4EEWA

Crystal structure of the ubl domain of bag6
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
74
structure length
74
Chain Sequence
b'PDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Large proline-rich protein BAG6
publication title Crystal structure of the Ubl domain of BAG6
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 19
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4eewA00
3B1LX 3VTWA 1Q5WB 4LCDE 2AL6A 4BKTA 2GBJA 1WJ4A 4YL8A 3L54A 3NZUA 2XEWA 5C1ZA 5AZHA 4CYEA 2I1JA 1WJUA 4ANUA 3H7PB 2NBVB 3ZNGC 2N7DA 4W9IA 3NOBA 4TQ0A 2D10A 2LZ6A 4K7WA 3PRPB 3WAMA 3GZNI 2A5UA 4F7ZA 3JYUA 4I6LB 4BFRA 4WWOA 3GOEA 4OVUA 3DDCB 1K8RB 3AU4A 2UWQA 4E71A 5CHWA 3K9PB 2LI5A 5AEKB 4HWIB 2M1MA 3H6NA 3HM6X 3M63B 4M8MA 4G3XB 3UF8A 3W1SC 3L10B 4NQKE 5JHBA 1C3TA 3R3MA 5LXHA 2KN5A 1VCBA 2PE6B 2UYZB 2XBBC 3CMMB 4FJZA 3UQAA 4KZCA 1P1AA 5JH5C 3QIJA 1EF5A 3DVNV 1EUVB 3PV1A 5CTRC 3ZNZB 4MSMB 2Z0EB 2CHXA 2K8BA 2D07B 1M94A 4K7UA 1XD3B 2J0KA 2KQSA 4KV2A 3VH4B 2L00B 1E8WA 2IZVB 2KK8A 2KHWB 4BBNF 3T8MA 4DXAB 2CKHB 1RLFA 1YX5B 1GUAB 2R2OA 2L0TA 4MJSB 2C7MB 1E8ZA 4FA6A 2GBNA 1I35A 1KLVA 4KSLC 2BKRB 2IY1B 3RCZA 1NI2A 2JXXA 1ZGUB 3IFWB 1PQSA 2KO3A 3DBHI 3PREA 4RM9A 4W9HA 2JRIB 1Z2MA 2KFKB 3SDLC 3V6CB 1E8YA 1UELA 2V1YA 3LJ3A 2M4NA 2K1FA 3PLVA 2KANA 2L76A 1J0GA 2LGYA 4ZRKA 4M0WB 2O6VB 1J8CA 1S3SG 2KX0A 5LXIB 3HK0A 2FNJB 3ENEA 4BKSD 2O2VA 4IM2A 1U4AA 2PJHA 2HTHA 1UH6A 2CHWA 3IBEA 4F1SA 4MGYE 1EO6A 3BINA 4BKSA 2REXA 1E8XA 1X1MA 2NBWB 2NBUA 1V5OA 2GOWA 4KIKB 2J0JA 2NPTA 2YLMA 4FADA 4JIOU 1IPGA 2KTFA 4GB9A 4LDTB 2V3SA 2IY0B 4DHZB 3MTNB 1WXAA 2L0FA 3ZDMC 4ICVA 3JSVA 1GC7A 4AJYB 2GMIC 3RT3B 2LD9A 2V4LA 4IC7B 2MCNB 2FIFA 3PHWB 4HXDA 4BOZB 4PYUA 3BY4B 2OJRA 2XK5B 2DYOA 2KMCA 4JL9A 4NAWB 1RAXA 4GDKB 3ZDTA 2D11A 2N1WA 1Q1OA 1RRBA 2N1VA 2KZRA 5CX3A 4FULA 5IAAC 3L08A 2ZZPB 1MG8A 2RSUA 3DCGA 3DBRI 3A9JA 5J17A 4DK5A 4B6WA 4HDQA 2LRUA 4XC2A 2KC1A 2ZPYA 5EDSA 2LVQA 4HDOA 5E6OA 2MBOA 2NCNA 1E7VA 4KDLB 3AI5A 2FCQA 4FHJA 1WX8A 3A1QB 1OEYJ 1WXMA 2HD5B 1AARA 4BOSC 1WR6E 3WAPA 4WAAA 1WGDA 1QZEA 1WMHB 3IG3A 3UIOB 5D94A 4GMVA 2FIDA 3P2BA 3RZFA 3QCAA 2KC2A 4IWPA 3APFA 3ZO5B 4GDLA 4ZRJA 1T0YA 4MDKE 1V80A 4IUMB 1KOTA 4AWJA 1L2NA 2KWUB 3QARA 1Z5SB 4HCPB 3H1UA 3PLUA 4LDTD 5D6JB 2KDIA 2CR5A 2RR9A 1WRDB 2N9XA 4MSQB 2GBMA 4K1RB 3W1YA 3ZRCA 3N32A 1HE8A 2DX5B 2ZCCA 2KLGA 4LJOB 1KJTA 3S2AA 3Q3JA 3V61A 3T9LA 2QHOA 3L16A 3VUYA 1YX6B 4MEMA 1ISNA 1WZ0A 2M17A 1WYWB 1GC6A 2NVUI 3AU5A 3APCA 3ZVVA 4DWFA 2KDBA 4MM3A 5E6NA 1E90A 3A9KA 5AZFA 1YJ1A 4GGQA 5GMVA 1P0RA 4TUUA 2CHZA 3NHEB 4HJKA 3ZTDA 2LXAA 4ANWA 2KTRB 3CF6E 3ZW3A 4EKUA 2BYFA 2JF5A 2BYVE 3TIXA 4NY0A 3ZRFA 5D7GA 2J7QB 2DYBA 1WIAA 3DPDA 2DZIA 5J18A 1Y8RC 4MGIE 3PPAA 3UINB 1KM7A 2A4ZA 3VUXA 2KJHB 2DHZA 1YIWA 1LFDA 4PS8A 2C7NB 2HJ8A 2MP2A 4TKNA 3C0RB 4DDID 1TBEA 2BPSA 1RFAA 4KDIC 1V81A 2JT4B 3HM3A 3ZIMA 3U30A 2KDEB 4E74A 3X23A 1WF9A 5CHVC 4W9KA 4KZ0A 3DBSA 4A3OA 4HK2A 2KX3A 2BF8B 3DVNU 4NJ7A 5DPRA 2GBKA 2IO2B 3DOWA 3TJPA 2LRWA 3PVLA 1WGYA 4A20A 1V9JA 2DZMA 4EEWA 4DBGA 2AEHA 1WE7A 1WM3A 1WGGA 2VRRB 3B08A 2M0XA 1ZKHA 4HVBA 2C9WB 4X57B 5DPTA 4K7SA 1NBFC 2JZZA 3A4SC 2BGFA 2JWZA 3H7PA 4WJQA 3QWZB 3PSEB 3VVWB 2KD0A 2DAFA 3OJ3A 2IO3B 2MWSB 3LDZE 2JUOA 5TR5A 3PZDA 5DPWA 3B0AA 2DENB 2EMTA 5KHQA 4NQLB 2OOBB 1GG3A 2G4DB 3EC8A 1WGRA 4EZLA 1WJNA 4EUTA 2CS4A 4IWQA 2KXJA 3W1SA 1UZXB 4G0NB 2JY6A 4ANXA 3ZUNA 2WYQA 3H7SA 1FXTB 1OTRB 3VAWA 2LVPA 3TL5A 1S1QB 2DZJA 3VQIA 1V2YA 1V49A 1VD2A 2ASQA 4ZYNA 4GIVA 3A33B 4BKGA 2JZ3B 3VTUA 2L7RA 3V62A 3EFUA 3VH3B 3ZTCA 3TMPB 2IO1B 4CO7A 1WR1A 5HKHA 2LXCA 1H4RA 2LGDA 1V6EA 2EKEC 4PS7A 2LWPA 3WANA 1WZ3A 1H8CA 2KMAA 3L0WB 4AP4C 3QHTA 1C1YB 4WWPA 4WQOB 5DPSA 3VFKA 2KJ6A 5CHFA 4XZ4A 2ZPNA 4LJPB 3PT2B 4IW0A 3WA0A 2MX2A 4FHKA 2MBBB 2KFKA 3MJWA 4JQWC 2O6VD 3R7RA 3DBLI 1A5RA 2AYOB 2J0MA 2B3AA 2L05A 4MH0E 4G11A 4P7IA 1WX9A 3NY5A 3M95A 3OAWA 4W9JA 4NPNA 4WJPA 5BO4B 4ZDVA 2G45B 1YQBA 4E3CA 2C5LC 4DDGD 2C7HA 3I3TB 3KUDB 3ECIA 4F8CB 1BT0A 4JGHB 4I6NB 2BWES 2IYDB 4EZKA 2MW5A 1WXVA 3L13A 2FAZA 2MP2B 5G2NA 2PE9A 3NS8A 4KSKC 3AULA 4GOCA 4KIKA 4BBNC 1F9JA 3DQVA 3U8ZA 4WWNA 3PS6A 4G50A 1UD7A 2D3GA 2L3ZA 3QX1A 5FR6A 4DHZE 2EMSA 4NJ6A 1J19A 5D2MB 3VHTC 1SGHA 2HE7A 4EZJA 4HLEA 3WIMA 1WJ6A 1WX7A 3PHXB 1WFYA 2KWVB 1CMXB 4HPMB 1WGHA 1EF1A 3QJZA 4IG7B 4IM3A 4HCNB 1Q0WB 2JRHA 2O2VB 1V5TA 3KUZA 2FCSA 3H9DA 2DAJA 2XK5A 4PYZA 4NAWA 4GDKA 3X0WA 2KNBA 2BKFA 4K81A 1R4MI 4PS3A 1LQBA 2RD0A 3KYCD 5JZEB 2IBIB 4ICUA 5JHAA 2KKCA 1I42A 2MA9B 2NPTB 3R7QA 3DVGY 3UIPB 1NDDA 2LGXA 1WI0A 3VTVA 3DVGX 4ZRIA 1TZ1A 5E6PA 2ZEQA 2DZKA 3U7DA 1R4NI 2KDFB 3JSVB 3PTFC 2G4SA 2WWZA 2MSED 3KVFB 4WJNA 4B9KA 2I1KA 4II2B 3ALBA 2FCMA 3A1QA 3M62B 4II3B 4RM8A 3IHPC 2LJ5A 2ZJDA 1OEYA 2D2QA 3KUCB 3OJ4B 2KOXA 2ZVOA 2MBQA 4GSWA 4RMAA 3RUIB 3Q3FA 1GNUA 3RULA 2KQ7A 1XT9B 4BVUC 2N7EA 3AXCA 2R2QA 4WJOA 1WMHA 2K6DB 3D32A 1UBQA 4TQ1A 5L83A 1LXDA 2FUHB 3O65B 1TTNA 1WM2A 2G3QB 2MRPA 3A9JB 1XQQA 2BYEA 2AL3A 4GU2A 4FJVB 2KVRA 3PRMB 4FLHA 3RZWC 1OGWA 4B95A 1TGZB 4MGZE 3JW0X 4I6PA 4TV3A 1OQYA 3CSTA 4OVVA 4KVGB 4FBJB 3A4RA 4XX5A 1P3QU 2Z0DB 3TBLD 5IA7A 1GJZA 2KJRA 3VDZA 4AJWA 4W9LA 3KH0A 3V6EB 4AOFA 3RD2A 4DHJB 3ML9A 3SHQA 3SD5A 2Z59B 1E7UA 2LASA 3CSFA 3WAOA 3M3JA 3N3KB 5AZGA 2Y5BB 2LUEA 4W9CA 4EFOA 2M8SA 4URKA 2K8CA 5LLIA 4GDLB 4W9EA 2CU1A 1WE6A 2IO0B 1IYFA 3VXWA 3IVFA 5L95C 2RPQA 3JVZX 2JVCA 2FCNA 2K25A 2K8HA 3N30A 3UGBB 2WX0A 1WH3A 3OLMD 2KTRA 4W9FA 2GBRA 2MLBA 4W9GA 5DCNA 1JRUA 3L17A 2PEAA 1L7YA 2JPHA 1LM8B 4J6IA 4M8NA 3ZKJC 3ZNID 2WDTB 2N4FA 4FN2A 3APDA 3ZLZA 4HPLB 1D3ZA 3V60A 3K9OB 1SIFA 2LVOA 2NS5A 2NR2A 3HHMA 5G55A 1YD8U 1SE9A 4MGKE 3SU8X 4ANVA 4N9F4 3UQBA 4MJSA 1G6JA 3KW5B 5KHOA 4A3PA 2AWTA 2PPHA 3QK0A 2ZNVC 1ZW7A 3A9KB 1E5WA 5J2RA 4IM0A 3HIZA 2N9EB 3R66C 4ASWC 3MHSD 2ZNVB 1V86A 3KYDD 4MELA 1WXSA 4JLCA 3EECA 1IP9A 2WX1A 2C60A 2O6VA 3TCAA 2DYMA 3QAQA 2N9PC 2K39A 3VUWA 3RYTA 2MBHA 2W9NA 3ONSA 1P98A 2RGFA 4AUQC 1UGMA 3NZSA 4IWOA 3ZNHB 3QQ8B 4DHJD 3EHVA 3PGEA 2MQJA 4FJYA 3ML8A 4EOYA 2KLCA 1WY8A 2ZCBA 3QA8A 3QC8B 4GN1A 4NNJB 4W9DA 2BWFA 5C23A 2ZVNA 1UBIA 2YVCA 2K6QA 2KFJA 2MBEA 4GXBA 1P9DU 2KWCA 3WALA 2L8JA 3PRZA 4CHKA
chains in the Genus database with same CATH superfamily
2L52A 3TSSA 2BS4B 1T0QC 3L54A 1QOGA 2XEWA 4CYEA 1WJUA 3J9CA 4OHJA 1TS2A 3Q3OC 3PRPB 2N0SB 1PUTA 3GOEA 3DDCB 4O1NA 2LGIA 1EWCA 2M1MA 4M8MA 2LGSA 2MJDA 2BW2A 3R3MA 2HJ1A 1VCBA 1JWUD 5JH5C 3DVNV 1EUVB 4MSMB 3Q8AA 1IGCA 4KV2A 3VH4B 4BBNF 2Q5WD 1N62A 3U4EG 1F77A 3Q14C 3RCZA 1FCCC 1NI2A 2W3RA 4YTMB 3PREA 2KFKB 1Z2MA 1KRHA 2L76A 3ZQ4A 5HG2A 3RPFC 4ACFA 3GP7A 1J8CA 1XXGA 1ZP0B 3Q69A 1C78A 4BKSA 1D5ZC 2REXA 1AN8A 2V3PA 2NBUA 4KIKB 2J0JA 2BB5A 2NPTA 2YLMA 2TSSA 4GB9A 3NRZA 4H2AA 4DHZB 4CQNA 3VRAB 3DBHB 1WXAA 3ZDMC 2R61A 2GMIC 2LD9A 2MCNB 2FIFA 3PHWB 1SJED 1KF6B 3BY4B 2PKOA 1UGJA 4AQ7A 4NAWB 2OHFA 2N1WA 1RRBA 2N1VA 1JW9D 2ZZPB 1NYQA 2IGGA 4R3DA 2WXMA 4DK5A 4HDQA 2KC1A 3T3NA 5IOIA 4P16A 4HDOA 2NCNA 4D2KA 1MPEA 4ITKA 3NZ3A 2LHEA 1QZEA 1WMHB 2MJEA 5D94A 3OG5A 4KKJA 5H92C 1L5PA 3QCAA 4NAMA 1K53A 2LUMA 3APFA 3MC8A 4MDKE 1V80A 4IUMB 1JWSD 3LB8C 4HCPB 3AM9A 2KDIA 2CR5A 1N63A 1MI0A 3W1YA 2DLBA 3ZRCA 3N32A 1ISNA 1WZ0A 1XLNA 4YTPB 2JYTA 1WYWB 1MJDA 5E6NA 3P4QB 5AZFA 1T0SC 4A8XC 4KX6B 2BYVE 5C3JB 5J18A 2A4ZA 2G9HD 1ZPSA 2FUG1 1RFAA 1V81A 1FXIA 2JT4B 1I4HA 3U30A 3ZIMA 5HFYA 1V8CA 2FBWB 3AE9B 1YMHE 4HK2A 4NJ7A 5HHDG 1ZDVA 2LRWA 3PVLA 2IDYA 2DZMA 1WE7A 1QOBA 3B08A 3AE3B 1ZKHA 1E6EB 2BVCA 2JZZA 4WJQA 2BBCA 2DAFA 2MWSB 4EE2A 1C4PA 1N60A 1MHXA 2DENB 1HZ6A 1WGRA 1FIQA 1WJNA 4EUTA 2CS4A 2KXJA 4G0NB 1UWMA 3ZUNA 2WYQA 4WQMA 1OTRB 1SB3C 3VAWA 2LVPA 3TL5A 1V49A 3P4SB 4ZYNA 3A33B 3Q8CA 2L7RA 3TMPB 2IO1B 2BB6A 2LGDA 1MVKA 1NENB 1CK1A 4REZA 4PS7A 1XLQA 1ZXHA 2CU3A 4ZHOA 4LJPB 3PT2B 2QILA 2O6VD 1Q10A 1STEA 1YJIA 2L05A 1F52A 3OAWA 4NPNA 2L1AA 4ZDVA 2RMMA 3GE3C 1YQBA 2C5LC 2C7HA 3NJTA 3KUDB 1FXAA 3HUIA 4F8CB 3EGRA 2MHJA 2BWES 2IYDB 2MW5A 3CWIA 3L13A 2FAZA 1AWDA 4GOCA 1TS5A 4XYCA 3U8ZA 3N1XC 2L3ZA 5FR6A 1EM7A 2GLSA 4EZJA 1SGHA 3TEZA 4HLEA 1WX7A 4YT0B 2KWVB 3AEAB 3QJZA 4UDUC 3P42A 2JRHA 2O2VB 2KQ4X 2DAJA 1BUIC 2WXOA 4GDKA 3X0WA 2IBIB 2KKCA 3W5UB 5AUIA 4ZRIA 2PVGC 1R4NI 1TY0A 1CZPA 2G4SA 2I1KA 2WHIA 2J53A 1XLPA 2LJ5A 2ZJDA 3SFDB 2MBQA 3IXSA 3RULA 1XT9B 2R2QA 4TQ1A 1UBQA 5L83A 3O65B 1KTKA 1TTNA 2G3QB 4WWMA 4LLGM 3GZNB 1JWBD 1N61A 2CJOA 3RZWC 1OGWA 2INDC 1TGZB 3URYA 1VR9A 4HKQA 5IA7A 2LFIA 3GB1A 2KJRA 3VDZA 3RD2A 3ZJUA 3SD5A 3RFZB 2LASA 3CSFA 4KGTA 2QMTA 4RGNA 2WDRB 1GAQB 4W9CA 4WAFA 2OJWA 3BYYB 1QT9A 3ABVB 3AE2B 5L95C 2RPQA 2JVCA 1WH3A 4JWSC 3U2SC 4J6IA 4DQOC 3BVGA 3ZJVA 2LHDA 3APDA 4FN2A 3ZLZA 3KWVA 3UQBA 1G6JA 3KW5B 4OZCA 3QK0A 2ZNVC 3A9KB 1SE2A 3DWGC 3HIZA 2N9EB 4ASWC 2WU2B 2WXQA 2SEBD 1V86A 1N6ZA 4JLCA 2WX1A 2C60A 2O6VA 2FE8A 3TCAA 3QAQA 1UF0A 1CQVA 3ONSA 2WNMA 3O13A 2RGFA 3MP9A 4DHJD 1FFVA 3R2IA 2PTLA 2KLCA 2ZCBA 1P7EA 3ZXRA 1OQQA 2W3SA 4TSSA 2IJ0A 3WALA 1DOXA 2KT7A 3B1LX 1TKEA 2AQ1B 1Q5WB 4BKTA 3AE5B 2GBJA 4M00A 5BYRA 3H7PB 1WGKA 2NBVB 3EA6A 1FNWA 3ZNGC 2H88B 2LZ6A 4K7WA 3I57A 4WWOA 1EU4A 1C76A 3NVVA 4NZLB 5IN7A 3H6NA 2WXPA 3DHHC 3SEBA 1SE4A 3HRDD 2UYZB 3CMMB 4FJZA 1SIJA 1P1AA 5JXVA 1HA5A 1EF5A 3PV1A 3ZNZB 4YSYB 1M94A 1XD3B 2J0KA 2KQSA 1E8WA 4RGOS 1B9RA 1AW7A 2KHWB 4BAXA 3T8MA 4DXGA 1RLFA 3W5VB 2R2OA 4QAYA 3SFEB 2C7MB 2GBNA 1I35A 4KSLC 1PQSA 2KO3A 3DBHI 5AUKA 2JRIB 2JXTA 1T6BX 2M4NA 1C79A 3PLVA 2KANA 2LGYA 2KYWA 4M0WB 2MH7A 5H8YE 3N1ZC 1S3SG 2KX0A 1KH0A 3TEWA 2FNJB 4BKSD 4PT5A 2INNE 3BVMA 2QJLA 1UH6A 4B0EA 1EO6A 3RI7C 4ZOHC 1V5OA 2GOWA 3H8HA 4LDTB 2IY0B 4JWUC 1QF6A 4KGSA 4AJYB 4ICVA 1GC7A 4XDCA 3BIID 4NJCA 1TZOA 4C4VA 4PYUA 2XK5B 2DYOA 1ACCA 4B0MA 5IAAC 3RNBC 3L08A 2WDVB 3PZ8A 3A9JA 3TEXA 4LNOA 4B6WA 1FCLA 2LVQA 4RH6A 3Q6BA 2J42A 3AI5A 2FCQA 1WX8A 1OEYJ 1WXMA 2HD5B 1I4XA 1AARA 4BOSC 1JALA 1WGDA 3IG3A 1YN5A 4GMVA 3P2BA 3RZFA 4PK1A 1GB1A 3B9JA 1QILA 1KOTA 4HKZE 4MH8A 3QARA 1Z5SB 3H1UA 5D6JB 3N20C 3MFGA 2GBMA 4K1RB 2DNFA 3U7ZA 1KJTA 4USAA 1YX6B 2XNAC 1HZ5A 3FILA 3SR6A 2NVUI 4DWFA 2J52A 1L6UA 3BK1A 2CHZA 3NHEB 4HJKA 3ZTDA 1YOVB 2LXAA 4ANWA 2KTRB 3CF6E 3ZW3A 3E9SA 1TS4A 1ZDXA 3AEDB 3TIXA 4YSXB 5D7GA 1I4QA 2J7QB 3DPDA 2DZIA 1Y8RC 3PPAA 3VUXA 2I38A 3U52E 2V0GA 4A90A 1LFDA 4PS8A 2MP2A 2HJ8A 2GI9A 4TKNA 1TBEA 3HM3A 1L0VB 2L83A 1GOZA 3V3XA 3B2GA 3WCQA 4E74A 4WH4A 4XE0A 1QKZA 4HJGE 1WF9A 1XO3A 3NG0A 4KZ0A 3DBSA 1SXTA 4BZAA 2GBKA 3DOWA 3TJPA 4A20A 1WGYA 4S0RA 2W82A 2VRRB 3RMKC 1V97A 2M0XA 2QDFA 2C9WB 2WXRA 4X57B 4HVBA 3QWZB 2V9HA 2JUOA 2VH1A 2IGDA 3B0AA 1GG3A 1PYWD 4A9AA 3W1SA 1FFUA 3T3OA 3BZDB 4ANXA 2DZJA 3VQIA 1V2YA 3VR9B 2ASQA 4MACA 4OW0A 2X38A 1DGJA 3EFUA 5GXGB 4CO7A 3TUOA 2LXCA 1H4RA 1V6EA 2EKEC 3I9V1 3IT4B 3L0WB 3QHTA 1C1YB 3VFKA 2KJ6A 4XZ4A 1J7BA 3C19A 1SE3A 2MBBB 2KFKA 3MJWA 1A5RA 1FO4A 3DBLI 2AYOB 5IP4D 2B3AA 4G11A 4P7IA 1IGDA 3NY5A 4WJPA 1UWXA 2N9LA 5BO4B 4C56C 1D4BA 3IT6B 3I3TB 3EUB2 1BT0A 2K3UA 3NVYA 4JGHB 2KDMA 1FEHA 1ZE3D 5EE1A 1PGBA 4KSKC 3AULA 5BYQA 4KIKA 4WWNA 4G50A 1UD7A 4HPPA 3AE1B 2HE7A 1E9MA 3WIMA 3PHXB 1WFYA 2WXJA 4IG7B 4IM3A 1WGHA 4M01A 4HCNB 1Q0WB 1OQRA 1XF5L 3KUZA 2KACA 4NAWA 1QQRA 1R4MI 1NYRA 4JX1C 2ICIA 4JPSA 3UIPB 1RFKA 2LGXA 1C77A 3R8BA 2ZEQA 3JSVB 2KDFB 3PTFC 3Q8BA 2MSED 1XCQL 3M62B 3IHPC 1OEYA 3ZJTA 2KAJA 2KOXA 3RUIB 4RMAA 3Q3FA 2KQ7A 4BVUC 3AXCA 1FNVA 1WMHA 2LMCA 1SSNA 1LXDA 2FUHB 2MRPA 1T5XD 1YN3A 4GU2A 4FJVB 4FLHA 3PRMB 2X8XX 4MGZE 4TV3A 1OQYA 3CSTA 4FBJB 4XX5A 2Z0DB 2LJIA 1ET9A 3KH0A 3V6EB 4HROA 3ML9A 3WAOA 1JROA 3N3KB 2GB1A 3OWEB 1JWMD 2M8SA 4URKA 4GDLB 4W9EA 1IYFA 2WXGA 3FAHA 4LK0M 3N30A 3UGBB 2QC8A 2WXNA 2WDQB 3DWMA 3L17A 2JPHA 4M8NA 3ZKJC 2D5GA 2SAKA 3V60A 1L4DB 4N9F4 4MJSA 1OFFA 2RDHA 4MM3B 3MC9A 1ZW7A 3KLSX 1E5WA 5J2RA 4IM0A 4RGTA 3MHSD 3AEGB 4RNAA 4MELA 3EECA 2N9PC 2K39A 2ON8A 3NVWA 2WXLA 4ZRQA 3PGEA 4K3CA 2MQJA 1ZXIA 4FJYA 3ML8A 2QCZA 1PDXA 3QA8A 1P7FA 4W9DA 5I4DA 1UUPA 2KFJA 2MBEA 4I6PA 2KMMA 4CHKA 3VTWA 4US8A 1YQ3B 2AL6A 1WJ4A 4YL8A 3NZUA 3AMZA 4IOIE 5AZHA 4KGRA 1K51A 2N7DA 2D10A 1C9FA 5E6JA 3WAMA 2A5UA 2WXKA 4I6LB 4BFRA 2VZKD 1K8RB 3BYTB 4E71A 5CHWA 5EE3A 4HWIB 4G3XB 3W1SC 1HQRD 4NQKE 5JHBA 3N1YC 5LXHA 1VLBA 1I7HA 2PE6B 4N59A 2XBBC 2RPVA 3QIJA 3BVZA 2B76B 1FM0D 3DHIC 2KK8A 2JX5A 4DXAB 2CKHB 3RNGC 3W9CB 2L0TA 2PW9A 2K22A 1E8ZA 2V3NA 3UI3A 2ZW1A 1KLVA 2BS2B 2JXXA 1ZGUB 4ARIA 4RM9A 1DOYA 3V6CB 3VR8B 2K1FA 1J0GA 5HI1A 1SF0A 2O6VB 2WGSA 3HK0A 2O2VA 4IM2A 1U4AA 2PJHA 4F1SA 2CHWA 1CJEA 1WSPA 2H89B 1E8XA 1SBBB 2KTFA 2V3SA 1V1PB 3AEFB 3MTNB 4C7YA 1JCKB 4LNKA 4HXDA 5IKCM 2OJRA 4JL9A 2KMCA 2WLBA 2D11A 1Q1OA 1L0XB 2KZRA 5CX3A 4FULA 2XN9C 2M0AA 3DCGA 1WWTA 4K3BA 5G5HA 4XC2A 2KN4A 1I4GA 5E6OA 3ZYYX 1BXTA 3IAS1 4KDLB 4L23A 4FHJA 3A1QB 1TYGB 4WAAA 1JWAD 2ONQA 2FIDA 2KC2A 3DBRB 1L2NA 3PLUA 4LDTD 2RR9A 1WRDB 1IBXB 2DX5B 2KLGA 4LJOB 3S2AA 3BK2A 3V61A 2QHOA 3L16A 3VUYA 4MEMA 3Q3NC 1GC6A 3ZVVA 3A9KA 4GGQA 5GMVA 4ARCA 2JF5A 1MHHE 3ZRFA 1YQ4B 2DYBA 1WIAA 3FKYA 4MGIE 4C4VB 2KJHB 1YIWA 2DBYA 4DDID 4KDIC 3HVZA 2UU7A 3X23A 3LYYA 5CHVC 4A3OA 2ACZB 1TT5B 2KX3A 2BF8B 1DOIA 3DVNU 5DPRA 2IO2B 1V9JA 3V05A 4DBGA 1WGGA 4TMAB 4K7SA 1R4NB 3H7PA 5FR3A 3L4PA 3PSEB 3VVWB 5D3DA 5FK9C 2IO3B 3HVDA 5TR5A 3PZDA 3EFCA 2EMTA 2OOBB 2G4DB 3EC8A 1WXQA 4ZYSA 4C7ZA 1JMLA 2G1EA 4IWQA 1D5XC 2BS3B 3H7SA 1FXTB 2DWQA 1VD2A 2N9KA 2JZ3B 3VTUA 3V62A 4P1CC 1WR1A 2ZW0A 5HKHA 2KWDA 3WANA 4GLSC 4M02A 1H8CA 2KMAA 2E6XA 4AP4C 5DPSA 3GS2A 4RF0A 4IW0A 4FHKA 1UNSA 2J0MA 4MH0E 1YJJA 1EWYC 4M0WA 3M95A 4HEA1 1F1HA 3C8YA 4J3OD 4E3CA 4DDGD 3ZGZA 2NTSA 5EE0A 3ECIA 3LXFA 2MP2B 2V4IB 3NS8A 1V1OA 2IPKD 4BBNC 1F9JA 2KVZA 1WRIA 3PS6A 2D3GA 3QX1A 2EMSA 1J19A 5D2MB 1WJ6A 2VH2A 1CMXB 4HPMB 1EF1A 2AQ3B 2FCSA 1KLGD 4XDDA 2XK5A 4PYZA 2KNBA 1XCTL 4K81A 2BKFA 4XWWA 3AE7B 1RWSA 4ICUA 5JHAA 4C80A 2MA9B 2NPTB 3R7QA 3Q3MC 3DVGY 1NDDA 2JSVX 1WI0A 3DVGX 1T3QA 1XLOA 2DZKA 3U7DA 4WJNA 3KVFB 2WWZA 4IKGA 4II2B 3AH7A 1KFYB 4RM8A 4GSWA 2ZVOA 2GRIA 2M19A 2N7EA 4WJOA 1L6VA 3P4RB 4LTUA 4RCOA 2AL3A 4B95A 1C4CA 4OVVA 4KVGB 2EKIA 3A4RA 3I63C 4S17A 1D5MC 1DYQA 1GJZA 2W54A 2K0PA 3AN1A 1E7UA 1PGAA 3M3JA 2MEKA 2WS3B 1GB4A 5AZGA 3RNEC 2BTEA 2LUEA 3MHZA 3GE8C 2W55A 2K8CA 5MPOA 3VXWA 3IVFA 1ROEA 1FRDA 2FCNA 2K25A 2K8HA 3Q8EA 2WX0A 2INCC 3OLMD 2KTRA 4W9FA 2GBRA 2YEPF 4W9GA 2WXHA 2PEAA 4N58A 3AB5A 4HPLB 1D3ZA 4C00A 3K9OB 2LVOA 5G55A 2NR2A 3HHMA 3SU8X 4MGKE 4ANVA 1VJKA 5KHOA 4AS1A 2M56B 2PPHA 1K50A 1TJEA 3R66C 2INPE 3B2FA 2ZNVB 3KYDD 4YXDB 1L0YB 1WXSA 5IO9A 1C4AA 2DYMA 2WP9B 3RYTA 1P98A 4AUQC 1UGMA 3NZSA 4LNNA 3EHVA 4EOYA 1KLUD 3QC8B 4GN1A 5C23A 1RYJA 5FKAC 2YVCA 1UBIA 1HXYD 4GXBA 2WXFA 2KWCA 2HTME 4AOFA 2BPSA 1BMLC 4RFBA 3PO0A 4LCDE 4LNFA 1RM6C 5C1ZA 3RNAC 2I1JA 4ANUA 2L32A 1PFDA 1QOAA 4W9IA 4TQ0A 3NOBA 4ZRPA 3GZNI 4F7ZA 2RDBC 3JYUA 1HEZE 1QLBB 4OVUA 3AU4A 2PLPA 2UWQA 1TKGA 3K9PB 2LI5A 5AEKB 1J7AA 3HM6X 3M63B 3UF8A 3L10B 2MJ3A 1C3TA 1I4RA 2JWUA 2KN5A 1ZOYB 3UQAA 4YSZB 4KZCA 1ENFA 5EE9A 5CTRC 2Z0EB 2CHXA 2K8BA 2D07B 4K7UA 2L00B 2IZVB 4HRSA 1ET6A 1YX5B 1GUAB 4MJSB 4RF1A 4FA6A 5LNK1 2BKRB 2IY1B 5T8IA 3IFWB 2N7JA 4MT5A 4W9HA 3SDLC 1NI3A 1E8YA 1UELA 2V1YA 3LJ3A 2D3CA 4ZRKA 2IGHA 4Q2JA 2PIAA 1YNTE 5LXIB 4OVZA 3ENEA 3P4PB 2OEDA 2HTHA 3MJ5A 3IBEA 4MGYE 3BINA 1VZ7A 1X1MA 2NBWB 3P63A 4WIPA 4FADA 4JIOU 1IPGA 2JYEA 1MG4A 3R2TA 1NVID 2L0FA 3JSVA 1TS3A 3RT3B 2V4LA 4IC7B 4BOZB 1RAXA 4GDKB 3ZDTA 4OZBA 4N6EB 1MG8A 2RSUA 2E3TA 3DBRI 5J17A 2JU6X 2Y5CA 2LRUA 5EDSA 2ZPYA 5BMIA 3P1MA 3IAM1 4YTNB 1N5WA 2MBOA 3AE4B 1E7VA 4A6QA 2NTTA 3FC4A 1K52A 4LNIA 1VZ8A 1WR6E 3WAPA 3UIOB 4IWPA 2PVOD 3ZO5B 4GDLA 4ZRJA 1T0YA 1TIFA 3PZ7A 4AWJA 2KWUB 4DXFA 2N9XA 3AV8A 4MSQB 1HE8A 1TY2A 2ZCCA 3Q3JA 4OZAA 3T9LA 3DBLB 2M17A 3AU5A 3APCA 2KDBA 4MM3A 1FRRA 3I5JC 1E90A 1YJ1A 1P0RA 4TUUA 5BMHA 1L4ZB 1D6EC 4EKUA 2BYFA 4NY0A 2I2YA 3UINB 1KM7A 4L1BA 2NMQA 2DHZA 2YEPB 2C7NB 3C0RB 1M4VA 2KDEB 4L2YA 4FXCA 1R4MB 4W9KA 1EU3A 1VZ6A 2BYTA 3KWLA 4EEWA 3Q2AC 2RDGA 2AEHA 1N5XA 1WM3A 3AE6B 5DPTA 1NBFC 3A4SC 2BGFA 2JWZA 1E7PB 4YWGG 3KQ4A 2KD0A 1LGRA 2AX5A 3OJ3A 1R7SA 1B1ZA 3LDZE 1SJHD 4RGMA 5DPWA 3N9YC 1IUEA 5KHQA 4NQLB 1HTQA 4A55A 4EZLA 2LEKA 3AECB 3RNCC 1ESFA 1E0ZA 2QEJC 1UZXB 1T0RC 2AQ2B 2JY6A 1S1QB 4GIVA 4BKGA 1SEBD 3CIRB 3VH3B 3ZTCA 2VZKB 2WU5B 2LWPA 1LO5D 1WZ3A 3BWUD 4XWTA 1GPXA 4P1BC 4WWPA 4WQOB 5CHFA 2ZPNA 3WA0A 2MX2A 4JQWC 3R7RA 1VRAB 1WX9A 2WXIA 4W9JA 3DHGC 5G5GA 3NVZA 2G45B 1JQ4A 4ZHPA 1FNUA 3NUHB 1FPYA 2PMVA 4I6NB 4EZKA 1WXVA 5G2NA 2PE9A 3AEEB 5TSSA 3DQVA 3VRBB 2Y5PA 2J4XA 4DHZE 4NJ6A 1V1PA 4IDIA 3VHTC 1E10A 1A70A 1Y56A 2K9XA 3ETRA 4P6VF 1J7CA 1V5TA 3H9DA 2QSDA 4XGAB 1F2RC 2QIEB 4PS3A 1LQBA 2RD0A 3KYCD 5JZEB 1I42A 3VTVA 1TZ1A 5E6PA 1VDVA 4B9KA 1FD6A 3ALBA 2FCMA 3A1QA 4II3B 1ZUD2 3KUCB 2D2QA 3OJ4B 1MFWA 1GNUA 2D3AA 1HTOA 2K6DB 3D32A 2Y3AA 1F0ZA 1WM2A 2BQQA 3NS1A 3A9JB 1XQQA 1JRPA 2BYEA 2KVRA 2EELA 3AE8B 1TKYA 3JW0X 1AYFA 4KKIA 2JQRB 1P3QU 3TBLD 4AJWA 4W9LA 4DHJB 3SHQA 2Z59B 1IBXA 2Y5BB 1WYGA 3E56A 4EFOA 1FMAD 5LLIA 2CU1A 1WE6A 2IO0B 3AEBB 3TEYA 5D3IB 3JVZX 2CJNA 2JZPA 3Q8FA 1QOFA 2K5PA 2HDEA 2MLBA 5DCNA 1JRUA 1L7YA 3ZXVA 1LM8B 3ZNID 2WDTB 2N4FA 1SIFA 2NS5A 2Z8LA 1YD8U 1SE9A 3MC0B 4WURA 3FILB 4A3PA 2AWTA 3RN9C 4US9A 1YN4A 2BT6A 2WQYB 1IP9A 3W2DA 5C2TB 3VUWA 4JE3B 2MBHA 2W9NA 5BYSA 1XEEA 1F2RI 4IWOA 3ZNHB 3QQ8B 5BMGA 1I4PA 1WY8A 4NNJB 2BWFA 2D3BA 1PGXA 1NEKB 2ZVNA 2K6QA 1P9DU 3RNFC 2L8JA 3PRZA
chains in the Genus database with same CATH topology
3B1LX 3VTWA 1Q5WB 4LCDE 2AL6A 4BKTA 2GBJA 1WJ4A 4YL8A 3L54A 3NZUA 2XEWA 5C1ZA 5AZHA 4CYEA 2I1JA 1WJUA 4ANUA 3H7PB 2NBVB 3ZNGC 2N7DA 4W9IA 3NOBA 4TQ0A 2D10A 2LZ6A 4K7WA 3PRPB 3WAMA 3GZNI 2A5UA 4F7ZA 3JYUA 4I6LB 4BFRA 4WWOA 3GOEA 4OVUA 3DDCB 1K8RB 3AU4A 2UWQA 4E71A 5CHWA 3K9PB 2LI5A 5AEKB 4HWIB 2M1MA 3H6NA 3HM6X 3M63B 4M8MA 4G3XB 3UF8A 3W1SC 3L10B 4NQKE 5JHBA 1C3TA 3R3MA 5LXHA 2KN5A 1VCBA 2PE6B 2UYZB 2XBBC 3CMMB 4FJZA 3UQAA 4KZCA 1P1AA 5JH5C 3QIJA 1EF5A 3DVNV 1EUVB 3PV1A 5CTRC 3ZNZB 4MSMB 2Z0EB 2CHXA 2K8BA 2D07B 1M94A 4K7UA 1XD3B 2J0KA 2KQSA 4KV2A 3VH4B 2L00B 1E8WA 2IZVB 2KK8A 2KHWB 4BBNF 3T8MA 4DXAB 2CKHB 1RLFA 1YX5B 1GUAB 2R2OA 2L0TA 4MJSB 2C7MB 1E8ZA 4FA6A 2GBNA 1I35A 1KLVA 4KSLC 2BKRB 2IY1B 3RCZA 1NI2A 2JXXA 1ZGUB 3IFWB 1PQSA 2KO3A 3DBHI 3PREA 4RM9A 4W9HA 2JRIB 1Z2MA 2KFKB 3SDLC 3V6CB 1E8YA 1UELA 2V1YA 3LJ3A 2M4NA 2K1FA 3PLVA 2KANA 2L76A 1J0GA 2LGYA 4ZRKA 4M0WB 2O6VB 1J8CA 1S3SG 2KX0A 5LXIB 3HK0A 2FNJB 3ENEA 4BKSD 2O2VA 4IM2A 1U4AA 2PJHA 2HTHA 1UH6A 2CHWA 3IBEA 4F1SA 4MGYE 1EO6A 3BINA 4BKSA 2REXA 1E8XA 1X1MA 2NBWB 2NBUA 1V5OA 2GOWA 4KIKB 2J0JA 2NPTA 2YLMA 4FADA 4JIOU 1IPGA 2KTFA 4GB9A 4LDTB 2V3SA 2IY0B 4DHZB 3MTNB 1WXAA 2L0FA 3ZDMC 4ICVA 3JSVA 1GC7A 4AJYB 2GMIC 3RT3B 2LD9A 2V4LA 4IC7B 2MCNB 2FIFA 3PHWB 4HXDA 4BOZB 4PYUA 3BY4B 2OJRA 2XK5B 2DYOA 2KMCA 4JL9A 4NAWB 1RAXA 4GDKB 3ZDTA 2D11A 2N1WA 1Q1OA 1RRBA 2N1VA 2KZRA 5CX3A 4FULA 5IAAC 3L08A 2ZZPB 1MG8A 2RSUA 3DCGA 3DBRI 3A9JA 5J17A 4DK5A 4B6WA 4HDQA 2LRUA 4XC2A 2KC1A 2ZPYA 5EDSA 2LVQA 4HDOA 5E6OA 2MBOA 2NCNA 1E7VA 4KDLB 3AI5A 2FCQA 4FHJA 1WX8A 3A1QB 1OEYJ 1WXMA 2HD5B 1AARA 4BOSC 1WR6E 3WAPA 4WAAA 1WGDA 1QZEA 1WMHB 3IG3A 3UIOB 5D94A 4GMVA 2FIDA 3P2BA 3RZFA 3QCAA 2KC2A 4IWPA 3APFA 3ZO5B 4GDLA 4ZRJA 1T0YA 4MDKE 1V80A 4IUMB 1KOTA 4AWJA 1L2NA 2KWUB 3QARA 1Z5SB 4HCPB 3H1UA 3PLUA 4LDTD 5D6JB 2KDIA 2CR5A 2RR9A 1WRDB 2N9XA 4MSQB 2GBMA 4K1RB 3W1YA 3ZRCA 3N32A 1HE8A 2DX5B 2ZCCA 2KLGA 4LJOB 1KJTA 3S2AA 3Q3JA 3V61A 3T9LA 2QHOA 3L16A 3VUYA 1YX6B 4MEMA 1ISNA 1WZ0A 2M17A 1WYWB 1GC6A 2NVUI 3AU5A 3APCA 3ZVVA 4DWFA 2KDBA 4MM3A 5E6NA 1E90A 3A9KA 5AZFA 1YJ1A 4GGQA 5GMVA 1P0RA 4TUUA 2CHZA 3NHEB 4HJKA 3ZTDA 2LXAA 4ANWA 2KTRB 3CF6E 3ZW3A 4EKUA 2BYFA 2JF5A 2BYVE 3TIXA 4NY0A 3ZRFA 5D7GA 2J7QB 2DYBA 1WIAA 3DPDA 2DZIA 5J18A 1Y8RC 4MGIE 3PPAA 3UINB 1KM7A 2A4ZA 3VUXA 2KJHB 2DHZA 1YIWA 1LFDA 4PS8A 2C7NB 2HJ8A 2MP2A 4TKNA 3C0RB 4DDID 1TBEA 2BPSA 1RFAA 4KDIC 1V81A 2JT4B 3HM3A 3ZIMA 3U30A 2KDEB 4E74A 3X23A 1WF9A 5CHVC 4W9KA 4KZ0A 3DBSA 4A3OA 4HK2A 2KX3A 2BF8B 3DVNU 4NJ7A 5DPRA 2GBKA 2IO2B 3DOWA 3TJPA 2LRWA 3PVLA 1WGYA 4A20A 1V9JA 2DZMA 4EEWA 4DBGA 2AEHA 1WE7A 1WM3A 1WGGA 2VRRB 3B08A 2M0XA 1ZKHA 4HVBA 2C9WB 4X57B 5DPTA 4K7SA 1NBFC 2JZZA 3A4SC 2BGFA 2JWZA 3H7PA 4WJQA 3QWZB 3PSEB 3VVWB 2KD0A 2DAFA 3OJ3A 2IO3B 2MWSB 3LDZE 2JUOA 5TR5A 3PZDA 5DPWA 3B0AA 2DENB 2EMTA 5KHQA 4NQLB 2OOBB 1GG3A 2G4DB 3EC8A 1WGRA 4EZLA 1WJNA 4EUTA 2CS4A 4IWQA 2KXJA 3W1SA 1UZXB 4G0NB 2JY6A 4ANXA 3ZUNA 2WYQA 3H7SA 1FXTB 1OTRB 3VAWA 2LVPA 3TL5A 1S1QB 2DZJA 3VQIA 1V2YA 1V49A 1VD2A 2ASQA 4ZYNA 4GIVA 3A33B 4BKGA 2JZ3B 3VTUA 2L7RA 3V62A 3EFUA 3VH3B 3ZTCA 3TMPB 2IO1B 4CO7A 1WR1A 5HKHA 2LXCA 1H4RA 2LGDA 1V6EA 2EKEC 4PS7A 2LWPA 3WANA 1WZ3A 1H8CA 2KMAA 3L0WB 4AP4C 3QHTA 1C1YB 4WWPA 4WQOB 5DPSA 3VFKA 2KJ6A 5CHFA 4XZ4A 2ZPNA 4LJPB 3PT2B 4IW0A 3WA0A 2MX2A 4FHKA 2MBBB 2KFKA 3MJWA 4JQWC 2O6VD 3R7RA 3DBLI 1A5RA 2AYOB 2J0MA 2B3AA 2L05A 4MH0E 4G11A 4P7IA 1WX9A 3NY5A 3M95A 3OAWA 4W9JA 4NPNA 4WJPA 5BO4B 4ZDVA 2G45B 1YQBA 4E3CA 2C5LC 4DDGD 2C7HA 3I3TB 3KUDB 3ECIA 4F8CB 1BT0A 4JGHB 4I6NB 2BWES 2IYDB 4EZKA 2MW5A 1WXVA 3L13A 2FAZA 2MP2B 5G2NA 2PE9A 3NS8A 4KSKC 3AULA 4GOCA 4KIKA 4BBNC 1F9JA 3DQVA 3U8ZA 4WWNA 3PS6A 4G50A 1UD7A 2D3GA 2L3ZA 3QX1A 5FR6A 4DHZE 2EMSA 4NJ6A 1J19A 5D2MB 3VHTC 1SGHA 2HE7A 4EZJA 4HLEA 3WIMA 1WJ6A 1WX7A 3PHXB 1WFYA 2KWVB 1CMXB 4HPMB 1WGHA 1EF1A 3QJZA 4IG7B 4IM3A 4HCNB 1Q0WB 2JRHA 2O2VB 1V5TA 3KUZA 2FCSA 3H9DA 2DAJA 2XK5A 4PYZA 4NAWA 4GDKA 3X0WA 2KNBA 2BKFA 4K81A 1R4MI 4PS3A 1LQBA 2RD0A 3KYCD 5JZEB 2IBIB 4ICUA 5JHAA 2KKCA 1I42A 2MA9B 2NPTB 3R7QA 3DVGY 3UIPB 1NDDA 2LGXA 1WI0A 3VTVA 3DVGX 4ZRIA 1TZ1A 5E6PA 2ZEQA 2DZKA 3U7DA 1R4NI 2KDFB 3JSVB 3PTFC 2G4SA 2WWZA 2MSED 3KVFB 4WJNA 4B9KA 2I1KA 4II2B 3ALBA 2FCMA 3A1QA 3M62B 4II3B 4RM8A 3IHPC 2LJ5A 2ZJDA 1OEYA 2D2QA 3KUCB 3OJ4B 2KOXA 2ZVOA 2MBQA 4GSWA 4RMAA 3RUIB 3Q3FA 1GNUA 3RULA 2KQ7A 1XT9B 4BVUC 2N7EA 3AXCA 2R2QA 4WJOA 1WMHA 2K6DB 3D32A 1UBQA 4TQ1A 5L83A 1LXDA 2FUHB 3O65B 1TTNA 1WM2A 2G3QB 2MRPA 3A9JB 1XQQA 2BYEA 2AL3A 4GU2A 4FJVB 2KVRA 3PRMB 4FLHA 3RZWC 1OGWA 4B95A 1TGZB 4MGZE 3JW0X 4I6PA 4TV3A 1OQYA 3CSTA 4OVVA 4KVGB 4FBJB 3A4RA 4XX5A 1P3QU 2Z0DB 3TBLD 5IA7A 1GJZA 2KJRA 3VDZA 4AJWA 4W9LA 3KH0A 3V6EB 4AOFA 3RD2A 4DHJB 3ML9A 3SHQA 3SD5A 2Z59B 1E7UA 2LASA 3CSFA 3WAOA 3M3JA 3N3KB 5AZGA 2Y5BB 2LUEA 4W9CA 4EFOA 2M8SA 4URKA 2K8CA 5LLIA 4GDLB 4W9EA 2CU1A 1WE6A 2IO0B 1IYFA 3VXWA 3IVFA 5L95C 2RPQA 3JVZX 2JVCA 2FCNA 2K25A 2K8HA 3N30A 3UGBB 2WX0A 1WH3A 3OLMD 2KTRA 4W9FA 2GBRA 2MLBA 4W9GA 5DCNA 1JRUA 3L17A 2PEAA 1L7YA 2JPHA 1LM8B 4J6IA 4M8NA 3ZKJC 3ZNID 2WDTB 2N4FA 4FN2A 3APDA 3ZLZA 4HPLB 1D3ZA 3V60A 3K9OB 1SIFA 2LVOA 2NS5A 2NR2A 3HHMA 5G55A 1YD8U 1SE9A 4MGKE 3SU8X 4ANVA 4N9F4 3UQBA 4MJSA 1G6JA 3KW5B 5KHOA 4A3PA 2AWTA 2PPHA 3QK0A 2ZNVC 1ZW7A 3A9KB 1E5WA 5J2RA 4IM0A 3HIZA 2N9EB 3R66C 4ASWC 3MHSD 2ZNVB 1V86A 3KYDD 4MELA 1WXSA 4JLCA 3EECA 1IP9A 2WX1A 2C60A 2O6VA 3TCAA 2DYMA 3QAQA 2N9PC 2K39A 3VUWA 3RYTA 2MBHA 2W9NA 3ONSA 1P98A 2RGFA 4AUQC 1UGMA 3NZSA 4IWOA 3ZNHB 3QQ8B 4DHJD 3EHVA 3PGEA 2MQJA 4FJYA 3ML8A 4EOYA 2KLCA 1WY8A 2ZCBA 3QA8A 3QC8B 4GN1A 4NNJB 4W9DA 2BWFA 5C23A 2ZVNA 1UBIA 2YVCA 2K6QA 2KFJA 2MBEA 4GXBA 1P9DU 2KWCA 3WALA 2L8JA 3PRZA 4CHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B1L X;  3VTW A;  1Q5W B;  4LCD E;  2AL6 A;  4BKT A;  2GBJ A;  1WJ4 A;  4YL8 A;  3L54 A;  3NZU A;  2XEW A;  5C1Z A;  5AZH A;  4CYE A;  2I1J A;  1WJU A;  4ANU A;  3H7P B;  2NBV B;  3ZNG C;  2N7D A;  4W9I A;  3NOB A;  4TQ0 A;  2D10 A;  2LZ6 A;  4K7W A;  3PRP B;  3WAM A;  3GZN I;  2A5U A;  4F7Z A;  3JYU A;  4I6L B;  4BFR A;  4WWO A;  3GOE A;  4OVU A;  3DDC B;  1K8R B;  3AU4 A;  2UWQ A;  4E71 A;  5CHW A;  3K9P B;  2LI5 A;  5AEK B;  4HWI B;  2M1M A;  3H6N A;  3HM6 X;  3M63 B;  4M8M A;  4G3X B;  3UF8 A;  3W1S C;  3L10 B;  4NQK E;  5JHB A;  1C3T A;  3R3M A;  5LXH A;  2KN5 A;  1VCB A;  2PE6 B;  2UYZ B;  2XBB C;  3CMM B;  4FJZ A;  3UQA A;  4KZC A;  1P1A A;  5JH5 C;  3QIJ A;  1EF5 A;  3DVN V;  1EUV B;  3PV1 A;  5CTR C;  3ZNZ B;  4MSM B;  2Z0E B;  2CHX A;  2K8B A;  2D07 B;  1M94 A;  4K7U A;  1XD3 B;  2J0K A;  2KQS A;  4KV2 A;  3VH4 B;  2L00 B;  1E8W A;  2IZV B;  2KK8 A;  2KHW B;  4BBN F;  3T8M A;  4DXA B;  2CKH B;  1RLF A;  1YX5 B;  1GUA B;  2R2O A;  2L0T A;  4MJS B;  2C7M B;  1E8Z A;  4FA6 A;  2GBN A;  1I35 A;  1KLV A;  4KSL C;  2BKR B;  2IY1 B;  3RCZ A;  1NI2 A;  2JXX A;  1ZGU B;  3IFW B;  1PQS A;  2KO3 A;  3DBH I;  3PRE A;  4RM9 A;  4W9H A;  2JRI B;  1Z2M A;  2KFK B;  3SDL C;  3V6C B;  1E8Y A;  1UEL A;  2V1Y A;  3LJ3 A;  2M4N A;  2K1F A;  3PLV A;  2KAN A;  2L76 A;  1J0G A;  2LGY A;  4ZRK A;  4M0W B;  2O6V B;  1J8C A;  1S3S G;  2KX0 A;  5LXI B;  3HK0 A;  2FNJ B;  3ENE A;  4BKS D;  2O2V A;  4IM2 A;  1U4A A;  2PJH A;  2HTH A;  1UH6 A;  2CHW A;  3IBE A;  4F1S A;  4MGY E;  1EO6 A;  3BIN A;  4BKS A;  2REX A;  1E8X A;  1X1M A;  2NBW B;  2NBU A;  1V5O A;  2GOW A;  4KIK B;  2J0J A;  2NPT A;  2YLM A;  4FAD A;  4JIO U;  1IPG A;  2KTF A;  4GB9 A;  4LDT B;  2V3S A;  2IY0 B;  4DHZ B;  3MTN B;  1WXA A;  2L0F A;  3ZDM C;  4ICV A;  3JSV A;  1GC7 A;  4AJY B;  2GMI C;  3RT3 B;  2LD9 A;  2V4L A;  4IC7 B;  2MCN B;  2FIF A;  3PHW B;  4HXD A;  4BOZ B;  4PYU A;  3BY4 B;  2OJR A;  2XK5 B;  2DYO A;  2KMC A;  4JL9 A;  4NAW B;  1RAX A;  4GDK B;  3ZDT A;  2D11 A;  2N1W A;  1Q1O A;  1RRB A;  2N1V A;  2KZR A;  5CX3 A;  4FUL A;  5IAA C;  3L08 A;  2ZZP B;  1MG8 A;  2RSU A;  3DCG A;  3DBR I;  3A9J A;  5J17 A;  4DK5 A;  4B6W A;  4HDQ A;  2LRU A;  4XC2 A;  2KC1 A;  2ZPY A;  5EDS A;  2LVQ A;  4HDO A;  5E6O A;  2MBO A;  2NCN A;  1E7V A;  4KDL B;  3AI5 A;  2FCQ A;  4FHJ A;  1WX8 A;  3A1Q B;  1OEY J;  1WXM A;  2HD5 B;  1AAR A;  4BOS C;  1WR6 E;  3WAP A;  4WAA A;  1WGD A;  1QZE A;  1WMH B;  3IG3 A;  3UIO B;  5D94 A;  4GMV A;  2FID A;  3P2B A;  3RZF A;  3QCA A;  2KC2 A;  4IWP A;  3APF A;  3ZO5 B;  4GDL A;  4ZRJ A;  1T0Y A;  4MDK E;  1V80 A;  4IUM B;  1KOT A;  4AWJ A;  1L2N A;  2KWU B;  3QAR A;  1Z5S B;  4HCP B;  3H1U A;  3PLU A;  4LDT D;  5D6J B;  2KDI A;  2CR5 A;  2RR9 A;  1WRD B;  2N9X A;  4MSQ B;  2GBM A;  4K1R B;  3W1Y A;  3ZRC A;  3N32 A;  1HE8 A;  2DX5 B;  2ZCC A;  2KLG A;  4LJO B;  1KJT A;  3S2A A;  3Q3J A;  3V61 A;  3T9L A;  2QHO A;  3L16 A;  3VUY A;  1YX6 B;  4MEM A;  1ISN A;  1WZ0 A;  2M17 A;  1WYW B;  1GC6 A;  2NVU I;  3AU5 A;  3APC A;  3ZVV A;  4DWF A;  2KDB A;  4MM3 A;  5E6N A;  1E90 A;  3A9K A;  5AZF A;  1YJ1 A;  4GGQ A;  5GMV A;  1P0R A;  4TUU A;  2CHZ A;  3NHE B;  4HJK A;  3ZTD A;  2LXA A;  4ANW A;  2KTR B;  3CF6 E;  3ZW3 A;  4EKU A;  2BYF A;  2JF5 A;  2BYV E;  3TIX A;  4NY0 A;  3ZRF A;  5D7G A;  2J7Q B;  2DYB A;  1WIA A;  3DPD A;  2DZI A;  5J18 A;  1Y8R C;  4MGI E;  3PPA A;  3UIN B;  1KM7 A;  2A4Z A;  3VUX A;  2KJH B;  2DHZ A;  1YIW A;  1LFD A;  4PS8 A;  2C7N B;  2HJ8 A;  2MP2 A;  4TKN A;  3C0R B;  4DDI D;  1TBE A;  2BPS A;  1RFA A;  4KDI C;  1V81 A;  2JT4 B;  3HM3 A;  3ZIM A;  3U30 A;  2KDE B;  4E74 A;  3X23 A;  1WF9 A;  5CHV C;  4W9K A;  4KZ0 A;  3DBS A;  4A3O A;  4HK2 A;  2KX3 A;  2BF8 B;  3DVN U;  4NJ7 A;  5DPR A;  2GBK A;  2IO2 B;  3DOW A;  3TJP A;  2LRW A;  3PVL A;  1WGY A;  4A20 A;  1V9J A;  2DZM A;  4EEW A;  4DBG A;  2AEH A;  1WE7 A;  1WM3 A;  1WGG A;  2VRR B;  3B08 A;  2M0X A;  1ZKH A;  4HVB A;  2C9W B;  4X57 B;  5DPT A;  4K7S A;  1NBF C;  2JZZ A;  3A4S C;  2BGF A;  2JWZ A;  3H7P A;  4WJQ A;  3QWZ B;  3PSE B;  3VVW B;  2KD0 A;  2DAF A;  3OJ3 A;  2IO3 B;  2MWS B;  3LDZ E;  2JUO A;  5TR5 A;  3PZD A;  5DPW A;  3B0A A;  2DEN B;  2EMT A;  5KHQ A;  4NQL B;  2OOB B;  1GG3 A;  2G4D B;  3EC8 A;  1WGR A;  4EZL A;  1WJN A;  4EUT A;  2CS4 A;  4IWQ A;  2KXJ A;  3W1S A;  1UZX B;  4G0N B;  2JY6 A;  4ANX A;  3ZUN A;  2WYQ A;  3H7S A;  1FXT B;  1OTR B;  3VAW A;  2LVP A;  3TL5 A;  1S1Q B;  2DZJ A;  3VQI A;  1V2Y A;  1V49 A;  1VD2 A;  2ASQ A;  4ZYN A;  4GIV A;  3A33 B;  4BKG A;  2JZ3 B;  3VTU A;  2L7R A;  3V62 A;  3EFU A;  3VH3 B;  3ZTC A;  3TMP B;  2IO1 B;  4CO7 A;  1WR1 A;  5HKH A;  2LXC A;  1H4R A;  2LGD A;  1V6E A;  2EKE C;  4PS7 A;  2LWP A;  3WAN A;  1WZ3 A;  1H8C A;  2KMA A;  3L0W B;  4AP4 C;  3QHT A;  1C1Y B;  4WWP A;  4WQO B;  5DPS A;  3VFK A;  2KJ6 A;  5CHF A;  4XZ4 A;  2ZPN A;  4LJP B;  3PT2 B;  4IW0 A;  3WA0 A;  2MX2 A;  4FHK A;  2MBB B;  2KFK A;  3MJW A;  4JQW C;  2O6V D;  3R7R A;  3DBL I;  1A5R A;  2AYO B;  2J0M A;  2B3A A;  2L05 A;  4MH0 E;  4G11 A;  4P7I A;  1WX9 A;  3NY5 A;  3M95 A;  3OAW A;  4W9J A;  4NPN A;  4WJP A;  5BO4 B;  4ZDV A;  2G45 B;  1YQB A;  4E3C A;  2C5L C;  4DDG D;  2C7H A;  3I3T B;  3KUD B;  3ECI A;  4F8C B;  1BT0 A;  4JGH B;  4I6N B;  2BWE S;  2IYD B;  4EZK A;  2MW5 A;  1WXV A;  3L13 A;  2FAZ A;  2MP2 B;  5G2N A;  2PE9 A;  3NS8 A;  4KSK C;  3AUL A;  4GOC A;  4KIK A;  4BBN C;  1F9J A;  3DQV A;  3U8Z A;  4WWN A;  3PS6 A;  4G50 A;  1UD7 A;  2D3G A;  2L3Z A;  3QX1 A;  5FR6 A;  4DHZ E;  2EMS A;  4NJ6 A;  1J19 A;  5D2M B;  3VHT C;  1SGH A;  2HE7 A;  4EZJ A;  4HLE A;  3WIM A;  1WJ6 A;  1WX7 A;  3PHX B;  1WFY A;  2KWV B;  1CMX B;  4HPM B;  1WGH A;  1EF1 A;  3QJZ A;  4IG7 B;  4IM3 A;  4HCN B;  1Q0W B;  2JRH A;  2O2V B;  1V5T A;  3KUZ A;  2FCS A;  3H9D A;  2DAJ A;  2XK5 A;  4PYZ A;  4NAW A;  4GDK A;  3X0W A;  2KNB A;  2BKF A;  4K81 A;  1R4M I;  4PS3 A;  1LQB A;  2RD0 A;  3KYC D;  5JZE B;  2IBI B;  4ICU A;  5JHA A;  2KKC A;  1I42 A;  2MA9 B;  2NPT B;  3R7Q A;  3DVG Y;  3UIP B;  1NDD A;  2LGX A;  1WI0 A;  3VTV A;  3DVG X;  4ZRI A;  1TZ1 A;  5E6P A;  2ZEQ A;  2DZK A;  3U7D A;  1R4N I;  2KDF B;  3JSV B;  3PTF C;  2G4S A;  2WWZ A;  2MSE D;  3KVF B;  4WJN A;  4B9K A;  2I1K A;  4II2 B;  3ALB A;  2FCM A;  3A1Q A;  3M62 B;  4II3 B;  4RM8 A;  3IHP C;  2LJ5 A;  2ZJD A;  1OEY A;  2D2Q A;  3KUC B;  3OJ4 B;  2KOX A;  2ZVO A;  2MBQ A;  4GSW A;  4RMA A;  3RUI B;  3Q3F A;  1GNU A;  3RUL A;  2KQ7 A;  1XT9 B;  4BVU C;  2N7E A;  3AXC A;  2R2Q A;  4WJO A;  1WMH A;  2K6D B;  3D32 A;  1UBQ A;  4TQ1 A;  5L83 A;  1LXD A;  2FUH B;  3O65 B;  1TTN A;  1WM2 A;  2G3Q B;  2MRP A;  3A9J B;  1XQQ A;  2BYE A;  2AL3 A;  4GU2 A;  4FJV B;  2KVR A;  3PRM B;  4FLH A;  3RZW C;  1OGW A;  4B95 A;  1TGZ B;  4MGZ E;  3JW0 X;  4I6P A;  4TV3 A;  1OQY A;  3CST A;  4OVV A;  4KVG B;  4FBJ B;  3A4R A;  4XX5 A;  1P3Q U;  2Z0D B;  3TBL D;  5IA7 A;  1GJZ A;  2KJR A;  3VDZ A;  4AJW A;  4W9L A;  3KH0 A;  3V6E B;  4AOF A;  3RD2 A;  4DHJ B;  3ML9 A;  3SHQ A;  3SD5 A;  2Z59 B;  1E7U A;  2LAS A;  3CSF A;  3WAO A;  3M3J A;  3N3K B;  5AZG A;  2Y5B B;  2LUE A;  4W9C A;  4EFO A;  2M8S A;  4URK A;  2K8C A;  5LLI A;  4GDL B;  4W9E A;  2CU1 A;  1WE6 A;  2IO0 B;  1IYF A;  3VXW A;  3IVF A;  5L95 C;  2RPQ A;  3JVZ X;  2JVC A;  2FCN A;  2K25 A;  2K8H A;  3N30 A;  3UGB B;  2WX0 A;  1WH3 A;  3OLM D;  2KTR A;  4W9F A;  2GBR A;  2MLB A;  4W9G A;  5DCN A;  1JRU A;  3L17 A;  2PEA A;  1L7Y A;  2JPH A;  1LM8 B;  4J6I A;  4M8N A;  3ZKJ C;  3ZNI D;  2WDT B;  2N4F A;  4FN2 A;  3APD A;  3ZLZ A;  4HPL B;  1D3Z A;  3V60 A;  3K9O B;  1SIF A;  2LVO A;  2NS5 A;  2NR2 A;  3HHM A;  5G55 A;  1YD8 U;  1SE9 A;  4MGK E;  3SU8 X;  4ANV A;  4N9F 4;  3UQB A;  4MJS A;  1G6J A;  3KW5 B;  5KHO A;  4A3P A;  2AWT A;  2PPH A;  3QK0 A;  2ZNV C;  1ZW7 A;  3A9K B;  1E5W A;  5J2R A;  4IM0 A;  3HIZ A;  2N9E B;  3R66 C;  4ASW C;  3MHS D;  2ZNV B;  1V86 A;  3KYD D;  4MEL A;  1WXS A;  4JLC A;  3EEC A;  1IP9 A;  2WX1 A;  2C60 A;  2O6V A;  3TCA A;  2DYM A;  3QAQ A;  2N9P C;  2K39 A;  3VUW A;  3RYT A;  2MBH A;  2W9N A;  3ONS A;  1P98 A;  2RGF A;  4AUQ C;  1UGM A;  3NZS A;  4IWO A;  3ZNH B;  3QQ8 B;  4DHJ D;  3EHV A;  3PGE A;  2MQJ A;  4FJY A;  3ML8 A;  4EOY A;  2KLC A;  1WY8 A;  2ZCB A;  3QA8 A;  3QC8 B;  4GN1 A;  4NNJ B;  4W9D A;  2BWF A;  5C23 A;  2ZVN A;  1UBI A;  2YVC A;  2K6Q A;  2KFJ A;  2MBE A;  4GXB A;  1P9D U;  2KWC A;  3WAL A;  2L8J A;  3PRZ A;  4CHK A; 
#chains in the Genus database with same CATH topology
 2L52 A;  3TSS A;  2BS4 B;  1T0Q C;  3L54 A;  1QOG A;  2XEW A;  4CYE A;  1WJU A;  3J9C A;  4OHJ A;  1TS2 A;  3Q3O C;  3PRP B;  2N0S B;  1PUT A;  3GOE A;  3DDC B;  4O1N A;  2LGI A;  1EWC A;  2M1M A;  4M8M A;  2LGS A;  2MJD A;  2BW2 A;  3R3M A;  2HJ1 A;  1VCB A;  1JWU D;  5JH5 C;  3DVN V;  1EUV B;  4MSM B;  3Q8A A;  1IGC A;  4KV2 A;  3VH4 B;  4BBN F;  2Q5W D;  1N62 A;  3U4E G;  1F77 A;  3Q14 C;  3RCZ A;  1FCC C;  1NI2 A;  2W3R A;  4YTM B;  3PRE A;  2KFK B;  1Z2M A;  1KRH A;  2L76 A;  3ZQ4 A;  5HG2 A;  3RPF C;  4ACF A;  3GP7 A;  1J8C A;  1XXG A;  1ZP0 B;  3Q69 A;  1C78 A;  4BKS A;  1D5Z C;  2REX A;  1AN8 A;  2V3P A;  2NBU A;  4KIK B;  2J0J A;  2BB5 A;  2NPT A;  2YLM A;  2TSS A;  4GB9 A;  3NRZ A;  4H2A A;  4DHZ B;  4CQN A;  3VRA B;  3DBH B;  1WXA A;  3ZDM C;  2R61 A;  2GMI C;  2LD9 A;  2MCN B;  2FIF A;  3PHW B;  1SJE D;  1KF6 B;  3BY4 B;  2PKO A;  1UGJ A;  4AQ7 A;  4NAW B;  2OHF A;  2N1W A;  1RRB A;  2N1V A;  1JW9 D;  2ZZP B;  1NYQ A;  2IGG A;  4R3D A;  2WXM A;  4DK5 A;  4HDQ A;  2KC1 A;  3T3N A;  5IOI A;  4P16 A;  4HDO A;  2NCN A;  4D2K A;  1MPE A;  4ITK A;  3NZ3 A;  2LHE A;  1QZE A;  1WMH B;  2MJE A;  5D94 A;  3OG5 A;  4KKJ A;  5H92 C;  1L5P A;  3QCA A;  4NAM A;  1K53 A;  2LUM A;  3APF A;  3MC8 A;  4MDK E;  1V80 A;  4IUM B;  1JWS D;  3LB8 C;  4HCP B;  3AM9 A;  2KDI A;  2CR5 A;  1N63 A;  1MI0 A;  3W1Y A;  2DLB A;  3ZRC A;  3N32 A;  1ISN A;  1WZ0 A;  1XLN A;  4YTP B;  2JYT A;  1WYW B;  1MJD A;  5E6N A;  3P4Q B;  5AZF A;  1T0S C;  4A8X C;  4KX6 B;  2BYV E;  5C3J B;  5J18 A;  2A4Z A;  2G9H D;  1ZPS A;  2FUG 1;  1RFA A;  1V81 A;  1FXI A;  2JT4 B;  1I4H A;  3U30 A;  3ZIM A;  5HFY A;  1V8C A;  2FBW B;  3AE9 B;  1YMH E;  4HK2 A;  4NJ7 A;  5HHD G;  1ZDV A;  2LRW A;  3PVL A;  2IDY A;  2DZM A;  1WE7 A;  1QOB A;  3B08 A;  3AE3 B;  1ZKH A;  1E6E B;  2BVC A;  2JZZ A;  4WJQ A;  2BBC A;  2DAF A;  2MWS B;  4EE2 A;  1C4P A;  1N60 A;  1MHX A;  2DEN B;  1HZ6 A;  1WGR A;  1FIQ A;  1WJN A;  4EUT A;  2CS4 A;  2KXJ A;  4G0N B;  1UWM A;  3ZUN A;  2WYQ A;  4WQM A;  1OTR B;  1SB3 C;  3VAW A;  2LVP A;  3TL5 A;  1V49 A;  3P4S B;  4ZYN A;  3A33 B;  3Q8C A;  2L7R A;  3TMP B;  2IO1 B;  2BB6 A;  2LGD A;  1MVK A;  1NEN B;  1CK1 A;  4REZ A;  4PS7 A;  1XLQ A;  1ZXH A;  2CU3 A;  4ZHO A;  4LJP B;  3PT2 B;  2QIL A;  2O6V D;  1Q10 A;  1STE A;  1YJI A;  2L05 A;  1F52 A;  3OAW A;  4NPN A;  2L1A A;  4ZDV A;  2RMM A;  3GE3 C;  1YQB A;  2C5L C;  2C7H A;  3NJT A;  3KUD B;  1FXA A;  3HUI A;  4F8C B;  3EGR A;  2MHJ A;  2BWE S;  2IYD B;  2MW5 A;  3CWI A;  3L13 A;  2FAZ A;  1AWD A;  4GOC A;  1TS5 A;  4XYC A;  3U8Z A;  3N1X C;  2L3Z A;  5FR6 A;  1EM7 A;  2GLS A;  4EZJ A;  1SGH A;  3TEZ A;  4HLE A;  1WX7 A;  4YT0 B;  2KWV B;  3AEA B;  3QJZ A;  4UDU C;  3P42 A;  2JRH A;  2O2V B;  2KQ4 X;  2DAJ A;  1BUI C;  2WXO A;  4GDK A;  3X0W A;  2IBI B;  2KKC A;  3W5U B;  5AUI A;  4ZRI A;  2PVG C;  1R4N I;  1TY0 A;  1CZP A;  2G4S A;  2I1K A;  2WHI A;  2J53 A;  1XLP A;  2LJ5 A;  2ZJD A;  3SFD B;  2MBQ A;  3IXS A;  3RUL A;  1XT9 B;  2R2Q A;  4TQ1 A;  1UBQ A;  5L83 A;  3O65 B;  1KTK A;  1TTN A;  2G3Q B;  4WWM A;  4LLG M;  3GZN B;  1JWB D;  1N61 A;  2CJO A;  3RZW C;  1OGW A;  2IND C;  1TGZ B;  3URY A;  1VR9 A;  4HKQ A;  5IA7 A;  2LFI A;  3GB1 A;  2KJR A;  3VDZ A;  3RD2 A;  3ZJU A;  3SD5 A;  3RFZ B;  2LAS A;  3CSF A;  4KGT A;  2QMT A;  4RGN A;  2WDR B;  1GAQ B;  4W9C A;  4WAF A;  2OJW A;  3BYY B;  1QT9 A;  3ABV B;  3AE2 B;  5L95 C;  2RPQ A;  2JVC A;  1WH3 A;  4JWS C;  3U2S C;  4J6I A;  4DQO C;  3BVG A;  3ZJV A;  2LHD A;  3APD A;  4FN2 A;  3ZLZ A;  3KWV A;  3UQB A;  1G6J A;  3KW5 B;  4OZC A;  3QK0 A;  2ZNV C;  3A9K B;  1SE2 A;  3DWG C;  3HIZ A;  2N9E B;  4ASW C;  2WU2 B;  2WXQ A;  2SEB D;  1V86 A;  1N6Z A;  4JLC A;  2WX1 A;  2C60 A;  2O6V A;  2FE8 A;  3TCA A;  3QAQ A;  1UF0 A;  1CQV A;  3ONS A;  2WNM A;  3O13 A;  2RGF A;  3MP9 A;  4DHJ D;  1FFV A;  3R2I A;  2PTL A;  2KLC A;  2ZCB A;  1P7E A;  3ZXR A;  1OQQ A;  2W3S A;  4TSS A;  2IJ0 A;  3WAL A;  1DOX A;  2KT7 A;  3B1L X;  1TKE A;  2AQ1 B;  1Q5W B;  4BKT A;  3AE5 B;  2GBJ A;  4M00 A;  5BYR A;  3H7P B;  1WGK A;  2NBV B;  3EA6 A;  1FNW A;  3ZNG C;  2H88 B;  2LZ6 A;  4K7W A;  3I57 A;  4WWO A;  1EU4 A;  1C76 A;  3NVV A;  4NZL B;  5IN7 A;  3H6N A;  2WXP A;  3DHH C;  3SEB A;  1SE4 A;  3HRD D;  2UYZ B;  3CMM B;  4FJZ A;  1SIJ A;  1P1A A;  5JXV A;  1HA5 A;  1EF5 A;  3PV1 A;  3ZNZ B;  4YSY B;  1M94 A;  1XD3 B;  2J0K A;  2KQS A;  1E8W A;  4RGO S;  1B9R A;  1AW7 A;  2KHW B;  4BAX A;  3T8M A;  4DXG A;  1RLF A;  3W5V B;  2R2O A;  4QAY A;  3SFE B;  2C7M B;  2GBN A;  1I35 A;  4KSL C;  1PQS A;  2KO3 A;  3DBH I;  5AUK A;  2JRI B;  2JXT A;  1T6B X;  2M4N A;  1C79 A;  3PLV A;  2KAN A;  2LGY A;  2KYW A;  4M0W B;  2MH7 A;  5H8Y E;  3N1Z C;  1S3S G;  2KX0 A;  1KH0 A;  3TEW A;  2FNJ B;  4BKS D;  4PT5 A;  2INN E;  3BVM A;  2QJL A;  1UH6 A;  4B0E A;  1EO6 A;  3RI7 C;  4ZOH C;  1V5O A;  2GOW A;  3H8H A;  4LDT B;  2IY0 B;  4JWU C;  1QF6 A;  4KGS A;  4AJY B;  4ICV A;  1GC7 A;  4XDC A;  3BII D;  4NJC A;  1TZO A;  4C4V A;  4PYU A;  2XK5 B;  2DYO A;  1ACC A;  4B0M A;  5IAA C;  3RNB C;  3L08 A;  2WDV B;  3PZ8 A;  3A9J A;  3TEX A;  4LNO A;  4B6W A;  1FCL A;  2LVQ A;  4RH6 A;  3Q6B A;  2J42 A;  3AI5 A;  2FCQ A;  1WX8 A;  1OEY J;  1WXM A;  2HD5 B;  1I4X A;  1AAR A;  4BOS C;  1JAL A;  1WGD A;  3IG3 A;  1YN5 A;  4GMV A;  3P2B A;  3RZF A;  4PK1 A;  1GB1 A;  3B9J A;  1QIL A;  1KOT A;  4HKZ E;  4MH8 A;  3QAR A;  1Z5S B;  3H1U A;  5D6J B;  3N20 C;  3MFG A;  2GBM A;  4K1R B;  2DNF A;  3U7Z A;  1KJT A;  4USA A;  1YX6 B;  2XNA C;  1HZ5 A;  3FIL A;  3SR6 A;  2NVU I;  4DWF A;  2J52 A;  1L6U A;  3BK1 A;  2CHZ A;  3NHE B;  4HJK A;  3ZTD A;  1YOV B;  2LXA A;  4ANW A;  2KTR B;  3CF6 E;  3ZW3 A;  3E9S A;  1TS4 A;  1ZDX A;  3AED B;  3TIX A;  4YSX B;  5D7G A;  1I4Q A;  2J7Q B;  3DPD A;  2DZI A;  1Y8R C;  3PPA A;  3VUX A;  2I38 A;  3U52 E;  2V0G A;  4A90 A;  1LFD A;  4PS8 A;  2MP2 A;  2HJ8 A;  2GI9 A;  4TKN A;  1TBE A;  3HM3 A;  1L0V B;  2L83 A;  1GOZ A;  3V3X A;  3B2G A;  3WCQ A;  4E74 A;  4WH4 A;  4XE0 A;  1QKZ A;  4HJG E;  1WF9 A;  1XO3 A;  3NG0 A;  4KZ0 A;  3DBS A;  1SXT A;  4BZA A;  2GBK A;  3DOW A;  3TJP A;  4A20 A;  1WGY A;  4S0R A;  2W82 A;  2VRR B;  3RMK C;  1V97 A;  2M0X A;  2QDF A;  2C9W B;  2WXR A;  4X57 B;  4HVB A;  3QWZ B;  2V9H A;  2JUO A;  2VH1 A;  2IGD A;  3B0A A;  1GG3 A;  1PYW D;  4A9A A;  3W1S A;  1FFU A;  3T3O A;  3BZD B;  4ANX A;  2DZJ A;  3VQI A;  1V2Y A;  3VR9 B;  2ASQ A;  4MAC A;  4OW0 A;  2X38 A;  1DGJ A;  3EFU A;  5GXG B;  4CO7 A;  3TUO A;  2LXC A;  1H4R A;  1V6E A;  2EKE C;  3I9V 1;  3IT4 B;  3L0W B;  3QHT A;  1C1Y B;  3VFK A;  2KJ6 A;  4XZ4 A;  1J7B A;  3C19 A;  1SE3 A;  2MBB B;  2KFK A;  3MJW A;  1A5R A;  1FO4 A;  3DBL I;  2AYO B;  5IP4 D;  2B3A A;  4G11 A;  4P7I A;  1IGD A;  3NY5 A;  4WJP A;  1UWX A;  2N9L A;  5BO4 B;  4C56 C;  1D4B A;  3IT6 B;  3I3T B;  3EUB 2;  1BT0 A;  2K3U A;  3NVY A;  4JGH B;  2KDM A;  1FEH A;  1ZE3 D;  5EE1 A;  1PGB A;  4KSK C;  3AUL A;  5BYQ A;  4KIK A;  4WWN A;  4G50 A;  1UD7 A;  4HPP A;  3AE1 B;  2HE7 A;  1E9M A;  3WIM A;  3PHX B;  1WFY A;  2WXJ A;  4IG7 B;  4IM3 A;  1WGH A;  4M01 A;  4HCN B;  1Q0W B;  1OQR A;  1XF5 L;  3KUZ A;  2KAC A;  4NAW A;  1QQR A;  1R4M I;  1NYR A;  4JX1 C;  2ICI A;  4JPS A;  3UIP B;  1RFK A;  2LGX A;  1C77 A;  3R8B A;  2ZEQ A;  3JSV B;  2KDF B;  3PTF C;  3Q8B A;  2MSE D;  1XCQ L;  3M62 B;  3IHP C;  1OEY A;  3ZJT A;  2KAJ A;  2KOX A;  3RUI B;  4RMA A;  3Q3F A;  2KQ7 A;  4BVU C;  3AXC A;  1FNV A;  1WMH A;  2LMC A;  1SSN A;  1LXD A;  2FUH B;  2MRP A;  1T5X D;  1YN3 A;  4GU2 A;  4FJV B;  4FLH A;  3PRM B;  2X8X X;  4MGZ E;  4TV3 A;  1OQY A;  3CST A;  4FBJ B;  4XX5 A;  2Z0D B;  2LJI A;  1ET9 A;  3KH0 A;  3V6E B;  4HRO A;  3ML9 A;  3WAO A;  1JRO A;  3N3K B;  2GB1 A;  3OWE B;  1JWM D;  2M8S A;  4URK A;  4GDL B;  4W9E A;  1IYF A;  2WXG A;  3FAH A;  4LK0 M;  3N30 A;  3UGB B;  2QC8 A;  2WXN A;  2WDQ B;  3DWM A;  3L17 A;  2JPH A;  4M8N A;  3ZKJ C;  2D5G A;  2SAK A;  3V60 A;  1L4D B;  4N9F 4;  4MJS A;  1OFF A;  2RDH A;  4MM3 B;  3MC9 A;  1ZW7 A;  3KLS X;  1E5W A;  5J2R A;  4IM0 A;  4RGT A;  3MHS D;  3AEG B;  4RNA A;  4MEL A;  3EEC A;  2N9P C;  2K39 A;  2ON8 A;  3NVW A;  2WXL A;  4ZRQ A;  3PGE A;  4K3C A;  2MQJ A;  1ZXI A;  4FJY A;  3ML8 A;  2QCZ A;  1PDX A;  3QA8 A;  1P7F A;  4W9D A;  5I4D A;  1UUP A;  2KFJ A;  2MBE A;  4I6P A;  2KMM A;  4CHK A;  3VTW A;  4US8 A;  1YQ3 B;  2AL6 A;  1WJ4 A;  4YL8 A;  3NZU A;  3AMZ A;  4IOI E;  5AZH A;  4KGR A;  1K51 A;  2N7D A;  2D10 A;  1C9F A;  5E6J A;  3WAM A;  2A5U A;  2WXK A;  4I6L B;  4BFR A;  2VZK D;  1K8R B;  3BYT B;  4E71 A;  5CHW A;  5EE3 A;  4HWI B;  4G3X B;  3W1S C;  1HQR D;  4NQK E;  5JHB A;  3N1Y C;  5LXH A;  1VLB A;  1I7H A;  2PE6 B;  4N59 A;  2XBB C;  2RPV A;  3QIJ A;  3BVZ A;  2B76 B;  1FM0 D;  3DHI C;  2KK8 A;  2JX5 A;  4DXA B;  2CKH B;  3RNG C;  3W9C B;  2L0T A;  2PW9 A;  2K22 A;  1E8Z A;  2V3N A;  3UI3 A;  2ZW1 A;  1KLV A;  2BS2 B;  2JXX A;  1ZGU B;  4ARI A;  4RM9 A;  1DOY A;  3V6C B;  3VR8 B;  2K1F A;  1J0G A;  5HI1 A;  1SF0 A;  2O6V B;  2WGS A;  3HK0 A;  2O2V A;  4IM2 A;  1U4A A;  2PJH A;  4F1S A;  2CHW A;  1CJE A;  1WSP A;  2H89 B;  1E8X A;  1SBB B;  2KTF A;  2V3S A;  1V1P B;  3AEF B;  3MTN B;  4C7Y A;  1JCK B;  4LNK A;  4HXD A;  5IKC M;  2OJR A;  4JL9 A;  2KMC A;  2WLB A;  2D11 A;  1Q1O A;  1L0X B;  2KZR A;  5CX3 A;  4FUL A;  2XN9 C;  2M0A A;  3DCG A;  1WWT A;  4K3B A;  5G5H A;  4XC2 A;  2KN4 A;  1I4G A;  5E6O A;  3ZYY X;  1BXT A;  3IAS 1;  4KDL B;  4L23 A;  4FHJ A;  3A1Q B;  1TYG B;  4WAA A;  1JWA D;  2ONQ A;  2FID A;  2KC2 A;  3DBR B;  1L2N A;  3PLU A;  4LDT D;  2RR9 A;  1WRD B;  1IBX B;  2DX5 B;  2KLG A;  4LJO B;  3S2A A;  3BK2 A;  3V61 A;  2QHO A;  3L16 A;  3VUY A;  4MEM A;  3Q3N C;  1GC6 A;  3ZVV A;  3A9K A;  4GGQ A;  5GMV A;  4ARC A;  2JF5 A;  1MHH E;  3ZRF A;  1YQ4 B;  2DYB A;  1WIA A;  3FKY A;  4MGI E;  4C4V B;  2KJH B;  1YIW A;  2DBY A;  4DDI D;  4KDI C;  3HVZ A;  2UU7 A;  3X23 A;  3LYY A;  5CHV C;  4A3O A;  2ACZ B;  1TT5 B;  2KX3 A;  2BF8 B;  1DOI A;  3DVN U;  5DPR A;  2IO2 B;  1V9J A;  3V05 A;  4DBG A;  1WGG A;  4TMA B;  4K7S A;  1R4N B;  3H7P A;  5FR3 A;  3L4P A;  3PSE B;  3VVW B;  5D3D A;  5FK9 C;  2IO3 B;  3HVD A;  5TR5 A;  3PZD A;  3EFC A;  2EMT A;  2OOB B;  2G4D B;  3EC8 A;  1WXQ A;  4ZYS A;  4C7Z A;  1JML A;  2G1E A;  4IWQ A;  1D5X C;  2BS3 B;  3H7S A;  1FXT B;  2DWQ A;  1VD2 A;  2N9K A;  2JZ3 B;  3VTU A;  3V62 A;  4P1C C;  1WR1 A;  2ZW0 A;  5HKH A;  2KWD A;  3WAN A;  4GLS C;  4M02 A;  1H8C A;  2KMA A;  2E6X A;  4AP4 C;  5DPS A;  3GS2 A;  4RF0 A;  4IW0 A;  4FHK A;  1UNS A;  2J0M A;  4MH0 E;  1YJJ A;  1EWY C;  4M0W A;  3M95 A;  4HEA 1;  1F1H A;  3C8Y A;  4J3O D;  4E3C A;  4DDG D;  3ZGZ A;  2NTS A;  5EE0 A;  3ECI A;  3LXF A;  2MP2 B;  2V4I B;  3NS8 A;  1V1O A;  2IPK D;  4BBN C;  1F9J A;  2KVZ A;  1WRI A;  3PS6 A;  2D3G A;  3QX1 A;  2EMS A;  1J19 A;  5D2M B;  1WJ6 A;  2VH2 A;  1CMX B;  4HPM B;  1EF1 A;  2AQ3 B;  2FCS A;  1KLG D;  4XDD A;  2XK5 A;  4PYZ A;  2KNB A;  1XCT L;  4K81 A;  2BKF A;  4XWW A;  3AE7 B;  1RWS A;  4ICU A;  5JHA A;  4C80 A;  2MA9 B;  2NPT B;  3R7Q A;  3Q3M C;  3DVG Y;  1NDD A;  2JSV X;  1WI0 A;  3DVG X;  1T3Q A;  1XLO A;  2DZK A;  3U7D A;  4WJN A;  3KVF B;  2WWZ A;  4IKG A;  4II2 B;  3AH7 A;  1KFY B;  4RM8 A;  4GSW A;  2ZVO A;  2GRI A;  2M19 A;  2N7E A;  4WJO A;  1L6V A;  3P4R B;  4LTU A;  4RCO A;  2AL3 A;  4B95 A;  1C4C A;  4OVV A;  4KVG B;  2EKI A;  3A4R A;  3I63 C;  4S17 A;  1D5M C;  1DYQ A;  1GJZ A;  2W54 A;  2K0P A;  3AN1 A;  1E7U A;  1PGA A;  3M3J A;  2MEK A;  2WS3 B;  1GB4 A;  5AZG A;  3RNE C;  2BTE A;  2LUE A;  3MHZ A;  3GE8 C;  2W55 A;  2K8C A;  5MPO A;  3VXW A;  3IVF A;  1ROE A;  1FRD A;  2FCN A;  2K25 A;  2K8H A;  3Q8E A;  2WX0 A;  2INC C;  3OLM D;  2KTR A;  4W9F A;  2GBR A;  2YEP F;  4W9G A;  2WXH A;  2PEA A;  4N58 A;  3AB5 A;  4HPL B;  1D3Z A;  4C00 A;  3K9O B;  2LVO A;  5G55 A;  2NR2 A;  3HHM A;  3SU8 X;  4MGK E;  4ANV A;  1VJK A;  5KHO A;  4AS1 A;  2M56 B;  2PPH A;  1K50 A;  1TJE A;  3R66 C;  2INP E;  3B2F A;  2ZNV B;  3KYD D;  4YXD B;  1L0Y B;  1WXS A;  5IO9 A;  1C4A A;  2DYM A;  2WP9 B;  3RYT A;  1P98 A;  4AUQ C;  1UGM A;  3NZS A;  4LNN A;  3EHV A;  4EOY A;  1KLU D;  3QC8 B;  4GN1 A;  5C23 A;  1RYJ A;  5FKA C;  2YVC A;  1UBI A;  1HXY D;  4GXB A;  2WXF A;  2KWC A;  2HTM E;  4AOF A;  2BPS A;  1BML C;  4RFB A;  3PO0 A;  4LCD E;  4LNF A;  1RM6 C;  5C1Z A;  3RNA C;  2I1J A;  4ANU A;  2L32 A;  1PFD A;  1QOA A;  4W9I A;  4TQ0 A;  3NOB A;  4ZRP A;  3GZN I;  4F7Z A;  2RDB C;  3JYU A;  1HEZ E;  1QLB B;  4OVU A;  3AU4 A;  2PLP A;  2UWQ A;  1TKG A;  3K9P B;  2LI5 A;  5AEK B;  1J7A A;  3HM6 X;  3M63 B;  3UF8 A;  3L10 B;  2MJ3 A;  1C3T A;  1I4R A;  2JWU A;  2KN5 A;  1ZOY B;  3UQA A;  4YSZ B;  4KZC A;  1ENF A;  5EE9 A;  5CTR C;  2Z0E B;  2CHX A;  2K8B A;  2D07 B;  4K7U A;  2L00 B;  2IZV B;  4HRS A;  1ET6 A;  1YX5 B;  1GUA B;  4MJS B;  4RF1 A;  4FA6 A;  5LNK 1;  2BKR B;  2IY1 B;  5T8I A;  3IFW B;  2N7J A;  4MT5 A;  4W9H A;  3SDL C;  1NI3 A;  1E8Y A;  1UEL A;  2V1Y A;  3LJ3 A;  2D3C A;  4ZRK A;  2IGH A;  4Q2J A;  2PIA A;  1YNT E;  5LXI B;  4OVZ A;  3ENE A;  3P4P B;  2OED A;  2HTH A;  3MJ5 A;  3IBE A;  4MGY E;  3BIN A;  1VZ7 A;  1X1M A;  2NBW B;  3P63 A;  4WIP A;  4FAD A;  4JIO U;  1IPG A;  2JYE A;  1MG4 A;  3R2T A;  1NVI D;  2L0F A;  3JSV A;  1TS3 A;  3RT3 B;  2V4L A;  4IC7 B;  4BOZ B;  1RAX A;  4GDK B;  3ZDT A;  4OZB A;  4N6E B;  1MG8 A;  2RSU A;  2E3T A;  3DBR I;  5J17 A;  2JU6 X;  2Y5C A;  2LRU A;  5EDS A;  2ZPY A;  5BMI A;  3P1M A;  3IAM 1;  4YTN B;  1N5W A;  2MBO A;  3AE4 B;  1E7V A;  4A6Q A;  2NTT A;  3FC4 A;  1K52 A;  4LNI A;  1VZ8 A;  1WR6 E;  3WAP A;  3UIO B;  4IWP A;  2PVO D;  3ZO5 B;  4GDL A;  4ZRJ A;  1T0Y A;  1TIF A;  3PZ7 A;  4AWJ A;  2KWU B;  4DXF A;  2N9X A;  3AV8 A;  4MSQ B;  1HE8 A;  1TY2 A;  2ZCC A;  3Q3J A;  4OZA A;  3T9L A;  3DBL B;  2M17 A;  3AU5 A;  3APC A;  2KDB A;  4MM3 A;  1FRR A;  3I5J C;  1E90 A;  1YJ1 A;  1P0R A;  4TUU A;  5BMH A;  1L4Z B;  1D6E C;  4EKU A;  2BYF A;  4NY0 A;  2I2Y A;  3UIN B;  1KM7 A;  4L1B A;  2NMQ A;  2DHZ A;  2YEP B;  2C7N B;  3C0R B;  1M4V A;  2KDE B;  4L2Y A;  4FXC A;  1R4M B;  4W9K A;  1EU3 A;  1VZ6 A;  2BYT A;  3KWL A;  4EEW A;  3Q2A C;  2RDG A;  2AEH A;  1N5X A;  1WM3 A;  3AE6 B;  5DPT A;  1NBF C;  3A4S C;  2BGF A;  2JWZ A;  1E7P B;  4YWG G;  3KQ4 A;  2KD0 A;  1LGR A;  2AX5 A;  3OJ3 A;  1R7S A;  1B1Z A;  3LDZ E;  1SJH D;  4RGM A;  5DPW A;  3N9Y C;  1IUE A;  5KHQ A;  4NQL B;  1HTQ A;  4A55 A;  4EZL A;  2LEK A;  3AEC B;  3RNC C;  1ESF A;  1E0Z A;  2QEJ C;  1UZX B;  1T0R C;  2AQ2 B;  2JY6 A;  1S1Q B;  4GIV A;  4BKG A;  1SEB D;  3CIR B;  3VH3 B;  3ZTC A;  2VZK B;  2WU5 B;  2LWP A;  1LO5 D;  1WZ3 A;  3BWU D;  4XWT A;  1GPX A;  4P1B C;  4WWP A;  4WQO B;  5CHF A;  2ZPN A;  3WA0 A;  2MX2 A;  4JQW C;  3R7R A;  1VRA B;  1WX9 A;  2WXI A;  4W9J A;  3DHG C;  5G5G A;  3NVZ A;  2G45 B;  1JQ4 A;  4ZHP A;  1FNU A;  3NUH B;  1FPY A;  2PMV A;  4I6N B;  4EZK A;  1WXV A;  5G2N A;  2PE9 A;  3AEE B;  5TSS A;  3DQV A;  3VRB B;  2Y5P A;  2J4X A;  4DHZ E;  4NJ6 A;  1V1P A;  4IDI A;  3VHT C;  1E10 A;  1A70 A;  1Y56 A;  2K9X A;  3ETR A;  4P6V F;  1J7C A;  1V5T A;  3H9D A;  2QSD A;  4XGA B;  1F2R C;  2QIE B;  4PS3 A;  1LQB A;  2RD0 A;  3KYC D;  5JZE B;  1I42 A;  3VTV A;  1TZ1 A;  5E6P A;  1VDV A;  4B9K A;  1FD6 A;  3ALB A;  2FCM A;  3A1Q A;  4II3 B;  1ZUD 2;  3KUC B;  2D2Q A;  3OJ4 B;  1MFW A;  1GNU A;  2D3A A;  1HTO A;  2K6D B;  3D32 A;  2Y3A A;  1F0Z A;  1WM2 A;  2BQQ A;  3NS1 A;  3A9J B;  1XQQ A;  1JRP A;  2BYE A;  2KVR A;  2EEL A;  3AE8 B;  1TKY A;  3JW0 X;  1AYF A;  4KKI A;  2JQR B;  1P3Q U;  3TBL D;  4AJW A;  4W9L A;  4DHJ B;  3SHQ A;  2Z59 B;  1IBX A;  2Y5B B;  1WYG A;  3E56 A;  4EFO A;  1FMA D;  5LLI A;  2CU1 A;  1WE6 A;  2IO0 B;  3AEB B;  3TEY A;  5D3I B;  3JVZ X;  2CJN A;  2JZP A;  3Q8F A;  1QOF A;  2K5P A;  2HDE A;  2MLB A;  5DCN A;  1JRU A;  1L7Y A;  3ZXV A;  1LM8 B;  3ZNI D;  2WDT B;  2N4F A;  1SIF A;  2NS5 A;  2Z8L A;  1YD8 U;  1SE9 A;  3MC0 B;  4WUR A;  3FIL B;  4A3P A;  2AWT A;  3RN9 C;  4US9 A;  1YN4 A;  2BT6 A;  2WQY B;  1IP9 A;  3W2D A;  5C2T B;  3VUW A;  4JE3 B;  2MBH A;  2W9N A;  5BYS A;  1XEE A;  1F2R I;  4IWO A;  3ZNH B;  3QQ8 B;  5BMG A;  1I4P A;  1WY8 A;  4NNJ B;  2BWF A;  2D3B A;  1PGX A;  1NEK B;  2ZVN A;  2K6Q A;  1P9D U;  3RNF C;  2L8J A;  3PRZ A; 
#chains in the Genus database with same CATH homology
 3B1L X;  3VTW A;  1Q5W B;  4LCD E;  2AL6 A;  4BKT A;  2GBJ A;  1WJ4 A;  4YL8 A;  3L54 A;  3NZU A;  2XEW A;  5C1Z A;  5AZH A;  4CYE A;  2I1J A;  1WJU A;  4ANU A;  3H7P B;  2NBV B;  3ZNG C;  2N7D A;  4W9I A;  3NOB A;  4TQ0 A;  2D10 A;  2LZ6 A;  4K7W A;  3PRP B;  3WAM A;  3GZN I;  2A5U A;  4F7Z A;  3JYU A;  4I6L B;  4BFR A;  4WWO A;  3GOE A;  4OVU A;  3DDC B;  1K8R B;  3AU4 A;  2UWQ A;  4E71 A;  5CHW A;  3K9P B;  2LI5 A;  5AEK B;  4HWI B;  2M1M A;  3H6N A;  3HM6 X;  3M63 B;  4M8M A;  4G3X B;  3UF8 A;  3W1S C;  3L10 B;  4NQK E;  5JHB A;  1C3T A;  3R3M A;  5LXH A;  2KN5 A;  1VCB A;  2PE6 B;  2UYZ B;  2XBB C;  3CMM B;  4FJZ A;  3UQA A;  4KZC A;  1P1A A;  5JH5 C;  3QIJ A;  1EF5 A;  3DVN V;  1EUV B;  3PV1 A;  5CTR C;  3ZNZ B;  4MSM B;  2Z0E B;  2CHX A;  2K8B A;  2D07 B;  1M94 A;  4K7U A;  1XD3 B;  2J0K A;  2KQS A;  4KV2 A;  3VH4 B;  2L00 B;  1E8W A;  2IZV B;  2KK8 A;  2KHW B;  4BBN F;  3T8M A;  4DXA B;  2CKH B;  1RLF A;  1YX5 B;  1GUA B;  2R2O A;  2L0T A;  4MJS B;  2C7M B;  1E8Z A;  4FA6 A;  2GBN A;  1I35 A;  1KLV A;  4KSL C;  2BKR B;  2IY1 B;  3RCZ A;  1NI2 A;  2JXX A;  1ZGU B;  3IFW B;  1PQS A;  2KO3 A;  3DBH I;  3PRE A;  4RM9 A;  4W9H A;  2JRI B;  1Z2M A;  2KFK B;  3SDL C;  3V6C B;  1E8Y A;  1UEL A;  2V1Y A;  3LJ3 A;  2M4N A;  2K1F A;  3PLV A;  2KAN A;  2L76 A;  1J0G A;  2LGY A;  4ZRK A;  4M0W B;  2O6V B;  1J8C A;  1S3S G;  2KX0 A;  5LXI B;  3HK0 A;  2FNJ B;  3ENE A;  4BKS D;  2O2V A;  4IM2 A;  1U4A A;  2PJH A;  2HTH A;  1UH6 A;  2CHW A;  3IBE A;  4F1S A;  4MGY E;  1EO6 A;  3BIN A;  4BKS A;  2REX A;  1E8X A;  1X1M A;  2NBW B;  2NBU A;  1V5O A;  2GOW A;  4KIK B;  2J0J A;  2NPT A;  2YLM A;  4FAD A;  4JIO U;  1IPG A;  2KTF A;  4GB9 A;  4LDT B;  2V3S A;  2IY0 B;  4DHZ B;  3MTN B;  1WXA A;  2L0F A;  3ZDM C;  4ICV A;  3JSV A;  1GC7 A;  4AJY B;  2GMI C;  3RT3 B;  2LD9 A;  2V4L A;  4IC7 B;  2MCN B;  2FIF A;  3PHW B;  4HXD A;  4BOZ B;  4PYU A;  3BY4 B;  2OJR A;  2XK5 B;  2DYO A;  2KMC A;  4JL9 A;  4NAW B;  1RAX A;  4GDK B;  3ZDT A;  2D11 A;  2N1W A;  1Q1O A;  1RRB A;  2N1V A;  2KZR A;  5CX3 A;  4FUL A;  5IAA C;  3L08 A;  2ZZP B;  1MG8 A;  2RSU A;  3DCG A;  3DBR I;  3A9J A;  5J17 A;  4DK5 A;  4B6W A;  4HDQ A;  2LRU A;  4XC2 A;  2KC1 A;  2ZPY A;  5EDS A;  2LVQ A;  4HDO A;  5E6O A;  2MBO A;  2NCN A;  1E7V A;  4KDL B;  3AI5 A;  2FCQ A;  4FHJ A;  1WX8 A;  3A1Q B;  1OEY J;  1WXM A;  2HD5 B;  1AAR A;  4BOS C;  1WR6 E;  3WAP A;  4WAA A;  1WGD A;  1QZE A;  1WMH B;  3IG3 A;  3UIO B;  5D94 A;  4GMV A;  2FID A;  3P2B A;  3RZF A;  3QCA A;  2KC2 A;  4IWP A;  3APF A;  3ZO5 B;  4GDL A;  4ZRJ A;  1T0Y A;  4MDK E;  1V80 A;  4IUM B;  1KOT A;  4AWJ A;  1L2N A;  2KWU B;  3QAR A;  1Z5S B;  4HCP B;  3H1U A;  3PLU A;  4LDT D;  5D6J B;  2KDI A;  2CR5 A;  2RR9 A;  1WRD B;  2N9X A;  4MSQ B;  2GBM A;  4K1R B;  3W1Y A;  3ZRC A;  3N32 A;  1HE8 A;  2DX5 B;  2ZCC A;  2KLG A;  4LJO B;  1KJT A;  3S2A A;  3Q3J A;  3V61 A;  3T9L A;  2QHO A;  3L16 A;  3VUY A;  1YX6 B;  4MEM A;  1ISN A;  1WZ0 A;  2M17 A;  1WYW B;  1GC6 A;  2NVU I;  3AU5 A;  3APC A;  3ZVV A;  4DWF A;  2KDB A;  4MM3 A;  5E6N A;  1E90 A;  3A9K A;  5AZF A;  1YJ1 A;  4GGQ A;  5GMV A;  1P0R A;  4TUU A;  2CHZ A;  3NHE B;  4HJK A;  3ZTD A;  2LXA A;  4ANW A;  2KTR B;  3CF6 E;  3ZW3 A;  4EKU A;  2BYF A;  2JF5 A;  2BYV E;  3TIX A;  4NY0 A;  3ZRF A;  5D7G A;  2J7Q B;  2DYB A;  1WIA A;  3DPD A;  2DZI A;  5J18 A;  1Y8R C;  4MGI E;  3PPA A;  3UIN B;  1KM7 A;  2A4Z A;  3VUX A;  2KJH B;  2DHZ A;  1YIW A;  1LFD A;  4PS8 A;  2C7N B;  2HJ8 A;  2MP2 A;  4TKN A;  3C0R B;  4DDI D;  1TBE A;  2BPS A;  1RFA A;  4KDI C;  1V81 A;  2JT4 B;  3HM3 A;  3ZIM A;  3U30 A;  2KDE B;  4E74 A;  3X23 A;  1WF9 A;  5CHV C;  4W9K A;  4KZ0 A;  3DBS A;  4A3O A;  4HK2 A;  2KX3 A;  2BF8 B;  3DVN U;  4NJ7 A;  5DPR A;  2GBK A;  2IO2 B;  3DOW A;  3TJP A;  2LRW A;  3PVL A;  1WGY A;  4A20 A;  1V9J A;  2DZM A;  4EEW A;  4DBG A;  2AEH A;  1WE7 A;  1WM3 A;  1WGG A;  2VRR B;  3B08 A;  2M0X A;  1ZKH A;  4HVB A;  2C9W B;  4X57 B;  5DPT A;  4K7S A;  1NBF C;  2JZZ A;  3A4S C;  2BGF A;  2JWZ A;  3H7P A;  4WJQ A;  3QWZ B;  3PSE B;  3VVW B;  2KD0 A;  2DAF A;  3OJ3 A;  2IO3 B;  2MWS B;  3LDZ E;  2JUO A;  5TR5 A;  3PZD A;  5DPW A;  3B0A A;  2DEN B;  2EMT A;  5KHQ A;  4NQL B;  2OOB B;  1GG3 A;  2G4D B;  3EC8 A;  1WGR A;  4EZL A;  1WJN A;  4EUT A;  2CS4 A;  4IWQ A;  2KXJ A;  3W1S A;  1UZX B;  4G0N B;  2JY6 A;  4ANX A;  3ZUN A;  2WYQ A;  3H7S A;  1FXT B;  1OTR B;  3VAW A;  2LVP A;  3TL5 A;  1S1Q B;  2DZJ A;  3VQI A;  1V2Y A;  1V49 A;  1VD2 A;  2ASQ A;  4ZYN A;  4GIV A;  3A33 B;  4BKG A;  2JZ3 B;  3VTU A;  2L7R A;  3V62 A;  3EFU A;  3VH3 B;  3ZTC A;  3TMP B;  2IO1 B;  4CO7 A;  1WR1 A;  5HKH A;  2LXC A;  1H4R A;  2LGD A;  1V6E A;  2EKE C;  4PS7 A;  2LWP A;  3WAN A;  1WZ3 A;  1H8C A;  2KMA A;  3L0W B;  4AP4 C;  3QHT A;  1C1Y B;  4WWP A;  4WQO B;  5DPS A;  3VFK A;  2KJ6 A;  5CHF A;  4XZ4 A;  2ZPN A;  4LJP B;  3PT2 B;  4IW0 A;  3WA0 A;  2MX2 A;  4FHK A;  2MBB B;  2KFK A;  3MJW A;  4JQW C;  2O6V D;  3R7R A;  3DBL I;  1A5R A;  2AYO B;  2J0M A;  2B3A A;  2L05 A;  4MH0 E;  4G11 A;  4P7I A;  1WX9 A;  3NY5 A;  3M95 A;  3OAW A;  4W9J A;  4NPN A;  4WJP A;  5BO4 B;  4ZDV A;  2G45 B;  1YQB A;  4E3C A;  2C5L C;  4DDG D;  2C7H A;  3I3T B;  3KUD B;  3ECI A;  4F8C B;  1BT0 A;  4JGH B;  4I6N B;  2BWE S;  2IYD B;  4EZK A;  2MW5 A;  1WXV A;  3L13 A;  2FAZ A;  2MP2 B;  5G2N A;  2PE9 A;  3NS8 A;  4KSK C;  3AUL A;  4GOC A;  4KIK A;  4BBN C;  1F9J A;  3DQV A;  3U8Z A;  4WWN A;  3PS6 A;  4G50 A;  1UD7 A;  2D3G A;  2L3Z A;  3QX1 A;  5FR6 A;  4DHZ E;  2EMS A;  4NJ6 A;  1J19 A;  5D2M B;  3VHT C;  1SGH A;  2HE7 A;  4EZJ A;  4HLE A;  3WIM A;  1WJ6 A;  1WX7 A;  3PHX B;  1WFY A;  2KWV B;  1CMX B;  4HPM B;  1WGH A;  1EF1 A;  3QJZ A;  4IG7 B;  4IM3 A;  4HCN B;  1Q0W B;  2JRH A;  2O2V B;  1V5T A;  3KUZ A;  2FCS A;  3H9D A;  2DAJ A;  2XK5 A;  4PYZ A;  4NAW A;  4GDK A;  3X0W A;  2KNB A;  2BKF A;  4K81 A;  1R4M I;  4PS3 A;  1LQB A;  2RD0 A;  3KYC D;  5JZE B;  2IBI B;  4ICU A;  5JHA A;  2KKC A;  1I42 A;  2MA9 B;  2NPT B;  3R7Q A;  3DVG Y;  3UIP B;  1NDD A;  2LGX A;  1WI0 A;  3VTV A;  3DVG X;  4ZRI A;  1TZ1 A;  5E6P A;  2ZEQ A;  2DZK A;  3U7D A;  1R4N I;  2KDF B;  3JSV B;  3PTF C;  2G4S A;  2WWZ A;  2MSE D;  3KVF B;  4WJN A;  4B9K A;  2I1K A;  4II2 B;  3ALB A;  2FCM A;  3A1Q A;  3M62 B;  4II3 B;  4RM8 A;  3IHP C;  2LJ5 A;  2ZJD A;  1OEY A;  2D2Q A;  3KUC B;  3OJ4 B;  2KOX A;  2ZVO A;  2MBQ A;  4GSW A;  4RMA A;  3RUI B;  3Q3F A;  1GNU A;  3RUL A;  2KQ7 A;  1XT9 B;  4BVU C;  2N7E A;  3AXC A;  2R2Q A;  4WJO A;  1WMH A;  2K6D B;  3D32 A;  1UBQ A;  4TQ1 A;  5L83 A;  1LXD A;  2FUH B;  3O65 B;  1TTN A;  1WM2 A;  2G3Q B;  2MRP A;  3A9J B;  1XQQ A;  2BYE A;  2AL3 A;  4GU2 A;  4FJV B;  2KVR A;  3PRM B;  4FLH A;  3RZW C;  1OGW A;  4B95 A;  1TGZ B;  4MGZ E;  3JW0 X;  4I6P A;  4TV3 A;  1OQY A;  3CST A;  4OVV A;  4KVG B;  4FBJ B;  3A4R A;  4XX5 A;  1P3Q U;  2Z0D B;  3TBL D;  5IA7 A;  1GJZ A;  2KJR A;  3VDZ A;  4AJW A;  4W9L A;  3KH0 A;  3V6E B;  4AOF A;  3RD2 A;  4DHJ B;  3ML9 A;  3SHQ A;  3SD5 A;  2Z59 B;  1E7U A;  2LAS A;  3CSF A;  3WAO A;  3M3J A;  3N3K B;  5AZG A;  2Y5B B;  2LUE A;  4W9C A;  4EFO A;  2M8S A;  4URK A;  2K8C A;  5LLI A;  4GDL B;  4W9E A;  2CU1 A;  1WE6 A;  2IO0 B;  1IYF A;  3VXW A;  3IVF A;  5L95 C;  2RPQ A;  3JVZ X;  2JVC A;  2FCN A;  2K25 A;  2K8H A;  3N30 A;  3UGB B;  2WX0 A;  1WH3 A;  3OLM D;  2KTR A;  4W9F A;  2GBR A;  2MLB A;  4W9G A;  5DCN A;  1JRU A;  3L17 A;  2PEA A;  1L7Y A;  2JPH A;  1LM8 B;  4J6I A;  4M8N A;  3ZKJ C;  3ZNI D;  2WDT B;  2N4F A;  4FN2 A;  3APD A;  3ZLZ A;  4HPL B;  1D3Z A;  3V60 A;  3K9O B;  1SIF A;  2LVO A;  2NS5 A;  2NR2 A;  3HHM A;  5G55 A;  1YD8 U;  1SE9 A;  4MGK E;  3SU8 X;  4ANV A;  4N9F 4;  3UQB A;  4MJS A;  1G6J A;  3KW5 B;  5KHO A;  4A3P A;  2AWT A;  2PPH A;  3QK0 A;  2ZNV C;  1ZW7 A;  3A9K B;  1E5W A;  5J2R A;  4IM0 A;  3HIZ A;  2N9E B;  3R66 C;  4ASW C;  3MHS D;  2ZNV B;  1V86 A;  3KYD D;  4MEL A;  1WXS A;  4JLC A;  3EEC A;  1IP9 A;  2WX1 A;  2C60 A;  2O6V A;  3TCA A;  2DYM A;  3QAQ A;  2N9P C;  2K39 A;  3VUW A;  3RYT A;  2MBH A;  2W9N A;  3ONS A;  1P98 A;  2RGF A;  4AUQ C;  1UGM A;  3NZS A;  4IWO A;  3ZNH B;  3QQ8 B;  4DHJ D;  3EHV A;  3PGE A;  2MQJ A;  4FJY A;  3ML8 A;  4EOY A;  2KLC A;  1WY8 A;  2ZCB A;  3QA8 A;  3QC8 B;  4GN1 A;  4NNJ B;  4W9D A;  2BWF A;  5C23 A;  2ZVN A;  1UBI A;  2YVC A;  2K6Q A;  2KFJ A;  2MBE A;  4GXB A;  1P9D U;  2KWC A;  3WAL A;  2L8J A;  3PRZ A;  4CHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...