4EEPA

Crystal structure of lov2 domain of arabidopsis thaliana phototropin 2
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
110
structure length
110
Chain Sequence
IEKNFVISDPRLPDNPIIFASDSFLELTEYSREEILGRNCRFLQGPETDQATVQKIRDAIRDQREITVQLINYTKSGKKFWNLFHLQPMRDQKGELQYFIGVQLDGSDHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phototropin-2
publication title Structural Tuning of the Fluorescent Protein iLOV for Improved Photostability.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein, flavoprotein
total genus 33
structure length 110
sequence length 110
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4eepA00
4EESA 3LI8A 5HWWA 1TS0A 2ZBBA 2PR6A 5TBMB 1Y28A 5IU1A 3LUQA 4MN6A 4WLAA 1XFQA 3FC7A 2H28A 4HH2A 1UWNX 2HV1A 4JGPA 2VV6A 4BBUA 3EWKA 4L9EA 5F68A 3MXQA 3NJAA 3LIBA 4WUJA 3GECA 2V1AA 1V9YA 1JNUA 1DP9A 4H6JA 4L9FA 1OTBA 1DP6A 1DP8A 5HDSA 1LSXA 1F98A 3VE4A 3G6OA 3ZQ5A 1N9NA 1OTAA 3UMEA 2PDRA 2VV7A 1T1AA 3IS2B 3FG8A 3NOUC 2OOLA 5HDCA 2A24A 1XFNA 5J7EA 3H82A 2J80A 5HDDA 4E04A 3UB9A 3D72A 5IS1A 5A8BA 2INWA 1WA9A 1XJ6A 1LSWA 1T19A 4LRXC 2KX6A 4MN5A 4EEPA 3C8CA 5EFWA 3HJIA 3A0VA 1BYWA 4PKYA 4F3LA 1XJ4A 2V0WA 3BY8A 2D01A 1OT9A 3MQQA 3RTYA 4K08A 2L0WA 5I5LA 2QWSA 2OWHA 4BBTA 1S4RA 1T1BA 3H9WA 3A0SA 3F1OB 4GS9A 1P97A 1T18A 3H7WA 3PHYA 2W0NA 2W27A 3NHQA 1OTEA 3UB6A 4NXFA 3H7WB 1S1ZA 4I3JA 4JGRA 3MQOA 2PR5A 3ULFA 2Z6DA 3RH8B 2JHEA 2JN7A 1G28A 3CLOA 4NXEA 1GSWA 4HP9A 3E4OA 3EEHA 3NOTC 1VB6A 2ZOIA 3BWLA 3UE6A 3F1NA 4RQ9A 4R6LA 4H6JB 3K3CA 2YKHA 3SW1A 2YKFA 4WL9A 4I3AA 3MJQA 5J3WA 4EETB 3F1NB 4HOIA 1DRMA 3B33A 4XT2A 5G4ZA 4HJ6A 4HH3A 1LT0A 2D02A 4NXGA 3CWFA 2CMNA 2Z6CA 1OJGA 4XT2B 3F1PA 3P7NA 1KOUA 1OJ5A 4GCZA 2KDKA 3E4PA 1UWPX 2A24B 4HIAA 3H82B 2VEAA 2PD8A 4HQAA 5F69A 5HWTA 2WKQA 4BBVA 3F1PB 4JGQA 1S67L 3K3DA 4NXBA 4L9GA 4EQ1A 4LRZE 4WF0A 1N9LA 1ODVA 4LPZA 1T1CA 2OWJA 1S4SA 2PHYA 4WN5A 3OLOA 4F3LB 4GHIA 2V0UA 5DKKA 4EXOA 3VOLA 4R38A 3UB7A 2WKPA 4EEUA 2VLGA 2GJ3A 2PYPA 5HZHA 4HP4A 1OTDA 4GHIB 5TBMA 5DJUA 1D06A 2QJ7A 5HD3A 3PYPA 1F9IA 2WKRA 1OT6A 4HJ4A 4GS9B 5J4EA 1XJ2A 3C2WA 3ICYA 3UB8A 5DJTA 3GDIA 3LICA 4B9OA 1LSVA 2QKPA 4GW9A 2EA9A 5AVFA 1V9ZA 3LIEA 5AVEA 1D7EA 2BASA 4HHDA 4PKYG 1N9OA 5F6AA 2V1BA 2V9AA 3LYXA 2R78A 4DJ3A 2QHKA 1NWZA 3KX0X 5HWVA 4I38A 1TS6A 1OTIA 3IBRA 1TS8A 1TS7A 4R70A 2M1CA 3LI9A 1S66L 3IS2A 3LIFA 3VE3A 5F5YA 4LRYC 2B02A 2PYRA 4KUOA 4KQDA 4EW7A 1UGUA 2ZOHA 4HJ3A 1P0ZA 2L4RA 2K7SA 1MZUA 2I9VA 3HJKA 4I39A 1XJ3A 1GSXA 1LL8A 5KIZA 2PD7A 3CAXA 5HD5A 2QJ5A 3LIAA 4HI4A 4I3IA 1GSVA 1S1YA 4DJ2A 3MFXA 2VV8A 4EERA 4HY8A 4HNBA 4KUKA 3BY9A 5G4YA 4YWZA 3A0RA 4I5SA 5HSQA 3E4QA 4R3AA 3UMDA 4M4XA 5DKLA 3LIDA 4LLOB 2L1MA 1X0OA 3NOPC 3MR0A 4JGOA 3T50A 3F1OA 2P7JA 1EW0A
chains in the Genus database with same CATH superfamily
4X6TA 2JKGA 1XKZA 4UQIM 2ZBBA 4YOFA 5TBMB 2KLIA 4MBKA 5IU1A 1KGFA 4P85A 5D3OA 4E3JA 5AQ7A 1H3QA 2HV1A 4OQHA 3V50A 4Z1WA 1N4OA 3HBRA 4XUZA 5U47A 3ZGAB 5DFXA 1V9YA 1F2KA 5AQAA 2XFTA 3LEZA 5E2FA 1NY0A 3HUMA 3JPUA 3DWKA 2K2NA 1OTBA 3NY4A 3TOIA 3PBNA 1LSXA 3G6OA 3N7WA 3IBJA 4II7A 5FQQA 3V3RA 4Y5FA 3EQUA 5KSCA 3MF0A 2Q9MA 3FZCA 1ZC2A 1LL5A 3NOUC 2OOLA 5EE8A 5HDCA 4UHUA 2EFUA 3GQZA 3W4OA 1XFNA 4HEFA 4MBFA 3CPTA 3ZFZA 3Q7VA 1IYQA 4PPRA 3EGDC 4PM6A 1K25A 5IT5A 2O9CA 1YLTA 1DJAA 1GA0A 5F1FA 2PU4A 4MN5A 3PBQA 5EFWA 2OLVA 2FFFB 1K57C 3IX3A 3HJIA 3SZTA 1BTLA 1XJ4A 1ES4A 1O07A 2H0YA 4PM7A 1OT9A 4DE3A 3MQQA 2HF6A 4K08A 5I5LA 3S1YA 3FWLA 2OWHA 4BBTA 3KSHA 3W4PA 1T1BA 4IBXA 4E3OA 3UNWA 5EVIB 5CGSA 4FUWA 4X69A 2ZQDA 3PHYA 3EQVA 4B88A 4IVIA 4LV1A 2XSSA 3L9KA 3JVUA 3GTCA 1OTEA 3LEQA 1GA9A 1OPXA 2P08A 5DF9A 1VETB 4UQIS 3TG9A 2VJWA 3H7WB 4I3JA 5FL3A 2M7UA 2PR5A 1G68A 2PT7A 1SKOA 1YT4A 2C5WB 3G4PA 4Y0OA 3T4OA 3UN7A 3E4OA 3NOTC 1IEMA 3BWLA 1FCNA 1P9WA 1RP5A 3F1NA 4GKUA 4Y15A 4Y2FA 4NEED 2UWXA 5HL1A 4KG2A 2XR0A 1GHIA 2EWVA 4KZ8A 2YKHA 2CC1A 3S7NA 4WL9A 4GOGA 4LCMA 4MLLA 2QYBA 3B33A 1P9RA 3RJUA 5EVEA 4KZ5A 1LT0A 5KSHA 1ZTUA 4S2IA 4FTXA 4JKTA 2Z6CA 2M7VA 3HLFA 4DN0A 3Q82A 1HTZA 3E4PA 2HJ9C 3FV7A 3H82B 3S4XA 4JBFA 2ZM2A 2R9WA 3IHBA 4HQAA 4BL2A 1J9MA 1YPRA 3DWZA 1YSQA 4R3BA 3RFBA 3NULA 5CERA 2OSUA 4L9GA 1KVMA 2JBFA 3R7WA 4DXBA 3UDFA 4LRZE 4D60A 3BFGA 1T1CA 3ZNYA 4CLCC 3C7VA 3M2KA 5HL6A 4D2OA 2Z2MB 5EV0A 4GHIA 3LR0A 3QP4A 2XA7M 3VOLA 4S2JA 4OVDA 3QP5A 3UB7A 1WYCA 2WKPA 4EEUA 2VLGA 2GJ3A 2PYPA 5DJUA 2JKTI 1LL9A 4OH0A 3MZDA 2DNSA 1LHYA 3Q81A 3UO9A 3LO7A 4GS9B 2J8YA 3VFFA 1XJ2A 5DJTA 3LICA 4B9OA 3HLEA 3OPRA 2WGWB 4Q0IA 4O8GA 2QKPA 3PAEA 1KVLA 4E6WA 2EA9A 4IVKA 4PM5A 5AVFA 1VQQA 1YLYA 4CLCE 2JCHA 1CF0A 5GHZA 3BLSA 2DRWA 2V9AA 1H8YA 1VEUA 4BL3A 4DJ3A 2QHKA 2PRFA 1NWZA 3KX0X 3ZYTA 1NZUA 3S7OA 1TS6A 2PBDP 4FD8A 3BFEA 3E98A 2J9PA 3HREA 2M1CA 1L0FA 5EVID 4IUHA 4B4XA 4WM9A 3MXSA 2PYRA 3N8SA 4EV4A 2ZMVA 4YFMA 5TGFA 3ITAA 1UGUA 2Y59A 5TFQA 5CHMA 4U0TA 1P0ZA 3CUEC 2HP9A 1MZUA 3HJKA 4I39A 4RA7A 1YQSA 4DE0A 1BLPA 3MQ0A 1GSXA 5HARA 3EGXC 2PD7A 4YNRA 3A3JA 5HD5A 4JPMA 4OOLA 4I3IA 2WAFA 4DF6A 4IUKA 3MFXA 2XFSA 3FKVA 2C6WB 2ZJ9A 4HNBA 4KUKA 1FCMA 3RXWA 4YWZA 3M2JA 5HSQA 3GV9A 5DTTA 3V3SA 4DMZA 4R3AA 4FH2A 2HDSA 5DKLA 3DTEA 1Q2QA 3MKFA 3MR0A 4Y13A 1NLZA 4GDNA 3CJMA 5FDHA 4G3VA 1W63Q 1IKGA 2Y2MA 2XA7S 3WS2A 3SS4A 1YLZA 3UPOA 5FI2A 1J3WA 3SH8A 4ZRRA 3IHAA 3O88A 3QP1A 3G30A 4DRTA 1TDGA 4S2KA 1Y4OA 4WEJA 3FC7A 3C30A 5CX7A 4JGPA 3G2ZA 1XP4A 2VV6A 3EWKA 4L9EA 3DW0A 3MXQA 1CI9A 1K6SA 2LB5A 3WS5A 3GECA 2V1AA 1JNUA 1DP9A 1Z09A 4DKIA 2Y79A 1K38A 1IYPA 3VP3A 5KZHA 4BLMA 3IWOA 2Y4AA 3T4QA 1DP8A 1H5XA 3VE4A 4PAUA 3ZQ5A 1QMEA 1SKFA 1ONHA 1JVJA 4DE2A 3UMEA 3KYQA 4IBRA 2XD1A 2PDRA 1WYBA 4OOMA 4ETZA 3KSGA 4ETXA 5GHYA 1KDSA 3HUNA 3PBTA 4LV0A 5J7EA 3E2LA 4MN7A 3HLGA 2J80A 3C7UA 4KG6A 3UB9A 5FQIA 3BEBA 5IS1A 3LR3A 5A8BA 4BMWA 5HFOA 1ESUA 1W8QA 2K31A 1IKIA 4FOFA 1N9BA 4EEPA 3Q7VB 2ZQ8A 3C8CA 4E6XA 5M18A 3G32A 3W8KA 1BYWA 2IWBA 4F3LA 2V1ZA 3WRTA 2V0WA 5EOEA 5EVIC 3AGEA 2E8JA 5A92A 3RTYA 4CLCA 2QWSA 3G35A 5AQ9A 4CPKA 1S4RA 3FKWA 1S6RA 3KSIA 1L0DA 3N4IA 5DTKA 5EECA 5FI6A 2WYXA 3A0SA 3F1OB 3E2KA 4RX2A 2HDQA 3AGDA 1P97A 3QHYA 2W0NA 5DTSA 3NHQA 5EM0A 1IOUA 4JXVA 4ZJ1A 1ONGA 2G7UA 1S1ZA 3CI6A 3MQOA 3ULFA 1QMFA 4GNUA 3W4QA 5CEBA 2ZD8A 3WS0A 2LB9A 3CLOA 2VGJA 3LR4A 4XUXA 1MC0A 4ME4A 1NZOA 1TF1A 3T4KA 2ZOIA 3V67A 1SKOB 2V8CA 4S2OA 5TJJA 3ZNTA 4H6JB 1KE3A 4BWIA 3BJNA 2NUPC 1TEMA 2XF3A 4Q0HA 3CMZA 4S2LA 2YKFA 4EETB 3MZEA 3F1NB 3BECA 1A0KA 5KMWA 1ERMA 4U0XA 3HVFA 3IWQA 2D02A 3V5MA 1K54C 3IXHA 2CMNA 3GMWA 5CRFA 4A5RA 5GLBA 3P7NA 3UDIA 1KOUA 1OJ5A 4G3WA 1E25A 5HPIA 4NKPA 2KDKA 4H8RA 1UWPX 2A24B 1RGZA 1XPBA 3MKEA 3O86A 2ZL1A 2PD8A 3S7PA 5F69A 1FIKA 2WKQA 4KZ7A 4BBVA 5HPFA 5E2EA 3MFDA 1S0WA 4XXRA 3K3DA 4NXBA 1YSPA 3KSFA 1KE4A 3NDEA 3PBRA 4LPZA 1S4SA 4ZJ3A 1K55A 4R3JA 3O5YA 4ZJ2A 3M6BA 2R9XA 4EXOA 3FPVA 2X02A 3MXRA 3TJZC 1L0GA 2Q0OA 4GHIB 5TBMA 2QJ7A 3LGOA 5HD3A 4N1XA 1FCOA 1E3UA 5EM1A 5JYOA 4UAAA 5J4EA 2UV0E 3C4OA 3PBSA 5C5KA 3ZDJA 4ESPA 4X1MA 2OAP1 4PM9A 1V9ZA 1YM1A 3LIEA 2ZM0A 5AVEA 1D7EA 3ITBA 1HVBA 2HGVA 4HHDA 2IWCA 1N9OA 2V1BA 1KE0A 4WMCA 4OP5A 2R78A 2Y8HA 5FSRA 2VK3A 5HWVA 1SHVA 2I72A 4WBGA 2JKTM 1OTIA 1VEUB 3KYZA 2GDNA 1TS8A 5L2FA 4R70A 5BOHA 2VX8A 3LI9A 3LIFA 1NRFA 1PYYA 5HX9A 2PBYA 5F5YA 4KUOA 2EWWA 1I2SA 2P74A 4KQDA 5E2GA 2FFYA 4Y3IA 2Y2IA 4NETA 1JTGA 4NG2A 3C4PA 5DF8A 3QNCA 3OPLA 4S2NC 4QHCA 2ZQCA 4MMNA 5KIZA 1I5QA 3CAXA 4R4SA 1YKDA 3TRCA 1XX2A 2QJ5A 3LIAA 4HI4A 1GSVA 1PIOA 2HZ5A 2XEPA 2J3TD 1U60A 5FQMA 3T12B 3N8LA 1PI5A 2VV8A 1PW8A 3KYEA 1XGJA 4QPRA 3BY9A 3UE0A 3ZG8B 2WAEA 3A0RA 1NLYA 4I5SA 3NIAA 3NBLA 2GZAA 5GLDA 3UMDA 1DJBA 3SS5A 3LIDA 2EX9A 2Y2OA 4LLOB 4GJ4A 2W3HA 2L1MA 4WZ5C 2XROA 4JGOA 2Y2HA 5DVAA 3T50A 1NYMA 3TSGA 2P7JA 3U2AA 2XDMA 5L07A 3LI8A 1TS0A 3T1RA 2PR6A 2XD5A 1MKMA 1Y28A 3T4JA 3Q1FA 4O7DA 4JLFA 3IF6B 3O87A 2VGLS 3IXGA 3P09A 3MMHA 2Y2LA 2IWDA 2XQZA 1OMEA 1UWNX 3UE3A 4OONA 5F68A 3WS1A 5HW3A 4HESA 1XGIA 3IH9A 1EROA 3LIBA 4OOYA 4P0MA 3I7JA 4WUJA 4WELA 2GX5A 2A2LA 2H10A 3IX8A 5CHUA 4ZTKA 1STZA 3SH9A 2Y2JA 5FEFA 4L9FA 3BRMA 2WZZA 2Q9NA 5FATA 3VFHA 3ZHHA 3SS3A 3PAGA 5HDSA 2JC7A 2VGKA 4KQQA 5L09A 2V20A 3A3IA 5TR7A 2WUQA 4X53A 2FZ0A 1OTAA 4JXSA 3IH8A 4KQRA 2VV7A 1G6AA 4KZAA 4QY5A 4FH4A 1SCWA 1BLCA 5G18A 1T1AA 3IS2B 1CEFA 3VOZA 2ZLYA 1MXOA 3H82A 3CITA 1FILA 3ZVTA 3B47A 2RCXA 4HBTA 1WA9A 1L3LA 4QU3A 4GB7A 3C38A 1K0KA 3A0VA 1K57A 2WKEA 3VSLA 3UY6A 4Y7PA 1XA1A 5K5BA 1ES3A 5MC7A 4ZDXA 2JE5A 2PU2A 1L2SA 3PR6A 4EQIA 1JWVA 3PTEA 1ES5A 3BQAA 4OLGA 2QMIA 3H9WA 1CEGA 4OPQA 4P6ZM 3BFFA 5HAPA 3DAVA 4QB8A 4GS9A 5CTNA 3UPNA 2W27A 4O01A 2WGWA 4P87A 3UB6A 3SOIA 1PZOA 4NXFA 3T1QB 4JGRA 4X68A 4NK3A 2WZXA 2ZQAA 4R1GA 2Z6DA 1BSGA 4EBNA 2G2WA 1W8YA 1XA7A 4HP9A 2RL3A 4GDBA 2ZC5B 5EUAA 3UE6A 2W1TA 1YMSA 4ZBEA 4RQ9A 1AWIA 2WK0A 3OBFA 1HZOA 2X71A 2B5RA 1EI5A 5CEDA 5L10A 1ES2A 3SW1A 2Y2QA 4AFIA 4I3AA 3MJQA 4CQHA 4S2MA 3ZG0A 4LENA 3U4LP 3HLBA 5A91A 3LCEA 4N9KA 1K56A 1XXMA 4XT2A 4M3KA 1ACFA 4LGWA 2P9VA 1BLHA 4NXGA 1HD8A 2ZC4B 4WEKA 4Q0JA 4Q8IA 4Y0TA 2JKRI 4OPZA 1OJGA 2W3GA 1BUEA 4DDSA 2A3UA 5A90A 3F1PA 4G3KA 3ZVWA 4GCZA 5FQJA 3JYIA 4HIAA 1ALQA 2VEAA 3CPTB 4UA9A 1SZVA 3T1XA 5GHXA 2XK1A 3MSHA 5HWTA 4ID4A 4WZ4A 4S2NA 1M6KA 3NCKA 4EQ1A 4OKPA 4Y17A 2V2FF 1ODVA 4X55A 3E0YA 2Y2NA 4GLQA 3VP1A 4OQIA 3CG5A 4LV3A 3WWXA 4R38A 2IA2A 1L0EA 3VP0A 3ISGA 4KG5A 4N1HA 3WS4A 3BFDA 2ZM8A 1OTDA 3NI9A 4K91A 1FR6A 4WZ5A 1PWGA 2HPBA 1D06A 2XLNA 3PYPA 3HL9A 2WGVA 1F9IA 4HBUA 5GLAA 3NC8A 2WKRA 3EOIA 1K56D 1MPLA 4P6ZS 3BYDA 3UB8A 4KZ6A 3HUOA 3GDIA 3NECA 5FI7A 3UDXA 3UE1A 4MBHA 1FSYA 4IEDA 4N9LA 1CI8A 4GW9A 2X01A 1FR1A 1EWZA 4QJGA 5FAOA 1K4EA 2VA0A 1PNEA 3NDGA 2J9OA 4B4ZA 4PKYG 3N8RA 3C5AA 3LYXA 2MJ6A 3G31A 3T4LA 3D3OA 2FH5A 4I38A 1FSWA 2Y91A 4MDZA 1IYSA 3AGFA 5FQ9A 4UEYA 3QP6A 4CLCD 2WKIA 3VE3A 1MWUA 2WGIA 4E3KA 3VV4A 2Y2PA 4LRYC 5EPHA 3WRZA 5F82A 3DBAA 1MWRA 3T4SA 3PXPA 3IF5A 1BLSA 2ZMFA 4OQ0A 1YMXA 3VSKA 3CUEA 2I9VA 3JVVA 3QP8A 5FA7A 4QD4A 1LL8A 3ZG7B 4MCWA 1W63M 5HAIA 1K4FA 5M19A 4QWOA 3LR5A 1S1YA 4ARZA 4PMAA 3LY4A 3IXBA 2AVXA 4DJ2A 3HLWA 5DFYA 1JWPA 2OLUA 4X25A 2W3FA 4EERA 4C75A 4S2PA 3R7WB 3DTMA 4Z9QA 3E4QA 2B18A 2HDUA 1NJ4A 4M4XA 1MY8A 2VKSA 3IT9A 1X0OA 3A3DA 3NOPC 2ZMAA 3IF6C 2VGLM 2JKFA 3A3FA 3F1OA 1RGYA 2GNXA 1DY6A 4JF5A 4L0LA 2OAQ1 2ZC7A 1VHMA 4E3NA 1ESIA 4EESA 5HWWA 4GN2A 5J8XA 5E43A 4DE1A 1PI4A 4YINA 4IHQA 5CECA 2ZC6B 1CQAA 4GD8A 1H0MA 3LUQA 1VM1A 4KZ3A 2NUTC 4MN6A 4WLAA 4GZBA 4E3MA 4OLDA 4JF4A 1XFQA 4KZ9A 2H28A 4HH2A 1MBLA 3W2ZA 4BBUA 3FPWA 3V39A 5FEGA 3NJAA 5FQKA 1JWZA 3BFCA 4LCLA 4BJPA 5F83A 4H6JA 5F1GA 4R23A 5CGXA 1W79A 5FAQA 1DP6A 5AJGA 1F98A 4JXWA 4RVAA 2W3DA 4U3TA 3G34A 2Y2KA 1N9NA 1G6OA 2DCFA 4EWFA 1I2WA 3MS6A 5LBRA 3BLMA 3LFVA 2WADA 1C3BA 3D4FA 4UA7A 4RX3A 1IFQA 5CHJA 4CJNA 3FG8A 4N92A 1GHMA 2A24A 4BENA 1YLJA 2O9AA 2EXBA 1CJFA 3DTKA 1NYYA 2P04A 5HDDA 1E3UD 4F94A 4O0PA 4E04A 4KZ4A 3D72A 2EXAA 2INWA 2A49A 3KO6A 1XJ6A 1LSWA 2EX8A 1T19A 1E4DA 4LRXC 2KX6A 5HAQA 1FQGA 2E8IA 4KQOA 3RXXA 3UB5P 4PKYA 3OPPA 1GHPA 1YLPA 3SH7A 4WMCD 3BY8A 2D01A 2O0YA 5EVIA 5I94A 2L0WA 3K2NA 2J3WA 1TDLA 1IYOA 4PM8A 1ZHHB 1PFLA 3Q07A 4RYEA 5FDSA 1Q2PA 4OQGA 5CGWA 3MBZA 3ZCZA 3IQAA 4FSFA 3BW6A 1VETA 1WE4A 1T18A 3H7WA 4QY6A 4R0QA 1D1JA 3T4TA 2H5SA 1F5MA 1AXBA 3P01A 5JYPA 4C6YA 1ZKJA 1SDEA 4DDYA 3RH8B 2Y55A 2JHEA 3DTIA 3OC2A 2JN7A 1JTDA 1G28A 4EU0A 2Z2LB 2G2UA 4NXEA 3GR2A 1GSWA 3EEHA 1VB6A 2EFXA 3OOVA 1KDWA 4BD1A 4BD0A 5IHVA 4JXGA 1Z6FA 4R6LA 3GVBA 3S7QA 4EBPA 4K0XA 3K3CA 2W3EA 4DXCA 2XH9A 4KZBA 2ACGA 3VOYA 2W1TB 5J3WA 1W7FA 1O7EA 4HOIA 1DRMA 4LFUA 4X1LA 3B3XA 5G4ZA 4HJ6A 3B42A 4HH3A 3CWFA 3S22A 1K54A 2EX6A 5AQBA 5FASA 3T1SA 3IXDA 4XT2B 1KGEA 2XGNA 2P9VB 1ZG4A 3BM6A 4MNRA 5M1AA 2QPNA 3OPHA 4P6BA 4MEZA 2KOIA 2HJEA 1SDNA 3F1PB 3UPPA 4JF6A 3M6HA 4JGQA 1S67L 1LI9A 1YAXA 1K6RA 1DJCA 5CXWA 1PWDA 1W5DA 4WF0A 1K55C 1N9LA 5GLCA 2OWJA 2PHYA 1FOFA 4WN5A 3HLCA 3OLOA 5E2HA 1PZPA 4F3LB 1G5UA 2V0UA 2W1RA 1Y54A 3TE8A 1TD5A 5DKKA 4E3LA 3GRJA 4KENB 2JKRM 2HP6A 3GSGA 2OV5A 5HZHA 4CLCB 4HP4A 4BQMA 3N6IA 1BULA 3FYZA 2BTFP 3IF6A 1MWSA 1IELA 3Q7ZA 4LV2A 3O3VA 1H8ZA 1PW1A 2V8FA 4EBLA 1OT6A 5CTMA 4HJ4A 2EX2A 3LY3A 2O9BA 3C2WA 1GCEA 2J3TC 3ICYA 1LI0A 5L8MA 3MZFA 1BT5A 2DMWA 1LSVA 4K0WA 2BLSA 4ZAMA 4EUVA 4E3IA 3OCLA 1CK3A 3IX4A 3D9YA 2QZ6A 2BASA 3HLDA 5EOOA 2H0TA 5F6AA 1PWCA 4FCFA 3BQ8A 4Y0UA 4GD6A 4PHTA 2WKHA 5A93A 5FAPA 1ERQA 5EVLA 1NRJA 4B93A 2XRNA 4UA6A 1HLUP 2ZC3B 5GL9A 3IBRA 1TS7A 1RCJA 2VZWA 4OP8A 1S66L 3IS2A 3TW8A 4IJGA 3ZG9B 3QNBA 2O99A 2B02A 4X56A 1M40A 1MKIA 4EW7A 1H8MA 2ZOHA 4OPRA 4HJ3A 3VP4A 3PBOA 3IWIA 1YLWA 3G2YA 2BG1A 1PRQA 1TVFA 2K7SA 2L4RA 4C3QA 1KGGA 2ZQ9A 2HDRA 3HCYA 1XJ3A 2PAVP 2ZQ7A 3CHWP 1ZG6A 2HP5A 2J7VA 2B95A 1LLBA 3P98A 2ZL1B 3QP2A 3ZG5A 1NXYA 3VMAA 3CZDA 3L7HA 3EEAA 3R4KA 4HY8A 5G4YA 4R4RA 1MWTA 3VP2A 3OZHA 4ARZB 4EUZA 4OPYA 1BZAA 4WYYA 3OCNA 5DF7A 3A3EA 2Y2GA 1EW0A
chains in the Genus database with same CATH topology
2XA7S 4EESA 3LI8A 5HWWA 1TS0A 4UQIM 2ZBBA 2PR6A 4YOFA 5TBMB 1MKMA 1Y28A 3T4JA 2KLIA 4IHQA 4ZRRA 5IU1A 2VGLS 3LUQA 2NUTC 4MN6A 4WLAA 1H3QA 1XFQA 4WEJA 3MMHA 3FC7A 3C30A 2H28A 4HH2A 1UWNX 2HV1A 5CX7A 4JGPA 3W2ZA 2VV6A 4BBUA 3FPWA 3UE3A 3EWKA 4L9EA 5F68A 3MXQA 4Z1WA 3NJAA 3LIBA 4WUJA 5DFXA 2LB5A 4WELA 2GX5A 2A2LA 3GECA 4BJPA 2V1AA 1V9YA 1JNUA 1STZA 1DP9A 4H6JA 2Y79A 4L9FA 2K2NA 1OTBA 3T4QA 1DP6A 1DP8A 3PBNA 5AJGA 5HDSA 1LSXA 1F98A 3VE4A 4PAUA 3G6OA 3ZQ5A 2W3DA 3IBJA 4II7A 2FZ0A 1N9NA 1OTAA 4Y5FA 3UMEA 3EQUA 3KYQA 1G6OA 2PDRA 3MF0A 2VV7A 5LBRA 4OOMA 4ETZA 3LFVA 1T1AA 3IS2B 1IFQA 3KSGA 4ETXA 3FG8A 3NOUC 2OOLA 5HDCA 2A24A 3PBTA 1XFNA 5J7EA 2O9AA 4MN7A 3H82A 2P04A 2J80A 3CITA 5HDDA 4O0PA 4E04A 3UB9A 3D72A 5IS1A 3LR3A 5A8BA 3EGDC 3B47A 4BMWA 5IT5A 2O9CA 2K31A 2INWA 3KO6A 1WA9A 4FOFA 1XJ6A 1LSWA 1T19A 4LRXC 2KX6A 4MN5A 4EEPA 3C8CA 3PBQA 5EFWA 4KQOA 3C38A 3HJIA 3A0VA 1BYWA 4PKYA 4F3LA 1XJ4A 2V0WA 5K5BA 5MC7A 3BY8A 2D01A 1OT9A 2O0YA 3MQQA 3RTYA 2HF6A 4K08A 4CLCA 2L0WA 5I5LA 3K2NA 2QWSA 3PR6A 2J3WA 1ZHHB 2OWHA 4BBTA 1S4RA 3BQAA 3KSHA 3KSIA 1T1BA 3H9WA 3A0SA 4P6ZM 3F1OB 4FSFA 3BW6A 4GS9A 1P97A 1T18A 3H7WA 3PHYA 3EQVA 2W0NA 2XSSA 2W27A 3NHQA 3JVUA 4O01A 1IOUA 3T4TA 1OTEA 1OPXA 3UB6A 1F5MA 2P08A 4NXFA 5DF9A 4UQIS 2VJWA 3H7WB 2G7UA 3CI6A 1S1ZA 4I3JA 4JGRA 3P01A 5FL3A 3MQOA 2M7UA 2PR5A 3ULFA 2Z6DA 3RH8B 2PT7A 2JHEA 3OC2A 2JN7A 1G28A 2LB9A 3CLOA 4EU0A 3LR4A 3T4OA 1MC0A 4NXEA 1GSWA 4HP9A 1TF1A 3E4OA 4ME4A 3EEHA 3NOTC 1VB6A 3T4KA 3OOVA 2ZOIA 3BWLA 3UE6A 2W1TA 1P9WA 3V67A 3F1NA 4RQ9A 3OBFA 3S7QA 4R6LA 4Y2FA 5TJJA 4NEED 4H6JB 3K3CA 4BWIA 3BJNA 2EWVA 2W3EA 2NUPC 2YKHA 4Q0HA 3S7NA 3SW1A 2YKFA 4WL9A 2W1TB 4AFIA 4I3AA 3MJQA 5J3WA 4EETB 3F1NB 4CQHA 4HOIA 1DRMA 2QYBA 3B33A 1P9RA 4XT2A 5G4ZA 4HJ6A 3B42A 1LT0A 4HH3A 2D02A 5KSHA 1ZTUA 4NXGA 3CWFA 2CMNA 4WEKA 4Q0JA 2Z6CA 2JKRI 1OJGA 2W3GA 2M7VA 4XT2B 3F1PA 3P7NA 4DN0A 1KOUA 4G3KA 1OJ5A 4G3WA 4GCZA 5HPIA 4NKPA 2KDKA 3E4PA 1UWPX 2A24B 2HJ9C 4HIAA 3H82B 2VEAA 2PD8A 3S7PA 4HQAA 5F69A 2KOIA 2HJEA 5HWTA 2WKQA 4BBVA 5HPFA 1YSQA 3F1PB 4JGQA 3RFBA 1S67L 3K3DA 1YAXA 4NXBA 4L9GA 1YSPA 3R7WA 4EQ1A 3KSFA 3PBRA 4LRZE 4WF0A 1N9LA 1ODVA 4LPZA 1T1CA 2OWJA 1S4SA 2PHYA 4CLCC 3E0YA 4WN5A 5HL6A 4GLQA 3O5YA 3OLOA 4F3LB 4GHIA 3LR0A 2V0UA 2W1RA 3TE8A 1TD5A 5DKKA 4EXOA 3FPVA 2XA7M 3VOLA 4R38A 3UB7A 2IA2A 2WKPA 2JKRM 4EEUA 2VLGA 3TJZC 2GJ3A 2PYPA 5HZHA 4CLCB 4HP4A 1OTDA 4GHIB 5TBMA 5DJUA 2JKTI 1D06A 2QJ7A 5HD3A 3PYPA 1F9IA 2WKRA 3EOIA 1OT6A 4HJ4A 4GS9B 5J4EA 4P6ZS 1XJ2A 2O9BA 3C2WA 2J3TC 3ICYA 3UB8A 3PBSA 5DJTA 5C5KA 3GDIA 5L8MA 3LICA 4B9OA 2DMWA 1LSVA 4Q0IA 4O8GA 2OAP1 2QKPA 4GW9A 4EUVA 2EA9A 5AVFA 3OCLA 1V9ZA 2VA0A 3LIEA 5AVEA 1D7EA 2BASA 4CLCE 2HGVA 4HHDA 4PKYG 1N9OA 5F6AA 2V1BA 2V9AA 3BQ8A 4G3VA 3LYXA 2R78A 4DJ3A 2Y8HA 4PHTA 2QHKA 2MJ6A 1NWZA 3KX0X 1NRJA 3T4LA 4B93A 3ZYTA 5HWVA 3D3OA 2FH5A 4I38A 3S7OA 1TS6A 2XRNA 2JKTM 4MDZA 1OTIA 3E98A 3KYZA 3IBRA 1TS8A 1TS7A 4R70A 2M1CA 2VX8A 4UEYA 2VZWA 3LI9A 1S66L 3IS2A 3LIFA 3TW8A 4CLCD 3VE3A 4IJGA 4IUHA 2O99A 3VV4A 5F5YA 4LRYC 2B02A 2PYRA 4KUOA 2EWWA 3DBAA 4KQDA 4EW7A 2ZMVA 1H8MA 1UGUA 2ZOHA 3T4SA 3PXPA 4HJ3A 4Y3IA 2ZMFA 3PBOA 1P0ZA 3CUEC 2L4RA 2K7SA 1MZUA 3CUEA 2I9VA 3HJKA 3JVVA 4I39A 3MQ0A 3HCYA 4MMNA 1XJ3A 1GSXA 1LL8A 3EGXC 4MCWA 5KIZA 2PD7A 1W63M 4YNRA 3CAXA 5HD5A 1YKDA 4OOLA 2QJ5A 3LIAA 3LR5A 4HI4A 1GSVA 4I3IA 3TRCA 1S1YA 4ARZA 2J3TD 4IUKA 4DJ2A 3MFXA 5DFYA 2W3FA 2VV8A 3EEAA 3R4KA 4EERA 4HY8A 4QPRA 4HNBA 4KUKA 3BY9A 5G4YA 4YWZA 3A0RA 3R7WB 1NLYA 4I5SA 5HSQA 4ARZB 3E4QA 2B18A 2GZAA 4DMZA 4R3AA 3UMDA 4M4XA 5DKLA 3LIDA 2VKSA 4LLOB 4GJ4A 2W3HA 2L1MA 2XROA 1X0OA 3NOPC 3MR0A 4JGOA 3OCNA 1NLZA 2VGLM 3T50A 3F1OA 2GNXA 4L0LA 2OAQ1 2P7JA 1VHMA 1EW0A 3U2AA 1W63Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EES A;  3LI8 A;  5HWW A;  1TS0 A;  2ZBB A;  2PR6 A;  5TBM B;  1Y28 A;  5IU1 A;  3LUQ A;  4MN6 A;  4WLA A;  1XFQ A;  3FC7 A;  2H28 A;  4HH2 A;  1UWN X;  2HV1 A;  4JGP A;  2VV6 A;  4BBU A;  3EWK A;  4L9E A;  5F68 A;  3MXQ A;  3NJA A;  3LIB A;  4WUJ A;  3GEC A;  2V1A A;  1V9Y A;  1JNU A;  1DP9 A;  4H6J A;  4L9F A;  1OTB A;  1DP6 A;  1DP8 A;  5HDS A;  1LSX A;  1F98 A;  3VE4 A;  3G6O A;  3ZQ5 A;  1N9N A;  1OTA A;  3UME A;  2PDR A;  2VV7 A;  1T1A A;  3IS2 B;  3FG8 A;  3NOU C;  2OOL A;  5HDC A;  2A24 A;  1XFN A;  5J7E A;  3H82 A;  2J80 A;  5HDD A;  4E04 A;  3UB9 A;  3D72 A;  5IS1 A;  5A8B A;  2INW A;  1WA9 A;  1XJ6 A;  1LSW A;  1T19 A;  4LRX C;  2KX6 A;  4MN5 A;  4EEP A;  3C8C A;  5EFW A;  3HJI A;  3A0V A;  1BYW A;  4PKY A;  4F3L A;  1XJ4 A;  2V0W A;  3BY8 A;  2D01 A;  1OT9 A;  3MQQ A;  3RTY A;  4K08 A;  2L0W A;  5I5L A;  2QWS A;  2OWH A;  4BBT A;  1S4R A;  1T1B A;  3H9W A;  3A0S A;  3F1O B;  4GS9 A;  1P97 A;  1T18 A;  3H7W A;  3PHY A;  2W0N A;  2W27 A;  3NHQ A;  1OTE A;  3UB6 A;  4NXF A;  3H7W B;  1S1Z A;  4I3J A;  4JGR A;  3MQO A;  2PR5 A;  3ULF A;  2Z6D A;  3RH8 B;  2JHE A;  2JN7 A;  1G28 A;  3CLO A;  4NXE A;  1GSW A;  4HP9 A;  3E4O A;  3EEH A;  3NOT C;  1VB6 A;  2ZOI A;  3BWL A;  3UE6 A;  3F1N A;  4RQ9 A;  4R6L A;  4H6J B;  3K3C A;  2YKH A;  3SW1 A;  2YKF A;  4WL9 A;  4I3A A;  3MJQ A;  5J3W A;  4EET B;  3F1N B;  4HOI A;  1DRM A;  3B33 A;  4XT2 A;  5G4Z A;  4HJ6 A;  4HH3 A;  1LT0 A;  2D02 A;  4NXG A;  3CWF A;  2CMN A;  2Z6C A;  1OJG A;  4XT2 B;  3F1P A;  3P7N A;  1KOU A;  1OJ5 A;  4GCZ A;  2KDK A;  3E4P A;  1UWP X;  2A24 B;  4HIA A;  3H82 B;  2VEA A;  2PD8 A;  4HQA A;  5F69 A;  5HWT A;  2WKQ A;  4BBV A;  3F1P B;  4JGQ A;  1S67 L;  3K3D A;  4NXB A;  4L9G A;  4EQ1 A;  4LRZ E;  4WF0 A;  1N9L A;  1ODV A;  4LPZ A;  1T1C A;  2OWJ A;  1S4S A;  2PHY A;  4WN5 A;  3OLO A;  4F3L B;  4GHI A;  2V0U A;  5DKK A;  4EXO A;  3VOL A;  4R38 A;  3UB7 A;  2WKP A;  4EEU A;  2VLG A;  2GJ3 A;  2PYP A;  5HZH A;  4HP4 A;  1OTD A;  4GHI B;  5TBM A;  5DJU A;  1D06 A;  2QJ7 A;  5HD3 A;  3PYP A;  1F9I A;  2WKR A;  1OT6 A;  4HJ4 A;  4GS9 B;  5J4E A;  1XJ2 A;  3C2W A;  3ICY A;  3UB8 A;  5DJT A;  3GDI A;  3LIC A;  4B9O A;  1LSV A;  2QKP A;  4GW9 A;  2EA9 A;  5AVF A;  1V9Z A;  3LIE A;  5AVE A;  1D7E A;  2BAS A;  4HHD A;  4PKY G;  1N9O A;  5F6A A;  2V1B A;  2V9A A;  3LYX A;  2R78 A;  4DJ3 A;  2QHK A;  1NWZ A;  3KX0 X;  5HWV A;  4I38 A;  1TS6 A;  1OTI A;  3IBR A;  1TS8 A;  1TS7 A;  4R70 A;  2M1C A;  3LI9 A;  1S66 L;  3IS2 A;  3LIF A;  3VE3 A;  5F5Y A;  4LRY C;  2B02 A;  2PYR A;  4KUO A;  4KQD A;  4EW7 A;  1UGU A;  2ZOH A;  4HJ3 A;  1P0Z A;  2L4R A;  2K7S A;  1MZU A;  2I9V A;  3HJK A;  4I39 A;  1XJ3 A;  1GSX A;  1LL8 A;  5KIZ A;  2PD7 A;  3CAX A;  5HD5 A;  2QJ5 A;  3LIA A;  4HI4 A;  4I3I A;  1GSV A;  1S1Y A;  4DJ2 A;  3MFX A;  2VV8 A;  4EER A;  4HY8 A;  4HNB A;  4KUK A;  3BY9 A;  5G4Y A;  4YWZ A;  3A0R A;  4I5S A;  5HSQ A;  3E4Q A;  4R3A A;  3UMD A;  4M4X A;  5DKL A;  3LID A;  4LLO B;  2L1M A;  1X0O A;  3NOP C;  3MR0 A;  4JGO A;  3T50 A;  3F1O A;  2P7J A;  1EW0 A; 
#chains in the Genus database with same CATH topology
 4X6T A;  2JKG A;  1XKZ A;  4UQI M;  2ZBB A;  4YOF A;  5TBM B;  2KLI A;  4MBK A;  5IU1 A;  1KGF A;  4P85 A;  5D3O A;  4E3J A;  5AQ7 A;  1H3Q A;  2HV1 A;  4OQH A;  3V50 A;  4Z1W A;  1N4O A;  3HBR A;  4XUZ A;  5U47 A;  3ZGA B;  5DFX A;  1V9Y A;  1F2K A;  5AQA A;  2XFT A;  3LEZ A;  5E2F A;  1NY0 A;  3HUM A;  3JPU A;  3DWK A;  2K2N A;  1OTB A;  3NY4 A;  3TOI A;  3PBN A;  1LSX A;  3G6O A;  3N7W A;  3IBJ A;  4II7 A;  5FQQ A;  3V3R A;  4Y5F A;  3EQU A;  5KSC A;  3MF0 A;  2Q9M A;  3FZC A;  1ZC2 A;  1LL5 A;  3NOU C;  2OOL A;  5EE8 A;  5HDC A;  4UHU A;  2EFU A;  3GQZ A;  3W4O A;  1XFN A;  4HEF A;  4MBF A;  3CPT A;  3ZFZ A;  3Q7V A;  1IYQ A;  4PPR A;  3EGD C;  4PM6 A;  1K25 A;  5IT5 A;  2O9C A;  1YLT A;  1DJA A;  1GA0 A;  5F1F A;  2PU4 A;  4MN5 A;  3PBQ A;  5EFW A;  2OLV A;  2FFF B;  1K57 C;  3IX3 A;  3HJI A;  3SZT A;  1BTL A;  1XJ4 A;  1ES4 A;  1O07 A;  2H0Y A;  4PM7 A;  1OT9 A;  4DE3 A;  3MQQ A;  2HF6 A;  4K08 A;  5I5L A;  3S1Y A;  3FWL A;  2OWH A;  4BBT A;  3KSH A;  3W4P A;  1T1B A;  4IBX A;  4E3O A;  3UNW A;  5EVI B;  5CGS A;  4FUW A;  4X69 A;  2ZQD A;  3PHY A;  3EQV A;  4B88 A;  4IVI A;  4LV1 A;  2XSS A;  3L9K A;  3JVU A;  3GTC A;  1OTE A;  3LEQ A;  1GA9 A;  1OPX A;  2P08 A;  5DF9 A;  1VET B;  4UQI S;  3TG9 A;  2VJW A;  3H7W B;  4I3J A;  5FL3 A;  2M7U A;  2PR5 A;  1G68 A;  2PT7 A;  1SKO A;  1YT4 A;  2C5W B;  3G4P A;  4Y0O A;  3T4O A;  3UN7 A;  3E4O A;  3NOT C;  1IEM A;  3BWL A;  1FCN A;  1P9W A;  1RP5 A;  3F1N A;  4GKU A;  4Y15 A;  4Y2F A;  4NEE D;  2UWX A;  5HL1 A;  4KG2 A;  2XR0 A;  1GHI A;  2EWV A;  4KZ8 A;  2YKH A;  2CC1 A;  3S7N A;  4WL9 A;  4GOG A;  4LCM A;  4MLL A;  2QYB A;  3B33 A;  1P9R A;  3RJU A;  5EVE A;  4KZ5 A;  1LT0 A;  5KSH A;  1ZTU A;  4S2I A;  4FTX A;  4JKT A;  2Z6C A;  2M7V A;  3HLF A;  4DN0 A;  3Q82 A;  1HTZ A;  3E4P A;  2HJ9 C;  3FV7 A;  3H82 B;  3S4X A;  4JBF A;  2ZM2 A;  2R9W A;  3IHB A;  4HQA A;  4BL2 A;  1J9M A;  1YPR A;  3DWZ A;  1YSQ A;  4R3B A;  3RFB A;  3NUL A;  5CER A;  2OSU A;  4L9G A;  1KVM A;  2JBF A;  3R7W A;  4DXB A;  3UDF A;  4LRZ E;  4D60 A;  3BFG A;  1T1C A;  3ZNY A;  4CLC C;  3C7V A;  3M2K A;  5HL6 A;  4D2O A;  2Z2M B;  5EV0 A;  4GHI A;  3LR0 A;  3QP4 A;  2XA7 M;  3VOL A;  4S2J A;  4OVD A;  3QP5 A;  3UB7 A;  1WYC A;  2WKP A;  4EEU A;  2VLG A;  2GJ3 A;  2PYP A;  5DJU A;  2JKT I;  1LL9 A;  4OH0 A;  3MZD A;  2DNS A;  1LHY A;  3Q81 A;  3UO9 A;  3LO7 A;  4GS9 B;  2J8Y A;  3VFF A;  1XJ2 A;  5DJT A;  3LIC A;  4B9O A;  3HLE A;  3OPR A;  2WGW B;  4Q0I A;  4O8G A;  2QKP A;  3PAE A;  1KVL A;  4E6W A;  2EA9 A;  4IVK A;  4PM5 A;  5AVF A;  1VQQ A;  1YLY A;  4CLC E;  2JCH A;  1CF0 A;  5GHZ A;  3BLS A;  2DRW A;  2V9A A;  1H8Y A;  1VEU A;  4BL3 A;  4DJ3 A;  2QHK A;  2PRF A;  1NWZ A;  3KX0 X;  3ZYT A;  1NZU A;  3S7O A;  1TS6 A;  2PBD P;  4FD8 A;  3BFE A;  3E98 A;  2J9P A;  3HRE A;  2M1C A;  1L0F A;  5EVI D;  4IUH A;  4B4X A;  4WM9 A;  3MXS A;  2PYR A;  3N8S A;  4EV4 A;  2ZMV A;  4YFM A;  5TGF A;  3ITA A;  1UGU A;  2Y59 A;  5TFQ A;  5CHM A;  4U0T A;  1P0Z A;  3CUE C;  2HP9 A;  1MZU A;  3HJK A;  4I39 A;  4RA7 A;  1YQS A;  4DE0 A;  1BLP A;  3MQ0 A;  1GSX A;  5HAR A;  3EGX C;  2PD7 A;  4YNR A;  3A3J A;  5HD5 A;  4JPM A;  4OOL A;  4I3I A;  2WAF A;  4DF6 A;  4IUK A;  3MFX A;  2XFS A;  3FKV A;  2C6W B;  2ZJ9 A;  4HNB A;  4KUK A;  1FCM A;  3RXW A;  4YWZ A;  3M2J A;  5HSQ A;  3GV9 A;  5DTT A;  3V3S A;  4DMZ A;  4R3A A;  4FH2 A;  2HDS A;  5DKL A;  3DTE A;  1Q2Q A;  3MKF A;  3MR0 A;  4Y13 A;  1NLZ A;  4GDN A;  3CJM A;  5FDH A;  4G3V A;  1W63 Q;  1IKG A;  2Y2M A;  2XA7 S;  3WS2 A;  3SS4 A;  1YLZ A;  3UPO A;  5FI2 A;  1J3W A;  3SH8 A;  4ZRR A;  3IHA A;  3O88 A;  3QP1 A;  3G30 A;  4DRT A;  1TDG A;  4S2K A;  1Y4O A;  4WEJ A;  3FC7 A;  3C30 A;  5CX7 A;  4JGP A;  3G2Z A;  1XP4 A;  2VV6 A;  3EWK A;  4L9E A;  3DW0 A;  3MXQ A;  1CI9 A;  1K6S A;  2LB5 A;  3WS5 A;  3GEC A;  2V1A A;  1JNU A;  1DP9 A;  1Z09 A;  4DKI A;  2Y79 A;  1K38 A;  1IYP A;  3VP3 A;  5KZH A;  4BLM A;  3IWO A;  2Y4A A;  3T4Q A;  1DP8 A;  1H5X A;  3VE4 A;  4PAU A;  3ZQ5 A;  1QME A;  1SKF A;  1ONH A;  1JVJ A;  4DE2 A;  3UME A;  3KYQ A;  4IBR A;  2XD1 A;  2PDR A;  1WYB A;  4OOM A;  4ETZ A;  3KSG A;  4ETX A;  5GHY A;  1KDS A;  3HUN A;  3PBT A;  4LV0 A;  5J7E A;  3E2L A;  4MN7 A;  3HLG A;  2J80 A;  3C7U A;  4KG6 A;  3UB9 A;  5FQI A;  3BEB A;  5IS1 A;  3LR3 A;  5A8B A;  4BMW A;  5HFO A;  1ESU A;  1W8Q A;  2K31 A;  1IKI A;  4FOF A;  1N9B A;  4EEP A;  3Q7V B;  2ZQ8 A;  3C8C A;  4E6X A;  5M18 A;  3G32 A;  3W8K A;  1BYW A;  2IWB A;  4F3L A;  2V1Z A;  3WRT A;  2V0W A;  5EOE A;  5EVI C;  3AGE A;  2E8J A;  5A92 A;  3RTY A;  4CLC A;  2QWS A;  3G35 A;  5AQ9 A;  4CPK A;  1S4R A;  3FKW A;  1S6R A;  3KSI A;  1L0D A;  3N4I A;  5DTK A;  5EEC A;  5FI6 A;  2WYX A;  3A0S A;  3F1O B;  3E2K A;  4RX2 A;  2HDQ A;  3AGD A;  1P97 A;  3QHY A;  2W0N A;  5DTS A;  3NHQ A;  5EM0 A;  1IOU A;  4JXV A;  4ZJ1 A;  1ONG A;  2G7U A;  1S1Z A;  3CI6 A;  3MQO A;  3ULF A;  1QMF A;  4GNU A;  3W4Q A;  5CEB A;  2ZD8 A;  3WS0 A;  2LB9 A;  3CLO A;  2VGJ A;  3LR4 A;  4XUX A;  1MC0 A;  4ME4 A;  1NZO A;  1TF1 A;  3T4K A;  2ZOI A;  3V67 A;  1SKO B;  2V8C A;  4S2O A;  5TJJ A;  3ZNT A;  4H6J B;  1KE3 A;  4BWI A;  3BJN A;  2NUP C;  1TEM A;  2XF3 A;  4Q0H A;  3CMZ A;  4S2L A;  2YKF A;  4EET B;  3MZE A;  3F1N B;  3BEC A;  1A0K A;  5KMW A;  1ERM A;  4U0X A;  3HVF A;  3IWQ A;  2D02 A;  3V5M A;  1K54 C;  3IXH A;  2CMN A;  3GMW A;  5CRF A;  4A5R A;  5GLB A;  3P7N A;  3UDI A;  1KOU A;  1OJ5 A;  4G3W A;  1E25 A;  5HPI A;  4NKP A;  2KDK A;  4H8R A;  1UWP X;  2A24 B;  1RGZ A;  1XPB A;  3MKE A;  3O86 A;  2ZL1 A;  2PD8 A;  3S7P A;  5F69 A;  1FIK A;  2WKQ A;  4KZ7 A;  4BBV A;  5HPF A;  5E2E A;  3MFD A;  1S0W A;  4XXR A;  3K3D A;  4NXB A;  1YSP A;  3KSF A;  1KE4 A;  3NDE A;  3PBR A;  4LPZ A;  1S4S A;  4ZJ3 A;  1K55 A;  4R3J A;  3O5Y A;  4ZJ2 A;  3M6B A;  2R9X A;  4EXO A;  3FPV A;  2X02 A;  3MXR A;  3TJZ C;  1L0G A;  2Q0O A;  4GHI B;  5TBM A;  2QJ7 A;  3LGO A;  5HD3 A;  4N1X A;  1FCO A;  1E3U A;  5EM1 A;  5JYO A;  4UAA A;  5J4E A;  2UV0 E;  3C4O A;  3PBS A;  5C5K A;  3ZDJ A;  4ESP A;  4X1M A;  2OAP 1;  4PM9 A;  1V9Z A;  1YM1 A;  3LIE A;  2ZM0 A;  5AVE A;  1D7E A;  3ITB A;  1HVB A;  2HGV A;  4HHD A;  2IWC A;  1N9O A;  2V1B A;  1KE0 A;  4WMC A;  4OP5 A;  2R78 A;  2Y8H A;  5FSR A;  2VK3 A;  5HWV A;  1SHV A;  2I72 A;  4WBG A;  2JKT M;  1OTI A;  1VEU B;  3KYZ A;  2GDN A;  1TS8 A;  5L2F A;  4R70 A;  5BOH A;  2VX8 A;  3LI9 A;  3LIF A;  1NRF A;  1PYY A;  5HX9 A;  2PBY A;  5F5Y A;  4KUO A;  2EWW A;  1I2S A;  2P74 A;  4KQD A;  5E2G A;  2FFY A;  4Y3I A;  2Y2I A;  4NET A;  1JTG A;  4NG2 A;  3C4P A;  5DF8 A;  3QNC A;  3OPL A;  4S2N C;  4QHC A;  2ZQC A;  4MMN A;  5KIZ A;  1I5Q A;  3CAX A;  4R4S A;  1YKD A;  3TRC A;  1XX2 A;  2QJ5 A;  3LIA A;  4HI4 A;  1GSV A;  1PIO A;  2HZ5 A;  2XEP A;  2J3T D;  1U60 A;  5FQM A;  3T12 B;  3N8L A;  1PI5 A;  2VV8 A;  1PW8 A;  3KYE A;  1XGJ A;  4QPR A;  3BY9 A;  3UE0 A;  3ZG8 B;  2WAE A;  3A0R A;  1NLY A;  4I5S A;  3NIA A;  3NBL A;  2GZA A;  5GLD A;  3UMD A;  1DJB A;  3SS5 A;  3LID A;  2EX9 A;  2Y2O A;  4LLO B;  4GJ4 A;  2W3H A;  2L1M A;  4WZ5 C;  2XRO A;  4JGO A;  2Y2H A;  5DVA A;  3T50 A;  1NYM A;  3TSG A;  2P7J A;  3U2A A;  2XDM A;  5L07 A;  3LI8 A;  1TS0 A;  3T1R A;  2PR6 A;  2XD5 A;  1MKM A;  1Y28 A;  3T4J A;  3Q1F A;  4O7D A;  4JLF A;  3IF6 B;  3O87 A;  2VGL S;  3IXG A;  3P09 A;  3MMH A;  2Y2L A;  2IWD A;  2XQZ A;  1OME A;  1UWN X;  3UE3 A;  4OON A;  5F68 A;  3WS1 A;  5HW3 A;  4HES A;  1XGI A;  3IH9 A;  1ERO A;  3LIB A;  4OOY A;  4P0M A;  3I7J A;  4WUJ A;  4WEL A;  2GX5 A;  2A2L A;  2H10 A;  3IX8 A;  5CHU A;  4ZTK A;  1STZ A;  3SH9 A;  2Y2J A;  5FEF A;  4L9F A;  3BRM A;  2WZZ A;  2Q9N A;  5FAT A;  3VFH A;  3ZHH A;  3SS3 A;  3PAG A;  5HDS A;  2JC7 A;  2VGK A;  4KQQ A;  5L09 A;  2V20 A;  3A3I A;  5TR7 A;  2WUQ A;  4X53 A;  2FZ0 A;  1OTA A;  4JXS A;  3IH8 A;  4KQR A;  2VV7 A;  1G6A A;  4KZA A;  4QY5 A;  4FH4 A;  1SCW A;  1BLC A;  5G18 A;  1T1A A;  3IS2 B;  1CEF A;  3VOZ A;  2ZLY A;  1MXO A;  3H82 A;  3CIT A;  1FIL A;  3ZVT A;  3B47 A;  2RCX A;  4HBT A;  1WA9 A;  1L3L A;  4QU3 A;  4GB7 A;  3C38 A;  1K0K A;  3A0V A;  1K57 A;  2WKE A;  3VSL A;  3UY6 A;  4Y7P A;  1XA1 A;  5K5B A;  1ES3 A;  5MC7 A;  4ZDX A;  2JE5 A;  2PU2 A;  1L2S A;  3PR6 A;  4EQI A;  1JWV A;  3PTE A;  1ES5 A;  3BQA A;  4OLG A;  2QMI A;  3H9W A;  1CEG A;  4OPQ A;  4P6Z M;  3BFF A;  5HAP A;  3DAV A;  4QB8 A;  4GS9 A;  5CTN A;  3UPN A;  2W27 A;  4O01 A;  2WGW A;  4P87 A;  3UB6 A;  3SOI A;  1PZO A;  4NXF A;  3T1Q B;  4JGR A;  4X68 A;  4NK3 A;  2WZX A;  2ZQA A;  4R1G A;  2Z6D A;  1BSG A;  4EBN A;  2G2W A;  1W8Y A;  1XA7 A;  4HP9 A;  2RL3 A;  4GDB A;  2ZC5 B;  5EUA A;  3UE6 A;  2W1T A;  1YMS A;  4ZBE A;  4RQ9 A;  1AWI A;  2WK0 A;  3OBF A;  1HZO A;  2X71 A;  2B5R A;  1EI5 A;  5CED A;  5L10 A;  1ES2 A;  3SW1 A;  2Y2Q A;  4AFI A;  4I3A A;  3MJQ A;  4CQH A;  4S2M A;  3ZG0 A;  4LEN A;  3U4L P;  3HLB A;  5A91 A;  3LCE A;  4N9K A;  1K56 A;  1XXM A;  4XT2 A;  4M3K A;  1ACF A;  4LGW A;  2P9V A;  1BLH A;  4NXG A;  1HD8 A;  2ZC4 B;  4WEK A;  4Q0J A;  4Q8I A;  4Y0T A;  2JKR I;  4OPZ A;  1OJG A;  2W3G A;  1BUE A;  4DDS A;  2A3U A;  5A90 A;  3F1P A;  4G3K A;  3ZVW A;  4GCZ A;  5FQJ A;  3JYI A;  4HIA A;  1ALQ A;  2VEA A;  3CPT B;  4UA9 A;  1SZV A;  3T1X A;  5GHX A;  2XK1 A;  3MSH A;  5HWT A;  4ID4 A;  4WZ4 A;  4S2N A;  1M6K A;  3NCK A;  4EQ1 A;  4OKP A;  4Y17 A;  2V2F F;  1ODV A;  4X55 A;  3E0Y A;  2Y2N A;  4GLQ A;  3VP1 A;  4OQI A;  3CG5 A;  4LV3 A;  3WWX A;  4R38 A;  2IA2 A;  1L0E A;  3VP0 A;  3ISG A;  4KG5 A;  4N1H A;  3WS4 A;  3BFD A;  2ZM8 A;  1OTD A;  3NI9 A;  4K91 A;  1FR6 A;  4WZ5 A;  1PWG A;  2HPB A;  1D06 A;  2XLN A;  3PYP A;  3HL9 A;  2WGV A;  1F9I A;  4HBU A;  5GLA A;  3NC8 A;  2WKR A;  3EOI A;  1K56 D;  1MPL A;  4P6Z S;  3BYD A;  3UB8 A;  4KZ6 A;  3HUO A;  3GDI A;  3NEC A;  5FI7 A;  3UDX A;  3UE1 A;  4MBH A;  1FSY A;  4IED A;  4N9L A;  1CI8 A;  4GW9 A;  2X01 A;  1FR1 A;  1EWZ A;  4QJG A;  5FAO A;  1K4E A;  2VA0 A;  1PNE A;  3NDG A;  2J9O A;  4B4Z A;  4PKY G;  3N8R A;  3C5A A;  3LYX A;  2MJ6 A;  3G31 A;  3T4L A;  3D3O A;  2FH5 A;  4I38 A;  1FSW A;  2Y91 A;  4MDZ A;  1IYS A;  3AGF A;  5FQ9 A;  4UEY A;  3QP6 A;  4CLC D;  2WKI A;  3VE3 A;  1MWU A;  2WGI A;  4E3K A;  3VV4 A;  2Y2P A;  4LRY C;  5EPH A;  3WRZ A;  5F82 A;  3DBA A;  1MWR A;  3T4S A;  3PXP A;  3IF5 A;  1BLS A;  2ZMF A;  4OQ0 A;  1YMX A;  3VSK A;  3CUE A;  2I9V A;  3JVV A;  3QP8 A;  5FA7 A;  4QD4 A;  1LL8 A;  3ZG7 B;  4MCW A;  1W63 M;  5HAI A;  1K4F A;  5M19 A;  4QWO A;  3LR5 A;  1S1Y A;  4ARZ A;  4PMA A;  3LY4 A;  3IXB A;  2AVX A;  4DJ2 A;  3HLW A;  5DFY A;  1JWP A;  2OLU A;  4X25 A;  2W3F A;  4EER A;  4C75 A;  4S2P A;  3R7W B;  3DTM A;  4Z9Q A;  3E4Q A;  2B18 A;  2HDU A;  1NJ4 A;  4M4X A;  1MY8 A;  2VKS A;  3IT9 A;  1X0O A;  3A3D A;  3NOP C;  2ZMA A;  3IF6 C;  2VGL M;  2JKF A;  3A3F A;  3F1O A;  1RGY A;  2GNX A;  1DY6 A;  4JF5 A;  4L0L A;  2OAQ 1;  2ZC7 A;  1VHM A;  4E3N A;  1ESI A;  4EES A;  5HWW A;  4GN2 A;  5J8X A;  5E43 A;  4DE1 A;  1PI4 A;  4YIN A;  4IHQ A;  5CEC A;  2ZC6 B;  1CQA A;  4GD8 A;  1H0M A;  3LUQ A;  1VM1 A;  4KZ3 A;  2NUT C;  4MN6 A;  4WLA A;  4GZB A;  4E3M A;  4OLD A;  4JF4 A;  1XFQ A;  4KZ9 A;  2H28 A;  4HH2 A;  1MBL A;  3W2Z A;  4BBU A;  3FPW A;  3V39 A;  5FEG A;  3NJA A;  5FQK A;  1JWZ A;  3BFC A;  4LCL A;  4BJP A;  5F83 A;  4H6J A;  5F1G A;  4R23 A;  5CGX A;  1W79 A;  5FAQ A;  1DP6 A;  5AJG A;  1F98 A;  4JXW A;  4RVA A;  2W3D A;  4U3T A;  3G34 A;  2Y2K A;  1N9N A;  1G6O A;  2DCF A;  4EWF A;  1I2W A;  3MS6 A;  5LBR A;  3BLM A;  3LFV A;  2WAD A;  1C3B A;  3D4F A;  4UA7 A;  4RX3 A;  1IFQ A;  5CHJ A;  4CJN A;  3FG8 A;  4N92 A;  1GHM A;  2A24 A;  4BEN A;  1YLJ A;  2O9A A;  2EXB A;  1CJF A;  3DTK A;  1NYY A;  2P04 A;  5HDD A;  1E3U D;  4F94 A;  4O0P A;  4E04 A;  4KZ4 A;  3D72 A;  2EXA A;  2INW A;  2A49 A;  3KO6 A;  1XJ6 A;  1LSW A;  2EX8 A;  1T19 A;  1E4D A;  4LRX C;  2KX6 A;  5HAQ A;  1FQG A;  2E8I A;  4KQO A;  3RXX A;  3UB5 P;  4PKY A;  3OPP A;  1GHP A;  1YLP A;  3SH7 A;  4WMC D;  3BY8 A;  2D01 A;  2O0Y A;  5EVI A;  5I94 A;  2L0W A;  3K2N A;  2J3W A;  1TDL A;  1IYO A;  4PM8 A;  1ZHH B;  1PFL A;  3Q07 A;  4RYE A;  5FDS A;  1Q2P A;  4OQG A;  5CGW A;  3MBZ A;  3ZCZ A;  3IQA A;  4FSF A;  3BW6 A;  1VET A;  1WE4 A;  1T18 A;  3H7W A;  4QY6 A;  4R0Q A;  1D1J A;  3T4T A;  2H5S A;  1F5M A;  1AXB A;  3P01 A;  5JYP A;  4C6Y A;  1ZKJ A;  1SDE A;  4DDY A;  3RH8 B;  2Y55 A;  2JHE A;  3DTI A;  3OC2 A;  2JN7 A;  1JTD A;  1G28 A;  4EU0 A;  2Z2L B;  2G2U A;  4NXE A;  3GR2 A;  1GSW A;  3EEH A;  1VB6 A;  2EFX A;  3OOV A;  1KDW A;  4BD1 A;  4BD0 A;  5IHV A;  4JXG A;  1Z6F A;  4R6L A;  3GVB A;  3S7Q A;  4EBP A;  4K0X A;  3K3C A;  2W3E A;  4DXC A;  2XH9 A;  4KZB A;  2ACG A;  3VOY A;  2W1T B;  5J3W A;  1W7F A;  1O7E A;  4HOI A;  1DRM A;  4LFU A;  4X1L A;  3B3X A;  5G4Z A;  4HJ6 A;  3B42 A;  4HH3 A;  3CWF A;  3S22 A;  1K54 A;  2EX6 A;  5AQB A;  5FAS A;  3T1S A;  3IXD A;  4XT2 B;  1KGE A;  2XGN A;  2P9V B;  1ZG4 A;  3BM6 A;  4MNR A;  5M1A A;  2QPN A;  3OPH A;  4P6B A;  4MEZ A;  2KOI A;  2HJE A;  1SDN A;  3F1P B;  3UPP A;  4JF6 A;  3M6H A;  4JGQ A;  1S67 L;  1LI9 A;  1YAX A;  1K6R A;  1DJC A;  5CXW A;  1PWD A;  1W5D A;  4WF0 A;  1K55 C;  1N9L A;  5GLC A;  2OWJ A;  2PHY A;  1FOF A;  4WN5 A;  3HLC A;  3OLO A;  5E2H A;  1PZP A;  4F3L B;  1G5U A;  2V0U A;  2W1R A;  1Y54 A;  3TE8 A;  1TD5 A;  5DKK A;  4E3L A;  3GRJ A;  4KEN B;  2JKR M;  2HP6 A;  3GSG A;  2OV5 A;  5HZH A;  4CLC B;  4HP4 A;  4BQM A;  3N6I A;  1BUL A;  3FYZ A;  2BTF P;  3IF6 A;  1MWS A;  1IEL A;  3Q7Z A;  4LV2 A;  3O3V A;  1H8Z A;  1PW1 A;  2V8F A;  4EBL A;  1OT6 A;  5CTM A;  4HJ4 A;  2EX2 A;  3LY3 A;  2O9B A;  3C2W A;  1GCE A;  2J3T C;  3ICY A;  1LI0 A;  5L8M A;  3MZF A;  1BT5 A;  2DMW A;  1LSV A;  4K0W A;  2BLS A;  4ZAM A;  4EUV A;  4E3I A;  3OCL A;  1CK3 A;  3IX4 A;  3D9Y A;  2QZ6 A;  2BAS A;  3HLD A;  5EOO A;  2H0T A;  5F6A A;  1PWC A;  4FCF A;  3BQ8 A;  4Y0U A;  4GD6 A;  4PHT A;  2WKH A;  5A93 A;  5FAP A;  1ERQ A;  5EVL A;  1NRJ A;  4B93 A;  2XRN A;  4UA6 A;  1HLU P;  2ZC3 B;  5GL9 A;  3IBR A;  1TS7 A;  1RCJ A;  2VZW A;  4OP8 A;  1S66 L;  3IS2 A;  3TW8 A;  4IJG A;  3ZG9 B;  3QNB A;  2O99 A;  2B02 A;  4X56 A;  1M40 A;  1MKI A;  4EW7 A;  1H8M A;  2ZOH A;  4OPR A;  4HJ3 A;  3VP4 A;  3PBO A;  3IWI A;  1YLW A;  3G2Y A;  2BG1 A;  1PRQ A;  1TVF A;  2K7S A;  2L4R A;  4C3Q A;  1KGG A;  2ZQ9 A;  2HDR A;  3HCY A;  1XJ3 A;  2PAV P;  2ZQ7 A;  3CHW P;  1ZG6 A;  2HP5 A;  2J7V A;  2B95 A;  1LLB A;  3P98 A;  2ZL1 B;  3QP2 A;  3ZG5 A;  1NXY A;  3VMA A;  3CZD A;  3L7H A;  3EEA A;  3R4K A;  4HY8 A;  5G4Y A;  4R4R A;  1MWT A;  3VP2 A;  3OZH A;  4ARZ B;  4EUZ A;  4OPY A;  1BZA A;  4WYY A;  3OCN A;  5DF7 A;  3A3E A;  2Y2G A;  1EW0 A; 
#chains in the Genus database with same CATH homology
 2XA7 S;  4EES A;  3LI8 A;  5HWW A;  1TS0 A;  4UQI M;  2ZBB A;  2PR6 A;  4YOF A;  5TBM B;  1MKM A;  1Y28 A;  3T4J A;  2KLI A;  4IHQ A;  4ZRR A;  5IU1 A;  2VGL S;  3LUQ A;  2NUT C;  4MN6 A;  4WLA A;  1H3Q A;  1XFQ A;  4WEJ A;  3MMH A;  3FC7 A;  3C30 A;  2H28 A;  4HH2 A;  1UWN X;  2HV1 A;  5CX7 A;  4JGP A;  3W2Z A;  2VV6 A;  4BBU A;  3FPW A;  3UE3 A;  3EWK A;  4L9E A;  5F68 A;  3MXQ A;  4Z1W A;  3NJA A;  3LIB A;  4WUJ A;  5DFX A;  2LB5 A;  4WEL A;  2GX5 A;  2A2L A;  3GEC A;  4BJP A;  2V1A A;  1V9Y A;  1JNU A;  1STZ A;  1DP9 A;  4H6J A;  2Y79 A;  4L9F A;  2K2N A;  1OTB A;  3T4Q A;  1DP6 A;  1DP8 A;  3PBN A;  5AJG A;  5HDS A;  1LSX A;  1F98 A;  3VE4 A;  4PAU A;  3G6O A;  3ZQ5 A;  2W3D A;  3IBJ A;  4II7 A;  2FZ0 A;  1N9N A;  1OTA A;  4Y5F A;  3UME A;  3EQU A;  3KYQ A;  1G6O A;  2PDR A;  3MF0 A;  2VV7 A;  5LBR A;  4OOM A;  4ETZ A;  3LFV A;  1T1A A;  3IS2 B;  1IFQ A;  3KSG A;  4ETX A;  3FG8 A;  3NOU C;  2OOL A;  5HDC A;  2A24 A;  3PBT A;  1XFN A;  5J7E A;  2O9A A;  4MN7 A;  3H82 A;  2P04 A;  2J80 A;  3CIT A;  5HDD A;  4O0P A;  4E04 A;  3UB9 A;  3D72 A;  5IS1 A;  3LR3 A;  5A8B A;  3EGD C;  3B47 A;  4BMW A;  5IT5 A;  2O9C A;  2K31 A;  2INW A;  3KO6 A;  1WA9 A;  4FOF A;  1XJ6 A;  1LSW A;  1T19 A;  4LRX C;  2KX6 A;  4MN5 A;  4EEP A;  3C8C A;  3PBQ A;  5EFW A;  4KQO A;  3C38 A;  3HJI A;  3A0V A;  1BYW A;  4PKY A;  4F3L A;  1XJ4 A;  2V0W A;  5K5B A;  5MC7 A;  3BY8 A;  2D01 A;  1OT9 A;  2O0Y A;  3MQQ A;  3RTY A;  2HF6 A;  4K08 A;  4CLC A;  2L0W A;  5I5L A;  3K2N A;  2QWS A;  3PR6 A;  2J3W A;  1ZHH B;  2OWH A;  4BBT A;  1S4R A;  3BQA A;  3KSH A;  3KSI A;  1T1B A;  3H9W A;  3A0S A;  4P6Z M;  3F1O B;  4FSF A;  3BW6 A;  4GS9 A;  1P97 A;  1T18 A;  3H7W A;  3PHY A;  3EQV A;  2W0N A;  2XSS A;  2W27 A;  3NHQ A;  3JVU A;  4O01 A;  1IOU A;  3T4T A;  1OTE A;  1OPX A;  3UB6 A;  1F5M A;  2P08 A;  4NXF A;  5DF9 A;  4UQI S;  2VJW A;  3H7W B;  2G7U A;  3CI6 A;  1S1Z A;  4I3J A;  4JGR A;  3P01 A;  5FL3 A;  3MQO A;  2M7U A;  2PR5 A;  3ULF A;  2Z6D A;  3RH8 B;  2PT7 A;  2JHE A;  3OC2 A;  2JN7 A;  1G28 A;  2LB9 A;  3CLO A;  4EU0 A;  3LR4 A;  3T4O A;  1MC0 A;  4NXE A;  1GSW A;  4HP9 A;  1TF1 A;  3E4O A;  4ME4 A;  3EEH A;  3NOT C;  1VB6 A;  3T4K A;  3OOV A;  2ZOI A;  3BWL A;  3UE6 A;  2W1T A;  1P9W A;  3V67 A;  3F1N A;  4RQ9 A;  3OBF A;  3S7Q A;  4R6L A;  4Y2F A;  5TJJ A;  4NEE D;  4H6J B;  3K3C A;  4BWI A;  3BJN A;  2EWV A;  2W3E A;  2NUP C;  2YKH A;  4Q0H A;  3S7N A;  3SW1 A;  2YKF A;  4WL9 A;  2W1T B;  4AFI A;  4I3A A;  3MJQ A;  5J3W A;  4EET B;  3F1N B;  4CQH A;  4HOI A;  1DRM A;  2QYB A;  3B33 A;  1P9R A;  4XT2 A;  5G4Z A;  4HJ6 A;  3B42 A;  1LT0 A;  4HH3 A;  2D02 A;  5KSH A;  1ZTU A;  4NXG A;  3CWF A;  2CMN A;  4WEK A;  4Q0J A;  2Z6C A;  2JKR I;  1OJG A;  2W3G A;  2M7V A;  4XT2 B;  3F1P A;  3P7N A;  4DN0 A;  1KOU A;  4G3K A;  1OJ5 A;  4G3W A;  4GCZ A;  5HPI A;  4NKP A;  2KDK A;  3E4P A;  1UWP X;  2A24 B;  2HJ9 C;  4HIA A;  3H82 B;  2VEA A;  2PD8 A;  3S7P A;  4HQA A;  5F69 A;  2KOI A;  2HJE A;  5HWT A;  2WKQ A;  4BBV A;  5HPF A;  1YSQ A;  3F1P B;  4JGQ A;  3RFB A;  1S67 L;  3K3D A;  1YAX A;  4NXB A;  4L9G A;  1YSP A;  3R7W A;  4EQ1 A;  3KSF A;  3PBR A;  4LRZ E;  4WF0 A;  1N9L A;  1ODV A;  4LPZ A;  1T1C A;  2OWJ A;  1S4S A;  2PHY A;  4CLC C;  3E0Y A;  4WN5 A;  5HL6 A;  4GLQ A;  3O5Y A;  3OLO A;  4F3L B;  4GHI A;  3LR0 A;  2V0U A;  2W1R A;  3TE8 A;  1TD5 A;  5DKK A;  4EXO A;  3FPV A;  2XA7 M;  3VOL A;  4R38 A;  3UB7 A;  2IA2 A;  2WKP A;  2JKR M;  4EEU A;  2VLG A;  3TJZ C;  2GJ3 A;  2PYP A;  5HZH A;  4CLC B;  4HP4 A;  1OTD A;  4GHI B;  5TBM A;  5DJU A;  2JKT I;  1D06 A;  2QJ7 A;  5HD3 A;  3PYP A;  1F9I A;  2WKR A;  3EOI A;  1OT6 A;  4HJ4 A;  4GS9 B;  5J4E A;  4P6Z S;  1XJ2 A;  2O9B A;  3C2W A;  2J3T C;  3ICY A;  3UB8 A;  3PBS A;  5DJT A;  5C5K A;  3GDI A;  5L8M A;  3LIC A;  4B9O A;  2DMW A;  1LSV A;  4Q0I A;  4O8G A;  2OAP 1;  2QKP A;  4GW9 A;  4EUV A;  2EA9 A;  5AVF A;  3OCL A;  1V9Z A;  2VA0 A;  3LIE A;  5AVE A;  1D7E A;  2BAS A;  4CLC E;  2HGV A;  4HHD A;  4PKY G;  1N9O A;  5F6A A;  2V1B A;  2V9A A;  3BQ8 A;  4G3V A;  3LYX A;  2R78 A;  4DJ3 A;  2Y8H A;  4PHT A;  2QHK A;  2MJ6 A;  1NWZ A;  3KX0 X;  1NRJ A;  3T4L A;  4B93 A;  3ZYT A;  5HWV A;  3D3O A;  2FH5 A;  4I38 A;  3S7O A;  1TS6 A;  2XRN A;  2JKT M;  4MDZ A;  1OTI A;  3E98 A;  3KYZ A;  3IBR A;  1TS8 A;  1TS7 A;  4R70 A;  2M1C A;  2VX8 A;  4UEY A;  2VZW A;  3LI9 A;  1S66 L;  3IS2 A;  3LIF A;  3TW8 A;  4CLC D;  3VE3 A;  4IJG A;  4IUH A;  2O99 A;  3VV4 A;  5F5Y A;  4LRY C;  2B02 A;  2PYR A;  4KUO A;  2EWW A;  3DBA A;  4KQD A;  4EW7 A;  2ZMV A;  1H8M A;  1UGU A;  2ZOH A;  3T4S A;  3PXP A;  4HJ3 A;  4Y3I A;  2ZMF A;  3PBO A;  1P0Z A;  3CUE C;  2L4R A;  2K7S A;  1MZU A;  3CUE A;  2I9V A;  3HJK A;  3JVV A;  4I39 A;  3MQ0 A;  3HCY A;  4MMN A;  1XJ3 A;  1GSX A;  1LL8 A;  3EGX C;  4MCW A;  5KIZ A;  2PD7 A;  1W63 M;  4YNR A;  3CAX A;  5HD5 A;  1YKD A;  4OOL A;  2QJ5 A;  3LIA A;  3LR5 A;  4HI4 A;  1GSV A;  4I3I A;  3TRC A;  1S1Y A;  4ARZ A;  2J3T D;  4IUK A;  4DJ2 A;  3MFX A;  5DFY A;  2W3F A;  2VV8 A;  3EEA A;  3R4K A;  4EER A;  4HY8 A;  4QPR A;  4HNB A;  4KUK A;  3BY9 A;  5G4Y A;  4YWZ A;  3A0R A;  3R7W B;  1NLY A;  4I5S A;  5HSQ A;  4ARZ B;  3E4Q A;  2B18 A;  2GZA A;  4DMZ A;  4R3A A;  3UMD A;  4M4X A;  5DKL A;  3LID A;  2VKS A;  4LLO B;  4GJ4 A;  2W3H A;  2L1M A;  2XRO A;  1X0O A;  3NOP C;  3MR0 A;  4JGO A;  3OCN A;  1NLZ A;  2VGL M;  3T50 A;  3F1O A;  2GNX A;  4L0L A;  2OAQ 1;  2P7J A;  1VHM A;  1EW0 A;  3U2A A;  1W63 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...