD5C 1C16A 1KOAA 4RZCA 1PZ5B 1IC4L 4QGYA 3VFTB 2V7HA 4PREA 2VDOH 3KXFA 1Y6MR 2VXSH 1D5IL 3O8XA 5T3ZD 4U1SB 4H1LB 3U30C 3FT2B 5GJTH 4ELMB 5I1KL 4PGEA 3WIFB 1QO3B 2DDQH 2RR3A 5ILTL 1X5GA 3L95A 3VFPA 4ORGA 1INEL 3KXFE 1SHMA 1UJTA 1AE6H 2YEZA 3IJSB 5JW5A 3KYKL 4AK1A 3ZKXB 2A6DB 5GPRA 1P2CA 3KPPB 4KKBC 3KYAA 3T0XA 2V17H 4BH7B 3MRCB 4Y1AB 3ARDC 4PJHF 1A3LH 4G8GA 3RVTD 5C09A 4M3JA 4LSVH 5T3XE 1WBXB 2I9TB 3QUZB 3BDXA 1BZQK 2EEAA 3NZHL 1T4KA 1H3GA 3ESUF 1GZPA 1DL7H 4G8GE 5HHME 5C09E 3SE3C 4DZBA 2JIXD 4LQ1A 2E6PA 4GSDL 5F1IB 5E1AA 1NANI 3EJYC 2W65A 4KTEH 3N50A 4JRWA 3SKJL 3MRDA 4L8SB 1JRHH 1T1YB 5IFHH 2R0WH 4GKSB 3V6FA 5DJ8A 4NNYA 5FAAA 4FXKA 4UV7H 5JZ7D 1JJUA 2EDYA 3OKKB 4KK9D 3GMNA 4MCZB 4RGNE 1MIEH 1UCBH 4FQQB 1M7DB 3ARZA 4BSWB 3B5TA 5K33A 2YC1A 4X6EA 3CUPB 8FABA 4G9FA 4OV6F 4D3CH 1JN6A 1UGNA 4H0IA 4BFGA 5IWLC 1JPFB 2NX5B 4RAVA 3WNLA 1SMAA 4F7CB 2J88L 4ENED 1NC4A 1TVHA 2C7UB 4HGWB 1OM3L 1RI8A 4G9FE 3MJ9H 5IW1A 5D72H 1AQDA 1CIDA 2HFEB 4QHLB 4XTRC 2XT1B 3O6FB 3TA3D 1MHPL 3HG1D 3QRGL 3MSPA 3JWOL 3DMMD 5JQ6H 3ZYJA 3AY4A 2X70B 3MROA 2GK2A 4OI7A 3BD3A 3C2AH 1SYVB 4ZUVA 2FYYB 1FLRH 1MPAL 2IAMA 4HUUB 4S1SH 4YHZL 1BAFH 2HKFL 4I48A 1Z5LB 2I5YH 4NN5C 4DGYL 3HPLB 1OSPL 3HS0A 4XMLL 3AXLA 2ED7A 1FFNA 3SCMA 1V5JA 1BIIB 4S1QL 4YUEL 1MJUH 2FX7L 2PO6C 1HXYB 4YC2B 3FO0L 4TTDD 1EGJA 3ILQC 4M1CC 4KJYB 4EI5A 1BPVA 1I1FA 4NCDA 2OJEA 2K7QA 1NEZA 3PHSA 3IVKB 3UDWC 1GZQA 1Q72L 2BOCA 1SMOA 1P1ZB 1S78C 3BYTA 3UEZA 4S10A 3MQIA 3T8XB 4F37K 1QRNA 1L7IL 3GIZL 3OKOA 3PF2A 4KK8D 2IMMA 5CJOH 4QTHA 6FABH 1UB6B 5IW6B 3QI9B 5KSVB 2YD1A 5D2LA 2DMCA 3RWHB 3T2OA 1YY8A 4JY4A 5EO9B 5CLTA 1GAFL 4PLJD 3KHQA 1QRNE 5EU7C 5IIEA 3ZTJH 4YAQB 2VLLA 4EBQL 3R0MA 2BNQB 2HWZL 4IIQA 2ZWLT 5A16B 5D2LE 4A6YA 2Z92B 1NFKA 3F5WB 5ADPL 5EUOA 3PDDA 5I1LA 4UIKL 2BVUA 1NGWB 3UMTA 4CBPA 3RTQD 1TPXB 1HWGB 5HHOD 1FE8L 1UACL 5D8JH 1I8MA 1OCWH 1WV7T 3MLRL 4ONFL 1V3LA 2R29H 4LBEB 1R3LB 2EDXA 2ZG2A 3QIUC 4KJQD 4U1LB 4WHTB 5EUOE 12E8H 4LSRL 3SOBH 1A9BA 4Q6IC 1VADA 1MVFA 3PG2A 4RBPK 3QXAA 4PYHA 1K4CB 3TO4C 1Q0XL 2YPLA 4WO4B 1YEHL 4AM0B 1S9XB 1GVIA 1WIUA 3CVHH 5F93C 4QEGA 1LE9A 2FECI 2ICWI 3EYVA 3ZDXF 2XWTB 1GGCH 1Q9LA 3X12B 1S5IH 1EEZA 4Y88A 1CU4H 2YPLE 5DVKA 1S3KL 2A83A 4JO3H 3P30L 5E6YA 3SDDA 1HHIA 1UB5A 4LCWB 1A5FH 3U9PH 1AXSA 4HMCA 2D7QA 4JDTH 5SWSA 4ZO7A 3WFDH 4P3DB 4PB9H 3UTTA 4ETYA 3BH9B 3BDYH 4X6DA 4OFYD 5SWSE 5EZLA 4OSUL 1NUNB 5C08D 3MRQA 3VXUA 3TCXA 1Z6JT 3CU1A 4GBXA 4LLMA 3UTTE 3MCKA 2PR4H 4KAQL 1B6DA 4LNVA 3KPLB 4X6DE 2VZVA 4F37F 1MF2L 5ID1B 5I73B 1EXUA 1AIFA 2QLVB 3VXUE 4E0RB 3DURB 5C0AA 1ZT1A 3ARRA 1KACB 4HJJH 5JIIA 5J1AA 2IBBA 3KYNB 2P7TA 1Y0LA 3U30B 2DQEL 2ED9A 3HUJB 5C0AE 3WNPA 5JDSB 3O45B 3VWJC 2XV6B 1WC7A 5DJAA 3P4LA 5DSCA 5DFVC 3BW9A 1S7TA 2UVEA 2VTFA 5CZKA 3O6KH 3QNXA 4S0SD 4D8PA 3MODL 1DSFL 1FZOB 3M17B 2XG4A 1EEUA 2GK0B 1IEAA 3U4EA 3BXNA 5CJ5A 1G6RB 1A0QH 4G7VL 3LKRB 3ARGA 4FFYL 3ARDB 1NFDA 4L3CA 5BJTB 4OKDA 4L9LC 5A2KH 4Y1AD 1BBDL 4OQ1A 1EHNA 4UTBH 2J3SA 3WKMH 3QIBC 2IF7A 5EA0H 3QEUB 3OG6B 2OL3H 3QUZD 4UTAL 3H0TB 1KEGH 2WUCL 1NUFA 1NFDE 1PX4A 4GRLC 4ZAKA 2VR9A 4Y5VA 5DJCB 3HUJF 1HZHL 1N5YL 4WFED 4HKBA 1L0XA 1EIBA 1F2QA 3ZYZA 2IH1A 5KS9A 4U1IB 3LAFA 3SEPA 3O41A 1A7PL 4LDEB 3DROA 3X3FL 3BKML 4LLVA 5MEPB 4Y4KA 2R1XB 3ZKMC 4NKDB 5JPMA 1KPRB 5KS9E 5FGBC 2BHYA 2NLJA 2ATKB 2AJUH 4RRPA 5FGRA 2E3VA 3MUJA 1CDJA 1YEIL 3W39A 4MNHB 2NY7L 3V6ZB 4AENA 3GBLA 4KUZH 3MRGA 4O9HL 1JNNL 5IB3A 3EYQC 5JR1H 2ADGA 1D6VL 1YPZA 4ZPTA 2NX5D 5D7JA 1QUNA 2CIKA 5L2KA 1R5VA 1FRGL 5FA4A 4L29B 1I7TA 4I4WB 3ZYIA 2APTA 2LE9A 3KAAA 1YC8A 3WFEL 1I1AA 4NQDB 5DHVA 3SDCA 3WJJA 4JHAL 4APQC 2ADJB 1LEIB 4OZHA 3O9WC 3ZTJG 1YPZE 3ARSA 1BQUA 5L2KE 4XBGB 1G7QB 2X4OB 2H6PB 3V4UH 2AK4B 3O6FD 4PBWD 1RMFH 4V1DA 4OZHE 4JHWL 3IDYC 1SJXA 3E6FA 4JPKL 1CBVL 3P4MB 4XNMB 4XBPB 1KTLB 1J5OL 1RUMH 1TZHB 3OKDA 3ZLQC 3IDUA 2XACC 3TP4A 4DVBB 5IB4A 3EYFA 4RX4A 5E1HB 4V1DE 3MLSL 4NN5B 1NGPH 1UWGL 3OAZH 4Y2DA 5LQBH 5CILH 4R7NA 4J4PD 5HYQB 3JV4A 4MD4A 4HUMB 1IAIH 2YRZA 1K8IB 4XVUD 2FX8L 1OAUL 1DZBA 5ESQB 2PO6B 4HK3N 4M7JH 4X98A 1T0NB 4ESKA 4HIJB 3TO2A 1CG9A 4X80H 1P7QB 4H0GA 1H3XA 1G84A 3IF1B 1MFCH 4HZLA 4R4ND 2G75A 4L3AA 5KOVC 4F7PA 1DN2A 3L5WA 3Q6FB 3EOTL 2ZJSH 4BELD 1DTUA 1QFWH 1KYOJ 3OXRA 4PG9A 5TF1L 3X17A 2D7TL 3Q3GA 2B4CL 3QI9D 1B0GA 1JYWA 2CMRH 4TPRL 5F8RC 4ZTPL 4P9HC 2VXVL 4LSQL 1VGEH 3CXHJ 2N56A 3LSOA 3UJIH 2EZ0C 1SY6H 2CDFB 1CE6A 2BNQD 4XT1C 5F9WC 2Y25A 3S88L 5I1AA 2N4IA 2R2HB 4WFFD 1PKOA 4P57A 4NQVA 5KVGH 2Y23A 1X5KA 3MLUL 4Q74A 4N8CH 3O3EA 4WWID 3L3HA 3PHOB 4O58H 3QIUB 1KULA 4IOIB 4MQTB 4WY7L 3TV3H 4R0LC 3DBXA 4Q6IB 3MR9B 4KKAC 4Z18A 3VFNA 3F65A 3O6ML 1QACA 3TO4B 1JNLH 4CVUA 2VL5A 1FYTA 3IFNH 1I7UB 3RUGB 4D0BB 3N1QC 1AGBA 2FO4A 4X4XB 5FYJH 4WO4D 2H8PA 1SJHB 3ROLB 1EDQA 4PJCB 4DCQB 3U7WL 4OLXL 3HC3H 3UPAA 1FYTE 4UIMB 3VI4F 1ODAA 3BIAX 4W4OA 4JO2L 1F3JB 3UBXB 3R1GH 3ARBA 4LCWD 43CAA 3ZO0A 3SDAA 2BVPB 2JB6B 1BFOA 2JJSA 2Z93A 4DFIA 5C9JB 3WMSA 2BVQB 3L9RB 2P43B 2N7AA 1R6VA 4BFIB 3T09A 4YDLC 3BH8A 5DJZB 4CU8A 4IHOB 3T3PF 2D03L 2BJML 3RUGF 1UXSA 1X5YA 3B6SB 3OJVC 2KBGA 1TZGH 2R15A 3FOLB 2UZIL 3F7YA 1HSAA 2R0LL 5IMLA 1BZ7B 4PJCF 1JPTL 1NEZG 5C92A 5C2UB 3FB6A 1GGYA 4ZSOB 5KJRH 3LQAH 3PWLB 1XGYH 3G5XA 5I8KL 5CD5D 4QYOB 1S7WA 4Z7OF 4AG4L 3S34H 2GEEA 1I9JL 5BO1H 4MDJB 1D5XA 3BRFA 4CU7A 3T4YA 5ADOL 5DJ6A 3VWJB 4JDZA 4MA1C 4PY8I 4LHJB 4PG2A 5TE7L 5GGQL 5D1ZA 3CLFH 5EO0A 1SEQL 3QNZB 3BEWB 5BVPL 1P6AB 3QT2A 1INQB 5SWQB 1U36A 4KKBD 4EVNA 2YD7A 2KQMA 4OLWH 4L9LB 5FKAA 3ARDD 3ORJA 4U1HB 3MRLA 5IFAL 2BDNL 2ZUQC 4PJDA 4LLUB 3QIBB 3NH7L 5DT1L 1G9MH 4HIHA 1MIML 4NZRL 5KVEL 4GRLB 4KK5C 4NHUB 5J56B 3QCTL 2ADFH 2F5AL 4MGXA 1RU9L 4PJDE 3V95A 1NLDL 1GOFA 1Q94B 3EJYD 4ALAH 3RKDC 1BGXL 5EG6C 1T83C 4FZEH 1ADQH 2ZNWA 1T3FB 3AUVA 4LEOB 3WFHA 3OWEA 5FOJA 5ERWA 4YHOH 1EO8L 5E6IA 4X6BA 3TIEA 2AK1L 2XZCL 2HRLA 2VQ1B 3JXAA 2J8OA 3TVMA 4O2FB 3MCLH 5IMOA 1GGBL 2PW2A 4FXGB 4DKFH 4EN3C 4YDJB 4KC3B 1FNSL 5HJ3A 3WDIA 2MTPA 4OCSL 4CMMB 1N4XH 4XPAH 1G7JB 2OR8A 3RWEA 1YYMH 4PGDA 1I9EA 3IDJB 2ZSVA 5AD0A 4WHYH 2H2PC 5GS3A 3F58H 4APQB 4GRWE 4XCEA 4NQDD 1C5BH 3MUGA 4HPOH 5JORB 3O9WB 4G5ZH 2IPTH 3IFOB 3Q1SL 4Q0XH 5HVGB 1Z9LA 3MLVL 1QG3A 3O2DA 4XTRD 4EEEA 5T1KA 4P59L 2APBA 1S5HA 2AK4D 1LP9B 4NUGH 1CQKA 1A4KA 1F4XL 1GHFL 1A7BA 1NCDH 4L4TA 4N0YH 1J0JA 3F6IA 4I3GA 2AXFB 3UO1H 3NMEA 2HLFC 4YGVB 4CADB 3TYGL 3UYOD 1AHWA 2OSLB 4XXCA 3X11B 4OLYL 4L4TE 1ZLUH 4DZ8B 3GSNH 4LSTL 1FVEB 2IH3A 5F8QC 4CW1B 1JV5A 4UOJA 1CZ8H 1GIGH 1MCDA 2PO6D 4KQ4H 3Q6GL 4TOYL 2VAAB 4MB4A 3VG0H 1KPVB 3ILQD 4M1CD 4NFDA 1P7QD 2Y36L 5GGTA 2APXA 3SKNA 4KRMB 4ONHB 2YR3A 4UT7H 1YA5A 1LP9F 4Z95L 5E8NB 4HFWA 1T7WA 2YSSB 5GS0C 1MCEA 1RUAL 1VA9A 3HC4H 4OCWL 1KUMA 2CR6A 1FGNL 1S78D 5IKCB 3WIIL 2VLJA 3NABL 1DUZA 4XP4L 5SX5H 5BV7H 1VSCA 4PRBA 2CKBB 4FP8L 3OKYA 3O0RL 4P46A 3DX7B 3LRGA 4HDIA 4IMKA 3EJJX 3MRMB 3RIAF 4ZTOH 3ECBB 5FUCC 5ALCH 2VLJE 2HRPL 2GW5A 2BVTA 5IGXH 1MI5B 1OLZA 3BE1L 4OF7A 4GXUM 1FH5L 3QUXC 2CKNA 5FM5O 5F9WB 3QO0B 4P3WA 4ZS6C 3WS6C 1CK0H 4NWTH 3QRFM 5FV2A 2H32B 4PJGF 5E2VH 3FONA 3THML 3V9FA 1ZT7A 1BVKA 5DLMH 3RVVC 3U36B 5F71A 1ZLWK 2YRPA 3D39B 4RQQB 3BIKB 1IGML 2NYYC 4UU9B 1E6OH 4RRPG 1G1CA 3OGCA 5I0DA 2FEEI 3KR3L 1OSZA 4XPTL 3MRBA 2DF3A 3TEUA 4NGHL 1I3GL 4CN1A 2VLMD 1FNEB 1IGTB 4Y5YA 5F3HA 3JBG7 2DLGA 4OJFL 3QIUD 4R0LB 1NPUA 1P5VA 3I6LD 4P23A 1DQJB 1R24B 4LHUB 2UY6A 3SY0B 3ZMRA 5I76A 3NTCL 1UZ8B 3TO4D 3CH1B 5CEYA 1J05A 5EULV 1U58A 5IW3A 1HH9B 3GI8H 4ZG1A 3CFEB 2G60H 4POUB 5CGYC 3G5ZA 5L7XH 3B9KA 3AMLA 2CK0L 4TRPL 3TBSA 1I9RL 5TE4L 4X4YA 3R06B 1JWMB 3GFUA 4JM2A 3WIHL 2MJWA 4NC1E 2XQBH 5DTFA 1AQKL 4XNQA 5EORH 4HH9A 1FAKT 1BECA 1EAPA 5CMAB 2VKXA 2A73B 5CEXB 1FN4B 1MCBA 2DWEB 3QCUH 5IV2A 3HAEH 4LDLB 3V4VH 3WDHA 1AD9A 4JLRA 4OTXL 1AGEB 4P0DA 1ZGLM 2DJ4A 4YDLB 2XIDA 2YOCA 2BFVH 1WT5A 4TNVK 3TC9A 2FZ3A 2WIMA 1OP3K 5B8CC 3ZT5A 5DF0A 3MYZA 4XPBH 5J7CC 3EO9H 3HHRB 4Q9QH 1QFUH 1UM4H 2B1HH 5DO2C 4JANA 5DGRA 3T1WA 1CDCA 1VEOA 5GSRA 1OAZL 3EOAA 3PV6A 3AREA 2EC9U 1MCRA 2ARJB 1PAMA 2Z8VC 5AG8A 5JPNB 1T03H 4MA1B 1FORH 3G04A 1FL3B 3VWJD 3GI9H 4IDLA 2FD6H 1MCIA 4RFEA 5DFVD 4MQ7A 2R0KH 5DS8B 1MJ7L 3KPQB 1G9EA 1KIQB 1UWEL 5ID0A 2X44D 1CD8A 2Y07H 1T21B 1MFDL 3FRUB 4DEPC 5I1EH 2HG5B 3RWDA 1HKFA 4L4JA 2ZUQB 5BS0A 2LABA 4LMQE 5DRZA 3ZKSD 4BM7A 4ZUSA 3QIBD 1UM5H 4KPHL 5FO7A 3IETB 1KIRA 5E5RB 2VDMH 1KENL 4NZUL 4P5MB 4GRLD 1DQML 5BS0E 3T1FB 3HCVA 4YZFF 2SEBA 3AAZB 1T1ZB 4F80A 5DC0A 1HINL 2R1WB 1FAIH 1ZLVK 4PJ5A 1A8JH 3ZKMD 4PY7B 3EFFB 1D5IH 2X40A 3RQ3A 5I1KH 3GJFH 2JB5L 4DJMA 5D7IB 5J8OA 2X4PB 5ILTH 2J8HA 4PJ5E 4PJAA 4BFEA 1INEH 3BKJL 3T4AA 1NQBA 2NMSA 4EN3B 3BOVA 3IS0X 4WI6A 3EYQD 2CRZA 4I0PC 4TNVF 1XCTA 4H5SA 3MOBL 4PJAE 2FIRT 4QF1A 2IBGA 1HSBB 1E4JA 1QSEA 3WL9A 5FECB 5JXEC 1IAII 4J7RA 1HK6A 4XH2B 4HKZA 3D85B 4APQD 1T5XB 1J0HA 3O9WD 4U7KA 2FB4L 5C6PB 5C0IB 2Y72A 1QSEE 3HNVL 3NZHH 1JHLL 4KZDL 4MXVE 5CSBA 4GSDH 1U8QB 4XPFL 3V6OC 1KJ2B 5D7IF 3SKJH 5CJBA 3PGFL 4R26L 4X6FB 3VDAA 5IB5A 5JUEL 1KIPA 2APFA 2CKBL 1NBYA 3EIFA 1KN2L 5IBLC 3HTLX 3WUWA 4OZFH 3WNOA 3VXMA 1MNUL 2R2BB 3LH2L 4KV5E 4YO0B 1U91B 3G6AB 3TNNA 4HAFA 4U6VL 1KCLA 5ETUA 1JTOA 4MA3B 1RUQL 1R3KA 5HY9A 3VXME 4D9QE 2J88H 1OM3H 1UZ6F 1KB9J 1GH7A 1FZKA 3HFML 5C6WH 1KXTB 1QQDA 3VMOA 1X3DA 2BNRA 3GEWB 1QVOB 4JO4L 1EEYA 4N0UB 3CFCL 3MLTB 1MHPH 2FIKA 3QRGH 4OFDA 1DEEA 3JWOH 1UADC 3S37X 3SGJA 5EPMB 2VNCA 5EO1A 5IQ9B 3ARUA 2BNRE 1U3YA 1JF1A 4D0DA 5HDBF 3B8SA 4UDTB 1MI5D 3QUXB 1MPAH 4YHZH 4L3EB 2EZ0D 2VN4A 4S11A 3BPCB 4NSKB 4MYWB 1A1NB 4DGYH 2C26A 1VEPA 3PIQA 4KDTC 1OSPH 5IEKB 1X6LA 3D39D 2BOBB 3PABB 3UYRL 5DC9B 4ZFFB 5IJKC 4QRPA 1XH3A 1BEYL 1VACB 2P8PB 1Q0YL 4S1QH 4YUEH 2FX7H 1U8HA 3HZMB 4GMTL 4JAMA 1CFQA 2YN5A 2FBOJ 3KJ4C 4AT6B 4YH6A 3L5JA 4RMUA 1FFOA 1DN0B 2P24B 5FOBA 4QRPE 4KKAD 1IEHA 2Q76B 3UP1A 4LHUD 4ZXBC 2QSCL 1Q72H 4AJ0A 5DD5L 4OZGA 5ACZA 4FG6C 2JK5B 5FF6B 3GIZH 1L7IH 2YPVL 1E4KC 2B8OT 2VLKB 4EDWL 2D9CA 1A6UL 1NDMB 3I6KB 2F53B 2UYLB 3ELAT 3WYRA 4OZGE 1MH5B 2E8ZA 1RZFL 2EXYC 3VGAB 1RUKL 1CXEA 4P5TA 3B2VL 1AC6A 3V4PL 3VXQB 4EBQH 3T77B 2HWZH 3D18B 5DUML 3EYUL 4OCXL 4FABL 2R1YB 3D9AL 1QPXA 1YDPB 5ADPH 2Z35B 3TCLA 5C0GB 4UIKH 3RBGA 1A6AB 1PG7L 2HN7A 3ZE1F 4YXLL 2YD8A 3KYOA 1FE8H 3HC0A 4HLZG 1UACH 4B7LA 2FEDC 2LU3A 5DJ0B 4P9HL 4XRCA 3MLRH 2EIZB 4U31A 4CKVX 4LSRH 1IBGL 3VFSB 3B9DA 3WFZA 4YHPB 2NZIA 3RZCC 5KAQG 2FRGP 3ETBF 5C1MB 4Z7NE 3RGVC 1HQRB 2DAVA 1Q0XH 1H3TA 1AGDB 5ENWB 3GGWB 1YEHH 3SE4C 3C6LA 4G9DB 4ODSL 3BEVB 3E6HA 3L3DA 1MCFA 2P47B 3EAKA 4Q9CA 1B0RA 1D5ZA 3OJDB 2AXJA 4NRZB 1CDUA 1S3KH 2DLEA 3OKEB 3P30H 3IKCA 3W5NA 1N8ZB 3WLBB 1OAYL 4H1LH 3GB7B 2KQNA 4DEPB 4ZUWA 2EYTB 3MRJB 2NW3A 3SBWA 1ZGLP 1X5HA 3F7VB 3O6LL 3MREA 4OSUH 1PKQB 2IEPA 3RNKB 2MSPA 1PSKL 4KAQH 3VWKC 4KK5D 1M1SA 3GKWL 1MF2H 1GYAA 4NRYA 1RUPL 5JIKA 3RKDD 3FMGL 2HFGL 3OKLB 2VZ1A 3LIZL 4LSPL 3QDJB 1H8NA 2ZSWA 4M1GL 5B39A 1KCKA 3K74B 1TNNA 1TCMA 3Q5YA 2DQEH 5DVNA 4R6UA 2XA8L 3BWUC 3EDKA 5GGVY 3GIVA 1S7QB 1KJ2L 5SV3A 4KY1L 3CXHK 1DANT 1M71B 1E27B 3W0WB 2HVKB 3UTZA 1ZVSB 4NZDA 3MODH 1DSFH 3FQXA 1P7KA 4DN4L 3WNKA 4EN3D 4F3FB 4X5WA 1RJLB 5EOCJ 5LBSH 4MD5B 4I5BA 3PP4L 4O4YL 4TNWK 1KB5A 1MHEA 5T5NG 4FFYH 3LQZA 4QRUA 3ARFA 1BBDH 2D7NA 3C5ZA 5LCVL 3D85D 3MACL 4NDMA 1MQKL 2W60B 1IGIH 4JY6B 3QAZC 3TBVB 1C5DA 4UTAH 5IEHB 2WUCH 1ZEAL 4HXAL 3LN5B 1E6JL 4E5XA 1X6NA 1G7PA 2JCCA 1N5YH 5GS0L 2IBZY 2DWDB 4NJ9L 4HZAA 2AKRB 3OKNB 1A7PH 1JGEA 4PJIA 1L6ZA 3BKMH 3X3FH 5I66B 3PJSA 5DD6B 2HLFD 1L7TH 5TFSL 2JCCE 4MAUL 1NCUA 5D2NC 2MOVA 5DZOA 1OVZA 4ELKA 4PJIE 3S6CA 1FFQA 3IDIB 2EE6A 3QEHB 2NY7H 4EKXA 1JNNH 1D6VH 1SJEB 5C0JB 3DUSB 2QQNL 4M7LL 4P49A 4OD2B 5GGRB 4JGMA 3P4NA 2H3NA 3ZHKA 5GS0D 4JHAH 4U33A 4XP5L 1P4LB 4KWUA 5E7FA 3PUCA 1KXVC 5IK3B 2MHAB 1U92B 2P42B 1NJ9B 1LMKA 3HZVB 1WIPA 3NFPA 3PWNB 3SDXA 5B3NA 3SE9L 4JPKH 1CBVH 1OGAA 3W9EA 1J5OH 1WZMA 1JL8A 4GAJL 3D1MC 4XGZA 1UQSA 3QUXD 3DVIA 3AB0C 4L3ED 5DQ9A 4ZS6D 3LRSA 5C2BL 1OGTA 2W0PA 1RZKC 3N0PB 3SDXE 4XP9H 2EH8L 4HUVB 4CVZB 3ARWA 1OGAE 3RVVD 5H37H 4IRSA 3DSFL 4PGJA 2NYYD 1T1WA 2FX8H 2J5LC 1OAUH 5LAXA 5I75C 4WFHD 4BUHA 4HUNB 4ODXA 1ETZA 2YUVA 3KJ4B 5E2UL 4OM0L 1Q9KA 3G9VA 2ENSA 4OCNC 2C1OB 2R0ZL 1HXMB 1ONQA 3JSSA 4CJ0A 4ZXBB 4PJBB 5GJSL 4YEFA 2CRYA 4HBQA 3EOTH 1UVQB 3REWB 5F1SA 3VW3L 1Q9WA 2ZKHL 5H94B 4TVPE 3ZTNL 1EERB 2P5EA 5CGYD 3IDGB 1YMHB 5TF1H 4Z7UA 3HR6A 4M6MH 2D7TH 4I77L 1QBLH 2VLKD 3U1SL 3HZYB 2B4CH 2FL5B 2BVOA 4OIIL 4TPRH 2F53D 1FO0B 3MGOA 5EB9A 4ZTPH 4NO3B 3U46A 3ET9F 2VXVH 2NTFB 3LN9A 3ULUL 3I6GA 5DEFA 5JOFB 2P5EE 3H9HA 1FNGA 3IU4L 4Z7UE 5DMKA 1ACYL 5J6HB 4X7CC 1DFBL 5EC1B 4L8BA 3WUWG 3S88H 2AEQL 3DECA 2DBJA 5CZXC 4JFPB 3SGDH 1SY6A 3DXAB 1YUHA 2FGWL 2RFXA 4HKXB 3MLUH 2B1AL 4NCC1 1B4JL 4PJBF 3P0VL 1I8KB 4P4KA 2GJ6B 5A43C 1BQHA 1P5UA 3G6JA 4HJGB 4WY7H 3RWJB 1EJ6A 4RMQA 4M9PA 5DUBA 1BOYA 1BFSA 1R3HA 3RZCB 4EUPB 3I75A 5FB8A 5DO2D 1Q9OA 1UG9A 3O6MH 2ICWB 3QIWA 2I9LA 2LAAA 2XZZA 3RGVB 3G6JE 1T1XB 1Z9OA 4LFHG 1G7HB 2H41A 4XCNB 5EU6A 4JGJA 4X99A 3QDGB 3FFCA 3K8KA 1MCPL 3UJTL 4PRHA 1NUDA 2DQHL 4GS7C 5EU6E 3BRGC 3S36X 3QJFA 3FFCE 3OF6D 4RFOL 3RY6C 1T66C 3VFRB 1MAML 4AMKL 3OHXB 4PRHE 1QA9B 5I1HL 5JDJA 3LEVL 1TVDA 5BQ7A 1UM6L 1IGCL 4PBXA 3L7EA 2X9WA 1HQ4B 3UC0H 2D03H 4Z7VB 1H15A 4LPUA 3VWKB 1IVLA 1ZVYA 5CIPA 1KJ3L 3CC5A 2UZIH 3BKCL 1O7VA 2ID5A 5DJ2A 1JPTH 3V5HB 3VXSE 2J6EA 1A64A 4PTTA 4N5UA 4ZS7H 3VH8A 5BW7A 5I8KH 1HH6A 2DM2A 5K9QG 1A1MA 3MNZB 2H9GA 3QDJD 5AZEL 4AG4H 2NZ9C 5C0CB 2KDGA 4JZJA 4AL8L 4IRJA 4P99A 5ADOH 3K2UL 4MDIA 5IBUG 5DXWA 1JZ4A 4OI8A 5TE7H 4YQXL 1U8JB 5GGQH 5IB2A 3W0WD 2LU4A 4TUJA 1SEQH 1CT8A 1RQ5A 5BVPH 4Z7VF 3LV3B 2V2XA 1TZIA 4L8DB 2GY7B 4HX1A 5JXED 3H42L 3BP7A 3PP3H 4HQQL 7FABL 5EU5A 5CD3A 2BDNH 5IFAH 3LHPL 3PWUA 1BHGA 3NH7H 4KMLB 2FWOA 2DIJA 4GG8A 3QAZB 3FO2A 3DV4B 4IS6B 1MIMH 4J3OC 4K9EL 4M1DL 4O02L 1W72L 4NZRH 1A7QL 1U8NB 4U1GC 5KVEH 2GSGA 1S9KC 1J0ZA 2VXQL 3QCTH 3BZFA 2XWJB 3VFVB 2VUOA 1RU9H 3O3DA 1NLDH 4HT1L 3TPUA 2G2RB 1BGXH 5AWNL 4LPCA 2NCMA 5GS1C 4Z0XB 1RZ7L 1G7IA 3QHFL 3QWOA 3ZDZE 5HYEA 1EO8H 5IBLD 5TDPB 2P8MB 1DQDL 2AK1H 5I30H 4NQCA 5D2NB 5C0BA 2AS5M 5TDNB 3G5VA 3EZ8A 1QFHA 3EOYG 2CLRB 1TJHL 1BLNA 3DGGA 4LCUB 1GGBH 4A2LA 4NQCE 1K2DA 5ESVB 2ZUTA 5F3BA 1RIVL 3CFKA 4AIOA 5C0BE 1FNSH 5CBAA 3B5HA 3T3MF 2F54B 2X4RA 4OCSH 3QYCA 1DJSA 3EUUA 3K4ZA 1JVKA 4K3EL 3CFJB 3BI9X 2A6KB 2EDBA 4ZFZB 4S0TD 3I84A 1CL7H 1WF5A 3OR6A 1MFAL 5CGTA 5LGKA 3HPJA 3TBTB 3Q1SH 4NUJB 3OR7B 4NKOB 3MLVH 1M6OA 3E0GA 1NMAL 4KMTL 1JGLL 4P59H 3CLEL 3SQOL 1MLCB 3UAJC 4JFEA 1P4BL 5IVZB 5ICZB 3SPVA 1S7SA 4I1NB 4Z5RA 1F4XH 1GHFH 4R4FH 3U48A 2X4UA 3AB0B 1N2RA 3ES6B 4LMQI 1B9ZA 4JFEE 3TYGH 3MLYL 2AJXL 3CDCA 4WTXA 3QUMB 3FQNA 1I8LC 4OLYH 2J5LB 5I1CL 4LSTH 5I75B 5IJVB 4MMXC 4R4BA 1JIBA 2F74B 1JFQH 3Q6GH 4TOYH 1KGCE 2R39A 3TFKC 3L3GA 4XVSH 2XRAL 2Y36H 4W81A 4RMSA 5E4EC 3QFDA 3IXTB 1RK0A 1ZA3A 3O8XC 4Z95H 2VDKH 4ZXBD 4OV5B 3MGTA 3M8OL 4XPGL 1FPTL 1KFAH 3RRQA 3LDBC 1RUAH 4OCWH 1FGNH 1XF3B 4FG6D 4ZPVB 3MBXL 5HGHA 3WIIH 3NABH 4XP4H 4K7FA 4OLVL 1RFDL 4FP8H 5DD3L 4GH7B 3O0RH 2EKSA 3MRKB 3RWFA 4LKCA 2ARWA 3VGDA 4CDGC 5DMGC 3KS0H 5C0DB 1VENA 1QSZA 2HRPH 1IKNC 1LDSA 3K2MC 5K9OB 5IMKA 5IF0A 2EXYD 1FH5H 3C60A 1ZHNA 3EDEA 4WU7B 1URLA 3DRQB 3ULSB 3THMH 5FGCE 5C0EB 3NIDF 1XFPA 1IGMH 2L4OA 4XI5C 3DXAD 3LKNA 1UXWB 1MUJA 4OF5A 4XPTH 3T04D 2VDLL 4GW5A 5FO8A 4NGHH 2XG5A 2FEDD 1I3GH 4C56B 1JZ7A 4DFHA 2GJ6D 4Z0BL 4OJFH 1QEWB 3MRRB 1ZTXH 5GZOC 1I1CA 1ITBB 1P84K 5JNYA 3RZCD 3DTXA 3DO7B 3MV9A 4ZO6A 1QSFA 2CH8A 2HFFB 3RGVD 3HRPA 3VFOB 1EZVX 3WHXA 2VOTA 3U7YL 3QR2A 4MJIB 3MXVH 4TRPH 2WINA 1I9RH 3QDGD 4XZUB 3MV9E 4LRIA 5TE4H 1QSFE 4XP1L 1CXKA 3WIHH 5HHNA 3OPZL 4GS7B 1AQKH 3KWWA 3MJ7A 4MMZC 2OTWA 3FN3A 5DI8B 2RBLA 3D69A 3VCLA 1QLFA 4TSAL 4XWOC 4G42A 4S2SA 3PDOB 3GSXB 3IJHA 2PYFA 4OLEA 3AY4C 2ZOLB 2VZSA 4JFXB 1ACZA 4I9WD 4WGVB 1LEGB 3BP4B 3VWKD 1KB9K 1FV1A 2D3VA 4JZNB 1NGYB 1VFOA 4NQSA 4D9RD 2IAMC 1JF5A 2FSEA 2YHGA 3TH4T 2DD8L 3GMLB 3TZVA 4MXWL 1LNUB 2CK2A 5E8OA 4PJFF 2DMBA 5JW4N 1FL5B 1NGZA 5JO5B 4NRXA 3MMEB 5C0CD 4N0FA 1JPGB 3LEXA 4G6JL 5FFLA 1BVLB 4X4ZA 1S7VB 2VISA 2YUZA 1RZJL 2WBKA 2FCBA 1N5AA 3M07A 4W4NA 1MAKA 2X89D 4QNPE 2XQYK 4X8JA 1MJ7H 1ERNA 4M61A 4J2XA 1UWEH 1MFDH 2W9EL 4MQSB 3IJYB 1N0LA 2AI0L 2Q87A 1EVTC 5HHQB 3BVNA 1IQDA 5K9QI 3DRTB 2E7CA 1DP0A 4JPVL 2FLRT 3S4SA 4KPHH 2DKSA 1W0VB 1CGVA 4U1GB 1KENH 4NZUH 2BRQA 2E7MA 5T3ZE 3GMOA 1I4FA 4RA3A 1DQMH 2NY2C 2XY1A 3QG6B 5CP3A 1NC2B 2DIBA 5EIIB 4UOW1 4HWZB 4AIXA 2PW1B 3MGAA 1S7RA 1MWAA 3EBAA 5GS1B 3IDMB 1JBJA 4M48L 1XAUA 1WITA 4LF3A 1T0PB 1T2JA 3RHWK 1JYXA 2QQLL 4OQTL 2Y5EA 5A40E 4DWHA 1KT2B 2JB5H 3L6FA 5IFJA 1RZ8A 2HJFB 3OXSB 1R3JB 1F3DH 1JK8A 2JIXA 3BKJH 4PJ9B 4U6HA 3WSQL 4CL7A 1RZKL 2A2QT 2V9RA 3P0YL 3NAAL 2FHBA 2F54D 3GSWB 3MOBH 5FYKD 1MHHB 5H2BA 2JJTC 4JDVA 4GQ9L 2DQFB 4QRTA 4YDVA 4KZEL 5F7DB 4XCCH 1YY9C 2FB4H 5CEZD 3GBMH 1JHTB 4F2MB 5E2WH 4QHUA 3T65A 3QA3A 4LVOC 3WS3B 3HNVH 3SDDC 4BQ9A 1C12A 4LIQE 4KZDH 3KPMA 4ODHH 4CVXB 3S35X 2O5ZH 3PXJA 4LSDA 4XPFH 1NLBL 1ZGLA 3O11A 4NHCL 4FMKA 3DETC 4HKJA 5CSZB 5EU4A 4R26H 4UBDC 5JUEH 2CKBH 1KN2H 4LLWA 4LLQB 4PJ7A 5MEOB 1I7ZB 3FTGB 1U95B 4JR9L 3G08B 4OAWB 4GBXC 4FQ2L 1MNUH 1T04B 3LH2H 3TA3A 2H2SC 3HG1A 3DMMA 2V2TA 5EC2A 4OZFA 5C07B 3TH3T 2LAGB 2P8LB 4U6VH 4PJ7E 1WGOA 2PXYC 3MNVA 4EI6B 1DCLA 1FZJA 4ZFOB 1RUQH 2H32H 3HG1E 1C16B 4QHNB 4RZCB 2DKUA 2VLRA 1P53A 2V7HB 5E4EB 1CFTA 3UZVB 2BSSB 3O8XB 3EFDL 3HFMH 3ZKQD 1IRAY 3LDBB 1LO2L 5E7BA 1O0VA 2FR4B 5ACLA 3FKUS 1IGYA 2VLRE 3N1MC 5AG9A 1OTUC 3CFCH 2YD2A 3LN4B 3BHBA 3HLAB 4Z77B 3LEYL 3MFFB 2X41A 4ZOAA 4PR5A 3CVHB 2FLBT 1J12A 1V7ML 1F42A 3FN0L 5E2TL 3FT3A 1WQVT 1JI2A 5HHMB 5C09B 2AJZA 1S9VA 3V7AE 4JFFB 4U0RC 1IE5A 5CZXD 4I8DA 4I3SL 1TIUA 1WZLA 3UYRH 1WBZA 1BEYH 3S37L 1Q0YH 2Q7NA 3KYMB 1RJZB 2GSIA 4WDIA 4GMTH 4C56D 4UQ3B 4YBHA 1I7RA 2HLAB 1CGWA 3TLRA 4NNYB 1M4KA 4ODUA 1XMWA 3MLXL 2Q1EA 5SX4I 2J8UA 5E4IA 1OP5K 2QSCH 4O51B 5DD5H 1NDGA 1OOAA 4KDWA 4GQPH 5D9SA 1IGJA 4NO5A 3T2NH 1QR1A 1K8DA 3RTQA 2YPVH 2J8UE 4MJID 5HHOA 4EDWH 4UILH 4G9FB 1JN6B 2IWGA 1A6UH 1XGPB 2YXMA 5L2JA 2CDGB 5D7JC 4WHDA 2V6HA 2VQTA 4JRYB 4WI5A 3N9GL 2M8XA 1RUKH 5HHOE 3C2SA 3B2VH 1I1AC 5IB1B 4KTDL 5IW1B 1GGTA 5K59E 3SDCC 5DUMH 3EYUH 3VGFA 5FKPA 1T66D 2CLVA 3P73B 3FO9B 4OCXH 4FABH 5IT2H 1NBQA 3D9AH 3KLAA 2OXHA 3CSYA 2XNAA 3F12A 1PG7H 1H3WM 3EO1B 4YR6A 2XYCA 4HCRA 1UENA 2D4DA 4PLKC 4JFDB 2PTUA 1TTUA 5HPMB 2IJ0C 3K7UA 2EDRA 1XCQA 1OAXL 2IAMB 1CGTA 5HHVL 3FOMB 1IBGH 5CHNB 1LHZA 1UKSA 1KPUA 4R96B 4MAYC 5DEZA 4NCC2 4IDJL 1NAML 4L8CA 4OD1L 4OFYA 4AEHH 1M05B 1FFNB 4RWYL 2NZ9D 5C08A 5GGRY 4K7PY 4K55A 4ODSH 5AYUL 2DQDL 4JQVC 3QULB 3VRJA 3RX7A 5DK2A 5C08E 1BREA 1NEZB 2EDTA 1DBAL 3OKMA 2OBGA 2BOCB 1OAYH 2WIIB 3HE6C 1EJOL 1QNZL 1HYSC 5F9DC 2C5DC 1MRDL 5CJXA 1ND0B 1XF2B 4H1LA 3SO3C 4ELMA 1QO3A 1MCSA 5C86A 5D2LB 3BP5B 5FYLL 1PSKH 2A9NL 3GKZA 2NY2B 4PV9B 2VLLB 2X2YA 5EU3B 4ELME 4WV1C 1NC2D 2A6DA 4K3HA 4Q2ZA 4EQ2A 3KPPA 1RUPH 5IM7B 5CAYB 1WWWX 2HFGH 3FMGH 4WI7A 3KGRA 3S3PA 4H0HB 1DLHB 1WFUA 3LIZH 4UT6L 3MRCA 4LSPH 1HHHB 4M1GH 3QHZL 4J8RA 2YD9A 1YMMA 2I9TA 3VXRB 2XA8H 5D96C 3O4LB 3J7HA 3QUZA 3DIFA 3FHAA 1KJ2H 4KY1H 5GZNC 4HC1L 2DQTL 1IM9A 3QPQC 1YMME 5DMIL 4OT1L 4PJ9D 1ZLVH 1OWWA 4DN4H 5D2LF 3U4AA 3I02B 2WLYA 4L8SA 3PP4H 4PRIB 4GKSA 1KBGH 4WFEE 2QHRH 1LE9B 4I2XB 3EYVB 2VE6A 4HG4K 3OKKA 4G6AC 4MCZA 1UT9A 5LCVH 4XB7A 1M7DA 2HFTA 1MQKH 5DRNB 4LVOB 4W4OC 5EUOF 1KXQE 2A83B 1OQXA 3SDDB 1ZEAH 4HXAH 1PJ9A 5L8KB 3ARBC 4WUUB 3UAJD 1JPFA 3SDAC 3NIFF 2NX5A 3VA6A 1S8DB 5GS0H 3PGCB 3WO4C 2C7UA 4HGWA 5FO9A 3F8UB 2Z4QB 1NCBL 3BSZL 4YE4L 1FC1A 3P40A 4PJ8C 5TFSH 3QUKB 2NX5E 3MRQB 4JJHA 4MAUH 4GBXB 4WEMB 2HFEA 5T3XL 2P49B 1YN7B 3CMOL 1WLHA 2MKLC 4AIZB 4GLRI 3SKMB 2PUQT 1JCKA 2A9ML 3H9SB 3QQ9C 3K8MA 5KVDL 2X70A 2OCFD 2PXYB 5C07D 1F02I 3HA0A 1EXUB 3C09C 3TNMB 3RBSA 5C0AB 5DQDL 1A6ZB 2FEEL 1SYVA 2APVA 2YS4A 3FB7B 1JZ6A 1GGIL 3TFKD 4M7LH 2FYYA 2QQNH 4HUUA 4M5YL 2PETA 1WICA 3MRNB 2C4FU 1KTRL 3O8XD 1LGVA 3HPLA 4XP5H 2Z0BA 4J4PA 1L6XA 2VC2L 1LK2B 1JYNA 1S7TB 4WHCA 5D1ZC 1BIIA 4DW2H 2R23B 2VO5A 1HXYA 5DJXB 3NZ8B 1IEAB 3U4EB 4YHYC 3VJ6B 2DL2A 1U8OB 5DMGD 1A1OA 1LK3L 4GKOA 4KJYA 3SE9H 1E4XL 4L3CB 4GAJH 1J87A 5HHMD 5C09D 5E94B 5C2BH 1P1ZA 4U0RB 3F7QA 4XPHL 4JFFD 2EH8H 5L88L 4YHNB 3DSFH 1LWRA 4XI5D 5IW6A 3QI9A 5JW3L 5KSVA 2QSVA 3NVQA 1J1OH 3RWHA 1MOEA 4WU5B 5EO9A 4YDIL 5DYOB 4P2CG 4WUKL 3DROB 4QHKJ 5E2UH 4OM0H 2YMXL 2R0ZH 2BNQA 5A16A 1FCGA 2J4WL 2Z92A 4X7SL 5GJSH 3F5WA 1P6FA 5HI3C 3CZFB 3NACL 4DUVA 4JFOB 1Z9SA 1CVSC 1NFDF 3VW3H 2OZ4A 3ZTNH 2BNQE 3TVMC 4FRWA 4I77H 3U1SH 3MA9L 4G9FD 3MRGB 4B41A 2ADGB 4OIIH 4LBEA 5D7JB 1NBZB 1R3LA 4B0MM 4U1LA 5L2KB 1R5VB 2IPUK 4UDUB 3IU4H 4JRYD 1F97A 4UV4H 1I1AB 1ACYH 3PHQA 3SDCB 5KS9F 3B8YA 4OZHB 1DFBH 1K4CA 5JA9A 2AEQH 1WFOA 3KPOB 4XWOD 4AM0A 1S9XA 1EGJL 3G5YB 1L9NA 2Q3AA 4OGXL 2FGWH 4V1DB 3BZEB 2B1AH 1B4JH 2XWTA 3B9VA 4JG0L 4PRPB 3X12A 1RSFA 3JVGC 3P0VH 5GISL 4JFDD 1ZVHA 1T7ZA 1D5MA 3D0LA 3EYFB 4LCWA 4G7YH 2IAMD 1CD1A 3GRWA 5F7LB 2ZOKB 2IQAB 1W0WA 4MAYB 2K3TA 1AHWC 1OB1A 1YPZF 3VG9B 4XXCC 5E8PA 2Z8WC 3QJHB 5B38B 3BH9A 4LCWE 4X9HA 4X98B 4OZHF 4PLNC 4A6YL 1UH3A 2WV3A 1MCPH 4U1JB 3V7AG 3UJTH 3LKOB 4IM8A 5D70L 1XGRB 4LARL 3MRPB 5ID1A 4HZLB 5TGBA 5EBMB 1X5ZA 5I9QC 3AU1B 4E0RA 4UZGA 4OUOA 3HE6B 4RFOH 5FM4A 3MRHB 4EDXB 3STBA 3KPNB 1MAMH 4KROC 4AMKH 1XGUB 3OXRB 3KYNA 1ZS8A 4PG9B 1JNHB 3SO3B 1VPOL 5T1LB 5CFHA 3Q3GB 3HUJA 2LVEA 4HFUL 3LEVH 1B0GB 2E9IA 3EGSA 2I26N 1UM6H 1IGCH 3NBNA 3VXOA 3B3IB 5CCKL 4NPYB 1J88A 5HTSA 1RIHL 2B0SL 3LSOB 1KJ3H 1FZOA 2NY2D 3M17A 4MJ5B 3HUJE 4WV1B 2GK0A 3BKCH 1YN6B 4N8VG 3D2UB 3NN8B 1SJVA 3S36L 1G6RA 4XCFL 4JZOA 2WAHA 2WBJC 3LKRA 4P57B 1Y18B 1NANH 4NQVB 3VD9A 5BJTA 5LGHH 5JHDB 3N1FC 4RISL 5AZEH 1H3PL 5CP7B 2VYRE 2ADIB 4HK0B 5D96B 3LZFL 4AL8H 3D48R 3VXRD 3O4LD 5DFTA 4M03A 3K2UH 1CDYA 2YD3A 4YQXH 2VZ3A 3SE3A 1R0AH 3DBXB 2VIRB 1D6EB 1VESA 3B9AA 4UINL 5DJCA 3GSNB 4U1IA 3INUL 4LNRB 4FQHB 4CU6A 1TJIL 5MEPA 4PRID 2R1XA 2IFGA 4NC1C 2H8PB 3H42H 2W91A 1KPRA 3SE8H 2NY6C 4HQQH 2NTSP 7FABH 4CDHA 1YNLL 3LHPH 1MLBB 3BPNC 1YY9D 2ATKA 2VSDA 4KI5C 2GHWB 3GNML 1T6VN 4YFDB 4CAGA 4K9EH 4M1DH 4O02H 1W72H 2B7DT 4K7PH 4CNIB 3SDDD 2Z31A 4MNHA 1WEJL 3V6ZA 2VXQH 1B2WL 3ARBB 2P4AB 43CAB 4NBZB 3SDAB 4WUUD 3WO4B 5DURB 3VXTB 3JWOC 2C3VB 1VHPA 5IHBA 4HT1H 5J3HC 5TQ2L 5AWNH 4L29A 1AFVL 4I4WA 3DETD 3IXAB 4UBDD 1RZ7H 5B4MC 4NQDA 3QHFH 4PJ8B 3BH8B 1HHGB 1UC6A 1LEIA 2ADJA 1KCRH 1DQDH 1WT5C 4MZ2A 5ICYB 1JI1A 1U0QA 3WN5A 4EXKA 4XBGA 5DJYB 4GBXD 1G7QA 2BSTB 2H2SD 2H6PA 5GSVA 2VSCA 2AK4A 3SGKC 3HRZB 3R8BB 2I27N 3F7YB 4NQDE 1WWAX 1TJHH 3H9SD 4M6NL 4YEEA 5E8DL 1H3UA 3C09B 4ZOCA 2PXYD 2R69L 1RIVH 3P4MA 4MJ6B 4XNMA 5C0AD 4L9DA 1KTLA 1BMGA 3G5XB 4P2OA 1AR1C 1B0WA 3PWJB 4K3EH 4DVBA 2AK4E 1UWXK 5E8EB 2EDKA 3MRIA 4AYFA 4Y4HC 3PWVB 3UTQA 5LXGL 1MFAH 4RCAA 5DJ6B 4JDZB 5HYQA 3LKSB 1K8IA 3W11C 4KMTH 1NMAH 4OZ4A 1JGLH 5D1ZB 1OTUD 5ESQA 3CLEH 5F97E 1T0NA 4YHYB 2EE3A 3SQOH 2ZG3A 4YXKL 1FZMB 1HDMB 4PB0L 2WQ8A 1P4BH 3K4AA 4V2BA 1P7QA 4YHIB 5I17B 5BRZB 3IF1A 4YFLI 2VABB 1IC7L 1HKLL 3S8WA 3MRLB 2NXZC 2ZUUA 4O5LL 4O2EB 5F88B 1LD9B 2VXTL 1VFBB 1YNKH 2NR6C 4HIHB 4LGPB 4GXUN 1FO0H 3S7GA 1F2XK 1N64L 1A7NL 4DK3A 4H25A 4KQ3L 3AS1A 3W2DL 2DQGH 4J6RL 3IFLL 1MSPA 1MVUB 1WCQA 3E3QC 2XRAH 4MD0B 2CDFA 3V52L 2ITDA 1BBJB 1QTYT