4EDZA

Crystal structure of hh-pgds with water displacing inhibitor
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hematopoietic prostaglandin D synthase
publication title Investigation of the binding pocket of human hematopoietic prostaglandin (PG) D2 synthase (hH-PGDS): a tale of two waters.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 70
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4edzA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4edzA01
2RLIA 2VOCA 4EVMA 3L9VA 2B1LA 3IRAA 1WJKA 2VL9A 5A4WA 4OFTA 3KIJA 1OE7A 1XW6A 1JLWA 5BMUA 2YZUA 1DE2A 1X9MB 4TOPA 2JACA 4USSA 5FWGA 3A5WA 3EC3A 5HFKA 4KDYA 1AC1A 4K0NA 2L4QA 2H0GA 4QQ7A 1WMJA 4IKHA 3P8WA 1GSDA 4WEYA 2H19A 2RIIA 4YQUA 1WP0A 2LRNA 4AF2A 3A2XA 2CV4A 1EZKA 1SYRA 3EMXA 2XPEA 2FCHA 4XTSA 2B6MA 3GTUA 1PRXA 1TK5B 3UIWA 4MP4A 3GYKA 2OBIA 2M80A 4KDUA 2X99A 3UBLA 4WXTA 5J5NA 3D22A 4MLYA 1UVZA 1ZOFA 3E9JB 4MABA 2V32A 4KX4A 2PWJA 2YWNA 5IMAA 3IC8A 3L78A 1O8XA 3LXZA 4KH7A 1Y25A 1GTUA 2KP2A 2F8AA 3HJMA 11GSA 3G7YA 3PH9A 3TKRA 4TR3A 2AB6A 2DSAA 4AJ8A 1M2DA 4QL7A 5DJLA 2IMIA 2VAFA 1XWGA 1ERTA 1HYUA 1DUGA 3BD2A 1XOBA 1XWAA 3D4TA 3F4TA 5J9BA 1OAZA 2C0GA 1TRSA 5EL8A 3QFBC 3GTUB 2VCWA 2HFDA 1EV4A 3PPUA 5CP1A 1KNGA 6GSUA 1W4VA 4DSQA 3UL3A 3SBCA 5A4UA 1SL1B 1E6BA 4IGJA 9GSSA 1XFLA 3F6DA 2FWEA 2MMOA 1TRVA 3GFKA 2QC7A 5B8BA 5B7CA 3QR6A 1OC3A 4G0LA 1XW5A 4G2EA 2E0QA 2MYGA 2C0FA 5DVBA 4ZIJA 3M3MA 2CVBA 4J57E 3RPNA 3I9V2 3A2VA 4LL1B 4ZL9A 1QFNA 1M9AA 4MMMA 3HXSA 6GSYA 4KAEA 3TJGA 6GSVA 1NHOA 2GZPA 2FY6A 3QD9A 4DSSA 3FR9A 3HVSA 4ILFA 4V1Ap 5DBQA 5B6MA 4K8MA 5F05A 4JBBA 3WGEA 4TXOA 1CQHA 5G5EA 1Z6NA 3ZVJD 1SK0A 1YEPA 4PURA 2R6KA 2KOKA 2MMNA 3TKSA 4PXOA 2X64A 3IC4A 2LNSA 2IN3A 4FH8A 3US3A 4ZB9A 3TKSE 1TK8B 2C3NA 1FO5A 1GTIA 4F03A 4I8BA 3BCKA 4E8HA 4HQZA 1TW9A 2KP1A 2X8GA 4MF7A 1BJXA 4POKA 2YJHA 4PUFC 3GN3A 1HNBA 1YDKA 2OA7A 2NTOA 2R4VA 3IAS2 2AV4A 2P5RA 3TRXA 18GSA 4EDYA 4EC0A 1XPVA 1AQWA 4MA9A 2V6KA 2VD0A 2C0EA 2LJKA 4WR4A 1Q4JA 1XBSA 2QSIA 3HKRA 2YWOA 1J9BA 2K6VA 3DXBA 1VRSD 4TXOB 1A2LA 1TTZA 2HSHA 1G6WA 2WZ9A 1QQ2A 5ECPB 1SJIA 4N11A 4GSSA 1ST9A 2NVLA 2YP6A 5KN0A 1JHBA 2VO4A 4CHSA 2HSNB 2KLXA 1BAYA 3DWVA 1R4WA 3GKNA 3TGZA 2TRCP 3TKQA 1K3LA 3IDVA 1G7OA 2C1YA 2H70A 3ZZXA 5HFGA 1KBNA 5GZZB 1PN9A 3CRTA 5ECMB 2P0GA 4ZILA 2WULA 1F2EA 4MH2A 2P31A 1VF1A 2HRFA 5H5QA 1ZYQB 1FOVA 1EP7A 1M0UA 1FAAA 1O85A 4MZWA 4MPGA 2EIOA 5G2ZA 2HYXA 2I3YA 3KGKA 4KSMA 2I81A 3V1WA 2HE3A 3GKKA 2JL4A 1SD9A 13GSA 3LJRA 2IPAA 2V2GA 4MK3A 4ZB6A 4XS1A 3S9FA 4N10A 4I6XA 1GSSA 1ZCPA 1GL8A 4BWSA 4Q5QA 2L59A 2YZHA 3L4NA 2H1GA 4IELA 1OKDA 2O7KA 3HVXA 1YJ6A 1YKCA 2H8LA 3GKXA 3C71A 2FGXA 2VCZA 3ED3A 2P5QA 3C1SA 5IOXA 2CQ9A 2VLTA 4L0UA 5A5KA 1ACVA 4IP1A 2ZCTA 1TXXA 2D2ZA 4OFNA 5B6NA 3PINA 4MPFA 4PGTA 4NHZA 1SKWB 3Q19A 5GAPD 5ID2A 5G31A 2YCDA 1ZGNA 1JZWA 3DGQA 1Z7RA 2WDUA 4TR4A 5ECRB 1F9MA 2LSTA 4EL1A 3QFAC 3TCOA 1JFUA 2JSZA 2JZTA 1TP9A 1X5EA 4ECCA 4KNDA 3HVVA 1XIYA 1U3IA 5G30A 5IMZA 3N9JA 4HU9A 2YJ7A 1U3AA 5ECIB 4BL7A 1TRUA 5IO2A 3PGTA 3TOTA 1V9WA 3D4MA 4FO5A 2LRTA 1SYXA 2ON5A 4PX1A 2LRCA 3GHAA 3ZMKA 1ZYEA 4IS0A 3D6IA 4X1UA 3VI5A 1WE0A 1Z7PA 2GT6A 1DBYA 2VL3A 2PN8A 1YY7A 5EPFA 3U5RE 5B8AA 3HZ8A 4IJ3A 1O73A 2XHFA 5IOWA 3RAZA 5ID2B 2AAWA 2L6CA 2MMAA 4E8EA 3BCIA 4ZL8A 1B9YC 3D21A 3ZITA 5D8IA 5JWQB 1V98A 3HJPA 2VL2C 3CTGA 2GDRA 4EUYA 1J0FA 4K9ZA 2PUKC 4O7HA 3NOFA 5HQPA 4NV2A 5DQYA 5HR2A 3KXOA 2H74A 4HZ2A 3LGCA 2YV7A 2CX4A 1PMTA 1GSUA 5ECNB 1A23A 1B48A 2RUFA 1G7EA 1E2YA 2B7KA 1FB6A 4BL7B 4K2DA 2LQOA 1KTEA 5CREA 1JZDA 1LU4A 3EINA 2OE0A 1AQVA 4MJCA 3FKFA 4GLTA 2HI7A 3R3EA 4RQXA 4F9ZA 3WT2A 4NHWA 1V58A 5G1KA 3QDNA 3DMLA 5D9VA 1TI1A 2RM5A 1TOFA 1V57A 4Q5NA 3ZFLA 4MJEA 2B5XA 1GULA 4WF5A 4QL9A 1XWKA 2WS2A 1ERUA 2OJLA 4ZB8A 3DVWA 3VPQA 2PMTA 3VWXA 2KHPA 1GUHA 6GSTA 2FWHA 4HDEA 3GNJA 2C0DA 4F82A 4HS1A 3KD0A 2TRXA 2CT6A 3MAKA 4IN0A 2ZUPA 1V2AA 1PL2A 3UVHA 1XCCA 2IMEA 2YWMA 5INYA 2GSTA 3VFIA 3LYPA 3QPMA 5AISA 2PBJA 2L5OA 3LFLA 1YKAA 3H93A 3DD3A 2N5BA 2B5EA 3CYNA 3GH9A 4OCFA 3UOMA 1XOAA 1PL1A 5ELGA 4JRRA 1EOHA 1O6JA 2MZCA 4I2UA 4WBRD 4JR6A 2IIYA 2C80A 2C3TA 2LNTA 1SKSB 3GURA 5JCGA 3GUSA 4TKYA 1ERVA 1THXA 5DJMA 3H8QA 4BVYA 1ML6A 1FVJA 1K0DA 4KE3A 5KN1A 14GSA 1GUMA 2GZYA 4LL4B 3I6AA 3KEBA 3BOAA 2H1BA 2HQTA 1KEBA 2L6DA 3C8EA 3OR5A 4MZBA 1XVWA 1SJZA 4GWRA 4RI6A 1I5GA 1WOUA 3DRNA 1FG4A 3IA1A 3ZIVA 2GQKA 1OVNA 1GSFA 3GMFA 3WYWA 3EMPA 4AJ6A 3MWHA 4KCAA 3TRPA 2FD3A 1BEDA 3VI7A 1Z6MA 3FR3A 1R5PA 2VD1A 1U87A 1EEMA 4XHMA 5JWRB 4YQVA 1X5DA 5CRGA 2BJXA 2YPMA 4L5OA 5HFIA 2WB9A 3K8NA 5ENUA 1GLQA 4ECBA 2V6OA 2YOIA 3CSIA 3KP9A 3UAPA 5LNKe 3ZFBA 4O32A 5ECSA 1YF0A 2I1UA 5D93A 16GSA 1FHEA 3RHBA 1ZL9A 2JZSA 2E2MA 1UN2A 4BVYB 4L8EA 5IM9A 3GKMA 1YF1A 2QKEA 2HZEA 1X0RA 2VM2A 3ZIJA 1XVQA 5IMCA 1X5CA 4Q5FA 3TJFA 3I43A 5IMVA 2AHEA 2XPDA 2R3XA 4ZL7A 5CRWA 5AIXA 1A2JA 2GQMA 3ZLPA 2GSSA 1HD2A 4HQSA 4O92A 2M46A 2CX3A 2LUSA 4L0WA 3F4SA 3LWAA 1A0FA 1F6MC 4WF4A 3ZVJA 3H79A 4POMA 4MJAA 1JZOA 2HRKB 4ID0A 3RHCA 1S3AA 4V2NA 5AN1A 3KP8A 3GSTA 3CTFA 1QK8A 4PQHA 1B8XA 2V41A 3UBKA 4ML6A 4KSOA 4YH2A 1S3DA 2AYTA 2B7JA 3P7XA 5G5FA 3VWVA 2RM6A 3HZ4A 3GL5A 1GH2A 2I4AA 1ZMAA 5AGYA 1Y6EA 3L0HA 5HR1A 1FW1A 2HZEB 1K0OA 4PUAA 2A4VA 1EGOA 2F9SA 2DJJA 1XWCA 4MDCA 3Q6OA 4XRAA 5D96A 4KA0A 4D73A 1USBA 3TJBA 4BA7A 1N2AA 4DSRA 1F3BA 1MD4A 4NAXA 5LCZA 1A2MA 4J56E 6GSSA 2FUG2 2DJ1A 4ECJA 2JZRA 1U6TA 2VCTA 2GGTA 3W6GA 2VLUA 7GSSA 1RK4A 3G9BA 1OKTA 3F4RA 4WKWA 2WRTA 4BPYA 2MMZA 4OD7A 5ECKB 4KW6A 4EDZA 4FYCA 1OE8A 4IQAA 4JE1A 4EF0A 3NIVA 3RDWA 4IJIA 2ZNMA 3M1GA 2WJUA 4K0GA 4LLRA 4K6XA 1N8JA 2E7PA 3EYTA 3APQA 1XWBA 1V40A 1QXHA 4HJ2A 5FT3A 2H0HA 4F0CA 1M2BA 4I97A 2DMMA 1URMA 3EU3A 3FRCA 3F8UA 2H30A 1PX7A 3VLNA 3BJ5A 3HA9A 4D73B 5L71A 1H75A 2NPBA 1VGLA 2O87A 4EKZA 2HZFA 4JR4A 1F37A 5EY6A 2GQLA 2VIMA 2K18A 5D9XA 4GSNA 5DQSA 5FHIA 4G9HA 2ALBA 1VF3A 2IL3A 4GQFA 5GAND 5F8BA 3FR6A 2CAQA 3W8SA 2IMDA 1A8YA 1OYJA 3R2QA 1HQOA 1PSQA 3E3EA 3APOA 2DJ0A 4WR5A 2FWFA 3P2AA 4XS4A 2B5YA 1GUKA 4I2TA 4IW9A 1X9WB 2C3QA 2HSMA 1I9DA 2CAIA 3A2WA 3JCML 3HJOA 1MDJA 1EGRA 5EVOA 2H6YA 3KCMA 1O8WA 1ZZYA 1T4ZA 4V1Ag 3FK8A 4ZBBA 3FZ4A 4K7OA 3P90A 1TI3A 3FZ9A 1GTBA 3IHQA 3FZ5A 4YAVA 1M99A 4H86A 4CDOA 4LA1A 1BX9A 5JWOB 3ZMLA 1VF2A 3F9UA 3EURA 4K1FA 3UEMA 1SK2A 4WETA 1BG5A 5IPHA 5DCGA 3KMOA 1IYHA 4G19A 4XCSA 2N5FA 1TU7A 3HYPA 3F3QA 4XS4B 3KM6A 5C00A 5IPGA 4NWYA 4MCUA 4OO4A 4OO5A 3FHKA 4HEA2 4F0BA 1K3YA 2HSMB 3IE3A 2HSYA 4G0IA 1M7TA 3GSSA 4I5QA 3UARA 4RI7A 2GT5A 1EV9A 3CSHA 1AUCA 4IVFA 4PTSA 3F63A 3HDCA 4MF6A 2ON7A 3EE2A 2C8UA 4BVXA 1NSWA 2F51A 1BYEA 1PX6A 2O89A 4FIWA 3IXRA 1SJ6A 1TJDA 2IFQA 1ERWA 2O8VB 4FYBA 4L5LA 3IV4A 2GS3A 1G0TA 3QAWA 1LBKA 3EWLA 1G6YA 2LJAA 5G1LA 4GXZA 4KGIA 1JZRA 1SU9A 4IP6A 2Z9SA 3TUEA 5CNWA 3M9KA 2ES7A 2FWGA 3ME7A 2H66A 1HNCA 4YAPA 4KB3A 3BBYA 2F3MA 1SKRB 1BQ7A 2OE3A 5CRDA 2L57A 1PKWA 3VURA 4X43A 1NW2A 3HCZA 2IMFA 1QMVA 2HLSA 2R37A 1TDIA 2UZ8A 4ZBAA 2VCQA 2JADA 3IAM2 4BVXB 4P3YB 4ZBDA 4GQCA 2FNOA 4F2IA 2EIRA 1K0CA 5ECHB 2X8CA 3ERWA 3QAVA 3WGDA 1M2AA 1ABAA 2IFQB 2NDOA 3VWUA 2EC4A 5COHA 2GSQA 1ILOA 3CBUA 3GH6A 2DIYA 3O76A 2HRAA 1PD21 1T3BA 4OFMA 3LSZA 3A3TA 2VCVA 2H73A 2HRNA 1GLPA 3GL3A 2MBSA 2H6XA 5J9CA 2FA8A 2XC2A 4GRFA 4N0ZA 3CMIA 1THOA 3MDKA 4XRDA 2M72A 5CRHA 5H5RA 3KMNA 2H76A 1SK1A 3F0IA 1T1VA 4HZ4A 17GSA 2VL2A 3KJYA 4TR0A 2PU9C 2OACA 4ML1A 4KDXA 3TKSC 1NM3A 2FA4A 1SL2B 5IMDA 3KZQA 2QGVA 2OBKA 5LD0A 1PA3A 2MBTA 2CVKA 3FYGA 4GSTA 1K0NA 1K3OA 2H6ZA 3TKPA 3F3RA 1ON4A 5D73A 2LS5A 3G7JA 3CSJA 2JSYA 4V2MA 2DJ3A 5DCHA 2K8VA 2L5LA 4OWYA 1Q98A 1Z3EA 5F07A 2PGTA 4GTUA 3QMXA 4PQIA 3IR4A 2YN1A 1W89A 3LEFA 2J23A 2HRKA 3E0UA 1A8LA 3HY2A 1T4YA 3DVXA 4DVCA 5J41A 5ELAA 1TU8A 4AGSA 4LMVA 3C7MA 5KN3A 4PNFA 4KUNA 1O7UA 3MNGA 4N0VA 1J08A 5JCWA 1NHYA 1DSBA 3PR8A 4XIHA 1GSYA 1HNAA 1AW9A 3FY7A 1C72A 4Q5RA 1B4PA 1R5AA 1CQGA 5IMFA 2N5AA 4HU7A 2H72A 3ZYWA 1K0MA 2CZ2A 2LEGA 1R26A 22GSA 2RUEA 3APSA 2YV9A 1PKZA 4HUAA 1T7PB 3QCPA 4AJ7A 3TJKA 3F6FA 5ABRA 5F0GA 2G2QA 3ERFA 4ZXGA 1XXUA 5ECLB 2DJKA 4NPBA 4MJBA 3UVTA 1FB0A 4IBPA 1AAZA 3IPZA 4PQ1A 3I69A 3GX0A 4NV5A 3CRUA 5IO0A 19GSA 2IJYA 3ERGA 2YNXA 2FHEA 3LORA 2GLRA 4DEJA 2REMA 3TRQA 1T8EB 1H4OA 3IOSA 3Q18A 3GA4A 5E59A 3RBTA 2LJRA 3HD5A 10GSA 3IK9A 1GRXA 1YEXA 3L9SA 5H5SA 2VCXA 3C1RA 1WRYA 2F8FA 1B9XC 3LYKA 1EWXA 3KH7A 1K0BA 1UA5A 1VF4A 2R5GA 3U6VA 5JCUA 1WIKA 3NZNA 2OE1A 3LXTA 2BTOT 2PERA 5GSTA 4TN8A 1A24A 3Q74A 1TK0B 2DBCA 4RQRA 1UC7A 2H01A 4EO3A 2LKUA 2CVDA 3UJ1A 4OCEA 4IHUA 2R2JA 2GZZA 1OC9A 4DSSB 4TW5A 4GF0A 3ISOA 2KUCA 2H0IA 1RW1A 1LJRA 1MDKA 2K8SA 4ACSA 1WWJA 1IYIA 2OADA 2WFCA 3KTLA 2TIRA 5HR3A 3VK9A 5DAKA 1QGVA 3GRXA 1Z5YE 2AJQB 1SL0B 3FW2A 1Z9HA 4KF9A 2LQQA 1GWCA 4MH3A 5KN2A 3W8JA 2YANA 2VM1A 1DE1A 2HT9A 2L4CA 2IWTA 2PPTA 4NMUA 2H1AA 3EU4A 3WT1A 3FZAA 6GSXA 20GSA 1MD3A 3O3TA 4KCEA 5HR0A 1YQ1A 1GP1A 1R7HA 2B1KA 5DALA 1TKDB 1S3CA 3DIEA 3ZRDA 2DC5A 3L9UA 2XBQA 3C73A 3N5OA 4V2LA 3LQ7A 3M0FA 4RUVA 5D9TA 4JEDA 2HNLA 3IK7A 2CZ3A 3ME8A 1GSEA 2GVPA 1X9SB 4FYUA 2EIQA 2CA8A 3UMAA 1OC9B 4TVEA 3LG6A 4ULXA 4FQUA 5IQYA 4JZQA 1MEKA 4MZCA 12GSA 5E4WA 3D0ZA 2C4JA 2DLXA 1K0AA 1T00A 5DAKB 1YZXA 2H71A 8GSSA 3VWWA 3G7IA 2X8HA 3FEUA 1F3AA 3HHVA 3QAGA 3EVIA 2VLVA 5ECQB 1MDIA 3ZREA 1PGTA 2H75A 3DEXA 1EP8A 1EOGA 2YWIA 2WCIA 4GCIA 4G10A 5DALB 4JU5A 4BWQA 1XZOA 3TB2A 4MF5A 2K9FA 4Z7XA 4K7IA 2IMKA 1EEJA 2AUVA 1QUWA 3SWLA 2OKAA 4TXVA 1RQMA 2V1MA 3GIXA 3GV1A 2G0FA 1WPIA 3GX8A 1M9BA 4ISDA 2PVQA 2DIZA 1U88A 3KH9A 2JU5A 3O6TA 4XS6A 2A2RA 3VPTA 5CYYA 5KEJA 4YQMA 1SD8A 5CO3A 4X0XA 4TR1A 2GSRA 4HI7A 1OC8A 3TDGA 2WGRA 2DMLA 4K7NA 4HJMA 2PVOC 1B4QA 2VUPA 3AY8A 5F06A 3D5JA 1AIUA 1SENA 1XW9A 3MSZA 2LV3A 6GSWA 5J4UA 1GTAA 5CAXA 1O81A 3J7Yb 1AQXA 2A2SA 1PQNA 2I9HA 3RPPA 3QOUA 3H4KA 4IQ1A 1TRWA 5AIVA 5GSSA 5ECOB 4OMVA 2DJ2A 4POBA 1GNWA 2BMXA 2B3SA 2LTKA 3WGXA 2GTUA 4POLA 2FLSA 4PNGA 3IBHA 4G0KA 5IIZA 4NXIA 2H1DA 1GNEA 2O85A 2XBIA 3J7Yk 1GSQA 1AXDA 3TJJA 3H1NA 2NBSA 3M9JA 2HXKA 4N30A 4O5RA 3DKSA 5DDLA 5J3RA 3DYRA 4HOJA 3ZTLA 5A4VA 1JLVA 1A0RP 1FVKA 4LMWA 4TR1B 4J2FA 3KTBA 4CW9A 1MTCA 3TOUA 3ZL5A 2J9HA 4EE0A 4TRXA 3WD6A 5D9WA 3M8NA 4EXJA 5C04A 3CXGA 2E2GA 4WBJA 4ECIA
chains in the Genus database with same CATH superfamily
2RLIA 2VOCA 4EVMA 3L9VA 2B1LA 3IRAA 1WJKA 2VL9A 5J4VA 5A4WA 4OFTA 3KIJA 1OE7A 1XW6A 1JLWA 5BMUA 2YZUA 1DE2A 1X9MB 4TOPA 2JACA 4USSA 5FWGA 3A5WA 3EC3A 5HFKA 4KDYA 1AC1A 4K0NA 2L4QA 2H0GA 4QQ7A 1WMJA 4E68A 4IKHA 3RFRC 3EPTA 3P8WA 1GSDA 4X4JA 4WEYA 2H19A 2RIIA 4YQUA 1WP0A 2LRNA 4AF2A 3A2XA 2CV4A 1EZKA 1SYRA 3EMXA 2XPEA 2FCHA 4XTSA 2B6MA 3GTUA 1PRXA 1TK5B 3UIWA 4MP4A 3GYKA 2OBIA 2M80A 4KDUA 2X99A 3UBLA 4WXTA 5J5NA 3D22A 4MLYA 1UVZA 1ZOFA 3E9JB 4MABA 2V32A 4KX4A 2PWJA 2YWNA 5IMAA 3IC8A 3L78A 1O8XA 3LXZA 4KH7A 1Y25A 1GTUA 2KP2A 5BMUB 2F8AA 3HJMA 11GSA 3G7YA 3PH9A 4AKIA 3TKRA 4TR3A 2AB6A 2DSAA 4AJ8A 1M2DA 4QL7A 5DJLA 2IMIA 2VAFA 1BG1A 1XWGA 1ERTA 1HYUA 1DUGA 3BD2A 5A1NB 1XOBA 1XWAA 3D4TA 3F4TA 5J9BA 1OAZA 1SVLA 2C0GA 1TRSA 5EL8A 3QFBC 3GTUB 2VCWA 2HFDA 1EV4A 3PPUA 5CP1A 4CY8A 1KNGA 6GSUA 1W4VA 4DSQA 3UL3A 2WW1A 2O3EA 3SBCA 5A4UA 1SL1B 1E6BA 4IGJA 9GSSA 1XFLA 3F6DA 2FWEA 2MMOA 1TRVA 3GFKA 2QC7A 5B8BA 5B7CA 3QR6A 1OC3A 4G0LA 1XW5A 4G2EA 2E0QA 2MYGA 2C0FA 5DVBA 4ZIJA 3M3MA 2CVBA 4J57E 3RPNA 3I9V2 3A2VA 4LL1B 4ZL9A 1QFNA 1M9AA 4MMMA 3HXSA 6GSYA 4KAEA 3MIXA 6GSVA 1NHOA 3TJGA 2GZPA 2FY6A 3QD9A 4DSSA 3FR9A 3HVSA 4ILFA 4V1Ap 5DBQA 5B6MA 4K8MA 5F05A 4JBBA 3WGEA 4TXOA 1CQHA 5G5EA 1Z6NA 3ZVJD 1SK0A 1YEPA 4PURA 2R6KA 2KOKA 2MMNA 3TKSA 4PXOA 2X64A 2HSNA 3IC4A 2LNSA 3HVNA 2IN3A 4FH8A 3US3A 4ZB9A 3TKSE 1TK8B 2C3NA 1FO5A 1GTIA 4F03A 4I8BA 3BCKA 4E8HA 4HQZA 1TW9A 2KP1A 1ZYNA 2X8GA 4MF7A 1BJXA 4POKA 2YJHA 4PUFC 5J47A 3GN3A 1HNBA 1YDKA 2OA7A 2NTOA 2R4VA 3IAS2 2AV4A 2P5RA 3TRXA 18GSA 4EDYA 4EC0A 1XPVA 1AQWA 3IHGA 4MA9A 2V6KA 2VD0A 2C0EA 2WVYA 2LJKA 4WR4A 1Q4JA 1XBSA 2QSIA 3HKRA 2YWOA 1J9BA 2K6VA 3DXBA 4CY6A 1VRSD 4TXOB 1FOHA 1A2LA 1TTZA 2HSHA 1G6WA 2WZ9A 1QQ2A 5ECPB 1SJIA 4N11A 4GSSA 1ST9A 2NVLA 2YP6A 5KN0A 1JHBA 2VO4A 4CHSA 2HSNB 2KLXA 1BAYA 3DWVA 1R4WA 3GKNA 5KOWA 3TGZA 2TRCP 3TKQA 1K3LA 3IDVA 1G7OA 2C1YA 2H70A 3ZZXA 5HFGA 1KBNA 5GZZB 1PN9A 3CRTA 5ECMB 2P0GA 4ZILA 1YEWC 2WULA 1F2EA 4MH2A 4A5PA 2P31A 1VF1A 2HRFA 5H5QA 1ZYQB 1FOVA 1EP7A 1M0UA 1FAAA 1O85A 4MZWA 1Y1UA 4MPGA 2EIOA 5G2ZA 2HYXA 2I3YA 3KGKA 4KSMA 2I81A 3V1WA 2HE3A 3GKKA 2JL4A 1SD9A 13GSA 3LJRA 2IPAA 4YKGA 2V2GA 4MK3A 4ZB6A 4XS1A 3S9FA 4N10A 4I6XA 1GSSA 1ZCPA 1GL8A 4BWSA 4Q5QA 2L59A 2YZHA 3L4NA 2H1GA 4IELA 1OKDA 2O7KA 3HVXA 1YJ6A 1YKCA 2H8LA 3GKXA 3C71A 2FGXA 2VCZA 3ED3A 2P5QA 3C1SA 5IOXA 2CQ9A 2DKIA 2VLTA 4L0UA 5A5KA 1ACVA 4IP1A 2ZCTA 1TXXA 2D2ZA 4OFNA 5B6NA 3PINA 4MPFA 4PGTA 4NHZA 1SKWB 3Q19A 5GAPD 5ID2A 5G31A 2YCDA 5J4YA 1ZGNA 1JZWA 3DGQA 1Z7RA 2WDUA 4TR4A 5ECRB 1F9MA 2LSTA 4EL1A 3QFAC 3TCOA 1JFUA 2JSZA 2JZTA 1TP9A 1X5EA 4ECCA 4KNDA 3HVVA 1XIYA 1U3IA 5G30A 5IMZA 3N9JA 4HU9A 2YJ7A 1U3AA 5ECIB 4BL7A 1TRUA 5IO2A 3PGTA 3TOTA 1V9WA 3D4MA 4FO5A 2X4AA 2LRTA 1SYXA 2ON5A 4PX1A 2LRCA 3GHAA 3ZMKA 1ZYEA 4IS0A 3D6IA 4X1UA 3VI5A 1WE0A 3CQFA 1Z7PA 2GT6A 2WW0A 1DBYA 2VL3A 2PN8A 1YY7A 5EPFA 3U5RE 5B8AA 3HZ8A 4IJ3A 1O73A 2XHFA 5IOWA 3RAZA 5ID2B 2AAWA 2L6CA 2MMAA 4E8EA 3BCIA 4ZL8A 1B9YC 3D21A 3ZITA 5D8IA 5JWQB 2R0PA 1V98A 3HJPA 2VL2C 3CTGA 2GDRA 4EUYA 1J0FA 4K9ZA 2PUKC 4O7HA 3NOFA 5HQPA 4NV2A 5DQYA 5HR2A 3KXOA 2H74A 4HZ2A 3LGCA 2YV7A 2CX4A 1PMTA 1GSUA 5ECNB 1A23A 1B48A 2RUFA 1G7EA 1E2YA 2B7KA 1FB6A 4BL7B 4K2DA 2LQOA 1KTEA 5CREA 4PI0C 1JZDA 1LU4A 3EINA 2OE0A 2WZSA 1AQVA 4MJCA 2WW2A 3FKFA 4GLTA 2HI7A 3R3EA 4RQXA 4F9ZA 3WT2A 4NHWA 1V58A 5G1KA 3QDNA 3DMLA 5D9VA 1TI1A 2RM5A 1TOFA 1V57A 4Q5NA 3ZFLA 4MJEA 2UV8G 2B5XA 1GULA 4WF5A 4QL9A 1XWKA 2WS2A 1ERUA 2OJLA 4ZB8A 3DVWA 3VPQA 4ICYA 2O5VA 2PMTA 3VWXA 2KHPA 1GUHA 6GSTA 2FWHA 4HDEA 3GNJA 2C0DA 4F82A 4HS1A 3KD0A 2TRXA 2CT6A 5A1NA 3MAKA 4IN0A 2ZUPA 1V2AA 1PL2A 3UVHA 1XCCA 2IMEA 2YWMA 5INYA 2GSTA 3VFIA 3LYPA 4AI6A 3QPMA 5AISA 2PBJA 2WVXA 2L5OA 3LFLA 1YKAA 3H93A 3DD3A 3FMWA 2N5BA 2B5EA 3CYNA 3GH9A 4OCFA 3UOMA 1XOAA 1PL1A 5ELGA 4JRRA 1EOHA 1O6JA 2MZCA 4I2UA 4WBRD 4JR6A 2IIYA 2C80A 2C3TA 2LNTA 1SKSB 3GURA 5JCGA 3GUSA 4TKYA 1ERVA 4FXYP 1THXA 5DJMA 3H8QA 2QA1A 4BVYA 4O5UA 1ML6A 1FVJA 1K0DA 4KE3A 2A2PA 5KN1A 14GSA 1GUMA 2GZYA 4LL4B 3I6AA 3KEBA 3BOAA 2H1BA 2HQTA 1KEBA 2L6DA 3C8EA 3OR5A 4MZBA 1XVWA 4WBJA 1SJZA 4RI6A 4GWRA 1I5GA 1ZYPA 1WOUA 3DRNA 1FG4A 3IA1A 3ZIVA 2GQKA 1OVNA 1GSFA 3GMFA 5KOXA 3WYWA 3EMPA 2A4HA 4AJ6A 3MWHA 4KCAA 3TRPA 2FD3A 1BEDA 3VI7A 1Z6MA 3FR3A 1R5PA 2VD1A 2WVXB 1U87A 1EEMA 4XHMA 5JWRB 4YQVA 1X5DA 5CRGA 2BJXA 2YPMA 4L5OA 5HFIA 2WB9A 3K8NA 5ENUA 1GLQA 4ECBA 2V6OA 2YOIA 3CSIA 3KP9A 3UAPA 5LNKe 3ZFBA 4O32A 5ECSA 1YF0A 2I1UA 5D93A 16GSA 1FHEA 3RHBA 1ZL9A 2JZSA 2E2MA 1UN2A 4BVYB 4L8EA 5IM9A 3GKMA 1M3JA 1YF1A 2QKEA 2HZEA 1X0RA 2VM2A 3ZIJA 1XVQA 5IMCA 1X5CA 4Q5FA 3TJFA 3I43A 5IMVA 2AHEA 2XPDA 2R3XA 4ZL7A 4QMKA 5CRWA 5AIXA 1A2JA 2GQMA 3ZLPA 2GSSA 1HD2A 4HQSA 4O92A 2M46A 2CX3A 4AKGA 2LUSA 4L0WA 3F4SA 3LWAA 1A0FA 1F6MC 1SVMA 4WF4A 3TU3B 3ZVJA 3H79A 4POMA 4MJAA 4ZB7A 1JZOA 5A5HA 4BIKA 2HRKB 4ID0A 3RHCA 1S3AA 4V2NA 5AN1A 3KP8A 3GSTA 3CTFA 1QK8A 4PQHA 1B8XA 2V41A 3UBKA 4ML6A 4KSOA 4YH2A 1S3DA 2AYTA 2B7JA 3P7XA 5G5FA 3VWVA 2RM6A 3HZ4A 3GL5A 1GH2A 2I4AA 1ZMAA 5AGYA 1Y6EA 4K5RA 3L0HA 5HR1A 1FW1A 2HZEB 2EFDA 1K0OA 4PUAA 2A4VA 2R0CA 1EGOA 2F9SA 2DJJA 1XWCA 4MDCA 3Q6OA 4XRAA 5D96A 4KA0A 4D73A 1USBA 3TJBA 4BA7A 1N2AA 4DSRA 1F3BA 1MD4A 4NAXA 5LCZA 1A2MA 4J56E 6GSSA 2FUG2 2DJ1A 4ECJA 2JZRA 1U6TA 2VCTA 2GGTA 3W6GA 2VLUA 7GSSA 1RK4A 3G9BA 1OKTA 3F4RA 4WKWA 2WRTA 4BPYA 5A5HB 2MMZA 4OD7A 5ECKB 2O36A 4KW6A 4EDZA 4FYCA 1OE8A 4IQAA 4JE1A 4EF0A 3NIVA 3RDWA 4IJIA 2ZNMA 3M1GA 5BRTA 2WJUA 4K0GA 4LLRA 4K6XA 1N8JA 2E7PA 3EYTA 3APQA 1XWBA 1V40A 1QXHA 4HJ2A 5FT3A 2H0HA 4F0CA 1M2BA 4I97A 2DMMA 1URMA 3EU3A 3FRCA 3F8UA 2H30A 1PX7A 3VLNA 3BJ5A 3HA9A 4D73B 5L71A 1H75A 2NPBA 1VGLA 2O87A 4EKZA 2HZFA 4JR4A 1F37A 5EY6A 2GQLA 2VIMA 2K18A 5D9XA 4GSNA 5DQSA 5FHIA 4K2XA 4G9HA 2ALBA 1VF3A 2IL3A 4GQFA 5GAND 5F8BA 3FR6A 2CAQA 3W8SA 2IMDA 1A8YA 1OYJA 3R2QA 1HQOA 1PSQA 3E3EA 4O5QA 3APOA 2DJ0A 4WR5A 2FWFA 3P2AA 4XS4A 2B5YA 1GUKA 4I2TA 4IW9A 2H1LA 1X9WB 2C3QA 2HSMA 1I9DA 2CAIA 3A2WA 3JCML 3HJOA 1MDJA 1EGRA 5EVOA 2H6YA 2X49A 3KCMA 3MYDA 1O8WA 1ZZYA 1T4ZA 4V1Ag 3FK8A 4ZBBA 3FZ4A 4K7OA 3P90A 4Z2RA 1TI3A 3FZ9A 1GTBA 3IHQA 3FZ5A 4YAVA 1M99A 4H86A 4CDOA 4LA1A 1BX9A 5JWOB 3ZMLA 1VF2A 4GDFA 3F9UA 3EURA 4YKFA 4K1FA 3UEMA 1S3RA 1SK2A 4WETA 1BG5A 5IPHA 5DCGA 3KMOA 1IYHA 4G19A 4XCSA 2N5FA 1TU7A 1BF5A 3HYPA 3F3QA 4XS4B 3KM6A 5C00A 5IPGA 4NWYA 4MCUA 4OO4A 4OO5A 3FHKA 4HEA2 4F0BA 1K3YA 2HSMB 3IE3A 2HSYA 4G0IA 1M7TA 3GSSA 4I5QA 3UARA 4RI7A 2GT5A 1EV9A 3CSHA 1AUCA 4IVFA 4PTSA 3F63A 4EIPA 3HDCA 4MF6A 2ON7A 3EE2A 2C8UA 4BVXA 1NSWA 2F51A 2WW3A 1BYEA 1PX6A 2O89A 4FIWA 3IXRA 1SJ6A 1TJDA 2IFQA 1ERWA 2O8VB 3HMJG 1N25A 4FYBA 4L5LA 3IV4A 2GS3A 1G0TA 3QAWA 1LBKA 3EWLA 1G6YA 2LJAA 4AKXB 5G1LA 4GXZA 4KGIA 5J40A 1JZRA 1SU9A 4IP6A 2Z9SA 3TUEA 5CNWA 3M9KA 2ES7A 2FWGA 3ME7A 4G01A 2H66A 1HNCA 4YAPA 4KB3A 3BBYA 2F3MA 1SKRB 1BQ7A 2OE3A 3LW9A 5CRDA 4HSCX 2L57A 2EFEA 1PKWA 3VURA 4X43A 2QA2A 1NW2A 3HCZA 2VKZG 2IMFA 1QMVA 2HLSA 2R37A 1TDIA 2UZ8A 4ZBAA 1PN0A 2VCQA 2JADA 3IAM2 4BVXB 4P3YB 4ZBDA 4GQCA 2FNOA 4F2IA 2EIRA 1K0CA 5ECHB 2X8CA 3ERWA 3QAVA 3WGDA 1M2AA 1ABAA 2IFQB 2NDOA 3VWUA 2EC4A 5COHA 2GSQA 1ILOA 3CBUA 3GH6A 2DIYA 3O76A 2HRAA 1PD21 1T3BA 4OFMA 3LSZA 3A3TA 2VCVA 2H73A 2HRNA 1GLPA 3GL3A 2MBSA 2H6XA 5J9CA 2FA8A 2XC2A 4GRFA 4N0ZA 3CMIA 1THOA 3MDKA 4XRDA 2M72A 5CRHA 5H5RA 3KMNA 2H76A 1SK1A 3F0IA 1T1VA 4Z2UA 4HZ4A 17GSA 2VL2A 3KJYA 4TR0A 2PU9C 2OACA 4ML1A 4KDXA 3TKSC 1NM3A 2FA4A 1SL2B 5IMDA 4PHZC 3KZQA 2QGVA 2OBKA 5LD0A 1PA3A 2MBTA 2CVKA 3FYGA 4GSTA 1K0NA 1K3OA 2H6ZA 3TKPA 3F3RA 1ON4A 5D73A 2LS5A 3G7JA 3CSJA 1S4BP 2JSYA 4V2MA 2DJ3A 5DCHA 2K8VA 2L5LA 4OWYA 1Q98A 1Z3EA 5F07A 2PGTA 4GTUA 3QMXA 4PQIA 3IR4A 2YN1A 1W89A 3LEFA 2J23A 2HRKA 3E0UA 1A8LA 3HY2A 1T4YA 3DVXA 4DVCA 5J41A 5ELAA 1TU8A 4N3ZA 4AGSA 4LMVA 3C7MA 5KN3A 4PNFA 4KUNA 1O7UA 3MNGA 4N0VA 1J08A 5JCWA 1NHYA 1DSBA 3PR8A 4XIHA 1GSYA 1HNAA 1M3IA 1AW9A 4PI2C 3FY7A 1C72A 4Q5RA 1B4PA 1R5AA 1CQGA 5IMFA 2N5AA 4HU7A 2H72A 3ZYWA 1K0MA 2CZ2A 2LEGA 1R26A 22GSA 1XG8A 2RUEA 3APSA 2YV9A 1PKZA 4HUAA 1T7PB 3QCPA 4AJ7A 3TJKA 3F6FA 5ABRA 5F0GA 2G2QA 3ERFA 1YVLA 4ZXGA 1XXUA 5ECLB 2DJKA 4NPBA 4MJBA 3UVTA 1FB0A 4IBPA 1AAZA 3IPZA 4PQ1A 3I69A 3GX0A 4NV5A 3CRUA 5IO0A 19GSA 2IJYA 3ERGA 2YNXA 5A34A 2FHEA 3LORA 2GLRA 4DEJA 4AKHA 2REMA 3TRQA 1T8EB 1H4OA 3IOSA 3Q18A 3A5IA 3GA4A 5E59A 3RBTA 2LJRA 3HD5A 10GSA 3IK9A 1GRXA 1YEXA 3L9SA 2DKHA 5H5SA 2VCXA 3C1RA 1WRYA 2F8FA 1B9XC 3LYKA 1EWXA 3KH7A 1K0BA 1UA5A 1I1IP 1VF4A 2R5GA 3U6VA 5JCUA 1WIKA 2WVZA 3NZNA 2OE1A 3LXTA 2BTOT 2PERA 5GSTA 4TN8A 1A24A 3Q74A 1TK0B 2DBCA 4Z2TA 4RQRA 3CWGA 1UC7A 2H01A 4EO3A 2LKUA 2CVDA 3UJ1A 4OCEA 4IHUA 2R2JA 2GZZA 3RGBC 1OC9A 3CHXC 4DSSB 4TW5A 4GF0A 3ISOA 2KUCA 5A34B 2H0IA 1RW1A 1LJRA 1MDKA 2K8SA 4ACSA 1WWJA 1IYIA 2OADA 2WFCA 3KTLA 2TIRA 5HR3A 3VK9A 5DAKA 1QGVA 3GRXA 1Z5YE 2AJQB 1SL0B 3FW2A 1Z9HA 4KF9A 2LQQA 1GWCA 4MH3A 5KN2A 3W8JA 2YANA 2VM1A 1DE1A 2HT9A 2L4CA 2IWTA 2PPTA 4NMUA 4MNNA 2H1AA 3EU4A 3WT1A 3FZAA 6GSXA 20GSA 1MD3A 3O3TA 4KCEA 5HR0A 1YQ1A 1GP1A 1R7HA 2B1KA 5DALA 1TKDB 1S3CA 3DIEA 3ZRDA 2DC5A 3L9UA 2R0GA 2XBQA 3C73A 3N5OA 4V2LA 3LQ7A 3M0FA 4RUVA 5D9TA 4JEDA 2HNLA 3IK7A 2CZ3A 3ME8A 1GSEA 2GVPA 1X9SB 4FYUA 2EIQA 2CA8A 3UMAA 1OC9B 1TXUA 4TVEA 3LG6A 4ULXA 4FQUA 5IQYA 4JZQA 1MEKA 4MZCA 12GSA 5E4WA 3D0ZA 2C4JA 2DLXA 1K0AA 1T00A 5DAKB 1YZXA 2H71A 8GSSA 3VWWA 3G7IA 2X8HA 3FEUA 1F3AA 3HHVA 3QAGA 3EVIA 2VLVA 5ECQB 1MDIA 3ZREA 1PGTA 2H75A 3DEXA 1EP8A 1EOGA 2YWIA 2WCIA 4GCIA 4G10A 5DALB 4JU5A 4BWQA 1XZOA 3TB2A 4MF5A 2K9FA 4Z7XA 2IMKA 4K7IA 1EEJA 2AUVA 1QUWA 3SWLA 2OKAA 4TXVA 1RQMA 2V1MA 3GIXA 3GV1A 2G0FA 1WPIA 3GX8A 1M9BA 4ISDA 2PVQA 2DIZA 1U88A 3KH9A 2JU5A 3O6TA 4XS6A 2A2RA 3VPTA 5CYYA 4EIQA 5KEJA 4YQMA 1SD8A 5CO3A 4X0XA 4TR1A 2GSRA 4HI7A 1OC8A 3TDGA 1PFOA 2WGRA 2DMLA 4K7NA 4HJMA 2PVOC 1B4QA 2VUPA 3AY8A 5F06A 3D5JA 1AIUA 1SENA 1XW9A 3MSZA 2LV3A 4W66A 6GSWA 5J4UA 1GTAA 5CAXA 1O81A 3J7Yb 1AQXA 2A2SA 1PQNA 2I9HA 3RPPA 3QOUA 3H4KA 4K5SA 4IQ1A 1TRWA 5AIVA 5GSSA 5ECOB 4OMVA 2DJ2A 4POBA 1GNWA 1SVOA 2BMXA 2EFCA 2B3SA 2LTKA 3WGXA 2GTUA 4POLA 2FLSA 4PNGA 3IBHA 4G0KA 5IIZA 4NXIA 2H1DA 1GNEA 2O85A 2XBIA 3J7Yk 1GSQA 1AXDA 3TJJA 2OT3A 3H1NA 2NBSA 3M9JA 2HXKA 4N30A 4O5RA 3DKSA 5DDLA 5J3RA 3DYRA 4HOJA 3ZTLA 5A4VA 1JLVA 1A0RP 1FVKA 4LMWA 4TR1B 4J2FA 3KTBA 4CW9A 1MTCA 3TOUA 3ZL5A 2J9HA 4EE0A 4TRXA 3WD6A 5D9WA 3M8NA 4EXJA 5C04A 3CXGA 2E2GA 2EFHA 4ECIA
chains in the Genus database with same CATH topology
2RLIA 2VOCA 4EVMA 3L9VA 2B1LA 3IRAA 1WJKA 2VL9A 5J4VA 5A4WA 4OFTA 3KIJA 1OE7A 1XW6A 1JLWA 5BMUA 2YZUA 1DE2A 1X9MB 4TOPA 2JACA 4USSA 5FWGA 3A5WA 3EC3A 5HFKA 4KDYA 1AC1A 4K0NA 2L4QA 2H0GA 4QQ7A 1WMJA 4E68A 4IKHA 3EPTA 3P8WA 1GSDA 4X4JA 4WEYA 2H19A 2RIIA 4YQUA 1WP0A 2LRNA 4AF2A 3A2XA 2CV4A 1EZKA 1SYRA 3EMXA 2XPEA 2FCHA 4XTSA 2B6MA 3GTUA 1PRXA 1TK5B 3UIWA 4MP4A 3GYKA 2OBIA 2M80A 4KDUA 2X99A 3UBLA 4WXTA 5J5NA 3D22A 4MLYA 1UVZA 1ZOFA 3E9JB 4MABA 2V32A 4KX4A 2PWJA 2YWNA 5IMAA 3IC8A 3L78A 1O8XA 3LXZA 4KH7A 1Y25A 1GTUA 2KP2A 5BMUB 2F8AA 3HJMA 11GSA 3G7YA 3PH9A 4AKIA 3TKRA 4TR3A 2AB6A 2DSAA 4AJ8A 1M2DA 4QL7A 5DJLA 2IMIA 2VAFA 1BG1A 1XWGA 1ERTA 1HYUA 1DUGA 3BD2A 5A1NB 1XOBA 1XWAA 3D4TA 3F4TA 5J9BA 1OAZA 1SVLA 2C0GA 1TRSA 5EL8A 3QFBC 3GTUB 2VCWA 2HFDA 1EV4A 3PPUA 5CP1A 4CY8A 1KNGA 6GSUA 1W4VA 4DSQA 3UL3A 3SBCA 5A4UA 1SL1B 1E6BA 4IGJA 9GSSA 1XFLA 3F6DA 2FWEA 2MMOA 1TRVA 3GFKA 2QC7A 5B8BA 5B7CA 3QR6A 1OC3A 4G0LA 1XW5A 4G2EA 2E0QA 2MYGA 2C0FA 5DVBA 4ZIJA 3M3MA 2CVBA 4J57E 3RPNA 3I9V2 3A2VA 4LL1B 4ZL9A 1QFNA 1M9AA 4MMMA 3HXSA 6GSYA 4KAEA 3MIXA 6GSVA 1NHOA 3TJGA 2GZPA 2FY6A 3QD9A 4DSSA 3FR9A 3HVSA 4ILFA 4V1Ap 5DBQA 5B6MA 4K8MA 5F05A 4JBBA 3WGEA 4TXOA 1CQHA 5G5EA 1Z6NA 3ZVJD 1SK0A 1YEPA 4PURA 2R6KA 2KOKA 2MMNA 3TKSA 4PXOA 2X64A 2HSNA 3IC4A 2LNSA 2IN3A 4FH8A 3US3A 4ZB9A 3TKSE 1TK8B 2C3NA 1FO5A 1GTIA 4F03A 4I8BA 3BCKA 4E8HA 4HQZA 1TW9A 2KP1A 1ZYNA 2X8GA 4MF7A 1BJXA 4POKA 2YJHA 4PUFC 5J47A 3GN3A 1HNBA 1YDKA 2OA7A 2NTOA 2R4VA 3IAS2 2AV4A 2P5RA 3TRXA 18GSA 4EDYA 4EC0A 1XPVA 1AQWA 3IHGA 4MA9A 2V6KA 2VD0A 2C0EA 2LJKA 4WR4A 1Q4JA 1XBSA 2QSIA 3HKRA 2YWOA 1J9BA 2K6VA 3DXBA 4CY6A 1VRSD 4TXOB 1FOHA 1A2LA 1TTZA 2HSHA 1G6WA 2WZ9A 1QQ2A 5ECPB 1SJIA 4N11A 4GSSA 1ST9A 2NVLA 2YP6A 5KN0A 1JHBA 2VO4A 4CHSA 2HSNB 2KLXA 1BAYA 3DWVA 1R4WA 3GKNA 5KOWA 3TGZA 2TRCP 3TKQA 1K3LA 3IDVA 1G7OA 2C1YA 2H70A 3ZZXA 5HFGA 1KBNA 5GZZB 1PN9A 3CRTA 5ECMB 2P0GA 4ZILA 2WULA 1F2EA 4MH2A 4A5PA 2P31A 1VF1A 2HRFA 5H5QA 1ZYQB 1FOVA 1EP7A 1M0UA 1FAAA 1O85A 4MZWA 1Y1UA 4MPGA 2EIOA 5G2ZA 2HYXA 2I3YA 3KGKA 4KSMA 2I81A 3V1WA 2HE3A 3GKKA 2JL4A 1SD9A 13GSA 3LJRA 2IPAA 4YKGA 2V2GA 4MK3A 4ZB6A 4XS1A 3S9FA 4N10A 4I6XA 1GSSA 1ZCPA 1GL8A 4BWSA 4Q5QA 2L59A 2YZHA 3L4NA 2H1GA 4IELA 1OKDA 2O7KA 3HVXA 1YJ6A 1YKCA 2H8LA 3GKXA 3C71A 2FGXA 2VCZA 3ED3A 2P5QA 3C1SA 5IOXA 2CQ9A 2DKIA 2VLTA 4L0UA 5A5KA 1ACVA 4IP1A 2ZCTA 1TXXA 2D2ZA 4OFNA 5B6NA 3PINA 4MPFA 4PGTA 4NHZA 1SKWB 3Q19A 5GAPD 5ID2A 5G31A 2YCDA 5J4YA 1ZGNA 1JZWA 3DGQA 1Z7RA 2WDUA 4TR4A 5ECRB 1F9MA 2LSTA 4EL1A 3QFAC 3TCOA 1JFUA 2JSZA 2JZTA 1TP9A 1X5EA 4ECCA 4KNDA 3HVVA 1XIYA 1U3IA 5G30A 5IMZA 3N9JA 4HU9A 2YJ7A 1U3AA 5ECIB 4BL7A 1TRUA 5IO2A 3PGTA 3TOTA 1V9WA 3D4MA 4FO5A 2X4AA 2LRTA 1SYXA 2ON5A 4PX1A 2LRCA 3GHAA 3ZMKA 1ZYEA 4IS0A 3D6IA 4X1UA 3VI5A 1WE0A 1Z7PA 2GT6A 1DBYA 2VL3A 2PN8A 1YY7A 5EPFA 3U5RE 5B8AA 3HZ8A 4IJ3A 1O73A 2XHFA 5IOWA 3RAZA 5ID2B 2AAWA 2L6CA 2MMAA 4E8EA 3BCIA 4ZL8A 1B9YC 3D21A 3ZITA 5D8IA 5JWQB 2R0PA 1V98A 3HJPA 2VL2C 3CTGA 2GDRA 4EUYA 1J0FA 4K9ZA 2PUKC 4O7HA 3NOFA 5HQPA 4NV2A 5DQYA 5HR2A 3KXOA 2H74A 4HZ2A 3LGCA 2YV7A 2CX4A 1PMTA 1GSUA 5ECNB 1A23A 1B48A 2RUFA 1G7EA 1E2YA 2B7KA 1FB6A 4BL7B 4K2DA 2LQOA 1KTEA 5CREA 1JZDA 1LU4A 3EINA 2OE0A 1AQVA 4MJCA 3FKFA 4GLTA 2HI7A 3R3EA 4RQXA 4F9ZA 3WT2A 4NHWA 1V58A 5G1KA 3QDNA 3DMLA 5D9VA 1TI1A 2RM5A 1TOFA 1V57A 4Q5NA 3ZFLA 4MJEA 2UV8G 2B5XA 1GULA 4WF5A 4QL9A 1XWKA 2WS2A 1ERUA 2OJLA 4ZB8A 3DVWA 3VPQA 4ICYA 2O5VA 2PMTA 3VWXA 2KHPA 1GUHA 6GSTA 2FWHA 4HDEA 3GNJA 2C0DA 4F82A 4HS1A 3KD0A 2TRXA 2CT6A 5A1NA 3MAKA 4IN0A 2ZUPA 1V2AA 1PL2A 3UVHA 1XCCA 2IMEA 2YWMA 5INYA 2GSTA 3VFIA 3LYPA 4AI6A 3QPMA 5AISA 2PBJA 2L5OA 3LFLA 1YKAA 3H93A 3DD3A 3FMWA 2N5BA 2B5EA 3CYNA 3GH9A 4OCFA 3UOMA 1XOAA 1PL1A 5ELGA 4JRRA 1EOHA 1O6JA 2MZCA 4I2UA 4WBRD 4JR6A 2IIYA 2C80A 2C3TA 2LNTA 1SKSB 3GURA 5JCGA 3GUSA 4TKYA 1ERVA 1THXA 5DJMA 3H8QA 2QA1A 4BVYA 4O5UA 1ML6A 1FVJA 1K0DA 4KE3A 2A2PA 5KN1A 14GSA 1GUMA 2GZYA 4LL4B 3I6AA 3KEBA 3BOAA 2H1BA 2HQTA 1KEBA 2L6DA 3C8EA 3OR5A 4MZBA 1XVWA 4WBJA 1SJZA 4RI6A 4GWRA 1I5GA 1ZYPA 1WOUA 3DRNA 1FG4A 3IA1A 3ZIVA 2GQKA 1OVNA 1GSFA 3GMFA 5KOXA 3WYWA 3EMPA 2A4HA 4AJ6A 3MWHA 4KCAA 3TRPA 2FD3A 1BEDA 3VI7A 1Z6MA 3FR3A 1R5PA 2VD1A 1U87A 1EEMA 4XHMA 5JWRB 4YQVA 1X5DA 5CRGA 2BJXA 2YPMA 4L5OA 5HFIA 2WB9A 3K8NA 5ENUA 1GLQA 4ECBA 2V6OA 2YOIA 3CSIA 3KP9A 3UAPA 5LNKe 3ZFBA 4O32A 5ECSA 1YF0A 2I1UA 5D93A 16GSA 1FHEA 3RHBA 1ZL9A 2JZSA 2E2MA 1UN2A 4BVYB 4L8EA 5IM9A 3GKMA 1YF1A 2QKEA 2HZEA 1X0RA 2VM2A 3ZIJA 1XVQA 5IMCA 1X5CA 4Q5FA 3TJFA 3I43A 5IMVA 2AHEA 2XPDA 2R3XA 4ZL7A 4QMKA 5CRWA 5AIXA 1A2JA 2GQMA 3ZLPA 2GSSA 1HD2A 4HQSA 4O92A 2M46A 2CX3A 4AKGA 2LUSA 4L0WA 3F4SA 3LWAA 1A0FA 1F6MC 1SVMA 4WF4A 3TU3B 3ZVJA 3H79A 4POMA 4MJAA 4ZB7A 1JZOA 5A5HA 2HRKB 4ID0A 3RHCA 1S3AA 4V2NA 5AN1A 3KP8A 3GSTA 3CTFA 1QK8A 4PQHA 1B8XA 2V41A 3UBKA 4ML6A 4KSOA 4YH2A 1S3DA 2AYTA 2B7JA 3P7XA 5G5FA 3VWVA 2RM6A 3HZ4A 3GL5A 1GH2A 2I4AA 1ZMAA 5AGYA 1Y6EA 4K5RA 3L0HA 5HR1A 1FW1A 2HZEB 2EFDA 1K0OA 4PUAA 2A4VA 2R0CA 1EGOA 2F9SA 2DJJA 1XWCA 4MDCA 3Q6OA 4XRAA 5D96A 4KA0A 4D73A 1USBA 3TJBA 4BA7A 1N2AA 4DSRA 1F3BA 1MD4A 4NAXA 5LCZA 1A2MA 4J56E 6GSSA 2FUG2 2DJ1A 4ECJA 2JZRA 1U6TA 2VCTA 2GGTA 3W6GA 2VLUA 7GSSA 1RK4A 3G9BA 1OKTA 3F4RA 4WKWA 2WRTA 4BPYA 5A5HB 2MMZA 4OD7A 5ECKB 4KW6A 4EDZA 4FYCA 1OE8A 4IQAA 4JE1A 4EF0A 3NIVA 3RDWA 4IJIA 2ZNMA 3M1GA 5BRTA 2WJUA 4K0GA 4LLRA 4K6XA 1N8JA 2E7PA 3EYTA 3APQA 1XWBA 1V40A 1QXHA 4HJ2A 5FT3A 2H0HA 4F0CA 1M2BA 4I97A 2DMMA 1URMA 3EU3A 3FRCA 3F8UA 2H30A 1PX7A 3VLNA 3BJ5A 3HA9A 4D73B 5L71A 1H75A 2NPBA 1VGLA 2O87A 4EKZA 2HZFA 4JR4A 1F37A 5EY6A 2GQLA 2VIMA 2K18A 5D9XA 4GSNA 5DQSA 5FHIA 4K2XA 4G9HA 2ALBA 1VF3A 2IL3A 4GQFA 5GAND 5F8BA 3FR6A 2CAQA 3W8SA 2IMDA 1A8YA 1OYJA 3R2QA 1HQOA 1PSQA 3E3EA 4O5QA 3APOA 2DJ0A 4WR5A 2FWFA 3P2AA 4XS4A 2B5YA 1GUKA 4I2TA 4IW9A 2H1LA 1X9WB 2C3QA 2HSMA 1I9DA 2CAIA 3A2WA 3JCML 3HJOA 1MDJA 1EGRA 5EVOA 2H6YA 2X49A 3KCMA 3MYDA 1O8WA 1ZZYA 1T4ZA 4V1Ag 3FK8A 4ZBBA 3FZ4A 4K7OA 3P90A 4Z2RA 1TI3A 3FZ9A 1GTBA 3IHQA 3FZ5A 4YAVA 1M99A 4H86A 4CDOA 4LA1A 1BX9A 5JWOB 3ZMLA 1VF2A 4GDFA 3F9UA 3EURA 4YKFA 4K1FA 3UEMA 1SK2A 4WETA 1BG5A 5IPHA 5DCGA 3KMOA 1IYHA 4G19A 4XCSA 2N5FA 1TU7A 1BF5A 3HYPA 3F3QA 4XS4B 3KM6A 5C00A 5IPGA 4NWYA 4MCUA 4OO4A 4OO5A 3FHKA 4HEA2 4F0BA 1K3YA 2HSMB 3IE3A 2HSYA 4G0IA 1M7TA 3GSSA 4I5QA 3UARA 4RI7A 2GT5A 1EV9A 3CSHA 1AUCA 4IVFA 4PTSA 3F63A 4EIPA 3HDCA 4MF6A 2ON7A 3EE2A 2C8UA 4BVXA 1NSWA 2F51A 1BYEA 1PX6A 2O89A 4FIWA 3IXRA 1SJ6A 1TJDA 2IFQA 1ERWA 2O8VB 3HMJG 1N25A 4FYBA 4L5LA 3IV4A 2GS3A 1G0TA 3QAWA 1LBKA 3EWLA 1G6YA 2LJAA 4AKXB 5G1LA 4GXZA 4KGIA 5J40A 1JZRA 1SU9A 4IP6A 2Z9SA 3TUEA 5CNWA 3M9KA 2ES7A 2FWGA 3ME7A 4G01A 2H66A 1HNCA 4YAPA 4KB3A 3BBYA 2F3MA 1SKRB 1BQ7A 2OE3A 3LW9A 5CRDA 2L57A 2EFEA 1PKWA 3VURA 4X43A 2QA2A 1NW2A 3HCZA 2VKZG 2IMFA 1QMVA 2HLSA 2R37A 1TDIA 2UZ8A 4ZBAA 1PN0A 2VCQA 2JADA 3IAM2 4BVXB 4P3YB 4ZBDA 4GQCA 2FNOA 4F2IA 2EIRA 1K0CA 5ECHB 2X8CA 3ERWA 3QAVA 3WGDA 1M2AA 1ABAA 2IFQB 2NDOA 3VWUA 2EC4A 5COHA 2GSQA 1ILOA 3CBUA 3GH6A 2DIYA 3O76A 2HRAA 1PD21 1T3BA 4OFMA 3LSZA 3A3TA 2VCVA 2H73A 2HRNA 1GLPA 3GL3A 2MBSA 2H6XA 5J9CA 2FA8A 2XC2A 4GRFA 4N0ZA 3CMIA 1THOA 3MDKA 4XRDA 2M72A 5CRHA 5H5RA 3KMNA 2H76A 1SK1A 3F0IA 1T1VA 4Z2UA 4HZ4A 17GSA 2VL2A 3KJYA 4TR0A 2PU9C 2OACA 4ML1A 4KDXA 3TKSC 1NM3A 2FA4A 1SL2B 5IMDA 3KZQA 2QGVA 2OBKA 5LD0A 1PA3A 2MBTA 2CVKA 3FYGA 4GSTA 1K0NA 1K3OA 2H6ZA 3TKPA 3F3RA 1ON4A 5D73A 2LS5A 3G7JA 3CSJA 2JSYA 4V2MA 2DJ3A 5DCHA 2K8VA 2L5LA 4OWYA 1Q98A 1Z3EA 5F07A 2PGTA 4GTUA 3QMXA 4PQIA 3IR4A 2YN1A 1W89A 3LEFA 2J23A 2HRKA 3E0UA 1A8LA 3HY2A 1T4YA 3DVXA 4DVCA 5J41A 5ELAA 1TU8A 4N3ZA 4AGSA 4LMVA 3C7MA 5KN3A 4PNFA 4KUNA 1O7UA 3MNGA 4N0VA 1J08A 5JCWA 1NHYA 1DSBA 3PR8A 4XIHA 1GSYA 1HNAA 1AW9A 3FY7A 1C72A 4Q5RA 1B4PA 1R5AA 1CQGA 5IMFA 2N5AA 4HU7A 2H72A 3ZYWA 1K0MA 2CZ2A 2LEGA 1R26A 22GSA 2RUEA 3APSA 2YV9A 1PKZA 4HUAA 1T7PB 3QCPA 4AJ7A 3TJKA 3F6FA 5ABRA 5F0GA 2G2QA 3ERFA 1YVLA 4ZXGA 1XXUA 5ECLB 2DJKA 4NPBA 4MJBA 3UVTA 1FB0A 4IBPA 1AAZA 3IPZA 4PQ1A 3I69A 3GX0A 4NV5A 3CRUA 5IO0A 19GSA 2IJYA 3ERGA 2YNXA 5A34A 2FHEA 3LORA 2GLRA 4DEJA 4AKHA 2REMA 3TRQA 1T8EB 1H4OA 3IOSA 3Q18A 3A5IA 3GA4A 5E59A 3RBTA 2LJRA 3HD5A 10GSA 3IK9A 1GRXA 1YEXA 3L9SA 2DKHA 5H5SA 2VCXA 3C1RA 1WRYA 2F8FA 1B9XC 3LYKA 1EWXA 3KH7A 1K0BA 1UA5A 1VF4A 2R5GA 3U6VA 5JCUA 1WIKA 3NZNA 2OE1A 3LXTA 2BTOT 2PERA 5GSTA 4TN8A 1A24A 3Q74A 1TK0B 2DBCA 4Z2TA 4RQRA 3CWGA 1UC7A 2H01A 4EO3A 2LKUA 2CVDA 3UJ1A 4OCEA 4IHUA 2R2JA 2GZZA 1OC9A 4DSSB 4TW5A 4GF0A 3ISOA 2KUCA 5A34B 2H0IA 1RW1A 1LJRA 1MDKA 2K8SA 4ACSA 1WWJA 1IYIA 2OADA 2WFCA 3KTLA 2TIRA 5HR3A 3VK9A 5DAKA 1QGVA 3GRXA 1Z5YE 2AJQB 1SL0B 3FW2A 1Z9HA 4KF9A 2LQQA 1GWCA 4MH3A 5KN2A 3W8JA 2YANA 2VM1A 1DE1A 2HT9A 2L4CA 2IWTA 2PPTA 4NMUA 4MNNA 2H1AA 3EU4A 3WT1A 3FZAA 6GSXA 20GSA 1MD3A 3O3TA 4KCEA 5HR0A 1YQ1A 1GP1A 1R7HA 2B1KA 5DALA 1TKDB 1S3CA 3DIEA 3ZRDA 2DC5A 3L9UA 2R0GA 2XBQA 3C73A 3N5OA 4V2LA 3LQ7A 3M0FA 4RUVA 5D9TA 4JEDA 2HNLA 3IK7A 2CZ3A 3ME8A 1GSEA 2GVPA 1X9SB 4FYUA 2EIQA 2CA8A 3UMAA 1OC9B 1TXUA 4TVEA 3LG6A 4ULXA 4FQUA 5IQYA 4JZQA 1MEKA 4MZCA 12GSA 5E4WA 3D0ZA 2C4JA 2DLXA 1K0AA 1T00A 5DAKB 1YZXA 2H71A 8GSSA 3VWWA 3G7IA 2X8HA 3FEUA 1F3AA 3HHVA 3QAGA 3EVIA 2VLVA 5ECQB 1MDIA 3ZREA 1PGTA 2H75A 3DEXA 1EP8A 1EOGA 2YWIA 2WCIA 4GCIA 4G10A 5DALB 4JU5A 4BWQA 1XZOA 3TB2A 4MF5A 2K9FA 4Z7XA 2IMKA 4K7IA 1EEJA 2AUVA 1QUWA 3SWLA 2OKAA 4TXVA 1RQMA 2V1MA 3GIXA 3GV1A 2G0FA 1WPIA 3GX8A 1M9BA 4ISDA 2PVQA 2DIZA 1U88A 3KH9A 2JU5A 3O6TA 4XS6A 2A2RA 3VPTA 5CYYA 4EIQA 5KEJA 4YQMA 1SD8A 5CO3A 4X0XA 4TR1A 2GSRA 4HI7A 1OC8A 3TDGA 2WGRA 2DMLA 4K7NA 4HJMA 2PVOC 1B4QA 2VUPA 3AY8A 5F06A 3D5JA 1AIUA 1SENA 1XW9A 3MSZA 2LV3A 4W66A 6GSWA 5J4UA 1GTAA 5CAXA 1O81A 3J7Yb 1AQXA 2A2SA 1PQNA 2I9HA 3RPPA 3QOUA 3H4KA 4K5SA 4IQ1A 1TRWA 5AIVA 5GSSA 5ECOB 4OMVA 2DJ2A 4POBA 1GNWA 1SVOA 2BMXA 2EFCA 2B3SA 2LTKA 3WGXA 2GTUA 4POLA 2FLSA 4PNGA 3IBHA 4G0KA 5IIZA 4NXIA 2H1DA 1GNEA 2O85A 2XBIA 3J7Yk 1GSQA 1AXDA 3TJJA 2OT3A 3H1NA 2NBSA 3M9JA 2HXKA 4N30A 4O5RA 3DKSA 5DDLA 5J3RA 3DYRA 4HOJA 3ZTLA 5A4VA 1JLVA 1A0RP 1FVKA 4LMWA 4TR1B 4J2FA 3KTBA 4CW9A 1MTCA 3TOUA 3ZL5A 2J9HA 4EE0A 4TRXA 3WD6A 5D9WA 3M8NA 4EXJA 5C04A 3CXGA 2E2GA 2EFHA 4ECIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RLI A;  2VOC A;  4EVM A;  3L9V A;  2B1L A;  3IRA A;  1WJK A;  2VL9 A;  5A4W A;  4OFT A;  3KIJ A;  1OE7 A;  1XW6 A;  1JLW A;  5BMU A;  2YZU A;  1DE2 A;  1X9M B;  4TOP A;  2JAC A;  4USS A;  5FWG A;  3A5W A;  3EC3 A;  5HFK A;  4KDY A;  1AC1 A;  4K0N A;  2L4Q A;  2H0G A;  4QQ7 A;  1WMJ A;  4IKH A;  3P8W A;  1GSD A;  4WEY A;  2H19 A;  2RII A;  4YQU A;  1WP0 A;  2LRN A;  4AF2 A;  3A2X A;  2CV4 A;  1EZK A;  1SYR A;  3EMX A;  2XPE A;  2FCH A;  4XTS A;  2B6M A;  3GTU A;  1PRX A;  1TK5 B;  3UIW A;  4MP4 A;  3GYK A;  2OBI A;  2M80 A;  4KDU A;  2X99 A;  3UBL A;  4WXT A;  5J5N A;  3D22 A;  4MLY A;  1UVZ A;  1ZOF A;  3E9J B;  4MAB A;  2V32 A;  4KX4 A;  2PWJ A;  2YWN A;  5IMA A;  3IC8 A;  3L78 A;  1O8X A;  3LXZ A;  4KH7 A;  1Y25 A;  1GTU A;  2KP2 A;  2F8A A;  3HJM A;  11GS A;  3G7Y A;  3PH9 A;  3TKR A;  4TR3 A;  2AB6 A;  2DSA A;  4AJ8 A;  1M2D A;  4QL7 A;  5DJL A;  2IMI A;  2VAF A;  1XWG A;  1ERT A;  1HYU A;  1DUG A;  3BD2 A;  1XOB A;  1XWA A;  3D4T A;  3F4T A;  5J9B A;  1OAZ A;  2C0G A;  1TRS A;  5EL8 A;  3QFB C;  3GTU B;  2VCW A;  2HFD A;  1EV4 A;  3PPU A;  5CP1 A;  1KNG A;  6GSU A;  1W4V A;  4DSQ A;  3UL3 A;  3SBC A;  5A4U A;  1SL1 B;  1E6B A;  4IGJ A;  9GSS A;  1XFL A;  3F6D A;  2FWE A;  2MMO A;  1TRV A;  3GFK A;  2QC7 A;  5B8B A;  5B7C A;  3QR6 A;  1OC3 A;  4G0L A;  1XW5 A;  4G2E A;  2E0Q A;  2MYG A;  2C0F A;  5DVB A;  4ZIJ A;  3M3M A;  2CVB A;  4J57 E;  3RPN A;  3I9V 2;  3A2V A;  4LL1 B;  4ZL9 A;  1QFN A;  1M9A A;  4MMM A;  3HXS A;  6GSY A;  4KAE A;  3TJG A;  6GSV A;  1NHO A;  2GZP A;  2FY6 A;  3QD9 A;  4DSS A;  3FR9 A;  3HVS A;  4ILF A;  4V1A p;  5DBQ A;  5B6M A;  4K8M A;  5F05 A;  4JBB A;  3WGE A;  4TXO A;  1CQH A;  5G5E A;  1Z6N A;  3ZVJ D;  1SK0 A;  1YEP A;  4PUR A;  2R6K A;  2KOK A;  2MMN A;  3TKS A;  4PXO A;  2X64 A;  3IC4 A;  2LNS A;  2IN3 A;  4FH8 A;  3US3 A;  4ZB9 A;  3TKS E;  1TK8 B;  2C3N A;  1FO5 A;  1GTI A;  4F03 A;  4I8B A;  3BCK A;  4E8H A;  4HQZ A;  1TW9 A;  2KP1 A;  2X8G A;  4MF7 A;  1BJX A;  4POK A;  2YJH A;  4PUF C;  3GN3 A;  1HNB A;  1YDK A;  2OA7 A;  2NTO A;  2R4V A;  3IAS 2;  2AV4 A;  2P5R A;  3TRX A;  18GS A;  4EDY A;  4EC0 A;  1XPV A;  1AQW A;  4MA9 A;  2V6K A;  2VD0 A;  2C0E A;  2LJK A;  4WR4 A;  1Q4J A;  1XBS A;  2QSI A;  3HKR A;  2YWO A;  1J9B A;  2K6V A;  3DXB A;  1VRS D;  4TXO B;  1A2L A;  1TTZ A;  2HSH A;  1G6W A;  2WZ9 A;  1QQ2 A;  5ECP B;  1SJI A;  4N11 A;  4GSS A;  1ST9 A;  2NVL A;  2YP6 A;  5KN0 A;  1JHB A;  2VO4 A;  4CHS A;  2HSN B;  2KLX A;  1BAY A;  3DWV A;  1R4W A;  3GKN A;  3TGZ A;  2TRC P;  3TKQ A;  1K3L A;  3IDV A;  1G7O A;  2C1Y A;  2H70 A;  3ZZX A;  5HFG A;  1KBN A;  5GZZ B;  1PN9 A;  3CRT A;  5ECM B;  2P0G A;  4ZIL A;  2WUL A;  1F2E A;  4MH2 A;  2P31 A;  1VF1 A;  2HRF A;  5H5Q A;  1ZYQ B;  1FOV A;  1EP7 A;  1M0U A;  1FAA A;  1O85 A;  4MZW A;  4MPG A;  2EIO A;  5G2Z A;  2HYX A;  2I3Y A;  3KGK A;  4KSM A;  2I81 A;  3V1W A;  2HE3 A;  3GKK A;  2JL4 A;  1SD9 A;  13GS A;  3LJR A;  2IPA A;  2V2G A;  4MK3 A;  4ZB6 A;  4XS1 A;  3S9F A;  4N10 A;  4I6X A;  1GSS A;  1ZCP A;  1GL8 A;  4BWS A;  4Q5Q A;  2L59 A;  2YZH A;  3L4N A;  2H1G A;  4IEL A;  1OKD A;  2O7K A;  3HVX A;  1YJ6 A;  1YKC A;  2H8L A;  3GKX A;  3C71 A;  2FGX A;  2VCZ A;  3ED3 A;  2P5Q A;  3C1S A;  5IOX A;  2CQ9 A;  2VLT A;  4L0U A;  5A5K A;  1ACV A;  4IP1 A;  2ZCT A;  1TXX A;  2D2Z A;  4OFN A;  5B6N A;  3PIN A;  4MPF A;  4PGT A;  4NHZ A;  1SKW B;  3Q19 A;  5GAP D;  5ID2 A;  5G31 A;  2YCD A;  1ZGN A;  1JZW A;  3DGQ A;  1Z7R A;  2WDU A;  4TR4 A;  5ECR B;  1F9M A;  2LST A;  4EL1 A;  3QFA C;  3TCO A;  1JFU A;  2JSZ A;  2JZT A;  1TP9 A;  1X5E A;  4ECC A;  4KND A;  3HVV A;  1XIY A;  1U3I A;  5G30 A;  5IMZ A;  3N9J A;  4HU9 A;  2YJ7 A;  1U3A A;  5ECI B;  4BL7 A;  1TRU A;  5IO2 A;  3PGT A;  3TOT A;  1V9W A;  3D4M A;  4FO5 A;  2LRT A;  1SYX A;  2ON5 A;  4PX1 A;  2LRC A;  3GHA A;  3ZMK A;  1ZYE A;  4IS0 A;  3D6I A;  4X1U A;  3VI5 A;  1WE0 A;  1Z7P A;  2GT6 A;  1DBY A;  2VL3 A;  2PN8 A;  1YY7 A;  5EPF A;  3U5R E;  5B8A A;  3HZ8 A;  4IJ3 A;  1O73 A;  2XHF A;  5IOW A;  3RAZ A;  5ID2 B;  2AAW A;  2L6C A;  2MMA A;  4E8E A;  3BCI A;  4ZL8 A;  1B9Y C;  3D21 A;  3ZIT A;  5D8I A;  5JWQ B;  1V98 A;  3HJP A;  2VL2 C;  3CTG A;  2GDR A;  4EUY A;  1J0F A;  4K9Z A;  2PUK C;  4O7H A;  3NOF A;  5HQP A;  4NV2 A;  5DQY A;  5HR2 A;  3KXO A;  2H74 A;  4HZ2 A;  3LGC A;  2YV7 A;  2CX4 A;  1PMT A;  1GSU A;  5ECN B;  1A23 A;  1B48 A;  2RUF A;  1G7E A;  1E2Y A;  2B7K A;  1FB6 A;  4BL7 B;  4K2D A;  2LQO A;  1KTE A;  5CRE A;  1JZD A;  1LU4 A;  3EIN A;  2OE0 A;  1AQV A;  4MJC A;  3FKF A;  4GLT A;  2HI7 A;  3R3E A;  4RQX A;  4F9Z A;  3WT2 A;  4NHW A;  1V58 A;  5G1K A;  3QDN A;  3DML A;  5D9V A;  1TI1 A;  2RM5 A;  1TOF A;  1V57 A;  4Q5N A;  3ZFL A;  4MJE A;  2B5X A;  1GUL A;  4WF5 A;  4QL9 A;  1XWK A;  2WS2 A;  1ERU A;  2OJL A;  4ZB8 A;  3DVW A;  3VPQ A;  2PMT A;  3VWX A;  2KHP A;  1GUH A;  6GST A;  2FWH A;  4HDE A;  3GNJ A;  2C0D A;  4F82 A;  4HS1 A;  3KD0 A;  2TRX A;  2CT6 A;  3MAK A;  4IN0 A;  2ZUP A;  1V2A A;  1PL2 A;  3UVH A;  1XCC A;  2IME A;  2YWM A;  5INY A;  2GST A;  3VFI A;  3LYP A;  3QPM A;  5AIS A;  2PBJ A;  2L5O A;  3LFL A;  1YKA A;  3H93 A;  3DD3 A;  2N5B A;  2B5E A;  3CYN A;  3GH9 A;  4OCF A;  3UOM A;  1XOA A;  1PL1 A;  5ELG A;  4JRR A;  1EOH A;  1O6J A;  2MZC A;  4I2U A;  4WBR D;  4JR6 A;  2IIY A;  2C80 A;  2C3T A;  2LNT A;  1SKS B;  3GUR A;  5JCG A;  3GUS A;  4TKY A;  1ERV A;  1THX A;  5DJM A;  3H8Q A;  4BVY A;  1ML6 A;  1FVJ A;  1K0D A;  4KE3 A;  5KN1 A;  14GS A;  1GUM A;  2GZY A;  4LL4 B;  3I6A A;  3KEB A;  3BOA A;  2H1B A;  2HQT A;  1KEB A;  2L6D A;  3C8E A;  3OR5 A;  4MZB A;  1XVW A;  1SJZ A;  4GWR A;  4RI6 A;  1I5G A;  1WOU A;  3DRN A;  1FG4 A;  3IA1 A;  3ZIV A;  2GQK A;  1OVN A;  1GSF A;  3GMF A;  3WYW A;  3EMP A;  4AJ6 A;  3MWH A;  4KCA A;  3TRP A;  2FD3 A;  1BED A;  3VI7 A;  1Z6M A;  3FR3 A;  1R5P A;  2VD1 A;  1U87 A;  1EEM A;  4XHM A;  5JWR B;  4YQV A;  1X5D A;  5CRG A;  2BJX A;  2YPM A;  4L5O A;  5HFI A;  2WB9 A;  3K8N A;  5ENU A;  1GLQ A;  4ECB A;  2V6O A;  2YOI A;  3CSI A;  3KP9 A;  3UAP A;  5LNK e;  3ZFB A;  4O32 A;  5ECS A;  1YF0 A;  2I1U A;  5D93 A;  16GS A;  1FHE A;  3RHB A;  1ZL9 A;  2JZS A;  2E2M A;  1UN2 A;  4BVY B;  4L8E A;  5IM9 A;  3GKM A;  1YF1 A;  2QKE A;  2HZE A;  1X0R A;  2VM2 A;  3ZIJ A;  1XVQ A;  5IMC A;  1X5C A;  4Q5F A;  3TJF A;  3I43 A;  5IMV A;  2AHE A;  2XPD A;  2R3X A;  4ZL7 A;  5CRW A;  5AIX A;  1A2J A;  2GQM A;  3ZLP A;  2GSS A;  1HD2 A;  4HQS A;  4O92 A;  2M46 A;  2CX3 A;  2LUS A;  4L0W A;  3F4S A;  3LWA A;  1A0F A;  1F6M C;  4WF4 A;  3ZVJ A;  3H79 A;  4POM A;  4MJA A;  1JZO A;  2HRK B;  4ID0 A;  3RHC A;  1S3A A;  4V2N A;  5AN1 A;  3KP8 A;  3GST A;  3CTF A;  1QK8 A;  4PQH A;  1B8X A;  2V41 A;  3UBK A;  4ML6 A;  4KSO A;  4YH2 A;  1S3D A;  2AYT A;  2B7J A;  3P7X A;  5G5F A;  3VWV A;  2RM6 A;  3HZ4 A;  3GL5 A;  1GH2 A;  2I4A A;  1ZMA A;  5AGY A;  1Y6E A;  3L0H A;  5HR1 A;  1FW1 A;  2HZE B;  1K0O A;  4PUA A;  2A4V A;  1EGO A;  2F9S A;  2DJJ A;  1XWC A;  4MDC A;  3Q6O A;  4XRA A;  5D96 A;  4KA0 A;  4D73 A;  1USB A;  3TJB A;  4BA7 A;  1N2A A;  4DSR A;  1F3B A;  1MD4 A;  4NAX A;  5LCZ A;  1A2M A;  4J56 E;  6GSS A;  2FUG 2;  2DJ1 A;  4ECJ A;  2JZR A;  1U6T A;  2VCT A;  2GGT A;  3W6G A;  2VLU A;  7GSS A;  1RK4 A;  3G9B A;  1OKT A;  3F4R A;  4WKW A;  2WRT A;  4BPY A;  2MMZ A;  4OD7 A;  5ECK B;  4KW6 A;  4EDZ A;  4FYC A;  1OE8 A;  4IQA A;  4JE1 A;  4EF0 A;  3NIV A;  3RDW A;  4IJI A;  2ZNM A;  3M1G A;  2WJU A;  4K0G A;  4LLR A;  4K6X A;  1N8J A;  2E7P A;  3EYT A;  3APQ A;  1XWB A;  1V40 A;  1QXH A;  4HJ2 A;  5FT3 A;  2H0H A;  4F0C A;  1M2B A;  4I97 A;  2DMM A;  1URM A;  3EU3 A;  3FRC A;  3F8U A;  2H30 A;  1PX7 A;  3VLN A;  3BJ5 A;  3HA9 A;  4D73 B;  5L71 A;  1H75 A;  2NPB A;  1VGL A;  2O87 A;  4EKZ A;  2HZF A;  4JR4 A;  1F37 A;  5EY6 A;  2GQL A;  2VIM A;  2K18 A;  5D9X A;  4GSN A;  5DQS A;  5FHI A;  4G9H A;  2ALB A;  1VF3 A;  2IL3 A;  4GQF A;  5GAN D;  5F8B A;  3FR6 A;  2CAQ A;  3W8S A;  2IMD A;  1A8Y A;  1OYJ A;  3R2Q A;  1HQO A;  1PSQ A;  3E3E A;  3APO A;  2DJ0 A;  4WR5 A;  2FWF A;  3P2A A;  4XS4 A;  2B5Y A;  1GUK A;  4I2T A;  4IW9 A;  1X9W B;  2C3Q A;  2HSM A;  1I9D A;  2CAI A;  3A2W A;  3JCM L;  3HJO A;  1MDJ A;  1EGR A;  5EVO A;  2H6Y A;  3KCM A;  1O8W A;  1ZZY A;  1T4Z A;  4V1A g;  3FK8 A;  4ZBB A;  3FZ4 A;  4K7O A;  3P90 A;  1TI3 A;  3FZ9 A;  1GTB A;  3IHQ A;  3FZ5 A;  4YAV A;  1M99 A;  4H86 A;  4CDO A;  4LA1 A;  1BX9 A;  5JWO B;  3ZML A;  1VF2 A;  3F9U A;  3EUR A;  4K1F A;  3UEM A;  1SK2 A;  4WET A;  1BG5 A;  5IPH A;  5DCG A;  3KMO A;  1IYH A;  4G19 A;  4XCS A;  2N5F A;  1TU7 A;  3HYP A;  3F3Q A;  4XS4 B;  3KM6 A;  5C00 A;  5IPG A;  4NWY A;  4MCU A;  4OO4 A;  4OO5 A;  3FHK A;  4HEA 2;  4F0B A;  1K3Y A;  2HSM B;  3IE3 A;  2HSY A;  4G0I A;  1M7T A;  3GSS A;  4I5Q A;  3UAR A;  4RI7 A;  2GT5 A;  1EV9 A;  3CSH A;  1AUC A;  4IVF A;  4PTS A;  3F63 A;  3HDC A;  4MF6 A;  2ON7 A;  3EE2 A;  2C8U A;  4BVX A;  1NSW A;  2F51 A;  1BYE A;  1PX6 A;  2O89 A;  4FIW A;  3IXR A;  1SJ6 A;  1TJD A;  2IFQ A;  1ERW A;  2O8V B;  4FYB A;  4L5L A;  3IV4 A;  2GS3 A;  1G0T A;  3QAW A;  1LBK A;  3EWL A;  1G6Y A;  2LJA A;  5G1L A;  4GXZ A;  4KGI A;  1JZR A;  1SU9 A;  4IP6 A;  2Z9S A;  3TUE A;  5CNW A;  3M9K A;  2ES7 A;  2FWG A;  3ME7 A;  2H66 A;  1HNC A;  4YAP A;  4KB3 A;  3BBY A;  2F3M A;  1SKR B;  1BQ7 A;  2OE3 A;  5CRD A;  2L57 A;  1PKW A;  3VUR A;  4X43 A;  1NW2 A;  3HCZ A;  2IMF A;  1QMV A;  2HLS A;  2R37 A;  1TDI A;  2UZ8 A;  4ZBA A;  2VCQ A;  2JAD A;  3IAM 2;  4BVX B;  4P3Y B;  4ZBD A;  4GQC A;  2FNO A;  4F2I A;  2EIR A;  1K0C A;  5ECH B;  2X8C A;  3ERW A;  3QAV A;  3WGD A;  1M2A A;  1ABA A;  2IFQ B;  2NDO A;  3VWU A;  2EC4 A;  5COH A;  2GSQ A;  1ILO A;  3CBU A;  3GH6 A;  2DIY A;  3O76 A;  2HRA A;  1PD2 1;  1T3B A;  4OFM A;  3LSZ A;  3A3T A;  2VCV A;  2H73 A;  2HRN A;  1GLP A;  3GL3 A;  2MBS A;  2H6X A;  5J9C A;  2FA8 A;  2XC2 A;  4GRF A;  4N0Z A;  3CMI A;  1THO A;  3MDK A;  4XRD A;  2M72 A;  5CRH A;  5H5R A;  3KMN A;  2H76 A;  1SK1 A;  3F0I A;  1T1V A;  4HZ4 A;  17GS A;  2VL2 A;  3KJY A;  4TR0 A;  2PU9 C;  2OAC A;  4ML1 A;  4KDX A;  3TKS C;  1NM3 A;  2FA4 A;  1SL2 B;  5IMD A;  3KZQ A;  2QGV A;  2OBK A;  5LD0 A;  1PA3 A;  2MBT A;  2CVK A;  3FYG A;  4GST A;  1K0N A;  1K3O A;  2H6Z A;  3TKP A;  3F3R A;  1ON4 A;  5D73 A;  2LS5 A;  3G7J A;  3CSJ A;  2JSY A;  4V2M A;  2DJ3 A;  5DCH A;  2K8V A;  2L5L A;  4OWY A;  1Q98 A;  1Z3E A;  5F07 A;  2PGT A;  4GTU A;  3QMX A;  4PQI A;  3IR4 A;  2YN1 A;  1W89 A;  3LEF A;  2J23 A;  2HRK A;  3E0U A;  1A8L A;  3HY2 A;  1T4Y A;  3DVX A;  4DVC A;  5J41 A;  5ELA A;  1TU8 A;  4AGS A;  4LMV A;  3C7M A;  5KN3 A;  4PNF A;  4KUN A;  1O7U A;  3MNG A;  4N0V A;  1J08 A;  5JCW A;  1NHY A;  1DSB A;  3PR8 A;  4XIH A;  1GSY A;  1HNA A;  1AW9 A;  3FY7 A;  1C72 A;  4Q5R A;  1B4P A;  1R5A A;  1CQG A;  5IMF A;  2N5A A;  4HU7 A;  2H72 A;  3ZYW A;  1K0M A;  2CZ2 A;  2LEG A;  1R26 A;  22GS A;  2RUE A;  3APS A;  2YV9 A;  1PKZ A;  4HUA A;  1T7P B;  3QCP A;  4AJ7 A;  3TJK A;  3F6F A;  5ABR A;  5F0G A;  2G2Q A;  3ERF A;  4ZXG A;  1XXU A;  5ECL B;  2DJK A;  4NPB A;  4MJB A;  3UVT A;  1FB0 A;  4IBP A;  1AAZ A;  3IPZ A;  4PQ1 A;  3I69 A;  3GX0 A;  4NV5 A;  3CRU A;  5IO0 A;  19GS A;  2IJY A;  3ERG A;  2YNX A;  2FHE A;  3LOR A;  2GLR A;  4DEJ A;  2REM A;  3TRQ A;  1T8E B;  1H4O A;  3IOS A;  3Q18 A;  3GA4 A;  5E59 A;  3RBT A;  2LJR A;  3HD5 A;  10GS A;  3IK9 A;  1GRX A;  1YEX A;  3L9S A;  5H5S A;  2VCX A;  3C1R A;  1WRY A;  2F8F A;  1B9X C;  3LYK A;  1EWX A;  3KH7 A;  1K0B A;  1UA5 A;  1VF4 A;  2R5G A;  3U6V A;  5JCU A;  1WIK A;  3NZN A;  2OE1 A;  3LXT A;  2BTO T;  2PER A;  5GST A;  4TN8 A;  1A24 A;  3Q74 A;  1TK0 B;  2DBC A;  4RQR A;  1UC7 A;  2H01 A;  4EO3 A;  2LKU A;  2CVD A;  3UJ1 A;  4OCE A;  4IHU A;  2R2J A;  2GZZ A;  1OC9 A;  4DSS B;  4TW5 A;  4GF0 A;  3ISO A;  2KUC A;  2H0I A;  1RW1 A;  1LJR A;  1MDK A;  2K8S A;  4ACS A;  1WWJ A;  1IYI A;  2OAD A;  2WFC A;  3KTL A;  2TIR A;  5HR3 A;  3VK9 A;  5DAK A;  1QGV A;  3GRX A;  1Z5Y E;  2AJQ B;  1SL0 B;  3FW2 A;  1Z9H A;  4KF9 A;  2LQQ A;  1GWC A;  4MH3 A;  5KN2 A;  3W8J A;  2YAN A;  2VM1 A;  1DE1 A;  2HT9 A;  2L4C A;  2IWT A;  2PPT A;  4NMU A;  2H1A A;  3EU4 A;  3WT1 A;  3FZA A;  6GSX A;  20GS A;  1MD3 A;  3O3T A;  4KCE A;  5HR0 A;  1YQ1 A;  1GP1 A;  1R7H A;  2B1K A;  5DAL A;  1TKD B;  1S3C A;  3DIE A;  3ZRD A;  2DC5 A;  3L9U A;  2XBQ A;  3C73 A;  3N5O A;  4V2L A;  3LQ7 A;  3M0F A;  4RUV A;  5D9T A;  4JED A;  2HNL A;  3IK7 A;  2CZ3 A;  3ME8 A;  1GSE A;  2GVP A;  1X9S B;  4FYU A;  2EIQ A;  2CA8 A;  3UMA A;  1OC9 B;  4TVE A;  3LG6 A;  4ULX A;  4FQU A;  5IQY A;  4JZQ A;  1MEK A;  4MZC A;  12GS A;  5E4W A;  3D0Z A;  2C4J A;  2DLX A;  1K0A A;  1T00 A;  5DAK B;  1YZX A;  2H71 A;  8GSS A;  3VWW A;  3G7I A;  2X8H A;  3FEU A;  1F3A A;  3HHV A;  3QAG A;  3EVI A;  2VLV A;  5ECQ B;  1MDI A;  3ZRE A;  1PGT A;  2H75 A;  3DEX A;  1EP8 A;  1EOG A;  2YWI A;  2WCI A;  4GCI A;  4G10 A;  5DAL B;  4JU5 A;  4BWQ A;  1XZO A;  3TB2 A;  4MF5 A;  2K9F A;  4Z7X A;  4K7I A;  2IMK A;  1EEJ A;  2AUV A;  1QUW A;  3SWL A;  2OKA A;  4TXV A;  1RQM A;  2V1M A;  3GIX A;  3GV1 A;  2G0F A;  1WPI A;  3GX8 A;  1M9B A;  4ISD A;  2PVQ A;  2DIZ A;  1U88 A;  3KH9 A;  2JU5 A;  3O6T A;  4XS6 A;  2A2R A;  3VPT A;  5CYY A;  5KEJ A;  4YQM A;  1SD8 A;  5CO3 A;  4X0X A;  4TR1 A;  2GSR A;  4HI7 A;  1OC8 A;  3TDG A;  2WGR A;  2DML A;  4K7N A;  4HJM A;  2PVO C;  1B4Q A;  2VUP A;  3AY8 A;  5F06 A;  3D5J A;  1AIU A;  1SEN A;  1XW9 A;  3MSZ A;  2LV3 A;  6GSW A;  5J4U A;  1GTA A;  5CAX A;  1O81 A;  3J7Y b;  1AQX A;  2A2S A;  1PQN A;  2I9H A;  3RPP A;  3QOU A;  3H4K A;  4IQ1 A;  1TRW A;  5AIV A;  5GSS A;  5ECO B;  4OMV A;  2DJ2 A;  4POB A;  1GNW A;  2BMX A;  2B3S A;  2LTK A;  3WGX A;  2GTU A;  4POL A;  2FLS A;  4PNG A;  3IBH A;  4G0K A;  5IIZ A;  4NXI A;  2H1D A;  1GNE A;  2O85 A;  2XBI A;  3J7Y k;  1GSQ A;  1AXD A;  3TJJ A;  3H1N A;  2NBS A;  3M9J A;  2HXK A;  4N30 A;  4O5R A;  3DKS A;  5DDL A;  5J3R A;  3DYR A;  4HOJ A;  3ZTL A;  5A4V A;  1JLV A;  1A0R P;  1FVK A;  4LMW A;  4TR1 B;  4J2F A;  3KTB A;  4CW9 A;  1MTC A;  3TOU A;  3ZL5 A;  2J9H A;  4EE0 A;  4TRX A;  3WD6 A;  5D9W A;  3M8N A;  4EXJ A;  5C04 A;  3CXG A;  2E2G A;  4WBJ A;  4ECI A; 
#chains in the Genus database with same CATH topology
 2RLI A;  2VOC A;  4EVM A;  3L9V A;  2B1L A;  3IRA A;  1WJK A;  2VL9 A;  5J4V A;  5A4W A;  4OFT A;  3KIJ A;  1OE7 A;  1XW6 A;  1JLW A;  5BMU A;  2YZU A;  1DE2 A;  1X9M B;  4TOP A;  2JAC A;  4USS A;  5FWG A;  3A5W A;  3EC3 A;  5HFK A;  4KDY A;  1AC1 A;  4K0N A;  2L4Q A;  2H0G A;  4QQ7 A;  1WMJ A;  4E68 A;  4IKH A;  3RFR C;  3EPT A;  3P8W A;  1GSD A;  4X4J A;  4WEY A;  2H19 A;  2RII A;  4YQU A;  1WP0 A;  2LRN A;  4AF2 A;  3A2X A;  2CV4 A;  1EZK A;  1SYR A;  3EMX A;  2XPE A;  2FCH A;  4XTS A;  2B6M A;  3GTU A;  1PRX A;  1TK5 B;  3UIW A;  4MP4 A;  3GYK A;  2OBI A;  2M80 A;  4KDU A;  2X99 A;  3UBL A;  4WXT A;  5J5N A;  3D22 A;  4MLY A;  1UVZ A;  1ZOF A;  3E9J B;  4MAB A;  2V32 A;  4KX4 A;  2PWJ A;  2YWN A;  5IMA A;  3IC8 A;  3L78 A;  1O8X A;  3LXZ A;  4KH7 A;  1Y25 A;  1GTU A;  2KP2 A;  5BMU B;  2F8A A;  3HJM A;  11GS A;  3G7Y A;  3PH9 A;  4AKI A;  3TKR A;  4TR3 A;  2AB6 A;  2DSA A;  4AJ8 A;  1M2D A;  4QL7 A;  5DJL A;  2IMI A;  2VAF A;  1BG1 A;  1XWG A;  1ERT A;  1HYU A;  1DUG A;  3BD2 A;  5A1N B;  1XOB A;  1XWA A;  3D4T A;  3F4T A;  5J9B A;  1OAZ A;  1SVL A;  2C0G A;  1TRS A;  5EL8 A;  3QFB C;  3GTU B;  2VCW A;  2HFD A;  1EV4 A;  3PPU A;  5CP1 A;  4CY8 A;  1KNG A;  6GSU A;  1W4V A;  4DSQ A;  3UL3 A;  2WW1 A;  2O3E A;  3SBC A;  5A4U A;  1SL1 B;  1E6B A;  4IGJ A;  9GSS A;  1XFL A;  3F6D A;  2FWE A;  2MMO A;  1TRV A;  3GFK A;  2QC7 A;  5B8B A;  5B7C A;  3QR6 A;  1OC3 A;  4G0L A;  1XW5 A;  4G2E A;  2E0Q A;  2MYG A;  2C0F A;  5DVB A;  4ZIJ A;  3M3M A;  2CVB A;  4J57 E;  3RPN A;  3I9V 2;  3A2V A;  4LL1 B;  4ZL9 A;  1QFN A;  1M9A A;  4MMM A;  3HXS A;  6GSY A;  4KAE A;  3MIX A;  6GSV A;  1NHO A;  3TJG A;  2GZP A;  2FY6 A;  3QD9 A;  4DSS A;  3FR9 A;  3HVS A;  4ILF A;  4V1A p;  5DBQ A;  5B6M A;  4K8M A;  5F05 A;  4JBB A;  3WGE A;  4TXO A;  1CQH A;  5G5E A;  1Z6N A;  3ZVJ D;  1SK0 A;  1YEP A;  4PUR A;  2R6K A;  2KOK A;  2MMN A;  3TKS A;  4PXO A;  2X64 A;  2HSN A;  3IC4 A;  2LNS A;  3HVN A;  2IN3 A;  4FH8 A;  3US3 A;  4ZB9 A;  3TKS E;  1TK8 B;  2C3N A;  1FO5 A;  1GTI A;  4F03 A;  4I8B A;  3BCK A;  4E8H A;  4HQZ A;  1TW9 A;  2KP1 A;  1ZYN A;  2X8G A;  4MF7 A;  1BJX A;  4POK A;  2YJH A;  4PUF C;  5J47 A;  3GN3 A;  1HNB A;  1YDK A;  2OA7 A;  2NTO A;  2R4V A;  3IAS 2;  2AV4 A;  2P5R A;  3TRX A;  18GS A;  4EDY A;  4EC0 A;  1XPV A;  1AQW A;  3IHG A;  4MA9 A;  2V6K A;  2VD0 A;  2C0E A;  2WVY A;  2LJK A;  4WR4 A;  1Q4J A;  1XBS A;  2QSI A;  3HKR A;  2YWO A;  1J9B A;  2K6V A;  3DXB A;  4CY6 A;  1VRS D;  4TXO B;  1FOH A;  1A2L A;  1TTZ A;  2HSH A;  1G6W A;  2WZ9 A;  1QQ2 A;  5ECP B;  1SJI A;  4N11 A;  4GSS A;  1ST9 A;  2NVL A;  2YP6 A;  5KN0 A;  1JHB A;  2VO4 A;  4CHS A;  2HSN B;  2KLX A;  1BAY A;  3DWV A;  1R4W A;  3GKN A;  5KOW A;  3TGZ A;  2TRC P;  3TKQ A;  1K3L A;  3IDV A;  1G7O A;  2C1Y A;  2H70 A;  3ZZX A;  5HFG A;  1KBN A;  5GZZ B;  1PN9 A;  3CRT A;  5ECM B;  2P0G A;  4ZIL A;  1YEW C;  2WUL A;  1F2E A;  4MH2 A;  4A5P A;  2P31 A;  1VF1 A;  2HRF A;  5H5Q A;  1ZYQ B;  1FOV A;  1EP7 A;  1M0U A;  1FAA A;  1O85 A;  4MZW A;  1Y1U A;  4MPG A;  2EIO A;  5G2Z A;  2HYX A;  2I3Y A;  3KGK A;  4KSM A;  2I81 A;  3V1W A;  2HE3 A;  3GKK A;  2JL4 A;  1SD9 A;  13GS A;  3LJR A;  2IPA A;  4YKG A;  2V2G A;  4MK3 A;  4ZB6 A;  4XS1 A;  3S9F A;  4N10 A;  4I6X A;  1GSS A;  1ZCP A;  1GL8 A;  4BWS A;  4Q5Q A;  2L59 A;  2YZH A;  3L4N A;  2H1G A;  4IEL A;  1OKD A;  2O7K A;  3HVX A;  1YJ6 A;  1YKC A;  2H8L A;  3GKX A;  3C71 A;  2FGX A;  2VCZ A;  3ED3 A;  2P5Q A;  3C1S A;  5IOX A;  2CQ9 A;  2DKI A;  2VLT A;  4L0U A;  5A5K A;  1ACV A;  4IP1 A;  2ZCT A;  1TXX A;  2D2Z A;  4OFN A;  5B6N A;  3PIN A;  4MPF A;  4PGT A;  4NHZ A;  1SKW B;  3Q19 A;  5GAP D;  5ID2 A;  5G31 A;  2YCD A;  5J4Y A;  1ZGN A;  1JZW A;  3DGQ A;  1Z7R A;  2WDU A;  4TR4 A;  5ECR B;  1F9M A;  2LST A;  4EL1 A;  3QFA C;  3TCO A;  1JFU A;  2JSZ A;  2JZT A;  1TP9 A;  1X5E A;  4ECC A;  4KND A;  3HVV A;  1XIY A;  1U3I A;  5G30 A;  5IMZ A;  3N9J A;  4HU9 A;  2YJ7 A;  1U3A A;  5ECI B;  4BL7 A;  1TRU A;  5IO2 A;  3PGT A;  3TOT A;  1V9W A;  3D4M A;  4FO5 A;  2X4A A;  2LRT A;  1SYX A;  2ON5 A;  4PX1 A;  2LRC A;  3GHA A;  3ZMK A;  1ZYE A;  4IS0 A;  3D6I A;  4X1U A;  3VI5 A;  1WE0 A;  3CQF A;  1Z7P A;  2GT6 A;  2WW0 A;  1DBY A;  2VL3 A;  2PN8 A;  1YY7 A;  5EPF A;  3U5R E;  5B8A A;  3HZ8 A;  4IJ3 A;  1O73 A;  2XHF A;  5IOW A;  3RAZ A;  5ID2 B;  2AAW A;  2L6C A;  2MMA A;  4E8E A;  3BCI A;  4ZL8 A;  1B9Y C;  3D21 A;  3ZIT A;  5D8I A;  5JWQ B;  2R0P A;  1V98 A;  3HJP A;  2VL2 C;  3CTG A;  2GDR A;  4EUY A;  1J0F A;  4K9Z A;  2PUK C;  4O7H A;  3NOF A;  5HQP A;  4NV2 A;  5DQY A;  5HR2 A;  3KXO A;  2H74 A;  4HZ2 A;  3LGC A;  2YV7 A;  2CX4 A;  1PMT A;  1GSU A;  5ECN B;  1A23 A;  1B48 A;  2RUF A;  1G7E A;  1E2Y A;  2B7K A;  1FB6 A;  4BL7 B;  4K2D A;  2LQO A;  1KTE A;  5CRE A;  4PI0 C;  1JZD A;  1LU4 A;  3EIN A;  2OE0 A;  2WZS A;  1AQV A;  4MJC A;  2WW2 A;  3FKF A;  4GLT A;  2HI7 A;  3R3E A;  4RQX A;  4F9Z A;  3WT2 A;  4NHW A;  1V58 A;  5G1K A;  3QDN A;  3DML A;  5D9V A;  1TI1 A;  2RM5 A;  1TOF A;  1V57 A;  4Q5N A;  3ZFL A;  4MJE A;  2UV8 G;  2B5X A;  1GUL A;  4WF5 A;  4QL9 A;  1XWK A;  2WS2 A;  1ERU A;  2OJL A;  4ZB8 A;  3DVW A;  3VPQ A;  4ICY A;  2O5V A;  2PMT A;  3VWX A;  2KHP A;  1GUH A;  6GST A;  2FWH A;  4HDE A;  3GNJ A;  2C0D A;  4F82 A;  4HS1 A;  3KD0 A;  2TRX A;  2CT6 A;  5A1N A;  3MAK A;  4IN0 A;  2ZUP A;  1V2A A;  1PL2 A;  3UVH A;  1XCC A;  2IME A;  2YWM A;  5INY A;  2GST A;  3VFI A;  3LYP A;  4AI6 A;  3QPM A;  5AIS A;  2PBJ A;  2WVX A;  2L5O A;  3LFL A;  1YKA A;  3H93 A;  3DD3 A;  3FMW A;  2N5B A;  2B5E A;  3CYN A;  3GH9 A;  4OCF A;  3UOM A;  1XOA A;  1PL1 A;  5ELG A;  4JRR A;  1EOH A;  1O6J A;  2MZC A;  4I2U A;  4WBR D;  4JR6 A;  2IIY A;  2C80 A;  2C3T A;  2LNT A;  1SKS B;  3GUR A;  5JCG A;  3GUS A;  4TKY A;  1ERV A;  4FXY P;  1THX A;  5DJM A;  3H8Q A;  2QA1 A;  4BVY A;  4O5U A;  1ML6 A;  1FVJ A;  1K0D A;  4KE3 A;  2A2P A;  5KN1 A;  14GS A;  1GUM A;  2GZY A;  4LL4 B;  3I6A A;  3KEB A;  3BOA A;  2H1B A;  2HQT A;  1KEB A;  2L6D A;  3C8E A;  3OR5 A;  4MZB A;  1XVW A;  4WBJ A;  1SJZ A;  4RI6 A;  4GWR A;  1I5G A;  1ZYP A;  1WOU A;  3DRN A;  1FG4 A;  3IA1 A;  3ZIV A;  2GQK A;  1OVN A;  1GSF A;  3GMF A;  5KOX A;  3WYW A;  3EMP A;  2A4H A;  4AJ6 A;  3MWH A;  4KCA A;  3TRP A;  2FD3 A;  1BED A;  3VI7 A;  1Z6M A;  3FR3 A;  1R5P A;  2VD1 A;  2WVX B;  1U87 A;  1EEM A;  4XHM A;  5JWR B;  4YQV A;  1X5D A;  5CRG A;  2BJX A;  2YPM A;  4L5O A;  5HFI A;  2WB9 A;  3K8N A;  5ENU A;  1GLQ A;  4ECB A;  2V6O A;  2YOI A;  3CSI A;  3KP9 A;  3UAP A;  5LNK e;  3ZFB A;  4O32 A;  5ECS A;  1YF0 A;  2I1U A;  5D93 A;  16GS A;  1FHE A;  3RHB A;  1ZL9 A;  2JZS A;  2E2M A;  1UN2 A;  4BVY B;  4L8E A;  5IM9 A;  3GKM A;  1M3J A;  1YF1 A;  2QKE A;  2HZE A;  1X0R A;  2VM2 A;  3ZIJ A;  1XVQ A;  5IMC A;  1X5C A;  4Q5F A;  3TJF A;  3I43 A;  5IMV A;  2AHE A;  2XPD A;  2R3X A;  4ZL7 A;  4QMK A;  5CRW A;  5AIX A;  1A2J A;  2GQM A;  3ZLP A;  2GSS A;  1HD2 A;  4HQS A;  4O92 A;  2M46 A;  2CX3 A;  4AKG A;  2LUS A;  4L0W A;  3F4S A;  3LWA A;  1A0F A;  1F6M C;  1SVM A;  4WF4 A;  3TU3 B;  3ZVJ A;  3H79 A;  4POM A;  4MJA A;  4ZB7 A;  1JZO A;  5A5H A;  4BIK A;  2HRK B;  4ID0 A;  3RHC A;  1S3A A;  4V2N A;  5AN1 A;  3KP8 A;  3GST A;  3CTF A;  1QK8 A;  4PQH A;  1B8X A;  2V41 A;  3UBK A;  4ML6 A;  4KSO A;  4YH2 A;  1S3D A;  2AYT A;  2B7J A;  3P7X A;  5G5F A;  3VWV A;  2RM6 A;  3HZ4 A;  3GL5 A;  1GH2 A;  2I4A A;  1ZMA A;  5AGY A;  1Y6E A;  4K5R A;  3L0H A;  5HR1 A;  1FW1 A;  2HZE B;  2EFD A;  1K0O A;  4PUA A;  2A4V A;  2R0C A;  1EGO A;  2F9S A;  2DJJ A;  1XWC A;  4MDC A;  3Q6O A;  4XRA A;  5D96 A;  4KA0 A;  4D73 A;  1USB A;  3TJB A;  4BA7 A;  1N2A A;  4DSR A;  1F3B A;  1MD4 A;  4NAX A;  5LCZ A;  1A2M A;  4J56 E;  6GSS A;  2FUG 2;  2DJ1 A;  4ECJ A;  2JZR A;  1U6T A;  2VCT A;  2GGT A;  3W6G A;  2VLU A;  7GSS A;  1RK4 A;  3G9B A;  1OKT A;  3F4R A;  4WKW A;  2WRT A;  4BPY A;  5A5H B;  2MMZ A;  4OD7 A;  5ECK B;  2O36 A;  4KW6 A;  4EDZ A;  4FYC A;  1OE8 A;  4IQA A;  4JE1 A;  4EF0 A;  3NIV A;  3RDW A;  4IJI A;  2ZNM A;  3M1G A;  5BRT A;  2WJU A;  4K0G A;  4LLR A;  4K6X A;  1N8J A;  2E7P A;  3EYT A;  3APQ A;  1XWB A;  1V40 A;  1QXH A;  4HJ2 A;  5FT3 A;  2H0H A;  4F0C A;  1M2B A;  4I97 A;  2DMM A;  1URM A;  3EU3 A;  3FRC A;  3F8U A;  2H30 A;  1PX7 A;  3VLN A;  3BJ5 A;  3HA9 A;  4D73 B;  5L71 A;  1H75 A;  2NPB A;  1VGL A;  2O87 A;  4EKZ A;  2HZF A;  4JR4 A;  1F37 A;  5EY6 A;  2GQL A;  2VIM A;  2K18 A;  5D9X A;  4GSN A;  5DQS A;  5FHI A;  4K2X A;  4G9H A;  2ALB A;  1VF3 A;  2IL3 A;  4GQF A;  5GAN D;  5F8B A;  3FR6 A;  2CAQ A;  3W8S A;  2IMD A;  1A8Y A;  1OYJ A;  3R2Q A;  1HQO A;  1PSQ A;  3E3E A;  4O5Q A;  3APO A;  2DJ0 A;  4WR5 A;  2FWF A;  3P2A A;  4XS4 A;  2B5Y A;  1GUK A;  4I2T A;  4IW9 A;  2H1L A;  1X9W B;  2C3Q A;  2HSM A;  1I9D A;  2CAI A;  3A2W A;  3JCM L;  3HJO A;  1MDJ A;  1EGR A;  5EVO A;  2H6Y A;  2X49 A;  3KCM A;  3MYD A;  1O8W A;  1ZZY A;  1T4Z A;  4V1A g;  3FK8 A;  4ZBB A;  3FZ4 A;  4K7O A;  3P90 A;  4Z2R A;  1TI3 A;  3FZ9 A;  1GTB A;  3IHQ A;  3FZ5 A;  4YAV A;  1M99 A;  4H86 A;  4CDO A;  4LA1 A;  1BX9 A;  5JWO B;  3ZML A;  1VF2 A;  4GDF A;  3F9U A;  3EUR A;  4YKF A;  4K1F A;  3UEM A;  1S3R A;  1SK2 A;  4WET A;  1BG5 A;  5IPH A;  5DCG A;  3KMO A;  1IYH A;  4G19 A;  4XCS A;  2N5F A;  1TU7 A;  1BF5 A;  3HYP A;  3F3Q A;  4XS4 B;  3KM6 A;  5C00 A;  5IPG A;  4NWY A;  4MCU A;  4OO4 A;  4OO5 A;  3FHK A;  4HEA 2;  4F0B A;  1K3Y A;  2HSM B;  3IE3 A;  2HSY A;  4G0I A;  1M7T A;  3GSS A;  4I5Q A;  3UAR A;  4RI7 A;  2GT5 A;  1EV9 A;  3CSH A;  1AUC A;  4IVF A;  4PTS A;  3F63 A;  4EIP A;  3HDC A;  4MF6 A;  2ON7 A;  3EE2 A;  2C8U A;  4BVX A;  1NSW A;  2F51 A;  2WW3 A;  1BYE A;  1PX6 A;  2O89 A;  4FIW A;  3IXR A;  1SJ6 A;  1TJD A;  2IFQ A;  1ERW A;  2O8V B;  3HMJ G;  1N25 A;  4FYB A;  4L5L A;  3IV4 A;  2GS3 A;  1G0T A;  3QAW A;  1LBK A;  3EWL A;  1G6Y A;  2LJA A;  4AKX B;  5G1L A;  4GXZ A;  4KGI A;  5J40 A;  1JZR A;  1SU9 A;  4IP6 A;  2Z9S A;  3TUE A;  5CNW A;  3M9K A;  2ES7 A;  2FWG A;  3ME7 A;  4G01 A;  2H66 A;  1HNC A;  4YAP A;  4KB3 A;  3BBY A;  2F3M A;  1SKR B;  1BQ7 A;  2OE3 A;  3LW9 A;  5CRD A;  4HSC X;  2L57 A;  2EFE A;  1PKW A;  3VUR A;  4X43 A;  2QA2 A;  1NW2 A;  3HCZ A;  2VKZ G;  2IMF A;  1QMV A;  2HLS A;  2R37 A;  1TDI A;  2UZ8 A;  4ZBA A;  1PN0 A;  2VCQ A;  2JAD A;  3IAM 2;  4BVX B;  4P3Y B;  4ZBD A;  4GQC A;  2FNO A;  4F2I A;  2EIR A;  1K0C A;  5ECH B;  2X8C A;  3ERW A;  3QAV A;  3WGD A;  1M2A A;  1ABA A;  2IFQ B;  2NDO A;  3VWU A;  2EC4 A;  5COH A;  2GSQ A;  1ILO A;  3CBU A;  3GH6 A;  2DIY A;  3O76 A;  2HRA A;  1PD2 1;  1T3B A;  4OFM A;  3LSZ A;  3A3T A;  2VCV A;  2H73 A;  2HRN A;  1GLP A;  3GL3 A;  2MBS A;  2H6X A;  5J9C A;  2FA8 A;  2XC2 A;  4GRF A;  4N0Z A;  3CMI A;  1THO A;  3MDK A;  4XRD A;  2M72 A;  5CRH A;  5H5R A;  3KMN A;  2H76 A;  1SK1 A;  3F0I A;  1T1V A;  4Z2U A;  4HZ4 A;  17GS A;  2VL2 A;  3KJY A;  4TR0 A;  2PU9 C;  2OAC A;  4ML1 A;  4KDX A;  3TKS C;  1NM3 A;  2FA4 A;  1SL2 B;  5IMD A;  4PHZ C;  3KZQ A;  2QGV A;  2OBK A;  5LD0 A;  1PA3 A;  2MBT A;  2CVK A;  3FYG A;  4GST A;  1K0N A;  1K3O A;  2H6Z A;  3TKP A;  3F3R A;  1ON4 A;  5D73 A;  2LS5 A;  3G7J A;  3CSJ A;  1S4B P;  2JSY A;  4V2M A;  2DJ3 A;  5DCH A;  2K8V A;  2L5L A;  4OWY A;  1Q98 A;  1Z3E A;  5F07 A;  2PGT A;  4GTU A;  3QMX A;  4PQI A;  3IR4 A;  2YN1 A;  1W89 A;  3LEF A;  2J23 A;  2HRK A;  3E0U A;  1A8L A;  3HY2 A;  1T4Y A;  3DVX A;  4DVC A;  5J41 A;  5ELA A;  1TU8 A;  4N3Z A;  4AGS A;  4LMV A;  3C7M A;  5KN3 A;  4PNF A;  4KUN A;  1O7U A;  3MNG A;  4N0V A;  1J08 A;  5JCW A;  1NHY A;  1DSB A;  3PR8 A;  4XIH A;  1GSY A;  1HNA A;  1M3I A;  1AW9 A;  4PI2 C;  3FY7 A;  1C72 A;  4Q5R A;  1B4P A;  1R5A A;  1CQG A;  5IMF A;  2N5A A;  4HU7 A;  2H72 A;  3ZYW A;  1K0M A;  2CZ2 A;  2LEG A;  1R26 A;  22GS A;  1XG8 A;  2RUE A;  3APS A;  2YV9 A;  1PKZ A;  4HUA A;  1T7P B;  3QCP A;  4AJ7 A;  3TJK A;  3F6F A;  5ABR A;  5F0G A;  2G2Q A;  3ERF A;  1YVL A;  4ZXG A;  1XXU A;  5ECL B;  2DJK A;  4NPB A;  4MJB A;  3UVT A;  1FB0 A;  4IBP A;  1AAZ A;  3IPZ A;  4PQ1 A;  3I69 A;  3GX0 A;  4NV5 A;  3CRU A;  5IO0 A;  19GS A;  2IJY A;  3ERG A;  2YNX A;  5A34 A;  2FHE A;  3LOR A;  2GLR A;  4DEJ A;  4AKH A;  2REM A;  3TRQ A;  1T8E B;  1H4O A;  3IOS A;  3Q18 A;  3A5I A;  3GA4 A;  5E59 A;  3RBT A;  2LJR A;  3HD5 A;  10GS A;  3IK9 A;  1GRX A;  1YEX A;  3L9S A;  2DKH A;  5H5S A;  2VCX A;  3C1R A;  1WRY A;  2F8F A;  1B9X C;  3LYK A;  1EWX A;  3KH7 A;  1K0B A;  1UA5 A;  1I1I P;  1VF4 A;  2R5G A;  3U6V A;  5JCU A;  1WIK A;  2WVZ A;  3NZN A;  2OE1 A;  3LXT A;  2BTO T;  2PER A;  5GST A;  4TN8 A;  1A24 A;  3Q74 A;  1TK0 B;  2DBC A;  4Z2T A;  4RQR A;  3CWG A;  1UC7 A;  2H01 A;  4EO3 A;  2LKU A;  2CVD A;  3UJ1 A;  4OCE A;  4IHU A;  2R2J A;  2GZZ A;  3RGB C;  1OC9 A;  3CHX C;  4DSS B;  4TW5 A;  4GF0 A;  3ISO A;  2KUC A;  5A34 B;  2H0I A;  1RW1 A;  1LJR A;  1MDK A;  2K8S A;  4ACS A;  1WWJ A;  1IYI A;  2OAD A;  2WFC A;  3KTL A;  2TIR A;  5HR3 A;  3VK9 A;  5DAK A;  1QGV A;  3GRX A;  1Z5Y E;  2AJQ B;  1SL0 B;  3FW2 A;  1Z9H A;  4KF9 A;  2LQQ A;  1GWC A;  4MH3 A;  5KN2 A;  3W8J A;  2YAN A;  2VM1 A;  1DE1 A;  2HT9 A;  2L4C A;  2IWT A;  2PPT A;  4NMU A;  4MNN A;  2H1A A;  3EU4 A;  3WT1 A;  3FZA A;  6GSX A;  20GS A;  1MD3 A;  3O3T A;  4KCE A;  5HR0 A;  1YQ1 A;  1GP1 A;  1R7H A;  2B1K A;  5DAL A;  1TKD B;  1S3C A;  3DIE A;  3ZRD A;  2DC5 A;  3L9U A;  2R0G A;  2XBQ A;  3C73 A;  3N5O A;  4V2L A;  3LQ7 A;  3M0F A;  4RUV A;  5D9T A;  4JED A;  2HNL A;  3IK7 A;  2CZ3 A;  3ME8 A;  1GSE A;  2GVP A;  1X9S B;  4FYU A;  2EIQ A;  2CA8 A;  3UMA A;  1OC9 B;  1TXU A;  4TVE A;  3LG6 A;  4ULX A;  4FQU A;  5IQY A;  4JZQ A;  1MEK A;  4MZC A;  12GS A;  5E4W A;  3D0Z A;  2C4J A;  2DLX A;  1K0A A;  1T00 A;  5DAK B;  1YZX A;  2H71 A;  8GSS A;  3VWW A;  3G7I A;  2X8H A;  3FEU A;  1F3A A;  3HHV A;  3QAG A;  3EVI A;  2VLV A;  5ECQ B;  1MDI A;  3ZRE A;  1PGT A;  2H75 A;  3DEX A;  1EP8 A;  1EOG A;  2YWI A;  2WCI A;  4GCI A;  4G10 A;  5DAL B;  4JU5 A;  4BWQ A;  1XZO A;  3TB2 A;  4MF5 A;  2K9F A;  4Z7X A;  2IMK A;  4K7I A;  1EEJ A;  2AUV A;  1QUW A;  3SWL A;  2OKA A;  4TXV A;  1RQM A;  2V1M A;  3GIX A;  3GV1 A;  2G0F A;  1WPI A;  3GX8 A;  1M9B A;  4ISD A;  2PVQ A;  2DIZ A;  1U88 A;  3KH9 A;  2JU5 A;  3O6T A;  4XS6 A;  2A2R A;  3VPT A;  5CYY A;  4EIQ A;  5KEJ A;  4YQM A;  1SD8 A;  5CO3 A;  4X0X A;  4TR1 A;  2GSR A;  4HI7 A;  1OC8 A;  3TDG A;  1PFO A;  2WGR A;  2DML A;  4K7N A;  4HJM A;  2PVO C;  1B4Q A;  2VUP A;  3AY8 A;  5F06 A;  3D5J A;  1AIU A;  1SEN A;  1XW9 A;  3MSZ A;  2LV3 A;  4W66 A;  6GSW A;  5J4U A;  1GTA A;  5CAX A;  1O81 A;  3J7Y b;  1AQX A;  2A2S A;  1PQN A;  2I9H A;  3RPP A;  3QOU A;  3H4K A;  4K5S A;  4IQ1 A;  1TRW A;  5AIV A;  5GSS A;  5ECO B;  4OMV A;  2DJ2 A;  4POB A;  1GNW A;  1SVO A;  2BMX A;  2EFC A;  2B3S A;  2LTK A;  3WGX A;  2GTU A;  4POL A;  2FLS A;  4PNG A;  3IBH A;  4G0K A;  5IIZ A;  4NXI A;  2H1D A;  1GNE A;  2O85 A;  2XBI A;  3J7Y k;  1GSQ A;  1AXD A;  3TJJ A;  2OT3 A;  3H1N A;  2NBS A;  3M9J A;  2HXK A;  4N30 A;  4O5R A;  3DKS A;  5DDL A;  5J3R A;  3DYR A;  4HOJ A;  3ZTL A;  5A4V A;  1JLV A;  1A0R P;  1FVK A;  4LMW A;  4TR1 B;  4J2F A;  3KTB A;  4CW9 A;  1MTC A;  3TOU A;  3ZL5 A;  2J9H A;  4EE0 A;  4TRX A;  3WD6 A;  5D9W A;  3M8N A;  4EXJ A;  5C04 A;  3CXG A;  2E2G A;  2EFH A;  4ECI A; 
#chains in the Genus database with same CATH homology
 2RLI A;  2VOC A;  4EVM A;  3L9V A;  2B1L A;  3IRA A;  1WJK A;  2VL9 A;  5J4V A;  5A4W A;  4OFT A;  3KIJ A;  1OE7 A;  1XW6 A;  1JLW A;  5BMU A;  2YZU A;  1DE2 A;  1X9M B;  4TOP A;  2JAC A;  4USS A;  5FWG A;  3A5W A;  3EC3 A;  5HFK A;  4KDY A;  1AC1 A;  4K0N A;  2L4Q A;  2H0G A;  4QQ7 A;  1WMJ A;  4E68 A;  4IKH A;  3EPT A;  3P8W A;  1GSD A;  4X4J A;  4WEY A;  2H19 A;  2RII A;  4YQU A;  1WP0 A;  2LRN A;  4AF2 A;  3A2X A;  2CV4 A;  1EZK A;  1SYR A;  3EMX A;  2XPE A;  2FCH A;  4XTS A;  2B6M A;  3GTU A;  1PRX A;  1TK5 B;  3UIW A;  4MP4 A;  3GYK A;  2OBI A;  2M80 A;  4KDU A;  2X99 A;  3UBL A;  4WXT A;  5J5N A;  3D22 A;  4MLY A;  1UVZ A;  1ZOF A;  3E9J B;  4MAB A;  2V32 A;  4KX4 A;  2PWJ A;  2YWN A;  5IMA A;  3IC8 A;  3L78 A;  1O8X A;  3LXZ A;  4KH7 A;  1Y25 A;  1GTU A;  2KP2 A;  5BMU B;  2F8A A;  3HJM A;  11GS A;  3G7Y A;  3PH9 A;  4AKI A;  3TKR A;  4TR3 A;  2AB6 A;  2DSA A;  4AJ8 A;  1M2D A;  4QL7 A;  5DJL A;  2IMI A;  2VAF A;  1BG1 A;  1XWG A;  1ERT A;  1HYU A;  1DUG A;  3BD2 A;  5A1N B;  1XOB A;  1XWA A;  3D4T A;  3F4T A;  5J9B A;  1OAZ A;  1SVL A;  2C0G A;  1TRS A;  5EL8 A;  3QFB C;  3GTU B;  2VCW A;  2HFD A;  1EV4 A;  3PPU A;  5CP1 A;  4CY8 A;  1KNG A;  6GSU A;  1W4V A;  4DSQ A;  3UL3 A;  3SBC A;  5A4U A;  1SL1 B;  1E6B A;  4IGJ A;  9GSS A;  1XFL A;  3F6D A;  2FWE A;  2MMO A;  1TRV A;  3GFK A;  2QC7 A;  5B8B A;  5B7C A;  3QR6 A;  1OC3 A;  4G0L A;  1XW5 A;  4G2E A;  2E0Q A;  2MYG A;  2C0F A;  5DVB A;  4ZIJ A;  3M3M A;  2CVB A;  4J57 E;  3RPN A;  3I9V 2;  3A2V A;  4LL1 B;  4ZL9 A;  1QFN A;  1M9A A;  4MMM A;  3HXS A;  6GSY A;  4KAE A;  3MIX A;  6GSV A;  1NHO A;  3TJG A;  2GZP A;  2FY6 A;  3QD9 A;  4DSS A;  3FR9 A;  3HVS A;  4ILF A;  4V1A p;  5DBQ A;  5B6M A;  4K8M A;  5F05 A;  4JBB A;  3WGE A;  4TXO A;  1CQH A;  5G5E A;  1Z6N A;  3ZVJ D;  1SK0 A;  1YEP A;  4PUR A;  2R6K A;  2KOK A;  2MMN A;  3TKS A;  4PXO A;  2X64 A;  2HSN A;  3IC4 A;  2LNS A;  2IN3 A;  4FH8 A;  3US3 A;  4ZB9 A;  3TKS E;  1TK8 B;  2C3N A;  1FO5 A;  1GTI A;  4F03 A;  4I8B A;  3BCK A;  4E8H A;  4HQZ A;  1TW9 A;  2KP1 A;  1ZYN A;  2X8G A;  4MF7 A;  1BJX A;  4POK A;  2YJH A;  4PUF C;  5J47 A;  3GN3 A;  1HNB A;  1YDK A;  2OA7 A;  2NTO A;  2R4V A;  3IAS 2;  2AV4 A;  2P5R A;  3TRX A;  18GS A;  4EDY A;  4EC0 A;  1XPV A;  1AQW A;  3IHG A;  4MA9 A;  2V6K A;  2VD0 A;  2C0E A;  2LJK A;  4WR4 A;  1Q4J A;  1XBS A;  2QSI A;  3HKR A;  2YWO A;  1J9B A;  2K6V A;  3DXB A;  4CY6 A;  1VRS D;  4TXO B;  1FOH A;  1A2L A;  1TTZ A;  2HSH A;  1G6W A;  2WZ9 A;  1QQ2 A;  5ECP B;  1SJI A;  4N11 A;  4GSS A;  1ST9 A;  2NVL A;  2YP6 A;  5KN0 A;  1JHB A;  2VO4 A;  4CHS A;  2HSN B;  2KLX A;  1BAY A;  3DWV A;  1R4W A;  3GKN A;  5KOW A;  3TGZ A;  2TRC P;  3TKQ A;  1K3L A;  3IDV A;  1G7O A;  2C1Y A;  2H70 A;  3ZZX A;  5HFG A;  1KBN A;  5GZZ B;  1PN9 A;  3CRT A;  5ECM B;  2P0G A;  4ZIL A;  2WUL A;  1F2E A;  4MH2 A;  4A5P A;  2P31 A;  1VF1 A;  2HRF A;  5H5Q A;  1ZYQ B;  1FOV A;  1EP7 A;  1M0U A;  1FAA A;  1O85 A;  4MZW A;  1Y1U A;  4MPG A;  2EIO A;  5G2Z A;  2HYX A;  2I3Y A;  3KGK A;  4KSM A;  2I81 A;  3V1W A;  2HE3 A;  3GKK A;  2JL4 A;  1SD9 A;  13GS A;  3LJR A;  2IPA A;  4YKG A;  2V2G A;  4MK3 A;  4ZB6 A;  4XS1 A;  3S9F A;  4N10 A;  4I6X A;  1GSS A;  1ZCP A;  1GL8 A;  4BWS A;  4Q5Q A;  2L59 A;  2YZH A;  3L4N A;  2H1G A;  4IEL A;  1OKD A;  2O7K A;  3HVX A;  1YJ6 A;  1YKC A;  2H8L A;  3GKX A;  3C71 A;  2FGX A;  2VCZ A;  3ED3 A;  2P5Q A;  3C1S A;  5IOX A;  2CQ9 A;  2DKI A;  2VLT A;  4L0U A;  5A5K A;  1ACV A;  4IP1 A;  2ZCT A;  1TXX A;  2D2Z A;  4OFN A;  5B6N A;  3PIN A;  4MPF A;  4PGT A;  4NHZ A;  1SKW B;  3Q19 A;  5GAP D;  5ID2 A;  5G31 A;  2YCD A;  5J4Y A;  1ZGN A;  1JZW A;  3DGQ A;  1Z7R A;  2WDU A;  4TR4 A;  5ECR B;  1F9M A;  2LST A;  4EL1 A;  3QFA C;  3TCO A;  1JFU A;  2JSZ A;  2JZT A;  1TP9 A;  1X5E A;  4ECC A;  4KND A;  3HVV A;  1XIY A;  1U3I A;  5G30 A;  5IMZ A;  3N9J A;  4HU9 A;  2YJ7 A;  1U3A A;  5ECI B;  4BL7 A;  1TRU A;  5IO2 A;  3PGT A;  3TOT A;  1V9W A;  3D4M A;  4FO5 A;  2X4A A;  2LRT A;  1SYX A;  2ON5 A;  4PX1 A;  2LRC A;  3GHA A;  3ZMK A;  1ZYE A;  4IS0 A;  3D6I A;  4X1U A;  3VI5 A;  1WE0 A;  1Z7P A;  2GT6 A;  1DBY A;  2VL3 A;  2PN8 A;  1YY7 A;  5EPF A;  3U5R E;  5B8A A;  3HZ8 A;  4IJ3 A;  1O73 A;  2XHF A;  5IOW A;  3RAZ A;  5ID2 B;  2AAW A;  2L6C A;  2MMA A;  4E8E A;  3BCI A;  4ZL8 A;  1B9Y C;  3D21 A;  3ZIT A;  5D8I A;  5JWQ B;  2R0P A;  1V98 A;  3HJP A;  2VL2 C;  3CTG A;  2GDR A;  4EUY A;  1J0F A;  4K9Z A;  2PUK C;  4O7H A;  3NOF A;  5HQP A;  4NV2 A;  5DQY A;  5HR2 A;  3KXO A;  2H74 A;  4HZ2 A;  3LGC A;  2YV7 A;  2CX4 A;  1PMT A;  1GSU A;  5ECN B;  1A23 A;  1B48 A;  2RUF A;  1G7E A;  1E2Y A;  2B7K A;  1FB6 A;  4BL7 B;  4K2D A;  2LQO A;  1KTE A;  5CRE A;  1JZD A;  1LU4 A;  3EIN A;  2OE0 A;  1AQV A;  4MJC A;  3FKF A;  4GLT A;  2HI7 A;  3R3E A;  4RQX A;  4F9Z A;  3WT2 A;  4NHW A;  1V58 A;  5G1K A;  3QDN A;  3DML A;  5D9V A;  1TI1 A;  2RM5 A;  1TOF A;  1V57 A;  4Q5N A;  3ZFL A;  4MJE A;  2UV8 G;  2B5X A;  1GUL A;  4WF5 A;  4QL9 A;  1XWK A;  2WS2 A;  1ERU A;  2OJL A;  4ZB8 A;  3DVW A;  3VPQ A;  4ICY A;  2O5V A;  2PMT A;  3VWX A;  2KHP A;  1GUH A;  6GST A;  2FWH A;  4HDE A;  3GNJ A;  2C0D A;  4F82 A;  4HS1 A;  3KD0 A;  2TRX A;  2CT6 A;  5A1N A;  3MAK A;  4IN0 A;  2ZUP A;  1V2A A;  1PL2 A;  3UVH A;  1XCC A;  2IME A;  2YWM A;  5INY A;  2GST A;  3VFI A;  3LYP A;  4AI6 A;  3QPM A;  5AIS A;  2PBJ A;  2L5O A;  3LFL A;  1YKA A;  3H93 A;  3DD3 A;  3FMW A;  2N5B A;  2B5E A;  3CYN A;  3GH9 A;  4OCF A;  3UOM A;  1XOA A;  1PL1 A;  5ELG A;  4JRR A;  1EOH A;  1O6J A;  2MZC A;  4I2U A;  4WBR D;  4JR6 A;  2IIY A;  2C80 A;  2C3T A;  2LNT A;  1SKS B;  3GUR A;  5JCG A;  3GUS A;  4TKY A;  1ERV A;  1THX A;  5DJM A;  3H8Q A;  2QA1 A;  4BVY A;  4O5U A;  1ML6 A;  1FVJ A;  1K0D A;  4KE3 A;  2A2P A;  5KN1 A;  14GS A;  1GUM A;  2GZY A;  4LL4 B;  3I6A A;  3KEB A;  3BOA A;  2H1B A;  2HQT A;  1KEB A;  2L6D A;  3C8E A;  3OR5 A;  4MZB A;  1XVW A;  4WBJ A;  1SJZ A;  4RI6 A;  4GWR A;  1I5G A;  1ZYP A;  1WOU A;  3DRN A;  1FG4 A;  3IA1 A;  3ZIV A;  2GQK A;  1OVN A;  1GSF A;  3GMF A;  5KOX A;  3WYW A;  3EMP A;  2A4H A;  4AJ6 A;  3MWH A;  4KCA A;  3TRP A;  2FD3 A;  1BED A;  3VI7 A;  1Z6M A;  3FR3 A;  1R5P A;  2VD1 A;  1U87 A;  1EEM A;  4XHM A;  5JWR B;  4YQV A;  1X5D A;  5CRG A;  2BJX A;  2YPM A;  4L5O A;  5HFI A;  2WB9 A;  3K8N A;  5ENU A;  1GLQ A;  4ECB A;  2V6O A;  2YOI A;  3CSI A;  3KP9 A;  3UAP A;  5LNK e;  3ZFB A;  4O32 A;  5ECS A;  1YF0 A;  2I1U A;  5D93 A;  16GS A;  1FHE A;  3RHB A;  1ZL9 A;  2JZS A;  2E2M A;  1UN2 A;  4BVY B;  4L8E A;  5IM9 A;  3GKM A;  1YF1 A;  2QKE A;  2HZE A;  1X0R A;  2VM2 A;  3ZIJ A;  1XVQ A;  5IMC A;  1X5C A;  4Q5F A;  3TJF A;  3I43 A;  5IMV A;  2AHE A;  2XPD A;  2R3X A;  4ZL7 A;  4QMK A;  5CRW A;  5AIX A;  1A2J A;  2GQM A;  3ZLP A;  2GSS A;  1HD2 A;  4HQS A;  4O92 A;  2M46 A;  2CX3 A;  4AKG A;  2LUS A;  4L0W A;  3F4S A;  3LWA A;  1A0F A;  1F6M C;  1SVM A;  4WF4 A;  3TU3 B;  3ZVJ A;  3H79 A;  4POM A;  4MJA A;  4ZB7 A;  1JZO A;  5A5H A;  2HRK B;  4ID0 A;  3RHC A;  1S3A A;  4V2N A;  5AN1 A;  3KP8 A;  3GST A;  3CTF A;  1QK8 A;  4PQH A;  1B8X A;  2V41 A;  3UBK A;  4ML6 A;  4KSO A;  4YH2 A;  1S3D A;  2AYT A;  2B7J A;  3P7X A;  5G5F A;  3VWV A;  2RM6 A;  3HZ4 A;  3GL5 A;  1GH2 A;  2I4A A;  1ZMA A;  5AGY A;  1Y6E A;  4K5R A;  3L0H A;  5HR1 A;  1FW1 A;  2HZE B;  2EFD A;  1K0O A;  4PUA A;  2A4V A;  2R0C A;  1EGO A;  2F9S A;  2DJJ A;  1XWC A;  4MDC A;  3Q6O A;  4XRA A;  5D96 A;  4KA0 A;  4D73 A;  1USB A;  3TJB A;  4BA7 A;  1N2A A;  4DSR A;  1F3B A;  1MD4 A;  4NAX A;  5LCZ A;  1A2M A;  4J56 E;  6GSS A;  2FUG 2;  2DJ1 A;  4ECJ A;  2JZR A;  1U6T A;  2VCT A;  2GGT A;  3W6G A;  2VLU A;  7GSS A;  1RK4 A;  3G9B A;  1OKT A;  3F4R A;  4WKW A;  2WRT A;  4BPY A;  5A5H B;  2MMZ A;  4OD7 A;  5ECK B;  4KW6 A;  4EDZ A;  4FYC A;  1OE8 A;  4IQA A;  4JE1 A;  4EF0 A;  3NIV A;  3RDW A;  4IJI A;  2ZNM A;  3M1G A;  5BRT A;  2WJU A;  4K0G A;  4LLR A;  4K6X A;  1N8J A;  2E7P A;  3EYT A;  3APQ A;  1XWB A;  1V40 A;  1QXH A;  4HJ2 A;  5FT3 A;  2H0H A;  4F0C A;  1M2B A;  4I97 A;  2DMM A;  1URM A;  3EU3 A;  3FRC A;  3F8U A;  2H30 A;  1PX7 A;  3VLN A;  3BJ5 A;  3HA9 A;  4D73 B;  5L71 A;  1H75 A;  2NPB A;  1VGL A;  2O87 A;  4EKZ A;  2HZF A;  4JR4 A;  1F37 A;  5EY6 A;  2GQL A;  2VIM A;  2K18 A;  5D9X A;  4GSN A;  5DQS A;  5FHI A;  4K2X A;  4G9H A;  2ALB A;  1VF3 A;  2IL3 A;  4GQF A;  5GAN D;  5F8B A;  3FR6 A;  2CAQ A;  3W8S A;  2IMD A;  1A8Y A;  1OYJ A;  3R2Q A;  1HQO A;  1PSQ A;  3E3E A;  4O5Q A;  3APO A;  2DJ0 A;  4WR5 A;  2FWF A;  3P2A A;  4XS4 A;  2B5Y A;  1GUK A;  4I2T A;  4IW9 A;  2H1L A;  1X9W B;  2C3Q A;  2HSM A;  1I9D A;  2CAI A;  3A2W A;  3JCM L;  3HJO A;  1MDJ A;  1EGR A;  5EVO A;  2H6Y A;  2X49 A;  3KCM A;  3MYD A;  1O8W A;  1ZZY A;  1T4Z A;  4V1A g;  3FK8 A;  4ZBB A;  3FZ4 A;  4K7O A;  3P90 A;  4Z2R A;  1TI3 A;  3FZ9 A;  1GTB A;  3IHQ A;  3FZ5 A;  4YAV A;  1M99 A;  4H86 A;  4CDO A;  4LA1 A;  1BX9 A;  5JWO B;  3ZML A;  1VF2 A;  4GDF A;  3F9U A;  3EUR A;  4YKF A;  4K1F A;  3UEM A;  1SK2 A;  4WET A;  1BG5 A;  5IPH A;  5DCG A;  3KMO A;  1IYH A;  4G19 A;  4XCS A;  2N5F A;  1TU7 A;  1BF5 A;  3HYP A;  3F3Q A;  4XS4 B;  3KM6 A;  5C00 A;  5IPG A;  4NWY A;  4MCU A;  4OO4 A;  4OO5 A;  3FHK A;  4HEA 2;  4F0B A;  1K3Y A;  2HSM B;  3IE3 A;  2HSY A;  4G0I A;  1M7T A;  3GSS A;  4I5Q A;  3UAR A;  4RI7 A;  2GT5 A;  1EV9 A;  3CSH A;  1AUC A;  4IVF A;  4PTS A;  3F63 A;  4EIP A;  3HDC A;  4MF6 A;  2ON7 A;  3EE2 A;  2C8U A;  4BVX A;  1NSW A;  2F51 A;  1BYE A;  1PX6 A;  2O89 A;  4FIW A;  3IXR A;  1SJ6 A;  1TJD A;  2IFQ A;  1ERW A;  2O8V B;  3HMJ G;  1N25 A;  4FYB A;  4L5L A;  3IV4 A;  2GS3 A;  1G0T A;  3QAW A;  1LBK A;  3EWL A;  1G6Y A;  2LJA A;  4AKX B;  5G1L A;  4GXZ A;  4KGI A;  5J40 A;  1JZR A;  1SU9 A;  4IP6 A;  2Z9S A;  3TUE A;  5CNW A;  3M9K A;  2ES7 A;  2FWG A;  3ME7 A;  4G01 A;  2H66 A;  1HNC A;  4YAP A;  4KB3 A;  3BBY A;  2F3M A;  1SKR B;  1BQ7 A;  2OE3 A;  3LW9 A;  5CRD A;  2L57 A;  2EFE A;  1PKW A;  3VUR A;  4X43 A;  2QA2 A;  1NW2 A;  3HCZ A;  2VKZ G;  2IMF A;  1QMV A;  2HLS A;  2R37 A;  1TDI A;  2UZ8 A;  4ZBA A;  1PN0 A;  2VCQ A;  2JAD A;  3IAM 2;  4BVX B;  4P3Y B;  4ZBD A;  4GQC A;  2FNO A;  4F2I A;  2EIR A;  1K0C A;  5ECH B;  2X8C A;  3ERW A;  3QAV A;  3WGD A;  1M2A A;  1ABA A;  2IFQ B;  2NDO A;  3VWU A;  2EC4 A;  5COH A;  2GSQ A;  1ILO A;  3CBU A;  3GH6 A;  2DIY A;  3O76 A;  2HRA A;  1PD2 1;  1T3B A;  4OFM A;  3LSZ A;  3A3T A;  2VCV A;  2H73 A;  2HRN A;  1GLP A;  3GL3 A;  2MBS A;  2H6X A;  5J9C A;  2FA8 A;  2XC2 A;  4GRF A;  4N0Z A;  3CMI A;  1THO A;  3MDK A;  4XRD A;  2M72 A;  5CRH A;  5H5R A;  3KMN A;  2H76 A;  1SK1 A;  3F0I A;  1T1V A;  4Z2U A;  4HZ4 A;  17GS A;  2VL2 A;  3KJY A;  4TR0 A;  2PU9 C;  2OAC A;  4ML1 A;  4KDX A;  3TKS C;  1NM3 A;  2FA4 A;  1SL2 B;  5IMD A;  3KZQ A;  2QGV A;  2OBK A;  5LD0 A;  1PA3 A;  2MBT A;  2CVK A;  3FYG A;  4GST A;  1K0N A;  1K3O A;  2H6Z A;  3TKP A;  3F3R A;  1ON4 A;  5D73 A;  2LS5 A;  3G7J A;  3CSJ A;  2JSY A;  4V2M A;  2DJ3 A;  5DCH A;  2K8V A;  2L5L A;  4OWY A;  1Q98 A;  1Z3E A;  5F07 A;  2PGT A;  4GTU A;  3QMX A;  4PQI A;  3IR4 A;  2YN1 A;  1W89 A;  3LEF A;  2J23 A;  2HRK A;  3E0U A;  1A8L A;  3HY2 A;  1T4Y A;  3DVX A;  4DVC A;  5J41 A;  5ELA A;  1TU8 A;  4N3Z A;  4AGS A;  4LMV A;  3C7M A;  5KN3 A;  4PNF A;  4KUN A;  1O7U A;  3MNG A;  4N0V A;  1J08 A;  5JCW A;  1NHY A;  1DSB A;  3PR8 A;  4XIH A;  1GSY A;  1HNA A;  1AW9 A;  3FY7 A;  1C72 A;  4Q5R A;  1B4P A;  1R5A A;  1CQG A;  5IMF A;  2N5A A;  4HU7 A;  2H72 A;  3ZYW A;  1K0M A;  2CZ2 A;  2LEG A;  1R26 A;  22GS A;  2RUE A;  3APS A;  2YV9 A;  1PKZ A;  4HUA A;  1T7P B;  3QCP A;  4AJ7 A;  3TJK A;  3F6F A;  5ABR A;  5F0G A;  2G2Q A;  3ERF A;  1YVL A;  4ZXG A;  1XXU A;  5ECL B;  2DJK A;  4NPB A;  4MJB A;  3UVT A;  1FB0 A;  4IBP A;  1AAZ A;  3IPZ A;  4PQ1 A;  3I69 A;  3GX0 A;  4NV5 A;  3CRU A;  5IO0 A;  19GS A;  2IJY A;  3ERG A;  2YNX A;  5A34 A;  2FHE A;  3LOR A;  2GLR A;  4DEJ A;  4AKH A;  2REM A;  3TRQ A;  1T8E B;  1H4O A;  3IOS A;  3Q18 A;  3A5I A;  3GA4 A;  5E59 A;  3RBT A;  2LJR A;  3HD5 A;  10GS A;  3IK9 A;  1GRX A;  1YEX A;  3L9S A;  2DKH A;  5H5S A;  2VCX A;  3C1R A;  1WRY A;  2F8F A;  1B9X C;  3LYK A;  1EWX A;  3KH7 A;  1K0B A;  1UA5 A;  1VF4 A;  2R5G A;  3U6V A;  5JCU A;  1WIK A;  3NZN A;  2OE1 A;  3LXT A;  2BTO T;  2PER A;  5GST A;  4TN8 A;  1A24 A;  3Q74 A;  1TK0 B;  2DBC A;  4Z2T A;  4RQR A;  3CWG A;  1UC7 A;  2H01 A;  4EO3 A;  2LKU A;  2CVD A;  3UJ1 A;  4OCE A;  4IHU A;  2R2J A;  2GZZ A;  1OC9 A;  4DSS B;  4TW5 A;  4GF0 A;  3ISO A;  2KUC A;  5A34 B;  2H0I A;  1RW1 A;  1LJR A;  1MDK A;  2K8S A;  4ACS A;  1WWJ A;  1IYI A;  2OAD A;  2WFC A;  3KTL A;  2TIR A;  5HR3 A;  3VK9 A;  5DAK A;  1QGV A;  3GRX A;  1Z5Y E;  2AJQ B;  1SL0 B;  3FW2 A;  1Z9H A;  4KF9 A;  2LQQ A;  1GWC A;  4MH3 A;  5KN2 A;  3W8J A;  2YAN A;  2VM1 A;  1DE1 A;  2HT9 A;  2L4C A;  2IWT A;  2PPT A;  4NMU A;  4MNN A;  2H1A A;  3EU4 A;  3WT1 A;  3FZA A;  6GSX A;  20GS A;  1MD3 A;  3O3T A;  4KCE A;  5HR0 A;  1YQ1 A;  1GP1 A;  1R7H A;  2B1K A;  5DAL A;  1TKD B;  1S3C A;  3DIE A;  3ZRD A;  2DC5 A;  3L9U A;  2R0G A;  2XBQ A;  3C73 A;  3N5O A;  4V2L A;  3LQ7 A;  3M0F A;  4RUV A;  5D9T A;  4JED A;  2HNL A;  3IK7 A;  2CZ3 A;  3ME8 A;  1GSE A;  2GVP A;  1X9S B;  4FYU A;  2EIQ A;  2CA8 A;  3UMA A;  1OC9 B;  1TXU A;  4TVE A;  3LG6 A;  4ULX A;  4FQU A;  5IQY A;  4JZQ A;  1MEK A;  4MZC A;  12GS A;  5E4W A;  3D0Z A;  2C4J A;  2DLX A;  1K0A A;  1T00 A;  5DAK B;  1YZX A;  2H71 A;  8GSS A;  3VWW A;  3G7I A;  2X8H A;  3FEU A;  1F3A A;  3HHV A;  3QAG A;  3EVI A;  2VLV A;  5ECQ B;  1MDI A;  3ZRE A;  1PGT A;  2H75 A;  3DEX A;  1EP8 A;  1EOG A;  2YWI A;  2WCI A;  4GCI A;  4G10 A;  5DAL B;  4JU5 A;  4BWQ A;  1XZO A;  3TB2 A;  4MF5 A;  2K9F A;  4Z7X A;  2IMK A;  4K7I A;  1EEJ A;  2AUV A;  1QUW A;  3SWL A;  2OKA A;  4TXV A;  1RQM A;  2V1M A;  3GIX A;  3GV1 A;  2G0F A;  1WPI A;  3GX8 A;  1M9B A;  4ISD A;  2PVQ A;  2DIZ A;  1U88 A;  3KH9 A;  2JU5 A;  3O6T A;  4XS6 A;  2A2R A;  3VPT A;  5CYY A;  4EIQ A;  5KEJ A;  4YQM A;  1SD8 A;  5CO3 A;  4X0X A;  4TR1 A;  2GSR A;  4HI7 A;  1OC8 A;  3TDG A;  2WGR A;  2DML A;  4K7N A;  4HJM A;  2PVO C;  1B4Q A;  2VUP A;  3AY8 A;  5F06 A;  3D5J A;  1AIU A;  1SEN A;  1XW9 A;  3MSZ A;  2LV3 A;  4W66 A;  6GSW A;  5J4U A;  1GTA A;  5CAX A;  1O81 A;  3J7Y b;  1AQX A;  2A2S A;  1PQN A;  2I9H A;  3RPP A;  3QOU A;  3H4K A;  4K5S A;  4IQ1 A;  1TRW A;  5AIV A;  5GSS A;  5ECO B;  4OMV A;  2DJ2 A;  4POB A;  1GNW A;  1SVO A;  2BMX A;  2EFC A;  2B3S A;  2LTK A;  3WGX A;  2GTU A;  4POL A;  2FLS A;  4PNG A;  3IBH A;  4G0K A;  5IIZ A;  4NXI A;  2H1D A;  1GNE A;  2O85 A;  2XBI A;  3J7Y k;  1GSQ A;  1AXD A;  3TJJ A;  2OT3 A;  3H1N A;  2NBS A;  3M9J A;  2HXK A;  4N30 A;  4O5R A;  3DKS A;  5DDL A;  5J3R A;  3DYR A;  4HOJ A;  3ZTL A;  5A4V A;  1JLV A;  1A0R P;  1FVK A;  4LMW A;  4TR1 B;  4J2F A;  3KTB A;  4CW9 A;  1MTC A;  3TOU A;  3ZL5 A;  2J9H A;  4EE0 A;  4TRX A;  3WD6 A;  5D9W A;  3M8N A;  4EXJ A;  5C04 A;  3CXG A;  2E2G A;  2EFH A;  4ECI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...