4EEPA

Crystal structure of lov2 domain of arabidopsis thaliana phototropin 2
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
110
structure length
110
Chain Sequence
b'IEKNFVISDPRLPDNPIIFASDSFLELTEYSREEILGRNCRFLQGPETDQATVQKIRDAIRDQREITVQLINYTKSGKKFWNLFHLQPMRDQKGELQYFIGVQLDGSDHV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phototropin-2
publication title Structural Tuning of the Fluorescent Protein iLOV for Improved Photostability.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein, flavoprotein
total genus 33
structure length 110
sequence length 110
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4eepA00
3G6OA 1XFQA 3NOPC 4I3AA 1OJ5A 4EERA 1V9ZA 4JGRA 4GS9A 2R78A 4EW7A 1S1ZA 1T1CA 3HJKA 4HJ6A 2WKQA 3MQOA 5F69A 2W0NA 4GW9A 4JGQA 1S1YA 3LIDA 2KX6A 4HHDA 2QJ7A 2JHEA 3BY9A 2Z6CA 2PR5A 5A8BA 2INWA 4GS9B 4HJ4A 4K08A 4JGPA 1TS0A 4M4XA 4WF0A 1KOUA 5J4EA 4HNBA 5TBMA 1X0OA 5AVEA 2ZOIA 5DJTA 5HSQA 3H7WA 1P0ZA 3ULFA 1S4RA 4HI4A 2WKRA 4RQ9A 1UWPX 4HH3A 2EA9A 4YWZA 4EQ1A 2V0WA 2W27A 4EXOA 3E4PA 1XJ3A 4LRYC 1EW0A 4KUOA 4I39A 1S67L 4HIAA 1UGUA 3LIAA 3CWFA 3MJQA 1T18A 1OTIA 1N9NA 2QHKA 1DP6A 5TBMB 3UB8A 3GECA 4H6JA 2PD7A 4LRXC 5DKKA 3FC7A 1TS7A 1GSWA 4NXBA 1OT6A 4EEUA 4HJ3A 3OLOA 4DJ3A 2YKFA 3H7WB 2HV1A 1S4SA 3RTYA 2OOLA 1F98A 3LYXA 4EESA 2PD8A 3UE6A 2QJ5A 2QKPA 2I9VA 2PYPA 3D72A 3ICYA 4F3LA 4I3JA 4XT2A 2K7SA 1OTDA 3F1OA 1LT0A 5HD3A 1P97A 1T1AA 5HWWA 3MR0A 4HQAA 4H6JB 2CMNA 1WA9A 3PHYA 4GHIA 3E4QA 1LSWA 1DP9A 4HP9A 4KUKA 4WLAA 1OTEA 2PHYA 1N9LA 5F6AA 3ZQ5A 5J7EA 1MZUA 2OWHA 1VB6A 1OT9A 1UWNX 1D06A 1G28A 5IU1A 3T50A 5F5YA 3LI9A 4F3LB 4WN5A 4XT2B 1XFNA 3F1OB 4E04A 5AVFA 1JNUA 4HH2A 1Y28A 4R38A 2V1AA 3P7NA 3VE4A 1LSXA 2JN7A 4GHIB 5G4YA 3LIBA 2PDRA 3VE3A 1OTBA 3BY8A 2ZOHA 5F68A 2VV6A 3FG8A 2VLGA 3EEHA 4EEPA 3UMEA 3NOTC 3A0VA 4I3IA 4HY8A 3IBRA 2KDKA 3IS2A 4LLOB 4BBTA 1NWZA 3F1NA 2A24A 2L1MA 3KX0X 3H82A 3RH8B 1T19A 4DJ2A 2D02A 3LI8A 5I5LA 4NXGA 4WUJA 4R6LA 4PKYA 2BASA 2VEAA 1ODVA 1V9YA 3IS2B 1OTAA 3C2WA 5HDDA 3C8CA 4BBUA 2V1BA 4GCZA 1S66L 3UMDA 3F1NB 4HP4A 2A24B 4BBVA 5EFWA 3BWLA 1F9IA 3H82B 3UB9A 1GSVA 3PYPA 5DJUA 4MN5A 3EWKA 2D01A 3LICA 1LL8A 1T1BA 1XJ4A 2V9AA 1XJ6A 5HD5A 4PKYG 1TS8A 2M1CA 2VV8A 4HOIA 4R70A 5KIZA 2H28A 3CLOA 3NJAA 3K3DA 4LPZA 4EETB 5HDCA 2P7JA 3SW1A 3LIFA 3NOUC 1GSXA 3LIEA 3VOLA 4NXEA 5HWVA 2GJ3A 2OWJA 3LUQA 2VV7A 2L0WA 3UB7A 4I5SA 2ZBBA 3MQQA 3F1PA 3A0SA 5DKLA 2Z6DA 2QWSA 4I38A 2YKHA 2WKPA 4L9FA 5HDSA 3H9WA 2PR6A 3GDIA 3A0RA 4L9EA 1OJGA 2L4RA 1N9OA 4KQDA 2J80A 4WL9A 3MFXA 1DP8A 1LSVA 1XJ2A 3CAXA 4B9OA 2PYRA 5J3WA 1TS6A 4JGOA 4R3AA 4LRZE 2V0UA 3UB6A 5HZHA 4MN6A 2B02A 3F1PB 3NHQA 3K3CA 5IS1A 4L9GA 3MXQA 4NXFA 1BYWA 5HWTA 1DRMA 5G4ZA 3E4OA 3B33A 3HJIA 1D7EA
chains in the Genus database with same CATH superfamily
4BL2A 1OJ5A 5A93A 1PIOA 2DNSA 1FCNA 1V9ZA 1PWCA 4Y15A 3IXBA 3LR4A 4GJ4A 4MN7A 2XEPA 1K57A 2WKQA 4HBTA 4FH4A 5F69A 4Z1WA 4OQIA 2Y2MA 3T4OA 2WZXA 5HPIA 4K0XA 3NC8A 2KX6A 1CQAA 4KQQA 4S2NC 2VGLM 1NY0A 4MDZA 3ZG5A 3B3XA 2ZD8A 3HUMA 3L9KA 2JHEA 4CPKA 3BY9A 5HL1A 3Q07A 4OOYA 5CHUA 3LEQA 4UA7A 5A8BA 2ZC3B 2INWA 5IT5A 1IKGA 4HJ4A 1CJFA 1FIKA 4FSFA 4K08A 2Y2QA 5KZHA 1BTLA 1TS0A 2ZMAA 2EFXA 4ZAMA 4AFIA 5L2FA 1N4OA 1MWRA 4QY6A 5BOHA 1FSWA 1WYBA 3ZHHA 4U0XA 3M2JA 1J9MA 4HESA 4KZ5A 2A2LA 3NDEA 5EM0A 3UDXA 1K25A 4ZJ3A 1G5UA 4K91A 3H7WA 5FQ9A 3ZNYA 4N1XA 3ULFA 2WKRA 4RQ9A 4HH3A 3GVBA 2V0WA 2P08A 3CI6A 3VFHA 2K31A 1EW0A 3MF0A 4NEED 2XSSA 4I39A 3VSLA 1S67L 1GA9A 1O07A 3MJQA 2H0TA 3QNCA 2QHKA 3SZTA 4FOFA 2ZM8A 1ZG6A 3FPWA 1K6RA 3BYDA 3WS4A 1MKIA 4S2LA 4DF6A 1BLPA 3D3OA 1GSWA 5DF9A 3OLOA 3H7WB 3EQVA 2HV1A 1ESIA 5GHYA 4R3BA 4NETA 5U47A 2ZQ7A 3LYXA 4C3QA 4EESA 2QJ5A 4FCFA 3OPPA 4Y0TA 3JYIA 1NRJA 5DFYA 4OQGA 1HLUP 4FUWA 1K56A 4CJNA 3F1OA 1P97A 3TJZC 4X53A 5FAQA 3PBOA 3HLGA 4B88A 2CMNA 5DTSA 3TSGA 1H0MA 1LSWA 4HP9A 4KUKA 3N6IA 3IWOA 2PHYA 4R0QA 3I7JA 2JKGA 3IBJA 1YM1A 3MMHA 3HLDA 5TR7A 2AVXA 1VHMA 1UWNX 5IU1A 2BLSA 1AXBA 5F5YA 3M6HA 4OPQA 3HBRA 3F1OB 2JKTM 5CTMA 5AVFA 3OOVA 4KENB 5EUAA 5FQIA 1JNUA 2HJ9C 2IWDA 4HH2A 4S2JA 1RGZA 2J3TC 3U4LP 1RCJA 5GHZA 2JN7A 2JKFA 1YMSA 3DTIA 4LV3A 1L0FA 2G7UA 3OBFA 1KDWA 3BY8A 3NBLA 5F68A 4IEDA 3C5AA 4BJPA 4B4XA 3OPHA 3EEHA 4EEPA 1ESUA 4U0TA 2ZQCA 3IBRA 5MC7A 4O8GA 2KDKA 1KGEA 2Y79A 3GR2A 2ZC4B 3IS2A 4QWOA 4N9LA 1H5XA 4BMWA 2Y2KA 2L1MA 1W8YA 3RH8B 4DRTA 4EQIA 3BFGA 3QHYA 5FQMA 4P6ZS 4KZAA 1W5DA 4JF6A 2W3GA 1YLJA 5F1GA 1JWVA 3T4KA 4X25A 1IYQA 1OPXA 4WUJA 4ME4A 4FD8A 4WEKA 4UA9A 1YLTA 1ODVA 3IS2B 3WS5A 1OTAA 5HDDA 3C8CA 1GHIA 2XLNA 2B5RA 4WMCD 1E25A 3N8SA 2DRWA 4Q0IA 4BBVA 5CGXA 3BWLA 3DTMA 3UB9A 3NECA 5EVID 3PYPA 2Y2IA 4MN5A 5KSHA 3T4QA 5FI6A 3HREA 2R9WA 3S7QA 5KMWA 1ES3A 3S7OA 3T4TA 5CX7A 1XJ6A 2EWWA 1FQGA 5I94A 4CLCD 5CERA 2PBYA 4GZBA 3UDIA 2J9OA 4QB8A 2WZZA 4S2KA 3JVUA 4U3TA 5KIZA 4MBKA 4ZDXA 3TRCA 2H0YA 3CLOA 3S7PA 2ZJ9A 4LPZA 4EETB 5HDCA 3SW1A 3NOUC 3LIEA 3WS2A 4H8RA 3AGEA 1PI5A 1Q2PA 3LUQA 2OLUA 3UB7A 1ALQA 2EWVA 2W3DA 1ONGA 2KOIA 4I5SA 3F1PA 4RVAA 4PM5A 1KDSA 4N92A 1U60A 4B93A 2XFSA 5DKLA 4KZBA 1IYSA 2Y4AA 4I38A 5EE8A 2WKPA 2PR6A 1MWTA 1IYOA 4JPMA 3PXPA 1DJCA 4WL9A 5EVEA 1J3WA 1NYYA 1SCWA 1W8QA 1O7EA 3UN7A 1K4EA 4DE1A 5J3WA 3UNWA 3QP8A 2GX5A 2XH9A 3IX3A 2O9AA 4LRZE 4UEYA 4MNRA 2EX6A 3F1PB 4MLLA 3NI9A 4OLGA 4WM9A 3Q82A 5G18A 3G6OA 1XFQA 1FCMA 3OC2A 1XP4A 3O3VA 4EERA 4EBPA 3MZEA 2QZ6A 4N1HA 3SS4A 5TFQA 3Q7ZA 1Z6FA 3HL9A 2P04A 3B42A 4R1GA 5A92A 3LCEA 3HJKA 3W4PA 2LB5A 3UPNA 4IBRA 3AGFA 4Y3IA 2W3EA 3VV4A 1WYCA 1G6AA 3NULA 3IXHA 2O9BA 4HHDA 2IWBA 2XR0A 2QJ7A 5EOEA 2HPBA 1I2SA 4KZ8A 3ZVWA 4L0LA 3E2LA 1PWDA 4BQMA 3SOIA 4JXGA 4QD4A 4Q0HA 3G31A 4PPRA 2VJWA 2V2FF 3BFFA 3OPRA 3N7WA 3S22A 1YSQA 4EUZA 4M4XA 2HP5A 2B95A 5J4EA 5TBMA 1TF1A 1X0OA 2X02A 3U2AA 4EUVA 4JBFA 2WUQA 3CHWP 1IEMA 2B18A 5M18A 2JE5A 5AVEA 2ZOIA 5DJTA 4UAAA 4BD0A 3G32A 1PNEA 3S1YA 5FSRA 2EA9A 1QMEA 4EQ1A 3KSHA 4QPRA 2EX2A 1FR1A 1XA1A 3E4PA 1XJ3A 4JXVA 5FI7A 4EBLA 1PW8A 3TOIA 4KUOA 1PRQA 3T12B 3GMWA 2O0YA 3UE1A 4WZ5A 4K0WA 1ES4A 1T18A 2DMWA 4KG5A 3D4FA 3V5MA 3BJNA 3BLSA 3EQUA 5TGFA 3QP6A 4PAUA 1MPLA 1DP6A 5TBMB 4H6JA 4LRXC 3NCKA 2Q9NA 2VX8A 4G3KA 1OT6A 4EEUA 4HJ3A 1IELA 3HLBA 5CHJA 1SKFA 2PAVP 4MBFA 3RTYA 3ZG7B 1KVMA 4D2OA 4OONA 3KSGA 3T1XA 3PBTA 2Y2JA 2QKPA 4PM7A 1YLYA 4JKTA 3CITA 4LV0A 2PYPA 3ICYA 2M7VA 2K7SA 1XA7A 3MR0A 4D60A 2Z2MB 4HQAA 4DN0A 4H6JB 2XGNA 4IVIA 4MMNA 3PHYA 3PBSA 4F94A 1ERMA 3A3EA 1PWGA 3FWLA 4QHCA 5GHXA 5AQ7A 1EWZA 1VB6A 5CEBA 1OT9A 1OMEA 4DDYA 1G28A 4R23A 4WN5A 1XFNA 2H10A 3ZDJA 3S7NA 1JWZA 1H8YA 1ONHA 3C7VA 4DXCA 5GL9A 1LSXA 1YQSA 3V3SA 3NIAA 1K55A 4E3OA 1K4FA 3WS0A 2FFYA 5DF7A 2JCHA 3VMAA 2ZOHA 4ZRRA 3UE0A 3WRZA 1K54C 3FG8A 2O9CA 4KQOA 3C4OA 3HVFA 1I2WA 3UMEA 3NOTC 3A0VA 1XKZA 4HY8A 2Y2OA 3CJMA 2XA7M 2ZQAA 2ZMFA 3QP5A 2ZC7A 4LENA 4LV1A 4LV2A 1STZA 4YNRA 5GLCA 3F1NA 4RA7A 2XF3A 5DF8A 3CZDA 2HGVA 1RP5A 2J7VA 5I5LA 2ZQ8A 5FQJA 3SH8A 2J3WA 3HLEA 3PAGA 4NXGA 5L07A 1FILA 3HLWA 4YINA 3K2NA 5DFXA 1VEUA 4QJGA 2BASA 2HZ5A 2VEAA 5FA7A 3M2KA 5HAQA 1K54A 4BBUA 2V1BA 1S66L 5A90A 2WAEA 3F1NB 1LL9A 4CQHA 4ETXA 4KG6A 5DJUA 3EGDC 1L2SA 1W63Q 3GRJA 1T1BA 4BD1A 1NLZA 4Y13A 5HD5A 4PKYG 1TS8A 1W63M 4LFUA 2XK1A 2VV8A 4EWFA 1VEUB 5EVIC 4R70A 2V1ZA 3VP4A 4XUXA 2DCFA 4WBGA 2H28A 4OKPA 1CEFA 5EPHA 1KE4A 2P7JA 1TDGA 4S2PA 1WE4A 2ACGA 2WKEA 1IKIA 5JYOA 4KZ7A 2OWJA 4UHUA 2I72A 2ZBBA 2R9XA 3GV9A 3V50A 3A0SA 3QP1A 3CPTA 2Z6DA 4PM9A 1BZAA 2FH5A 2XDMA 3V39A 3GDIA 3N4IA 4E6WA 1W79A 1QMFA 2WGIA 4S2IA 2NUPC 3N8RA 1KE0A 1CEGA 2J80A 4WMCA 3P01A 3UPOA 3UDFA 1IYPA 1MKMA 3Q1FA 4Y5FA 2ZMVA 1AWIA 5EVIA 4BLMA 3C7UA 3ZCZA 4B9OA 4P6BA 1IFQA 4Z9QA 5E2FA 4JF4A 3O5YA 5AQ9A 1TS6A 4R3AA 2WYXA 5EM1A 3DAVA 3UB5P 4X68A 5E2HA 5M1AA 2B02A 3NHQA 5IS1A 3CPTB 1NLYA 1F2KA 1NXYA 1DRMA 2OAQ1 4X1LA 5G4ZA 1ZC2A 3E4OA 4P0MA 4E6XA 2J8YA 3NOPC 4I3AA 2G2WA 1MBLA 3T1QB 5EVIB 4JGRA 1JTGA 5EOOA 4P87A 3MZFA 4S2MA 1S1ZA 1T1CA 2ZM0A 3TW8A 1BLCA 1YT4A 2W0NA 4P85A 4OPZA 4CLCB 4JGQA 3Q7VA 1TEMA 3BQ8A 2Z2LB 4OPRA 4WYYA 3ZG9B 4IJGA 1Q2QA 2ZL1A 3UPPA 3G34A 5F83A 3G2YA 2Y2NA 4DXBA 3MS6A 2E8JA 4EV4A 1KVLA 5CEDA 5GLDA 4HEFA 1ERQA 4M3KA 5E2EA 1VETA 3CUEC 3GTCA 3SH9A 3BQAA 4WF0A 2Y2PA 3FKVA 4OQHA 1TVFA 3O88A 3Q7VB 2XFTA 2M7UA 1G6OA 4C75A 3V3RA 4R3JA 5HSQA 3W4OA 5FATA 1P0ZA 3LGOA 1ZTUA 1BSGA 2A49A 4Q8IA 1GA0A 2W3FA 2ZL1B 1JVJA 5EVLA 3IH9A 1UWPX 4YWZA 3BRMA 3IF6C 1VQQA 2X71A 4WELA 3HCYA 3JVVA 3W8KA 1LHYA 4G3WA 1P9WA 4DDSA 4HIAA 3LIAA 3CWFA 1OTIA 4P6ZM 1VETB 1N9NA 3PBRA 1E4DA 3JPUA 1A0KA 3GSGA 2PRFA 3ZYTA 4GOGA 1XGIA 2Y2LA 3UB8A 5DKKA 2PD7A 3FC7A 5F82A 1K6SA 3CUEA 2V20A 4OP5A 2Q0OA 2WKHA 1LLBA 4DJ3A 4GDBA 1MWSA 1HD8A 4IHQA 1HTZA 2WAFA 1S4SA 4OPYA 2OOLA 2ZQDA 2I9VA 1MY8A 3M6BA 5AJGA 3D72A 3SH7A 4GN2A 4O7DA 3DW0A 4Y2FA 3IF6A 2EXAA 5HD3A 3W2ZA 2ZC6B 2VGKA 3EOIA 2ZC5B 3BECA 5M19A 1WA9A 4GLQA 2GDNA 3CMZA 3E4QA 2HDQA 4PMAA 3LR5A 4WLAA 3O87A 1PZPA 1OTEA 3DBAA 3IXGA 1N9LA 4WZ5C 1JTDA 1BLHA 5CHMA 1XXMA 3ZQ5A 2VGLS 5DVAA 1HZOA 3L7HA 3ZVTA 2EX8A 1GHPA 1D06A 4PHTA 3LI9A 3LR0A 1K0KA 3B47A 3ZG0A 1FOFA 2GNXA 3IF6B 3KSFA 4E04A 1YLWA 2C5WB 4KQRA 4PM8A 1N9BA 1Y28A 1XX2A 2WK0A 2WGVA 5AQAA 2XD1A 3P7NA 4NKPA 2BG1A 1TD5A 3IHAA 3VE4A 2O99A 4OOLA 4OH0A 1W7FA 3PTEA 5G4YA 1PFLA 3FZCA 2ZQ9A 1KGGA 3FV7A 3MKFA 3VE3A 2HDUA 1PYYA 4JXSA 5J8XA 1H8ZA 5E2GA 5HX9A 2E8IA 4I3IA 2XQZA 5FDSA 3ITBA 5AQBA 5KSCA 3RXWA 4DE0A 3LFVA 4LLOB 5CGWA 1EROA 5EECA 4KZ4A 2A24A 4NK3A 2XRNA 4ETZA 3H82A 2X01A 4BENA 3MSHA 5D3OA 1E3UD 2RCXA 3NDGA 3OZHA 3PBQA 4E3IA 1YLZA 3SS5A 4EBNA 2FFFB 1EI5A 5FL3A 2JC7A 4PKYA 4GD6A 3UO9A 2JBFA 4UA6A 1V9YA 5DTTA 3C2WA 4B4ZA 1K55C 3DWKA 4GCZA 3MQ0A 3VP2A 2OSUA 3VSKA 5HARA 2A24B 3UE3A 5EFWA 2ZM2A 5CGSA 2VGJA 1F9IA 3H82B 1YLPA 4E3MA 1XGJA 1FSYA 1JWPA 2D01A 2LB9A 3LICA 1LL8A 3NY4A 2V9AA 3G2ZA 4OOMA 4Y17A 3LR3A 3FPVA 2M1CA 1HVBA 1ACFA 3RJUA 3EGXC 3ITAA 1P9RA 3NJAA 3K3DA 3SS3A 1S6RA 3LIFA 4ESPA 3VOLA 4NXEA 1L0EA 1YAXA 2GJ3A 2VV7A 2RL3A 2L0WA 4FTXA 4ZJ2A 3MQQA 2HP9A 3KYZA 2HDSA 4L9FA 4GKUA 3A0RA 1OJGA 1FCOA 4FH2A 1N9OA 4GNUA 3IF5A 3E0YA 3MFXA 5TJJA 1F5MA 4S2NA 4A5RA 5L8MA 5EV0A 3CAXA 3QP2A 1PZOA 4GB7A 1Y54A 2JKRI 3DTKA 4PM6A 1H8MA 2QMIA 4R4RA 3C4PA 4OP8A 1SDNA 1SKOA 2V0UA 3UB6A 3KYQA 1M6KA 4RX3A 4C6YA 5IHVA 1MC0A 2OV5A 3Q81A 3QP4A 3B33A 3OPLA 1NRFA 1LL5A 1PI4A 1YSPA 2UV0E 3WRTA 2H5SA 3IWIA 3MXRA 1SZVA 4GS9A 2NUTC 3BW6A 3BLMA 4JXWA 1DJAA 2R78A 2VKSA 4EW7A 4MCWA 1SKOB 4HJ6A 3BM6A 4RX2A 5GLBA 2J9PA 1Z09A 4Y7PA 2A3UA 3MQOA 3ISGA 4E3LA 4GW9A 1DJBA 3IQAA 1TDLA 2OLVA 1S1YA 3HLCA 3LIDA 5DTKA 5C5KA 2W3HA 1L3LA 1Y4OA 2Z6CA 3W4QA 2WGWA 5GLAA 4OLDA 3IT9A 5CECA 3MKEA 2PR5A 5F1FA 3PR6A 5CTNA 4YOFA 2WADA 4GS9B 5FAPA 4CLCC 2VK3A 2Y59A 4JGPA 4BL3A 3TE8A 2FZ0A 5HL6A 2HDRA 2CC1A 3MFDA 1D1JA 3PBNA 3N8LA 5FAOA 1KOUA 1ES5A 1K56D 4HNBA 1MWUA 4XXRA 3RFBA 2HP6A 3BFEA 3A3JA 2Y8HA 4LCLA 3DWZA 4JLFA 3LY4A 4BWIA 3LO7A 1S4RA 4HI4A 1BULA 1VM1A 4X69A 2WGWB 5FDHA 4Y0OA 3ZG8B 3OCLA 2W27A 4EXOA 4LRYC 4XUZA 5LBRA 1IOUA 3VOYA 1PW1A 4ZJ1A 3HLFA 3G30A 3G4PA 4G3VA 3T4SA 1UGUA 5FQKA 3A3DA 3D9YA 4CLCA 3BFDA 3IX8A 3BFCA 5L10A 4NG2A 5L09A 3GECA 3HUNA 1TS7A 1YMXA 3O86A 3UY6A 4NXBA 3KYEA 2YKFA 1SDEA 4RYEA 3VP3A 3GQZA 1F98A 3IX4A 2PD8A 1K38A 3UE6A 3ZNTA 3HUOA 4MEZA 3G35A 1CF0A 2XROA 4F3LA 1RGYA 4I3JA 4XT2A 3LY3A 1OTDA 1L0GA 4ARZA 3IHBA 1YPRA 1LT0A 2IA2A 3WWXA 1T1AA 5HWWA 2C6WB 4DKIA 4LCMA 1CI8A 2K2NA 3T1SA 4IUHA 2W1TA 4ZBEA 4ID4A 4GHIA 2UWXA 1BLSA 3QNBA 4MBHA 3MBZA 1DP9A 3T4LA 2OAP1 1LI0A 3VFFA 3RXXA 5F6AA 4JF5A 2J3TD 5J7EA 3DTEA 1MZUA 2OWHA 4KZ9A 1ZHHB 5HFOA 3AGDA 1KE3A 3IH8A 3T50A 1H3QA 4F3LB 3P98A 2Y55A 4XT2B 3FYZA 4Q0JA 4ARZB 3KO6A 2KLIA 4II7A 1ZG4A 2HF6A 5K5BA 4R38A 2V1AA 1SHVA 2PU2A 4KZ6A 1LI9A 3MZDA 2PBDP 2W1TB 1GHMA 4GHIB 2GZAA 3LIBA 4LGWA 2BTFP 4QU3A 2WKIA 2PDRA 3BEBA 4GDNA 1C3BA 1OTBA 4DMZA 2Y2HA 3R4KA 2VV6A 2VLGA 1NJ4A 3CG5A 1BUEA 2VZWA 4EU0A 1DY6A 1BT5A 4UQIS 1NZUA 2P74A 5FEGA 4X55A 4BBTA 1NWZA 3VP1A 3KX0X 1ZKJA 2G2UA 5FEFA 1T19A 4DJ2A 3E2KA 4CLCE 2D02A 2JKTI 3LI8A 5FI2A 2Q9MA 4X1MA 4DE3A 4KZ3A 4E3NA 3VOZA 4R6LA 3S4XA 3OCNA 2EFUA 1I5QA 3TG9A 4GD8A 1CI9A 2QYBA 4QY5A 2MJ6A 3R7WA 4N9KA 2ZLYA 3UMDA 4HP4A 3MXSA 3P09A 5JYPA 1GSVA 4X6TA 3A3FA 4KG2A 3V67A 4E3KA 5HW3A 3EWKA 1CK3A 1GCEA 1XJ4A 1MXOA 3C38A 2QPNA 1FR6A 4R4SA 4IBXA 5E43A 2JKRM 3FKWA 3T4JA 4HOIA 3E98A 5HAPA 2EX9A 5CXWA 3LEZA 3KSIA 3R7WB 1G68A 3ZFZA 1GSXA 1L0DA 4WZ4A 1NYMA 5HWVA 4O0PA 1E3UA 2PU4A 1YKDA 1S0WA 2EXBA 5HPFA 5A91A 2XD5A 3EEAA 2P9VA 4O01A 3T1RA 1ES2A 4X56A 2QWSA 4YFMA 4HBUA 5FQQA 2YKHA 4E3JA 3IWQA 5HDSA 3H9WA 4L9EA 2L4RA 3C30A 1NZOA 2V8FA 4KQDA 1KGFA 1DP8A 1LSVA 3PAEA 3VP0A 4UQIM 1XPBA 1K57C 1XJ2A 5HAIA 2PT7A 2HJEA 2PYRA 3IXDA 2W1RA 2XA7S 4S2OA 2Y91A 3WS1A 3ZGAB 4JGOA 4IVKA 4WEJA 3A3IA 5HZHA 2V8CA 4MN6A 4IUKA 3K3CA 5FASA 4L9GA 2P9VB 3MXQA 2VA0A 1BYWA 4NXFA 5CRFA 4DE2A 4OQ0A 4Y0UA 5HWTA 4OVDA 2Y2GA 2IWCA 4ZTKA 3HJIA 1M40A 1D7EA
chains in the Genus database with same CATH topology
3G6OA 1XFQA 3NOPC 4I3AA 1OJ5A 3OC2A 4EERA 1YSPA 1V9ZA 4JGRA 4GS9A 2NUTC 3BW6A 2P04A 3B42A 2R78A 2VKSA 3LR4A 4EW7A 4MCWA 1S1ZA 4GJ4A 1T1CA 3HJKA 3TW8A 2LB5A 4HJ6A 4MN7A 2WKQA 3MQOA 5F69A 2W0NA 4GW9A 4CLCB 4Y3IA 4Z1WA 4JGQA 3T4OA 2W3EA 1S1YA 3VV4A 3BQ8A 5HPIA 3LIDA 2KX6A 2VGLM 2O9BA 4HHDA 5C5KA 2W3HA 2QJ7A 4IJGA 4MDZA 2JHEA 3BY9A 2Z6CA 4L0LA 2PR5A 5A8BA 3PR6A 2INWA 5IT5A 4YOFA 4GS9B 4HJ4A 4CLCC 4FSFA 4K08A 4JGPA 3TE8A 4Q0HA 2FZ0A 5HL6A 1TS0A 2VJWA 3CUEC 4AFIA 3PBNA 1YSQA 3BQAA 4M4XA 4WF0A 1KOUA 5J4EA 4HNBA 5TBMA 1TF1A 1X0OA 3U2AA 2M7UA 4EUVA 1G6OA 3RFBA 2B18A 2A2LA 5AVEA 2ZOIA 2Y8HA 5DJTA 5HSQA 3H7WA 1P0ZA 1ZTUA 4BWIA 3ULFA 1S4RA 4HI4A 2WKRA 2W3FA 4RQ9A 1UWPX 4HH3A 2EA9A 4YWZA 4EQ1A 2V0WA 3KSHA 2P08A 3OCLA 2W27A 4QPRA 3CI6A 4EXOA 3E4PA 1XJ3A 4LRYC 5LBRA 1IOUA 4WELA 2K31A 3HCYA 3JVVA 1EW0A 4G3WA 4KUOA 3MF0A 4NEED 4G3VA 3T4SA 1P9WA 2O0YA 2XSSA 4I39A 1S67L 4HIAA 1UGUA 3LIAA 3CWFA 3MJQA 1T18A 1OTIA 4P6ZM 2DMWA 1N9NA 3PBRA 2QHKA 3BJNA 4CLCA 3EQUA 4FOFA 3ZYTA 3FPWA 4PAUA 1DP6A 5TBMB 3UB8A 3GECA 4H6JA 2PD7A 4LRXC 5DKKA 3FC7A 2VX8A 1TS7A 4G3KA 3D3OA 1GSWA 3CUEA 4NXBA 1OT6A 4EEUA 5DF9A 4HJ3A 3OLOA 4DJ3A 2YKFA 3H7WB 4IHQA 3EQVA 2HV1A 1S4SA 3RTYA 2OOLA 1F98A 3LYXA 4EESA 3KSGA 2PD8A 3UE6A 2QJ5A 3PBTA 2QKPA 2I9VA 3CITA 5AJGA 2PYPA 3D72A 3ICYA 2XROA 1NRJA 4F3LA 4I3JA 4XT2A 2K7SA 1OTDA 5DFYA 2M7VA 4Y2FA 4ARZA 3F1OA 1LT0A 5HD3A 1P97A 3W2ZA 2IA2A 3TJZC 1T1AA 5HWWA 3MR0A 3EOIA 3PBOA 4HQAA 4DN0A 4H6JB 2K2NA 4IUHA 2W1TA 2CMNA 1WA9A 4GLQA 4MMNA 3PHYA 3PBSA 4GHIA 3E4QA 1LSWA 3LR5A 1DP9A 4HP9A 3T4LA 4KUKA 4WLAA 2OAP1 1OTEA 2PHYA 3DBAA 1N9LA 3IBJA 5F6AA 3ZQ5A 2J3TD 5J7EA 2VGLS 3MMHA 1MZUA 1VHMA 2OWHA 1ZHHB 1VB6A 1OT9A 1UWNX 1D06A 1G28A 5IU1A 3T50A 5F5YA 4PHTA 1H3QA 3LI9A 4F3LB 3LR0A 3B47A 4WN5A 4XT2B 4Q0JA 1XFNA 4ARZB 3KO6A 2GNXA 2KLIA 3F1OB 3KSFA 4II7A 4E04A 2JKTM 5AVFA 3OOVA 2HF6A 5K5BA 2HJ9C 1JNUA 4HH2A 1Y28A 3S7NA 4R38A 2V1AA 2J3TC 3P7NA 4NKPA 1TD5A 3VE4A 1LSXA 2W1TB 2O99A 4OOLA 2JN7A 4GHIB 2GZAA 5G4YA 3LIBA 2G7UA 3OBFA 2PDRA 3VE3A 1OTBA 3BY8A 4DMZA 2ZOHA 4ZRRA 5F68A 3R4KA 4BJPA 2VV6A 3FG8A 2O9CA 4KQOA 2VLGA 3EEHA 4EEPA 3UMEA 3NOTC 3A0VA 4I3IA 4HY8A 3IBRA 5MC7A 2VZWA 2XA7M 4O8GA 2KDKA 4EU0A 2ZMFA 4UQIS 2Y79A 3IS2A 1STZA 3LFVA 4LLOB 4BBTA 1NWZA 4YNRA 4BMWA 3F1NA 2A24A 2XRNA 4ETZA 2L1MA 3KX0X 3H82A 3RH8B 4P6ZS 1T19A 2HGVA 4DJ2A 4CLCE 2D02A 2JKTI 3LI8A 5I5LA 2W3GA 2J3WA 3T4KA 3PBQA 4NXGA 1OPXA 4WUJA 4R6LA 4ME4A 5FL3A 3K2NA 5DFXA 4PKYA 3OCNA 2BASA 2VEAA 4WEKA 2QYBA 1ODVA 1V9YA 3IS2B 1OTAA 2MJ6A 3C2WA 5HDDA 3R7WA 3C8CA 4BBUA 2V1BA 4GCZA 1S66L 3MQ0A 3UMDA 3F1NB 4HP4A 2A24B 4Q0IA 4BBVA 3UE3A 5EFWA 4CQHA 3BWLA 1F9IA 3H82B 3UB9A 4ETXA 1GSVA 3PYPA 5DJUA 3V67A 4MN5A 5KSHA 3EGDC 3T4QA 3EWKA 1W63Q 2D01A 2LB9A 1LL8A 3LICA 3S7QA 1T1BA 1XJ4A 2V9AA 3C38A 3S7OA 4OOMA 1NLZA 3T4TA 5CX7A 1XJ6A 5HD5A 2EWWA 4PKYG 1TS8A 1W63M 4CLCD 3LR3A 3FPVA 2M1CA 2VV8A 2JKRM 3T4JA 4HOIA 3EGXC 4R70A 3E98A 3JVUA 5KIZA 3KSIA 2H28A 3TRCA 3CLOA 1P9RA 3NJAA 3R7WB 3S7PA 3K3DA 4LPZA 4EETB 5HDCA 2P7JA 3SW1A 3LIFA 3NOUC 1GSXA 3LIEA 3VOLA 4NXEA 5HWVA 4O0PA 1YAXA 2GJ3A 2OWJA 1YKDA 2VV7A 3LUQA 2L0WA 3UB7A 2EWVA 2W3DA 2KOIA 2ZBBA 3MQQA 4I5SA 5HPFA 3F1PA 3A0SA 3EEAA 4O01A 4B93A 5DKLA 2Z6DA 2QWSA 3KYZA 2FH5A 4I38A 2YKHA 2WKPA 4L9FA 5HDSA 3H9WA 2PR6A 3GDIA 3A0RA 4L9EA 1OJGA 2L4RA 3C30A 2NUPC 1N9OA 4KQDA 3PXPA 2J80A 4WL9A 3P01A 3E0YA 3MFXA 5TJJA 1DP8A 1LSVA 4UQIM 1F5MA 1MKMA 4Y5FA 2ZMVA 5L8MA 1XJ2A 3CAXA 4B9OA 2PT7A 2HJEA 2JKRI 1IFQA 2PYRA 5J3WA 1H8MA 2W1RA 2XA7S 3O5YA 2GX5A 1TS6A 4JGOA 4R3AA 2O9AA 2V0UA 4LRZE 4UEYA 3UB6A 3KYQA 4WEJA 5HZHA 4MN6A 2B02A 3F1PB 4IUKA 3NHQA 3K3CA 5IS1A 1MC0A 4L9GA 3MXQA 2VA0A 1BYWA 4NXFA 1NLYA 5HWTA 2OAQ1 1DRMA 5G4ZA 3E4OA 3B33A 3HJIA 1D7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6O A;  1XFQ A;  3NOP C;  4I3A A;  1OJ5 A;  4EER A;  1V9Z A;  4JGR A;  4GS9 A;  2R78 A;  4EW7 A;  1S1Z A;  1T1C A;  3HJK A;  4HJ6 A;  2WKQ A;  3MQO A;  5F69 A;  2W0N A;  4GW9 A;  4JGQ A;  1S1Y A;  3LID A;  2KX6 A;  4HHD A;  2QJ7 A;  2JHE A;  3BY9 A;  2Z6C A;  2PR5 A;  5A8B A;  2INW A;  4GS9 B;  4HJ4 A;  4K08 A;  4JGP A;  1TS0 A;  4M4X A;  4WF0 A;  1KOU A;  5J4E A;  4HNB A;  5TBM A;  1X0O A;  5AVE A;  2ZOI A;  5DJT A;  5HSQ A;  3H7W A;  1P0Z A;  3ULF A;  1S4R A;  4HI4 A;  2WKR A;  4RQ9 A;  1UWP X;  4HH3 A;  2EA9 A;  4YWZ A;  4EQ1 A;  2V0W A;  2W27 A;  4EXO A;  3E4P A;  1XJ3 A;  4LRY C;  1EW0 A;  4KUO A;  4I39 A;  1S67 L;  4HIA A;  1UGU A;  3LIA A;  3CWF A;  3MJQ A;  1T18 A;  1OTI A;  1N9N A;  2QHK A;  1DP6 A;  5TBM B;  3UB8 A;  3GEC A;  4H6J A;  2PD7 A;  4LRX C;  5DKK A;  3FC7 A;  1TS7 A;  1GSW A;  4NXB A;  1OT6 A;  4EEU A;  4HJ3 A;  3OLO A;  4DJ3 A;  2YKF A;  3H7W B;  2HV1 A;  1S4S A;  3RTY A;  2OOL A;  1F98 A;  3LYX A;  4EES A;  2PD8 A;  3UE6 A;  2QJ5 A;  2QKP A;  2I9V A;  2PYP A;  3D72 A;  3ICY A;  4F3L A;  4I3J A;  4XT2 A;  2K7S A;  1OTD A;  3F1O A;  1LT0 A;  5HD3 A;  1P97 A;  1T1A A;  5HWW A;  3MR0 A;  4HQA A;  4H6J B;  2CMN A;  1WA9 A;  3PHY A;  4GHI A;  3E4Q A;  1LSW A;  1DP9 A;  4HP9 A;  4KUK A;  4WLA A;  1OTE A;  2PHY A;  1N9L A;  5F6A A;  3ZQ5 A;  5J7E A;  1MZU A;  2OWH A;  1VB6 A;  1OT9 A;  1UWN X;  1D06 A;  1G28 A;  5IU1 A;  3T50 A;  5F5Y A;  3LI9 A;  4F3L B;  4WN5 A;  4XT2 B;  1XFN A;  3F1O B;  4E04 A;  5AVF A;  1JNU A;  4HH2 A;  1Y28 A;  4R38 A;  2V1A A;  3P7N A;  3VE4 A;  1LSX A;  2JN7 A;  4GHI B;  5G4Y A;  3LIB A;  2PDR A;  3VE3 A;  1OTB A;  3BY8 A;  2ZOH A;  5F68 A;  2VV6 A;  3FG8 A;  2VLG A;  3EEH A;  4EEP A;  3UME A;  3NOT C;  3A0V A;  4I3I A;  4HY8 A;  3IBR A;  2KDK A;  3IS2 A;  4LLO B;  4BBT A;  1NWZ A;  3F1N A;  2A24 A;  2L1M A;  3KX0 X;  3H82 A;  3RH8 B;  1T19 A;  4DJ2 A;  2D02 A;  3LI8 A;  5I5L A;  4NXG A;  4WUJ A;  4R6L A;  4PKY A;  2BAS A;  2VEA A;  1ODV A;  1V9Y A;  3IS2 B;  1OTA A;  3C2W A;  5HDD A;  3C8C A;  4BBU A;  2V1B A;  4GCZ A;  1S66 L;  3UMD A;  3F1N B;  4HP4 A;  2A24 B;  4BBV A;  5EFW A;  3BWL A;  1F9I A;  3H82 B;  3UB9 A;  1GSV A;  3PYP A;  5DJU A;  4MN5 A;  3EWK A;  2D01 A;  3LIC A;  1LL8 A;  1T1B A;  1XJ4 A;  2V9A A;  1XJ6 A;  5HD5 A;  4PKY G;  1TS8 A;  2M1C A;  2VV8 A;  4HOI A;  4R70 A;  5KIZ A;  2H28 A;  3CLO A;  3NJA A;  3K3D A;  4LPZ A;  4EET B;  5HDC A;  2P7J A;  3SW1 A;  3LIF A;  3NOU C;  1GSX A;  3LIE A;  3VOL A;  4NXE A;  5HWV A;  2GJ3 A;  2OWJ A;  3LUQ A;  2VV7 A;  2L0W A;  3UB7 A;  4I5S A;  2ZBB A;  3MQQ A;  3F1P A;  3A0S A;  5DKL A;  2Z6D A;  2QWS A;  4I38 A;  2YKH A;  2WKP A;  4L9F A;  5HDS A;  3H9W A;  2PR6 A;  3GDI A;  3A0R A;  4L9E A;  1OJG A;  2L4R A;  1N9O A;  4KQD A;  2J80 A;  4WL9 A;  3MFX A;  1DP8 A;  1LSV A;  1XJ2 A;  3CAX A;  4B9O A;  2PYR A;  5J3W A;  1TS6 A;  4JGO A;  4R3A A;  4LRZ E;  2V0U A;  3UB6 A;  5HZH A;  4MN6 A;  2B02 A;  3F1P B;  3NHQ A;  3K3C A;  5IS1 A;  4L9G A;  3MXQ A;  4NXF A;  1BYW A;  5HWT A;  1DRM A;  5G4Z A;  3E4O A;  3B33 A;  3HJI A;  1D7E A; 
#chains in the Genus database with same CATH topology
 4BL2 A;  1OJ5 A;  5A93 A;  1PIO A;  2DNS A;  1FCN A;  1V9Z A;  1PWC A;  4Y15 A;  3IXB A;  3LR4 A;  4GJ4 A;  4MN7 A;  2XEP A;  1K57 A;  2WKQ A;  4HBT A;  4FH4 A;  5F69 A;  4Z1W A;  4OQI A;  2Y2M A;  3T4O A;  2WZX A;  5HPI A;  4K0X A;  3NC8 A;  2KX6 A;  1CQA A;  4KQQ A;  4S2N C;  2VGL M;  1NY0 A;  4MDZ A;  3ZG5 A;  3B3X A;  2ZD8 A;  3HUM A;  3L9K A;  2JHE A;  4CPK A;  3BY9 A;  5HL1 A;  3Q07 A;  4OOY A;  5CHU A;  3LEQ A;  4UA7 A;  5A8B A;  2ZC3 B;  2INW A;  5IT5 A;  1IKG A;  4HJ4 A;  1CJF A;  1FIK A;  4FSF A;  4K08 A;  2Y2Q A;  5KZH A;  1BTL A;  1TS0 A;  2ZMA A;  2EFX A;  4ZAM A;  4AFI A;  5L2F A;  1N4O A;  1MWR A;  4QY6 A;  5BOH A;  1FSW A;  1WYB A;  3ZHH A;  4U0X A;  3M2J A;  1J9M A;  4HES A;  4KZ5 A;  2A2L A;  3NDE A;  5EM0 A;  3UDX A;  1K25 A;  4ZJ3 A;  1G5U A;  4K91 A;  3H7W A;  5FQ9 A;  3ZNY A;  4N1X A;  3ULF A;  2WKR A;  4RQ9 A;  4HH3 A;  3GVB A;  2V0W A;  2P08 A;  3CI6 A;  3VFH A;  2K31 A;  1EW0 A;  3MF0 A;  4NEE D;  2XSS A;  4I39 A;  3VSL A;  1S67 L;  1GA9 A;  1O07 A;  3MJQ A;  2H0T A;  3QNC A;  2QHK A;  3SZT A;  4FOF A;  2ZM8 A;  1ZG6 A;  3FPW A;  1K6R A;  3BYD A;  3WS4 A;  1MKI A;  4S2L A;  4DF6 A;  1BLP A;  3D3O A;  1GSW A;  5DF9 A;  3OLO A;  3H7W B;  3EQV A;  2HV1 A;  1ESI A;  5GHY A;  4R3B A;  4NET A;  5U47 A;  2ZQ7 A;  3LYX A;  4C3Q A;  4EES A;  2QJ5 A;  4FCF A;  3OPP A;  4Y0T A;  3JYI A;  1NRJ A;  5DFY A;  4OQG A;  1HLU P;  4FUW A;  1K56 A;  4CJN A;  3F1O A;  1P97 A;  3TJZ C;  4X53 A;  5FAQ A;  3PBO A;  3HLG A;  4B88 A;  2CMN A;  5DTS A;  3TSG A;  1H0M A;  1LSW A;  4HP9 A;  4KUK A;  3N6I A;  3IWO A;  2PHY A;  4R0Q A;  3I7J A;  2JKG A;  3IBJ A;  1YM1 A;  3MMH A;  3HLD A;  5TR7 A;  2AVX A;  1VHM A;  1UWN X;  5IU1 A;  2BLS A;  1AXB A;  5F5Y A;  3M6H A;  4OPQ A;  3HBR A;  3F1O B;  2JKT M;  5CTM A;  5AVF A;  3OOV A;  4KEN B;  5EUA A;  5FQI A;  1JNU A;  2HJ9 C;  2IWD A;  4HH2 A;  4S2J A;  1RGZ A;  2J3T C;  3U4L P;  1RCJ A;  5GHZ A;  2JN7 A;  2JKF A;  1YMS A;  3DTI A;  4LV3 A;  1L0F A;  2G7U A;  3OBF A;  1KDW A;  3BY8 A;  3NBL A;  5F68 A;  4IED A;  3C5A A;  4BJP A;  4B4X A;  3OPH A;  3EEH A;  4EEP A;  1ESU A;  4U0T A;  2ZQC A;  3IBR A;  5MC7 A;  4O8G A;  2KDK A;  1KGE A;  2Y79 A;  3GR2 A;  2ZC4 B;  3IS2 A;  4QWO A;  4N9L A;  1H5X A;  4BMW A;  2Y2K A;  2L1M A;  1W8Y A;  3RH8 B;  4DRT A;  4EQI A;  3BFG A;  3QHY A;  5FQM A;  4P6Z S;  4KZA A;  1W5D A;  4JF6 A;  2W3G A;  1YLJ A;  5F1G A;  1JWV A;  3T4K A;  4X25 A;  1IYQ A;  1OPX A;  4WUJ A;  4ME4 A;  4FD8 A;  4WEK A;  4UA9 A;  1YLT A;  1ODV A;  3IS2 B;  3WS5 A;  1OTA A;  5HDD A;  3C8C A;  1GHI A;  2XLN A;  2B5R A;  4WMC D;  1E25 A;  3N8S A;  2DRW A;  4Q0I A;  4BBV A;  5CGX A;  3BWL A;  3DTM A;  3UB9 A;  3NEC A;  5EVI D;  3PYP A;  2Y2I A;  4MN5 A;  5KSH A;  3T4Q A;  5FI6 A;  3HRE A;  2R9W A;  3S7Q A;  5KMW A;  1ES3 A;  3S7O A;  3T4T A;  5CX7 A;  1XJ6 A;  2EWW A;  1FQG A;  5I94 A;  4CLC D;  5CER A;  2PBY A;  4GZB A;  3UDI A;  2J9O A;  4QB8 A;  2WZZ A;  4S2K A;  3JVU A;  4U3T A;  5KIZ A;  4MBK A;  4ZDX A;  3TRC A;  2H0Y A;  3CLO A;  3S7P A;  2ZJ9 A;  4LPZ A;  4EET B;  5HDC A;  3SW1 A;  3NOU C;  3LIE A;  3WS2 A;  4H8R A;  3AGE A;  1PI5 A;  1Q2P A;  3LUQ A;  2OLU A;  3UB7 A;  1ALQ A;  2EWV A;  2W3D A;  1ONG A;  2KOI A;  4I5S A;  3F1P A;  4RVA A;  4PM5 A;  1KDS A;  4N92 A;  1U60 A;  4B93 A;  2XFS A;  5DKL A;  4KZB A;  1IYS A;  2Y4A A;  4I38 A;  5EE8 A;  2WKP A;  2PR6 A;  1MWT A;  1IYO A;  4JPM A;  3PXP A;  1DJC A;  4WL9 A;  5EVE A;  1J3W A;  1NYY A;  1SCW A;  1W8Q A;  1O7E A;  3UN7 A;  1K4E A;  4DE1 A;  5J3W A;  3UNW A;  3QP8 A;  2GX5 A;  2XH9 A;  3IX3 A;  2O9A A;  4LRZ E;  4UEY A;  4MNR A;  2EX6 A;  3F1P B;  4MLL A;  3NI9 A;  4OLG A;  4WM9 A;  3Q82 A;  5G18 A;  3G6O A;  1XFQ A;  1FCM A;  3OC2 A;  1XP4 A;  3O3V A;  4EER A;  4EBP A;  3MZE A;  2QZ6 A;  4N1H A;  3SS4 A;  5TFQ A;  3Q7Z A;  1Z6F A;  3HL9 A;  2P04 A;  3B42 A;  4R1G A;  5A92 A;  3LCE A;  3HJK A;  3W4P A;  2LB5 A;  3UPN A;  4IBR A;  3AGF A;  4Y3I A;  2W3E A;  3VV4 A;  1WYC A;  1G6A A;  3NUL A;  3IXH A;  2O9B A;  4HHD A;  2IWB A;  2XR0 A;  2QJ7 A;  5EOE A;  2HPB A;  1I2S A;  4KZ8 A;  3ZVW A;  4L0L A;  3E2L A;  1PWD A;  4BQM A;  3SOI A;  4JXG A;  4QD4 A;  4Q0H A;  3G31 A;  4PPR A;  2VJW A;  2V2F F;  3BFF A;  3OPR A;  3N7W A;  3S22 A;  1YSQ A;  4EUZ A;  4M4X A;  2HP5 A;  2B95 A;  5J4E A;  5TBM A;  1TF1 A;  1X0O A;  2X02 A;  3U2A A;  4EUV A;  4JBF A;  2WUQ A;  3CHW P;  1IEM A;  2B18 A;  5M18 A;  2JE5 A;  5AVE A;  2ZOI A;  5DJT A;  4UAA A;  4BD0 A;  3G32 A;  1PNE A;  3S1Y A;  5FSR A;  2EA9 A;  1QME A;  4EQ1 A;  3KSH A;  4QPR A;  2EX2 A;  1FR1 A;  1XA1 A;  3E4P A;  1XJ3 A;  4JXV A;  5FI7 A;  4EBL A;  1PW8 A;  3TOI A;  4KUO A;  1PRQ A;  3T12 B;  3GMW A;  2O0Y A;  3UE1 A;  4WZ5 A;  4K0W A;  1ES4 A;  1T18 A;  2DMW A;  4KG5 A;  3D4F A;  3V5M A;  3BJN A;  3BLS A;  3EQU A;  5TGF A;  3QP6 A;  4PAU A;  1MPL A;  1DP6 A;  5TBM B;  4H6J A;  4LRX C;  3NCK A;  2Q9N A;  2VX8 A;  4G3K A;  1OT6 A;  4EEU A;  4HJ3 A;  1IEL A;  3HLB A;  5CHJ A;  1SKF A;  2PAV P;  4MBF A;  3RTY A;  3ZG7 B;  1KVM A;  4D2O A;  4OON A;  3KSG A;  3T1X A;  3PBT A;  2Y2J A;  2QKP A;  4PM7 A;  1YLY A;  4JKT A;  3CIT A;  4LV0 A;  2PYP A;  3ICY A;  2M7V A;  2K7S A;  1XA7 A;  3MR0 A;  4D60 A;  2Z2M B;  4HQA A;  4DN0 A;  4H6J B;  2XGN A;  4IVI A;  4MMN A;  3PHY A;  3PBS A;  4F94 A;  1ERM A;  3A3E A;  1PWG A;  3FWL A;  4QHC A;  5GHX A;  5AQ7 A;  1EWZ A;  1VB6 A;  5CEB A;  1OT9 A;  1OME A;  4DDY A;  1G28 A;  4R23 A;  4WN5 A;  1XFN A;  2H10 A;  3ZDJ A;  3S7N A;  1JWZ A;  1H8Y A;  1ONH A;  3C7V A;  4DXC A;  5GL9 A;  1LSX A;  1YQS A;  3V3S A;  3NIA A;  1K55 A;  4E3O A;  1K4F A;  3WS0 A;  2FFY A;  5DF7 A;  2JCH A;  3VMA A;  2ZOH A;  4ZRR A;  3UE0 A;  3WRZ A;  1K54 C;  3FG8 A;  2O9C A;  4KQO A;  3C4O A;  3HVF A;  1I2W A;  3UME A;  3NOT C;  3A0V A;  1XKZ A;  4HY8 A;  2Y2O A;  3CJM A;  2XA7 M;  2ZQA A;  2ZMF A;  3QP5 A;  2ZC7 A;  4LEN A;  4LV1 A;  4LV2 A;  1STZ A;  4YNR A;  5GLC A;  3F1N A;  4RA7 A;  2XF3 A;  5DF8 A;  3CZD A;  2HGV A;  1RP5 A;  2J7V A;  5I5L A;  2ZQ8 A;  5FQJ A;  3SH8 A;  2J3W A;  3HLE A;  3PAG A;  4NXG A;  5L07 A;  1FIL A;  3HLW A;  4YIN A;  3K2N A;  5DFX A;  1VEU A;  4QJG A;  2BAS A;  2HZ5 A;  2VEA A;  5FA7 A;  3M2K A;  5HAQ A;  1K54 A;  4BBU A;  2V1B A;  1S66 L;  5A90 A;  2WAE A;  3F1N B;  1LL9 A;  4CQH A;  4ETX A;  4KG6 A;  5DJU A;  3EGD C;  1L2S A;  1W63 Q;  3GRJ A;  1T1B A;  4BD1 A;  1NLZ A;  4Y13 A;  5HD5 A;  4PKY G;  1TS8 A;  1W63 M;  4LFU A;  2XK1 A;  2VV8 A;  4EWF A;  1VEU B;  5EVI C;  4R70 A;  2V1Z A;  3VP4 A;  4XUX A;  2DCF A;  4WBG A;  2H28 A;  4OKP A;  1CEF A;  5EPH A;  1KE4 A;  2P7J A;  1TDG A;  4S2P A;  1WE4 A;  2ACG A;  2WKE A;  1IKI A;  5JYO A;  4KZ7 A;  2OWJ A;  4UHU A;  2I72 A;  2ZBB A;  2R9X A;  3GV9 A;  3V50 A;  3A0S A;  3QP1 A;  3CPT A;  2Z6D A;  4PM9 A;  1BZA A;  2FH5 A;  2XDM A;  3V39 A;  3GDI A;  3N4I A;  4E6W A;  1W79 A;  1QMF A;  2WGI A;  4S2I A;  2NUP C;  3N8R A;  1KE0 A;  1CEG A;  2J80 A;  4WMC A;  3P01 A;  3UPO A;  3UDF A;  1IYP A;  1MKM A;  3Q1F A;  4Y5F A;  2ZMV A;  1AWI A;  5EVI A;  4BLM A;  3C7U A;  3ZCZ A;  4B9O A;  4P6B A;  1IFQ A;  4Z9Q A;  5E2F A;  4JF4 A;  3O5Y A;  5AQ9 A;  1TS6 A;  4R3A A;  2WYX A;  5EM1 A;  3DAV A;  3UB5 P;  4X68 A;  5E2H A;  5M1A A;  2B02 A;  3NHQ A;  5IS1 A;  3CPT B;  1NLY A;  1F2K A;  1NXY A;  1DRM A;  2OAQ 1;  4X1L A;  5G4Z A;  1ZC2 A;  3E4O A;  4P0M A;  4E6X A;  2J8Y A;  3NOP C;  4I3A A;  2G2W A;  1MBL A;  3T1Q B;  5EVI B;  4JGR A;  1JTG A;  5EOO A;  4P87 A;  3MZF A;  4S2M A;  1S1Z A;  1T1C A;  2ZM0 A;  3TW8 A;  1BLC A;  1YT4 A;  2W0N A;  4P85 A;  4OPZ A;  4CLC B;  4JGQ A;  3Q7V A;  1TEM A;  3BQ8 A;  2Z2L B;  4OPR A;  4WYY A;  3ZG9 B;  4IJG A;  1Q2Q A;  2ZL1 A;  3UPP A;  3G34 A;  5F83 A;  3G2Y A;  2Y2N A;  4DXB A;  3MS6 A;  2E8J A;  4EV4 A;  1KVL A;  5CED A;  5GLD A;  4HEF A;  1ERQ A;  4M3K A;  5E2E A;  1VET A;  3CUE C;  3GTC A;  3SH9 A;  3BQA A;  4WF0 A;  2Y2P A;  3FKV A;  4OQH A;  1TVF A;  3O88 A;  3Q7V B;  2XFT A;  2M7U A;  1G6O A;  4C75 A;  3V3R A;  4R3J A;  5HSQ A;  3W4O A;  5FAT A;  1P0Z A;  3LGO A;  1ZTU A;  1BSG A;  2A49 A;  4Q8I A;  1GA0 A;  2W3F A;  2ZL1 B;  1JVJ A;  5EVL A;  3IH9 A;  1UWP X;  4YWZ A;  3BRM A;  3IF6 C;  1VQQ A;  2X71 A;  4WEL A;  3HCY A;  3JVV A;  3W8K A;  1LHY A;  4G3W A;  1P9W A;  4DDS A;  4HIA A;  3LIA A;  3CWF A;  1OTI A;  4P6Z M;  1VET B;  1N9N A;  3PBR A;  1E4D A;  3JPU A;  1A0K A;  3GSG A;  2PRF A;  3ZYT A;  4GOG A;  1XGI A;  2Y2L A;  3UB8 A;  5DKK A;  2PD7 A;  3FC7 A;  5F82 A;  1K6S A;  3CUE A;  2V20 A;  4OP5 A;  2Q0O A;  2WKH A;  1LLB A;  4DJ3 A;  4GDB A;  1MWS A;  1HD8 A;  4IHQ A;  1HTZ A;  2WAF A;  1S4S A;  4OPY A;  2OOL A;  2ZQD A;  2I9V A;  1MY8 A;  3M6B A;  5AJG A;  3D72 A;  3SH7 A;  4GN2 A;  4O7D A;  3DW0 A;  4Y2F A;  3IF6 A;  2EXA A;  5HD3 A;  3W2Z A;  2ZC6 B;  2VGK A;  3EOI A;  2ZC5 B;  3BEC A;  5M19 A;  1WA9 A;  4GLQ A;  2GDN A;  3CMZ A;  3E4Q A;  2HDQ A;  4PMA A;  3LR5 A;  4WLA A;  3O87 A;  1PZP A;  1OTE A;  3DBA A;  3IXG A;  1N9L A;  4WZ5 C;  1JTD A;  1BLH A;  5CHM A;  1XXM A;  3ZQ5 A;  2VGL S;  5DVA A;  1HZO A;  3L7H A;  3ZVT A;  2EX8 A;  1GHP A;  1D06 A;  4PHT A;  3LI9 A;  3LR0 A;  1K0K A;  3B47 A;  3ZG0 A;  1FOF A;  2GNX A;  3IF6 B;  3KSF A;  4E04 A;  1YLW A;  2C5W B;  4KQR A;  4PM8 A;  1N9B A;  1Y28 A;  1XX2 A;  2WK0 A;  2WGV A;  5AQA A;  2XD1 A;  3P7N A;  4NKP A;  2BG1 A;  1TD5 A;  3IHA A;  3VE4 A;  2O99 A;  4OOL A;  4OH0 A;  1W7F A;  3PTE A;  5G4Y A;  1PFL A;  3FZC A;  2ZQ9 A;  1KGG A;  3FV7 A;  3MKF A;  3VE3 A;  2HDU A;  1PYY A;  4JXS A;  5J8X A;  1H8Z A;  5E2G A;  5HX9 A;  2E8I A;  4I3I A;  2XQZ A;  5FDS A;  3ITB A;  5AQB A;  5KSC A;  3RXW A;  4DE0 A;  3LFV A;  4LLO B;  5CGW A;  1ERO A;  5EEC A;  4KZ4 A;  2A24 A;  4NK3 A;  2XRN A;  4ETZ A;  3H82 A;  2X01 A;  4BEN A;  3MSH A;  5D3O A;  1E3U D;  2RCX A;  3NDG A;  3OZH A;  3PBQ A;  4E3I A;  1YLZ A;  3SS5 A;  4EBN A;  2FFF B;  1EI5 A;  5FL3 A;  2JC7 A;  4PKY A;  4GD6 A;  3UO9 A;  2JBF A;  4UA6 A;  1V9Y A;  5DTT A;  3C2W A;  4B4Z A;  1K55 C;  3DWK A;  4GCZ A;  3MQ0 A;  3VP2 A;  2OSU A;  3VSK A;  5HAR A;  2A24 B;  3UE3 A;  5EFW A;  2ZM2 A;  5CGS A;  2VGJ A;  1F9I A;  3H82 B;  1YLP A;  4E3M A;  1XGJ A;  1FSY A;  1JWP A;  2D01 A;  2LB9 A;  3LIC A;  1LL8 A;  3NY4 A;  2V9A A;  3G2Z A;  4OOM A;  4Y17 A;  3LR3 A;  3FPV A;  2M1C A;  1HVB A;  1ACF A;  3RJU A;  3EGX C;  3ITA A;  1P9R A;  3NJA A;  3K3D A;  3SS3 A;  1S6R A;  3LIF A;  4ESP A;  3VOL A;  4NXE A;  1L0E A;  1YAX A;  2GJ3 A;  2VV7 A;  2RL3 A;  2L0W A;  4FTX A;  4ZJ2 A;  3MQQ A;  2HP9 A;  3KYZ A;  2HDS A;  4L9F A;  4GKU A;  3A0R A;  1OJG A;  1FCO A;  4FH2 A;  1N9O A;  4GNU A;  3IF5 A;  3E0Y A;  3MFX A;  5TJJ A;  1F5M A;  4S2N A;  4A5R A;  5L8M A;  5EV0 A;  3CAX A;  3QP2 A;  1PZO A;  4GB7 A;  1Y54 A;  2JKR I;  3DTK A;  4PM6 A;  1H8M A;  2QMI A;  4R4R A;  3C4P A;  4OP8 A;  1SDN A;  1SKO A;  2V0U A;  3UB6 A;  3KYQ A;  1M6K A;  4RX3 A;  4C6Y A;  5IHV A;  1MC0 A;  2OV5 A;  3Q81 A;  3QP4 A;  3B33 A;  3OPL A;  1NRF A;  1LL5 A;  1PI4 A;  1YSP A;  2UV0 E;  3WRT A;  2H5S A;  3IWI A;  3MXR A;  1SZV A;  4GS9 A;  2NUT C;  3BW6 A;  3BLM A;  4JXW A;  1DJA A;  2R78 A;  2VKS A;  4EW7 A;  4MCW A;  1SKO B;  4HJ6 A;  3BM6 A;  4RX2 A;  5GLB A;  2J9P A;  1Z09 A;  4Y7P A;  2A3U A;  3MQO A;  3ISG A;  4E3L A;  4GW9 A;  1DJB A;  3IQA A;  1TDL A;  2OLV A;  1S1Y A;  3HLC A;  3LID A;  5DTK A;  5C5K A;  2W3H A;  1L3L A;  1Y4O A;  2Z6C A;  3W4Q A;  2WGW A;  5GLA A;  4OLD A;  3IT9 A;  5CEC A;  3MKE A;  2PR5 A;  5F1F A;  3PR6 A;  5CTN A;  4YOF A;  2WAD A;  4GS9 B;  5FAP A;  4CLC C;  2VK3 A;  2Y59 A;  4JGP A;  4BL3 A;  3TE8 A;  2FZ0 A;  5HL6 A;  2HDR A;  2CC1 A;  3MFD A;  1D1J A;  3PBN A;  3N8L A;  5FAO A;  1KOU A;  1ES5 A;  1K56 D;  4HNB A;  1MWU A;  4XXR A;  3RFB A;  2HP6 A;  3BFE A;  3A3J A;  2Y8H A;  4LCL A;  3DWZ A;  4JLF A;  3LY4 A;  4BWI A;  3LO7 A;  1S4R A;  4HI4 A;  1BUL A;  1VM1 A;  4X69 A;  2WGW B;  5FDH A;  4Y0O A;  3ZG8 B;  3OCL A;  2W27 A;  4EXO A;  4LRY C;  4XUZ A;  5LBR A;  1IOU A;  3VOY A;  1PW1 A;  4ZJ1 A;  3HLF A;  3G30 A;  3G4P A;  4G3V A;  3T4S A;  1UGU A;  5FQK A;  3A3D A;  3D9Y A;  4CLC A;  3BFD A;  3IX8 A;  3BFC A;  5L10 A;  4NG2 A;  5L09 A;  3GEC A;  3HUN A;  1TS7 A;  1YMX A;  3O86 A;  3UY6 A;  4NXB A;  3KYE A;  2YKF A;  1SDE A;  4RYE A;  3VP3 A;  3GQZ A;  1F98 A;  3IX4 A;  2PD8 A;  1K38 A;  3UE6 A;  3ZNT A;  3HUO A;  4MEZ A;  3G35 A;  1CF0 A;  2XRO A;  4F3L A;  1RGY A;  4I3J A;  4XT2 A;  3LY3 A;  1OTD A;  1L0G A;  4ARZ A;  3IHB A;  1YPR A;  1LT0 A;  2IA2 A;  3WWX A;  1T1A A;  5HWW A;  2C6W B;  4DKI A;  4LCM A;  1CI8 A;  2K2N A;  3T1S A;  4IUH A;  2W1T A;  4ZBE A;  4ID4 A;  4GHI A;  2UWX A;  1BLS A;  3QNB A;  4MBH A;  3MBZ A;  1DP9 A;  3T4L A;  2OAP 1;  1LI0 A;  3VFF A;  3RXX A;  5F6A A;  4JF5 A;  2J3T D;  5J7E A;  3DTE A;  1MZU A;  2OWH A;  4KZ9 A;  1ZHH B;  5HFO A;  3AGD A;  1KE3 A;  3IH8 A;  3T50 A;  1H3Q A;  4F3L B;  3P98 A;  2Y55 A;  4XT2 B;  3FYZ A;  4Q0J A;  4ARZ B;  3KO6 A;  2KLI A;  4II7 A;  1ZG4 A;  2HF6 A;  5K5B A;  4R38 A;  2V1A A;  1SHV A;  2PU2 A;  4KZ6 A;  1LI9 A;  3MZD A;  2PBD P;  2W1T B;  1GHM A;  4GHI B;  2GZA A;  3LIB A;  4LGW A;  2BTF P;  4QU3 A;  2WKI A;  2PDR A;  3BEB A;  4GDN A;  1C3B A;  1OTB A;  4DMZ A;  2Y2H A;  3R4K A;  2VV6 A;  2VLG A;  1NJ4 A;  3CG5 A;  1BUE A;  2VZW A;  4EU0 A;  1DY6 A;  1BT5 A;  4UQI S;  1NZU A;  2P74 A;  5FEG A;  4X55 A;  4BBT A;  1NWZ A;  3VP1 A;  3KX0 X;  1ZKJ A;  2G2U A;  5FEF A;  1T19 A;  4DJ2 A;  3E2K A;  4CLC E;  2D02 A;  2JKT I;  3LI8 A;  5FI2 A;  2Q9M A;  4X1M A;  4DE3 A;  4KZ3 A;  4E3N A;  3VOZ A;  4R6L A;  3S4X A;  3OCN A;  2EFU A;  1I5Q A;  3TG9 A;  4GD8 A;  1CI9 A;  2QYB A;  4QY5 A;  2MJ6 A;  3R7W A;  4N9K A;  2ZLY A;  3UMD A;  4HP4 A;  3MXS A;  3P09 A;  5JYP A;  1GSV A;  4X6T A;  3A3F A;  4KG2 A;  3V67 A;  4E3K A;  5HW3 A;  3EWK A;  1CK3 A;  1GCE A;  1XJ4 A;  1MXO A;  3C38 A;  2QPN A;  1FR6 A;  4R4S A;  4IBX A;  5E43 A;  2JKR M;  3FKW A;  3T4J A;  4HOI A;  3E98 A;  5HAP A;  2EX9 A;  5CXW A;  3LEZ A;  3KSI A;  3R7W B;  1G68 A;  3ZFZ A;  1GSX A;  1L0D A;  4WZ4 A;  1NYM A;  5HWV A;  4O0P A;  1E3U A;  2PU4 A;  1YKD A;  1S0W A;  2EXB A;  5HPF A;  5A91 A;  2XD5 A;  3EEA A;  2P9V A;  4O01 A;  3T1R A;  1ES2 A;  4X56 A;  2QWS A;  4YFM A;  4HBU A;  5FQQ A;  2YKH A;  4E3J A;  3IWQ A;  5HDS A;  3H9W A;  4L9E A;  2L4R A;  3C30 A;  1NZO A;  2V8F A;  4KQD A;  1KGF A;  1DP8 A;  1LSV A;  3PAE A;  3VP0 A;  4UQI M;  1XPB A;  1K57 C;  1XJ2 A;  5HAI A;  2PT7 A;  2HJE A;  2PYR A;  3IXD A;  2W1R A;  2XA7 S;  4S2O A;  2Y91 A;  3WS1 A;  3ZGA B;  4JGO A;  4IVK A;  4WEJ A;  3A3I A;  5HZH A;  2V8C A;  4MN6 A;  4IUK A;  3K3C A;  5FAS A;  4L9G A;  2P9V B;  3MXQ A;  2VA0 A;  1BYW A;  4NXF A;  5CRF A;  4DE2 A;  4OQ0 A;  4Y0U A;  5HWT A;  4OVD A;  2Y2G A;  2IWC A;  4ZTK A;  3HJI A;  1M40 A;  1D7E A; 
#chains in the Genus database with same CATH homology
 3G6O A;  1XFQ A;  3NOP C;  4I3A A;  1OJ5 A;  3OC2 A;  4EER A;  1YSP A;  1V9Z A;  4JGR A;  4GS9 A;  2NUT C;  3BW6 A;  2P04 A;  3B42 A;  2R78 A;  2VKS A;  3LR4 A;  4EW7 A;  4MCW A;  1S1Z A;  4GJ4 A;  1T1C A;  3HJK A;  3TW8 A;  2LB5 A;  4HJ6 A;  4MN7 A;  2WKQ A;  3MQO A;  5F69 A;  2W0N A;  4GW9 A;  4CLC B;  4Y3I A;  4Z1W A;  4JGQ A;  3T4O A;  2W3E A;  1S1Y A;  3VV4 A;  3BQ8 A;  5HPI A;  3LID A;  2KX6 A;  2VGL M;  2O9B A;  4HHD A;  5C5K A;  2W3H A;  2QJ7 A;  4IJG A;  4MDZ A;  2JHE A;  3BY9 A;  2Z6C A;  4L0L A;  2PR5 A;  5A8B A;  3PR6 A;  2INW A;  5IT5 A;  4YOF A;  4GS9 B;  4HJ4 A;  4CLC C;  4FSF A;  4K08 A;  4JGP A;  3TE8 A;  4Q0H A;  2FZ0 A;  5HL6 A;  1TS0 A;  2VJW A;  3CUE C;  4AFI A;  3PBN A;  1YSQ A;  3BQA A;  4M4X A;  4WF0 A;  1KOU A;  5J4E A;  4HNB A;  5TBM A;  1TF1 A;  1X0O A;  3U2A A;  2M7U A;  4EUV A;  1G6O A;  3RFB A;  2B18 A;  2A2L A;  5AVE A;  2ZOI A;  2Y8H A;  5DJT A;  5HSQ A;  3H7W A;  1P0Z A;  1ZTU A;  4BWI A;  3ULF A;  1S4R A;  4HI4 A;  2WKR A;  2W3F A;  4RQ9 A;  1UWP X;  4HH3 A;  2EA9 A;  4YWZ A;  4EQ1 A;  2V0W A;  3KSH A;  2P08 A;  3OCL A;  2W27 A;  4QPR A;  3CI6 A;  4EXO A;  3E4P A;  1XJ3 A;  4LRY C;  5LBR A;  1IOU A;  4WEL A;  2K31 A;  3HCY A;  3JVV A;  1EW0 A;  4G3W A;  4KUO A;  3MF0 A;  4NEE D;  4G3V A;  3T4S A;  1P9W A;  2O0Y A;  2XSS A;  4I39 A;  1S67 L;  4HIA A;  1UGU A;  3LIA A;  3CWF A;  3MJQ A;  1T18 A;  1OTI A;  4P6Z M;  2DMW A;  1N9N A;  3PBR A;  2QHK A;  3BJN A;  4CLC A;  3EQU A;  4FOF A;  3ZYT A;  3FPW A;  4PAU A;  1DP6 A;  5TBM B;  3UB8 A;  3GEC A;  4H6J A;  2PD7 A;  4LRX C;  5DKK A;  3FC7 A;  2VX8 A;  1TS7 A;  4G3K A;  3D3O A;  1GSW A;  3CUE A;  4NXB A;  1OT6 A;  4EEU A;  5DF9 A;  4HJ3 A;  3OLO A;  4DJ3 A;  2YKF A;  3H7W B;  4IHQ A;  3EQV A;  2HV1 A;  1S4S A;  3RTY A;  2OOL A;  1F98 A;  3LYX A;  4EES A;  3KSG A;  2PD8 A;  3UE6 A;  2QJ5 A;  3PBT A;  2QKP A;  2I9V A;  3CIT A;  5AJG A;  2PYP A;  3D72 A;  3ICY A;  2XRO A;  1NRJ A;  4F3L A;  4I3J A;  4XT2 A;  2K7S A;  1OTD A;  5DFY A;  2M7V A;  4Y2F A;  4ARZ A;  3F1O A;  1LT0 A;  5HD3 A;  1P97 A;  3W2Z A;  2IA2 A;  3TJZ C;  1T1A A;  5HWW A;  3MR0 A;  3EOI A;  3PBO A;  4HQA A;  4DN0 A;  4H6J B;  2K2N A;  4IUH A;  2W1T A;  2CMN A;  1WA9 A;  4GLQ A;  4MMN A;  3PHY A;  3PBS A;  4GHI A;  3E4Q A;  1LSW A;  3LR5 A;  1DP9 A;  4HP9 A;  3T4L A;  4KUK A;  4WLA A;  2OAP 1;  1OTE A;  2PHY A;  3DBA A;  1N9L A;  3IBJ A;  5F6A A;  3ZQ5 A;  2J3T D;  5J7E A;  2VGL S;  3MMH A;  1MZU A;  1VHM A;  2OWH A;  1ZHH B;  1VB6 A;  1OT9 A;  1UWN X;  1D06 A;  1G28 A;  5IU1 A;  3T50 A;  5F5Y A;  4PHT A;  1H3Q A;  3LI9 A;  4F3L B;  3LR0 A;  3B47 A;  4WN5 A;  4XT2 B;  4Q0J A;  1XFN A;  4ARZ B;  3KO6 A;  2GNX A;  2KLI A;  3F1O B;  3KSF A;  4II7 A;  4E04 A;  2JKT M;  5AVF A;  3OOV A;  2HF6 A;  5K5B A;  2HJ9 C;  1JNU A;  4HH2 A;  1Y28 A;  3S7N A;  4R38 A;  2V1A A;  2J3T C;  3P7N A;  4NKP A;  1TD5 A;  3VE4 A;  1LSX A;  2W1T B;  2O99 A;  4OOL A;  2JN7 A;  4GHI B;  2GZA A;  5G4Y A;  3LIB A;  2G7U A;  3OBF A;  2PDR A;  3VE3 A;  1OTB A;  3BY8 A;  4DMZ A;  2ZOH A;  4ZRR A;  5F68 A;  3R4K A;  4BJP A;  2VV6 A;  3FG8 A;  2O9C A;  4KQO A;  2VLG A;  3EEH A;  4EEP A;  3UME A;  3NOT C;  3A0V A;  4I3I A;  4HY8 A;  3IBR A;  5MC7 A;  2VZW A;  2XA7 M;  4O8G A;  2KDK A;  4EU0 A;  2ZMF A;  4UQI S;  2Y79 A;  3IS2 A;  1STZ A;  3LFV A;  4LLO B;  4BBT A;  1NWZ A;  4YNR A;  4BMW A;  3F1N A;  2A24 A;  2XRN A;  4ETZ A;  2L1M A;  3KX0 X;  3H82 A;  3RH8 B;  4P6Z S;  1T19 A;  2HGV A;  4DJ2 A;  4CLC E;  2D02 A;  2JKT I;  3LI8 A;  5I5L A;  2W3G A;  2J3W A;  3T4K A;  3PBQ A;  4NXG A;  1OPX A;  4WUJ A;  4R6L A;  4ME4 A;  5FL3 A;  3K2N A;  5DFX A;  4PKY A;  3OCN A;  2BAS A;  2VEA A;  4WEK A;  2QYB A;  1ODV A;  1V9Y A;  3IS2 B;  1OTA A;  2MJ6 A;  3C2W A;  5HDD A;  3R7W A;  3C8C A;  4BBU A;  2V1B A;  4GCZ A;  1S66 L;  3MQ0 A;  3UMD A;  3F1N B;  4HP4 A;  2A24 B;  4Q0I A;  4BBV A;  3UE3 A;  5EFW A;  4CQH A;  3BWL A;  1F9I A;  3H82 B;  3UB9 A;  4ETX A;  1GSV A;  3PYP A;  5DJU A;  3V67 A;  4MN5 A;  5KSH A;  3EGD C;  3T4Q A;  3EWK A;  1W63 Q;  2D01 A;  2LB9 A;  1LL8 A;  3LIC A;  3S7Q A;  1T1B A;  1XJ4 A;  2V9A A;  3C38 A;  3S7O A;  4OOM A;  1NLZ A;  3T4T A;  5CX7 A;  1XJ6 A;  5HD5 A;  2EWW A;  4PKY G;  1TS8 A;  1W63 M;  4CLC D;  3LR3 A;  3FPV A;  2M1C A;  2VV8 A;  2JKR M;  3T4J A;  4HOI A;  3EGX C;  4R70 A;  3E98 A;  3JVU A;  5KIZ A;  3KSI A;  2H28 A;  3TRC A;  3CLO A;  1P9R A;  3NJA A;  3R7W B;  3S7P A;  3K3D A;  4LPZ A;  4EET B;  5HDC A;  2P7J A;  3SW1 A;  3LIF A;  3NOU C;  1GSX A;  3LIE A;  3VOL A;  4NXE A;  5HWV A;  4O0P A;  1YAX A;  2GJ3 A;  2OWJ A;  1YKD A;  2VV7 A;  3LUQ A;  2L0W A;  3UB7 A;  2EWV A;  2W3D A;  2KOI A;  2ZBB A;  3MQQ A;  4I5S A;  5HPF A;  3F1P A;  3A0S A;  3EEA A;  4O01 A;  4B93 A;  5DKL A;  2Z6D A;  2QWS A;  3KYZ A;  2FH5 A;  4I38 A;  2YKH A;  2WKP A;  4L9F A;  5HDS A;  3H9W A;  2PR6 A;  3GDI A;  3A0R A;  4L9E A;  1OJG A;  2L4R A;  3C30 A;  2NUP C;  1N9O A;  4KQD A;  3PXP A;  2J80 A;  4WL9 A;  3P01 A;  3E0Y A;  3MFX A;  5TJJ A;  1DP8 A;  1LSV A;  4UQI M;  1F5M A;  1MKM A;  4Y5F A;  2ZMV A;  5L8M A;  1XJ2 A;  3CAX A;  4B9O A;  2PT7 A;  2HJE A;  2JKR I;  1IFQ A;  2PYR A;  5J3W A;  1H8M A;  2W1R A;  2XA7 S;  3O5Y A;  2GX5 A;  1TS6 A;  4JGO A;  4R3A A;  2O9A A;  2V0U A;  4LRZ E;  4UEY A;  3UB6 A;  3KYQ A;  4WEJ A;  5HZH A;  4MN6 A;  2B02 A;  3F1P B;  4IUK A;  3NHQ A;  3K3C A;  5IS1 A;  1MC0 A;  4L9G A;  3MXQ A;  2VA0 A;  1BYW A;  4NXF A;  1NLY A;  5HWT A;  2OAQ 1;  1DRM A;  5G4Z A;  3E4O A;  3B33 A;  3HJI A;  1D7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...