4EEWA

Crystal structure of the ubl domain of bag6
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
74
structure length
74
Chain Sequence
PDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Large proline-rich protein BAG6
publication title Crystal structure of the Ubl domain of BAG6
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 19
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4eewA00
4DK5A 2PPHA 4NAWB 3ZW3A 3U8ZA 3NHEB 5AEKB 3QJZA 1NBFC 2K8BA 1WR1A 2KJRA 3IG3A 2KC2A 2LRWA 3ML9A 2DAJA 1WE7A 1WX8A 3IVFA 2MLBA 3ALBA 4ICVA 3M62B 2FIDA 4FADA 1Q5WB 1WXVA 1D3ZA 3VUXA 4AOFA 1KLVA 1V5TA 2Z0EB 1OQYA 3ZNZB 1UELA 4WJNA 3A9KB 1E7VA 3TBLD 4F8CB 1K8RB 2N7DA 3KUDB 2NS5A 2HJ8A 2K8CA 2L8JA 3VAWA 2HD5B 4IM2A 2KO3A 2O2VA 1S1QB 2MW5A 4LDTD 3U30A 3VTWA 4DHZB 3DQVA 4HVBA 2OJRA 2L0FA 2UWQA 3ZDTA 1ISNA 2V4LA 3AXCA 2M17A 3BY4B 3DVGX 4FJVB 2KTRB 4JGHB 1WMHA 1Z5SB 4HXDA 1JRUA 2L05A 3ZTCA 1V6EA 2V1YA 2L76A 3PRZA 2LVOA 3RD2A 2AEHA 2FNJB 4E74A 2AL3A 1IPGA 3QC8B 4A20A 4LDTB 2JT4B 2LUEA 4MGKE 1LFDA 2EMTA 3D32A 2ZNVB 3A1QB 1TZ1A 3PS6A 4B6WA 4X57B 1YX5B 3PRPB 4J6IA 5BO4B 4BFRA 1SIFA 3QX1A 3RT3B 1WM3A 1EF1A 2L7RA 4IW0A 3O65B 4KZCA 1YJ1A 2KX0A 3VFKA 3RZWC 5TR5A 2MBBB 3B08A 4ICUA 3VTVA 5AZGA 2FIFA 1UGMA 2C60A 4JIOU 4K81A 1HE8A 3KVFB 4EZKA 2KFJA 2FCNA 1R4MI 4GSWA 2K8HA 2AL6A 1SE9A 4DXAB 2D3GA 2KMCA 4WQOB 1WXMA 2KDEB 3PRMB 2R2QA 3UQBA 2KANA 3DBLI 3L10B 5D7GA 2VRRB 2L3ZA 4XC2A 1I35A 3T8MA 3PHXB 1WJ6A 3GOEA 5G55A 5CHFA 1E8WA 4W9KA 3TJPA 4BKSD 4BKGA 2Y5BB 5E6OA 5J17A 3A9JB 4LCDE 4W9HA 3TL5A 2NVUI 5CX3A 2Z0DB 3APCA 4IM0A 3JSVB 3L17A 4PS8A 3ZNID 4BVUC 4EZLA 2JWZA 3UF8A 4KVGB 3DVGY 2KFKA 4GDLA 2BYEA 2MQJA 3H9DA 1UBQA 3S2AA 2ZCBA 2KOXA 3HK0A 3IHPC 2K1FA 4FN2A 4N9F4 3VVWB 3V61A 2N7EA 3ZDMC 4AWJA 2O6VA 4YL8A 1WYWB 4F1SA 1UD7A 1J19A 2WX1A 4GIVA 2KX3A 2LZ6A 2XBBC 2MRPA 3M95A 3N30A 4ASWC 2GBKA 4RMAA 4A3PA 2DZIA 2IY0B 3EC8A 2KTFA 4JLCA 4DHJD 2DZJA 2BPSA 3QK0A 4BBNC 2KJHB 4BOZB 1UZXB 3H7PB 4MM3A 1RLFA 4HPLB 1WI0A 4FA6A 2NPTB 1OTRB 4K1RB 5D6JB 1WM2A 3PPAA 2IYDB 5AZHA 1ZGUB 2N1WA 1GJZA 3ZRCA 4G50A 4WJQA 3OJ3A 3DPDA 1M94A 5D2MB 1EF5A 2JY6A 4DHJB 5DPWA 1GNUA 3AU5A 4KSLC 1GUAB 2KK8A 3ENEA 4XX5A 4HLEA 3QIJA 3CSFA 2MSED 1E8ZA 2MBEA 3QA8A 1R4NI 2CS4A 1OGWA 1Q1OA 4NJ6A 1YX6B 2EKEC 4IWPA 4W9IA 2ASQA 5DPTA 1V2YA 1I42A 2RR9A 3X0WA 1ZW7A 3APFA 4MDKE 2QHOA 3PVLA 1WGHA 2PJHA 1YQBA 4AJYB 2MBOA 4NPNA 2DAFA 4NY0A 1TBEA 2I1KA 3M3JA 2PE6B 1Q0WB 2BKFA 3QCAA 4GMVA 5C23A 4MJSB 4W9FA 4I6LB 4ANXA 2AWTA 2C7MB 3KUCB 2KN5A 2ZCCA 2IY1B 4LJPB 3KW5B 2W9NA 2J0JA 3NOBA 1OEYJ 2LGYA 2MBHA 3KYDD 1RFAA 4GDKA 4W9CA 4WAAA 2R2OA 2DENB 2REXA 2ZVOA 3ECIA 1WJNA 3VUWA 4HK2A 2J7QB 1WF9A 5JH5C 1V5OA 3DDCB 1QZEA 2D07B 2IO0B 3HM3A 2N1VA 4FJZA 4TV3A 1WGRA 3QQ8B 1A5RA 1V49A 2KWCA 4NQKE 1GG3A 2RD0A 1LQBA 3RYTA 2KMAA 1YD8U 2MBQA 2YLMA 4K7UA 4JQWC 1E8YA 4TQ0A 2PEAA 2PE9A 1IP9A 4K7SA 2FUHB 3RUIB 4EKUA 4EOYA 3UINB 4WWNA 3AI5A 2DX5B 2NBVB 3IBEA 2KJ6A 2LVQA 2DYOA 5AZFA 4KIKA 1WZ0A 3L16A 2JVCA 1GC7A 2DZKA 4M8NA 2L00B 1P0RA 2CKHB 2BYVE 1ZKHA 2O2VB 3MHSD 2IBIB 2LRUA 5LXIB 2J0KA 3NZSA 2C5LC 3WIMA 4G0NB 4FBJB 5KHQA 3SU8X 3V6EB 2KVRA 2KDIA 2RGFA 3PGEA 4FHKA 3TMPB 1WMHB 3PZDA 3H1UA 2LD9A 3L13A 2ZVNA 1Z2MA 3V6CB 2GBJA 3APDA 5J18A 4ZRKA 4OVVA 4RM8A 4MGZE 2JXXA 3QARA 4M8MA 5GMVA 3ZRFA 1WE6A 2MA9B 1WX9A 3K9PB 2I1JA 1V81A 2C7HA 2G3QB 4FULA 4IM3A 4KV2A 2JZZA 3R7RA 3TCAA 1J0GA 2N4FA 2NR2A 3L54A 3MTNB 1WXSA 2FAZA 4GOCA 4FJYA 1WIAA 2GOWA 4P7IA 3ZNGC 5IA7A 2M0XA 1F9JA 2HTHA 4IG7B 4TKNA 1V80A 2DHZA 4W9JA 3MJWA 4MH0E 4JL9A 3LJ3A 4E71A 3ZO5B 2FCSA 2XK5A 1XT9B 3WA0A 1L2NA 3V62A 3LDZE 2WDTB 3WANA 2L0TA 3W1YA 1FXTB 4GGQA 2MP2A 2WWZA 4ANUA 2KQSA 1XQQA 3A33B 4PYUA 3JVZX 2ZPYA 4WWOA 1C3TA 2BF8B 2V3SA 4BOSC 3PT2B 4DHZE 2O6VD 3GZNI 4WJPA 4KZ0A 3DCGA 4EEWA 2KZRA 2C9WB 4I6PA 4M0WB 2LI5A 4W9LA 3PREA 2KFKB 4GDLB 2KDBA 1WGDA 4IWOA 3SD5A 3TIXA 4E3CA 5DPRA 1RRBA 2GBMA 2RPQA 2O6VB 2ZNVC 2OOBB 4MELA 4TQ1A 4URKA 4XZ4A 2CU1A 4GU2A 4MGIE 2NBUA 2LWPA 4DWFA 4GB9A 1E5WA 2LGDA 3QHTA 3VH3B 1TGZB 2GMIC 2LASA 2MCNB 2ZPNA 4RM9A 1BT0A 3VH4B 2HE7A 2Z59B 4HPMB 2M8SA 4EZJA 4MEMA 2GBNA 2KWVB 4AJWA 2N9PC 3DBHI 3VHTC 3CMMB 3B1LX 4IUMB 2LXAA 1Y8RC 3JYUA 1RAXA 3HM6X 1WGGA 4HJKA 1UH6A 3IFWB 4NAWA 2DYBA 4PYZA 1MG8A 3VQIA 1WZ3A 2JRHA 2KLCA 3DBSA 3SDLC 4II3B 2LXCA 4HCNB 1L7YA 2G4SA 4HWIB 4ZDVA 2KXJA 3OLMD 3U7DA 1X1MA 2FCQA 3NZUA 1V86A 1P3QU 2BGFA 4TUUA 3PSEB 2G4DB 5CTRC 3M63B 1GC6A 3A9KA 3H7SA 2JUOA 3L0WB 2UYZB 3ZKJC 3UQAA 4G3XB 5IAAC 1S3SG 3ML8A 2DZMA 3PV1A 4GN1A 3NS8A 4EFOA 2BWES 3HIZA 4I6NB 3R7QA 1WFYA 2K39A 2BKRB 1KM7A 2LJ5A 3N32A 3PTFC 3P2BA 2N9XA 1E7UA 3A4SC 1G6JA 1NDDA 2J0MA 3NY5A 2BWFA 2ZZPB 4GDKB 3N3KB 3BINA 3OJ4B 2KTRA 3R3MA 3QAQA 4HCPB 3ZLZA 1LM8B 2ZEQA 3W1SC 4KDIC 2D2QA 5HKHA 2WYQA 2KLGA 2IZVB 5FR6A 4B9KA 4FLHA 5J2RA 3RCZA 1V9JA 5E6PA 4NNJB 4II2B 4W9DA 3A1QA 3RZFA 2A4ZA 1WRDB 2LVPA 3HHMA 3VDZA 2N9EB 4G11A 1WH3A 3KH0A 1UBIA 3SHQA 3UIPB 5L95C 4AUQC 1WY8A 3DBRI 1VCBA 4NJ7A 4K7WA 1H8CA 1P1AA 1TTNA 4ZRJA 2CR5A 2KWUB 1WJUA 3EECA 4A3OA 1KJTA 4CHKA 4HDQA 3VXWA 2DYMA 4KIKB 1P98A 2YVCA 5KHOA 1YIWA 3DVNV 2IO3B 3CSTA 3A4RA 4CO7A 2LGXA 2XEWA 4FHJA 3UGBB 5G2NA 4WJOA 3T9LA 2K25A 1E8XA 1VD2A 3A9JA 3PLUA 4F7ZA 2ZJDA 3C0RB 2RSUA 3JSVA 1KOTA 3DOWA 4AP4C 3EHVA 4ZRIA 2AYOB 4W9EA 1IYFA 2EMSA 2KHWB 4DDGD 4MSQB 2GBRA 1EO6A 3WAPA 5D94A 5C1ZA 5L83A 3ZIMA 2KKCA 2D10A 1WJ4A 1WGYA 2A5UA 2CHXA 2KDFB 1WR6E 2WX0A 3PLVA 4MSMB 4BKSA 4DBGA 2G45B 3VTUA 4ANVA 2KQ7A 2JF5A 3PHWB 3WAOA 4HDOA 5LXHA 4DDID 1NI2A 3K9OB 3VUYA 4GXBA 2XK5B 3L08A 3W1SA 1AARA 1T0YA 3Q3FA 3H7PA 2M4NA 1WXAA 4IC7B 2K6QA 3ZNHB 4CYEA 2MP2B 3WAMA 2IO2B 1U4AA 2NPTA 4B95A 3ZTDA 3QWZB 3AU4A 2CHZA 4LJOB 4WWPA 4IWQA 5JZEB 5EDSA 3V60A 4PS7A 1EUVB 3WALA 4BKTA 2K6DB 3DVNU 4EUTA 1C1YB 2JRIB 2M1MA 5LLIA 2FCMA 3UIOB 1E90A 1J8CA 2BYFA 2B3AA 1OEYA 4BBNF 2KNBA 4NQLB 2NBWB 3Q3JA 4KSKC 2JPHA 3I3TB 3EFUA 5CHVC 3X23A 3KYCD 3B0AA 3H6NA 5E6NA 5JHAA 1LXDA 5DCNA 3JW0X 3RULA 4MJSA 3KUZA 5CHWA 4MGYE 4W9GA 4PS3A 2IO1B 2JZ3B 2KD0A 3AULA 1PQSA 4ZYNA 2C7NB 3ZVVA 1H4RA 3CF6E 3OAWA 4OVUA 2CHWA 1XD3B 2MWSB 2NCNA 2MX2A 3ZUNA 2KC1A 1WX7A 1CMXB 1P9DU 2D11A 3ONSA 5DPSA 4ANWA 5JHBA 3R66C 1SGHA 4KDLB
chains in the Genus database with same CATH superfamily
1UGJA 5AEKB 3QJZA 1WR1A 3ML9A 1WE7A 1RWSA 3M62B 3MJ5A 1PGAA 1WXVA 3VUXA 1V5TA 1LGRA 3ZNZB 3A9KB 1GAQB 1OFFA 2N7DA 2NS5A 4YSXB 2HJ8A 3TEYA 2WXFA 4IM2A 4LDTD 2O2VA 5E6JA 5FK9C 3VRBB 2OJRA 2L0FA 3ZDTA 1JWUD 1TIFA 1YQ3B 3AXCA 4HROA 1DYQA 2KTRB 2OHFA 3ZJUA 1Z5SB 1JRUA 2V1YA 3RD2A 2AL3A 1EM7A 3QC8B 4LDTB 1TYGB 4MGKE 1D5ZC 1MG4A 4US8A 1UUPA 4NZLB 1DOXA 1SEBD 3FC4A 1SIFA 4IW0A 4KZCA 4YTMB 1YJ1A 2KX0A 1I7HA 2MBBB 2WNMA 3RNFC 1UGMA 2C60A 1C77A 2AQ2B 4US9A 2K8HA 2D3GA 2KDEB 3BWUD 2K22A 1TT5B 2VRRB 4XC2A 1ZDXA 1I35A 3T8MA 2N7JA 3PHXB 5G55A 1ZP0B 5CHFA 1E8WA 1N6ZA 4W9KA 3TJPA 4BKSD 5J17A 3A9JB 4W9HA 3TL5A 4EZLA 4KVGB 3H9DA 2WDRB 3S2AA 3HK0A 3IHPC 4N9F4 4DQOC 2VH1A 2N7EA 3P4SB 4WH4A 4ARCA 1WYWB 3VRAB 5G5HA 4ACFA 3ZGZA 2BVCA 4LNOA 3Q2AC 2WHIA 2MRPA 4RMAA 2DZIA 3EC8A 4DHJD 2CU3A 2BPSA 3U52E 2W82A 4LNKA 4PK1A 2NPTB 5AUIA 1GJZA 2AQ3B 4WJQA 4DHJB 5DPWA 4P1CC 1QOGA 2MBEA 5H8YE 4WQMA 3X0WA 2PW9A 4MDKE 2QHOA 3E56A 4JPSA 1YQBA 1TBEA 3M3JA 4OHJA 2PE6B 3OWEB 4GMVA 2AWTA 2C7MB 1OEYJ 3KYDD 4N58A 3GP7A 1GB4A 2IPKD 2ZVOA 3ECIA 1WF9A 1WGKA 5JH5C 2D07B 2IO0B 4RH6A 1QF6A 3QQ8B 4RGNA 2KWCA 1GG3A 2OJWA 4KX6B 4JQWC 4QAYA 2NTSA 4TQ0A 2PEAA 3DHIC 4L1BA 2V0GA 1IP9A 2JWUA 3UINB 3AN1A 2NBVB 1T6BX 2KJ6A 1GC7A 4M8NA 4HRSA 3BYTB 2INDC 5LXIB 3WIMA 2C5LC 2DLBA 2MJDA 3SU8X 1WMHB 3PZDA 3H1UA 1C4CA 2LD9A 4XYCA 5J18A 4OVVA 4MGZE 1D5MC 5GMVA 3QARA 3ZRFA 2MA9B 1SSNA 4FULA 2JZZA 3FILB 2KT7A 2NR2A 2PIAA 1WIAA 3ZNGC 3RNEC 5BYQA 5IA7A 4IG7B 4YTNB 3LJ3A 2JSVX 5HG2A 1XT9B 3H8HA 1XLPA 2OEDA 3LDZE 2L0TA 2WWZA 2PKOA 5HFYA 3C19A 4XDCA 2ZPYA 2CJOA 3I63C 2GLSA 1SJHD 2O6VD 4AQ7A 4WJPA 1J7BA 2C9WB 4I6PA 2WQYB 2KFKB 4ZOHC 5GXGB 1QT9A 4E3CA 3DHGC 2O6VB 4GU2A 5EE9A 2NBUA 1ET6A 4S17A 1E5WA 4J3OD 2GMIC 2ZPNA 4RM9A 2EKIA 2HE7A 2V9HA 4YWGG 4AJWA 1XLOA 3DBHI 3B1LX 1F77A 2LXAA 3C8YA 1T0SC 1RAXA 2L1AA 1WGGA 3HM6X 3IFWB 4YSZB 4NAWA 2BW2A 1WZ3A 2JRHA 3U7ZA 3SDLC 3ZXRA 2LXCA 4ZDVA 2WXLA 1V8CA 2G4DB 3E9SA 3CIRB 1L4DB 3L0WB 3ZKJC 4G3XB 4KGRA 1S3SG 3ML8A 2DZMA 5IN7A 3PV1A 3NS8A 3DHHC 2AQ1B 1CK1A 3R7QA 2BKRB 3N32A 4IDIA 3P2BA 3A4SC 1G6JA 1MVKA 2J0MA 4K3BA 4GDKB 3N3KB 3KLSX 5FR6A 4RF1A 5D3DA 4W9DA 3IAS1 1FO4A 1FRRA 1YQ4B 2KAJA 3DBRI 1XF5L 1TTNA 2RMMA 2CR5A 4N59A 2LGSA 2YVCA 2IO3B 5BMHA 1SE2A 3SEBA 3DBRB 2ON8A 4WJOA 2JU6X 2ZJDA 2KACA 2RSUA 1TJEA 4RF0A 2BBCA 2AYOB 2WU2B 4B0MA 5D94A 5L83A 2WXHA 1SE4A 3ZIMA 3AE2B 2A5UA 2WX0A 1WR6E 1UWMA 3AEDB 2H89B 2W3RA 3WAOA 4HDOA 1T0YA 4LLGM 3H7PA 1N62A 2MP2B 1JRPA 4WWPA 2UU7A 2SAKA 2LEKA 1N5WA 4PS7A 1EUVB 3U4EG 3WALA 4BKTA 1J7AA 4M00A 2QDFA 1IGDA 2BYFA 3MHZA 4BBNF 1PGBA 4RFBA 3EFUA 3X23A 4A55A 3B0AA 2LFIA 3ZQ4A 4MJSA 2ZW0A 1KRHA 4RNAA 5CHWA 5IO9A 4PS3A 2IO1B 3ETRA 1PQSA 4ZYNA 2IGHA 3RNGC 1P9DU 5DPSA 4PYZA 1PFDA 1IBXA 1DOYA 3NHEB 3ABVB 2KC2A 4MACA 3ALBA 1Q5WB 1L0VB 4AOFA 3TEWA 1OQYA 1E7VA 3TBLD 1VZ8A 3NVZA 4F8CB 1K8RB 3KUDB 1VDVA 1QOBA 2MW5A 3DQVA 1WRIA 3BY4B 3DVGX 3RNBC 4JGHB 4HXDA 3RNAC 3ZTCA 1V6EA 2L76A 3N1ZC 2AEHA 2FNJB 2LUEA 2GRIA 3A1QB 1TY0A 1FNWA 4NJCA 1YX5B 5BO4B 4BFRA 3QX1A 3O65B 5TR5A 3B08A 1P7FA 2FIFA 4JIOU 4K81A 1HE8A 2RDBC 1GPXA 4WQOB 1E0ZA 1WXMA 3P63A 2KANA 3L10B 2WXQA 5D7GA 2YEPF 4LK0M 2IJ0A 1HEZE 4BKGA 4RGMA 2Y5BB 1ZDVA 4A9AA 2NVUI 4LNIA 2Z0DB 1NYRA 4M0WA 4IM0A 4BVUC 4PS8A 3ZNID 2JWZA 2VH2A 2MQJA 1UBQA 2KOXA 4FN2A 2K1FA 3VVWB 3ZDMC 4AWJA 3N1YC 1YN5A 4ZRQA 5C3JB 2BS3B 4F1SA 1J19A 4GIVA 2LZ6A 1CJEA 3AE5B 3N30A 3LXFA 4ASWC 1NYQA 1V1PB 4DXFA 5D3IB 2IY0B 1K53A 2J53A 2V3NA 3QK0A 3AE6B 1STEA 1UZXB 4HPLB 4C4VA 4K1RB 1OTRB 2R61A 3PPAA 2QJLA 2N1WA 2JXTA 1UF0A 1ZPSA 4C80A 3EGRA 1M94A 4KKJA 2ZW1A 1T0QC 3AU5A 2KK8A 4HLEA 3CSFA 2CS4A 1Q1OA 2ICIA 4W9IA 2EKEC 5DPTA 3RPFC 3AEBB 2PJHA 4NPNA 4NY0A 1Q0WB 5BMGA 4W9FA 4ANXA 2IY1B 2W9NA 2J0JA 2CJNA 4YXDB 1HZ5A 2REXA 2DENB 3NRZA 2KWDA 1WJNA 4HK2A 4OZAA 3R2TA 4ZHOA 3DDCB 3HM3A 4FJZA 1YN3A 2N1VA 1A5RA 4NQKE 2RD0A 4L2YA 2KMAA 1YD8U 1CZPA 1JWSD 1WYGA 4K7SA 4EKUA 4EOYA 1WZ0A 3URYA 2JVCA 1MFWA 2CKHB 2O2VB 3MHSD 2DNFA 2IBIB 2J0KA 3NZSA 4C7YA 3AV8A 2KVRA 3PZ8A 2KDIA 3TMPB 1Z2MA 2J4XA 4R3DA 2GBJA 3MFGA 4RM8A 1SB3C 1WE6A 3RI7C 1J0GA 1QLBB 4O1NA 2N4FA 3MTNB 4GOCA 4YSYB 4RGOS 4FJYA 3IAM1 3V3XA 2BYTA 3AB5A 4MH8A 1NI3A 2XK5A 2XNAC 3WA0A 1L2NA 2KVZA 2D3AA 2WDTB 3W1YA 1FXTB 2KQSA 2MEKA 3A33B 1V1OA 1BXTA 1C3TA 1TS3A 2V3SA 2WDQB 2JZPA 4KZ0A 2KZRA 1HQRD 2LI5A 2X8XX 3BIID 5EE1A 4JX1C 1RRBA 2OOBB 4XZ4A 1T5XD 3I57A 1TGZB 1OQRA 2QSDA 3MC9A 1BT0A 2M8SA 4EZJA 4MEMA 2GBNA 2KWVB 4A90A 2BB6A 3JYUA 4HJKA 5BYRA 2HTME 1IGCA 2GB1A 3OLMD 1X1MA 3NZUA 1V86A 1JQ4A 1P3QU 2BGFA 3WCQA 3PSEB 3M63B 1JALA 2UYZB 3UQAA 4GN1A 1E7PB 2BWES 3HIZA 2BS4B 2LJ5A 3EFCA 2J42A 2WXKA 2N9XA 1E7UA 4HKZE 1YNTE 3NY5A 3NZ3A 3AE7B 3BINA 3OJ4B 3NUHB 2D2QA 5HKHA 1PYWD 4KGSA 4B9KA 4FLHA 4A8XC 5E6PA 4P6VF 1A70A 2LVPA 4BAXA 4G11A 2D3BA 1WH3A 1H8CA 1P1AA 3MC8A 3ZXVA 1WJUA 2IGGA 4HDQA 3V05A 5KHOA 1RFKA 3DVNV 1QOFA 5AUKA 2Z8LA 5H92C 1L0YB 5G2NA 3T9LA 3EA6A 1E8XA 1VD2A 3AM9A 3PLUA 3SFEB 3JSVA 1KOTA 3DOWA 3EHVA 4W9EA 2KYWA 4DDGD 4DXGA 1KFYB 5C1ZA 2KKCA 4ZYSA 4DBGA 1KLUD 3RFZB 2KQ7A 1ZE3D 3PHWB 2M19A 5LXHA 4CQNA 1JCKB 3K9OB 1QOAA 2DWQA 4GXBA 3W1SA 4IC7B 2K6QA 1FFUA 2JYEA 3P1MA 1F52A 2HDEA 2K6DB 3DVNU 2M1MA 3UIOB 2FCMA 1B9RA 4NQLB 3AH7A 2KMMA 5CHVC 3KYCD 2GI9A 3Q8AA 5DCNA 3RULA 1NENB 3KUZA 4MGYE 3AULA 1FNVA 3ZVVA 3DBHB 3OAWA 4OVUA 5IKCM 1WWTA 1WX7A 2D11A 2KC1A 1SGHA 3AE4B 4DK5A 2YEPB 4NAWB 2VZKB 1C4AA 1NBFC 2K8BA 2KJRA 2DAJA 3IVFA 2MHJA 2FIDA 4FADA 3UI3A 2Y5CA 2Z0EB 1WXQA 4WJNA 2WXNA 1VJKA 1RM6C 4Q2JA 2K8CA 2L8JA 2KO3A 3U30A 3VTWA 3MP9A 4DHZB 4HVBA 1VLBA 1XLNA 4OVZA 1KTKA 1ISNA 4FXCA 4FJVB 3ZJTA 2L05A 3PRZA 2LVOA 2PMVA 4E74A 3Q3NC 4A20A 1TS2A 2JT4B 1LFDA 2ZNVB 1CQVA 1TZ1A 2QEJC 1FM0D 1JROA 1SJED 3RT3B 1D3ZA 3RZWC 3T3OA 3NVWA 5AZGA 1BUIC 4IKGA 3KVFB 2KFJA 2FCNA 1R4MI 4GSWA 3U2SC 1SE9A 3FKYA 2R2QA 3T3NA 3DBLI 2LHEA 1FXAA 4WWMA 1WJ6A 3GOEA 2SEBD 3PZ7A 3ZYYX 1R4MB 4MT5A 2W54A 3APCA 1MJDA 5EE0A 3L17A 4GDLA 3DBLB 2ZCBA 1NEKB 3V61A 1B1ZA 4YL8A 1K50A 1KLGD 3GE8C 3HRDD 1FRDA 3M95A 2GBKA 3AEFB 4JLCA 2DZJA 4BBNC 2KJHB 4NAMA 3H7PB 2WXIA 4MM3A 1RLFA 1XEEA 1WI0A 4FA6A 4LTUA 2IYDB 5AZHA 1ZGUB 3ZRCA 3DPDA 1EF5A 2JY6A 1GUAB 3ENEA 4XX5A 3QIJA 1E8ZA 4A3OA 4NJ6A 1R4NI 4ANUA 3P4QB 1I42A 2FBWB 1V2YA 2RR9A 2D5GA 3NS1A 1ZW7A 3APFA 1ESFA 3KQ4A 2DAFA 2BKFA 3BZDB 3GB1A 1T0RC 4MJSB 4XGAB 2W3SA 4I6LB 4LJPB 2KN5A 3KW5B 1R7SA 2L32A 3NOBA 3Q8FA 2MBHA 1RFAA 4W9CA 4WAAA 2B76B 3DWMA 2J7QB 1N5XA 1V5OA 4C00A 1QZEA 1IBXB 1LO5D 2E6XA 2WXRA 3RYTA 2MBQA 2YLMA 4K7UA 1E8YA 4TMAB 2FUHB 3RUIB 4K3CA 4WWNA 3AI5A 1UNSA 2LVQA 2DYOA 2E3TA 5AZFA 4KIKA 1HA5A 2L00B 2LMCA 2LRUA 4PT5A 1I4PA 2LHDA 2INCC 2RGFA 1WSPA 2AX5A 1HXYD 3Q8EA 2ZVNA 4RCOA 3V6CB 3APDA 4ZRKA 2JXXA 4M8MA 1L6VA 1WX9A 3K9PB 1FFVA 3R7RA 4WAFA 3TCAA 2HJ1A 3L54A 1WXSA 2FAZA 4P7IA 1F2RI 2M0XA 3TEXA 2DHZA 4HEA1 3MJWA 1I4HA 4MH0E 4E71A 1ZXIA 1HZ6A 3V62A 4M02A 1D4BA 2EELA 4GGQA 4WWOA 3AE9B 2BF8B 3PT2B 3P4PB 4DHZE 2INPE 3DCGA 1HTQA 4M0WB 4ZRPA 4ITKA 4REZA 1XCQL 3PREA 4ZHPA 1WGDA 4IWOA 3SD5A 2Y3AA 5DPRA 1E9MA 2GBMA 3N20C 2ZNVC 4TQ1A 4URKA 1ZOYB 2PLPA 2WP9B 1YJJA 4GB9A 4DWFA 3QHTA 2N0SB 3TSSA 2MCNB 3VH4B 4OZCA 4OW0A 4C4VB 3IT6B 3VHTC 3BVGA 1UH6A 3GE3C 2DYBA 3DBSA 4II3B 1F1HA 4HCNB 1L7YA 4HWIB 2WXJA 5LNK1 2KXJA 3U7DA 2NTTA 1FD6A 2FCQA 2M56B 3BYYB 3DWGC 1GC6A 3A9KA 3H7SA 4GLSC 1XCTL 3FAHA 1SIJA 1C76A 3HUIA 4EFOA 1WFYA 3VR9B 2K39A 1KM7A 5T8IA 3HVZA 3AMZA 2BWFA 3R3MA 2KTRA 1C9FA 2MJEA 2ZEQA 4B0EA 2KLGA 1JWAD 3RCZA 3RZFA 1WRDB 2QC8A 4JE3B 3VDZA 2N9EB 2JX5A 4XE0A 3KH0A 1UBIA 3SHQA 1WY8A 2QMTA 1VCBA 4NJ7A 2MJ3A 4K7WA 3I9V1 2KN4A 4M01A 2KWUB 3AECB 1KJTA 1L4ZB 1TKYA 3Q6BA 4CHKA 1QKZA 4OZBA 2DYMA 1P98A 2PVOD 3A4RA 1YJIA 4CO7A 4FHJA 4HKQA 3UGBB 2J52A 1V97A 2ONQA 3A9JA 4F7ZA 2K5PA 1SBBB 5FR3A 4AP4C 5G5GA 4P16A 1IYFA 2KHWB 2QILA 3KWLA 3WAPA 3AEEB 2D10A 1WGYA 1YN4A 2KDFB 2WGSA 3PLVA 4MSMB 4BKSA 2G45B 3VTUA 5C2TB 1AW7A 4ANVA 2JF5A 4KGTA 5EE3A 2XN9C 2XK5B 3L08A 4AS1A 3Q3FA 2M4NA 1WXAA 2I38A 1ROEA 1U4AA 2NPTA 4B95A 3ZTDA 1KF6B 3W5VB 3QWZB 3AU4A 2DBYA 1D5XC 3SFDB 4HJGE 5EDSA 3V60A 3GS2A 1RYJA 1TY2A 3NJTA 1C1YB 3B2FA 1E90A 1J8CA 2B3AA 2KNBA 2NBWB 3Q3JA 4KSKC 2H88B 2G1EA 3I3TB 1VZ7A 4BZAA 3O13A 3H6NA 1TKGA 5JHAA 1K52A 3JW0X 2WDVB 4S0RA 2WXGA 4RGTA 2KD0A 2M0AA 2C7NB 1H4RA 3CF6E 3NG0A 2CHWA 1XD3B 2MWSB 2MX2A 1SE3A 1NVID 3ONSA 1CMXB 5JHBA 2Y5PA 4KDLB 2PPHA 3ZW3A 1AWDA 3U8ZA 3IG3A 1F2RC 2LRWA 1WX8A 4XDDA 2MLBA 4ICVA 2WXOA 3OG5A 4YT0B 1KLVA 1MI0A 1UELA 3N1XC 3VAWA 2HD5B 2PVGC 4IOIE 1S1QB 3CWIA 3KWVA 2QCZA 4ARIA 1N61A 2UWQA 3W2DA 2V4LA 2M17A 1C79A 1WMHA 3P4RB 4XWTA 2X38A 1IPGA 1SXTA 2EMTA 3D32A 2ACZB 3PS6A 4B6WA 1DGJA 4X57B 1JWMD 3PRPB 4J6IA 2V3PA 3FILA 3VFKA 1WM3A 1EF1A 2L7RA 2LJIA 2FUG1 4ICUA 3VTVA 3NVVA 3BK1A 2RPVA 4EZKA 3BVMA 2I2YA 2AL6A 4C56C 4DXAB 3LB8C 2KMCA 3PRMB 3UQBA 2WLBA 2L3ZA 3P42A 4LNFA 4L23A 5E6OA 4LCDE 5CX3A 3JSVB 3UF8A 3DVGY 1EU4A 2KFKA 2BYEA 1EU3A 2O6VA 2WU5B 4JWUC 1UD7A 1C4PA 1MPEA 2WX1A 2KX3A 2XBBC 2QIEB 4A3PA 2KTFA 3HVDA 3MC0B 4TSSA 4BOZB 4LNNA 3Q69A 1JWBD 5D6JB 1WM2A 5HI1A 4G50A 3OJ3A 5D2MB 1F0ZA 2W55A 1GNUA 2VZKD 4KSLC 1E6EB 3QA8A 2MSED 1OGWA 4YTPB 1YX6B 4IWPA 2ASQA 3BVZA 1ENFA 1ZUD2 1P7EA 3PVLA 1WGHA 3LYYA 3RNCC 4AJYB 2MBOA 3TUOA 2I1KA 2IDYA 3QCAA 5C23A 3TEZA 2K0PA 2RDGA 3KUCB 2ZCCA 3Q3MC 4H2AA 3R8BA 2KDMA 2LGYA 1FXIA 4GDKA 4C7ZA 1MHXA 2R2OA 3VUWA 1L5PA 5HHDG 1FPYA 1EWCA 1FMAD 1YMHE 4TV3A 2BS2B 1WGRA 1V49A 1KH0A 4A6QA 2JQRB 1LQBA 2MH7A 1Q10A 2N9LA 5BYSA 2PE9A 1TZOA 2LUMA 2L52A 2DX5B 3IBEA 1T3QA 3IT4B 3W5UB 4EE2A 2K9XA 3L16A 2DZKA 1J7CA 1P0RA 2BYVE 1ZKHA 2BB5A 1PGXA 4KKIA 4FBJB 4G0NB 5KHQA 3V6EB 3NVYA 3PGEA 4FHKA 1FCCC 3L13A 1PUTA 4WURA 1QILA 1M4VA 3AE8B 2BQQA 2LGIA 2I1JA 1V81A 2C7HA 2G3QB 4IM3A 4KV2A 2KQ4X 2PTLA 4HPPA 2GOWA 5IP4D 1F9JA 2HTHA 4TKNA 1V80A 4W9JA 4JL9A 1ET9A 3ZO5B 2FCSA 1DOIA 3WANA 1I4XA 2MP2A 1XQQA 2JYTA 4PYUA 3JVZX 4BOSC 1HTOA 4WIPA 1ZXHA 5FKAC 3GZNI 5IOIA 4EEWA 4W9LA 4GDLB 2WXPA 2KDBA 2Q5WD 2FE8A 3ZJVA 1JMLA 3TIXA 2D3CA 1MHHE 2RPQA 4MELA 1QQRA 3GZNB 2CU1A 4MGIE 2LWPA 5I4DA 1AYFA 1I4QA 2LGDA 3VH3B 2LASA 4XWWA 2TSSA 4HPMB 2Z59B 1I4RA 3IXSA 1FNUA 4MM3B 2N9PC 1GOZA 3CMMB 1FCLA 4IUMB 1Y8RC 3Q14C 3Q8CA 4N6EB 1MG8A 1C78A 3VQIA 2KLCA 1R4NB 5TSSA 2G4SA 1XO3A 1EWYC 4TUUA 5CTRC 1N60A 2JUOA 2V4IB 1TS5A 2IGDA 5IAAC 3RMKC 1TS4A 3R2IA 4I6NB 3PTFC 1L6UA 1FEHA 2L83A 1IUEA 1NDDA 2ZZPB 4HCPB 1L0XB 3QAQA 3ZLZA 1LM8B 1YOVB 3W1SC 4KDIC 2WYQA 2IZVB 5J2RA 1OQQA 1V9JA 2G9HD 4NNJB 1GB1A 4II2B 3A1QA 2A4ZA 3AEAB 3HHMA 3PO0A 4D2KA 5L95C 3UIPB 4AUQC 3Q3OC 1UWXA 4ZRJA 3EECA 1PDXA 3VXWA 3EUB2 4KIKB 2BTEA 1YIWA 3CSTA 2BT6A 2LGXA 1TKEA 2XEWA 2INNE 3B2GA 1FIQA 2K25A 3AEGB 3C0RB 3AE1B 4ZRIA 4P1BC 2EMSA 4MSQB 2GBRA 1EO6A 1WJ4A 1ACCA 2CHXA 1K51A 3Q8BA 2WS3B 1XLQA 5BMIA 4DDID 4USAA 1I4GA 1V1PA 1VR9A 1NI2A 3VUYA 3N9YC 1AARA 3ZNHB 4CYEA 3I5JC 3WAMA 2IO2B 2N9KA 2NMQA 1SF0A 1Y56A 2CHZA 4LJOB 4IWQA 5MPOA 3W9CB 3J9CA 5JZEB 4EUTA 2JRIB 3L4PA 1VZ6A 5LLIA 3B9JA 1D6EC 1OEYA 4JWSC 2JPHA 3SR6A 5E6NA 1LXDA 1JW9D 2K3UA 4UDUC 5JXVA 4W9GA 1E10A 2JZ3B 1BMLC 3VR8B 1XXGA 2RDHA 3AE3B 3BK2A 2WXMA 2NCNA 1N63A 3ZUNA 4ANWA 3RN9C 3R66C 1VRAB 1AN8A
chains in the Genus database with same CATH topology
4DK5A 2PPHA 4NAWB 3ZW3A 3U8ZA 3NHEB 5AEKB 3QJZA 1NBFC 2K8BA 1WR1A 2KJRA 3IG3A 2KC2A 2LRWA 3ML9A 2DAJA 1WE7A 1WX8A 3IVFA 2MLBA 3ALBA 4ICVA 3M62B 2FIDA 4FADA 1Q5WB 1WXVA 1D3ZA 3VUXA 4AOFA 1KLVA 1V5TA 2Z0EB 1OQYA 3ZNZB 1UELA 4WJNA 3A9KB 1E7VA 3TBLD 4F8CB 1K8RB 2N7DA 3KUDB 2NS5A 2HJ8A 2K8CA 2L8JA 3VAWA 2HD5B 4IM2A 2KO3A 2O2VA 1S1QB 2MW5A 4LDTD 3U30A 3VTWA 4DHZB 3DQVA 4HVBA 2OJRA 2L0FA 2UWQA 3ZDTA 1ISNA 2V4LA 3AXCA 2M17A 3BY4B 3DVGX 4FJVB 2KTRB 4JGHB 1WMHA 1Z5SB 4HXDA 1JRUA 2L05A 3ZTCA 1V6EA 2V1YA 2L76A 3PRZA 2LVOA 3RD2A 2AEHA 2FNJB 4E74A 2AL3A 1IPGA 3QC8B 4A20A 4LDTB 2JT4B 2LUEA 4MGKE 1LFDA 2EMTA 3D32A 2ZNVB 3A1QB 1TZ1A 3PS6A 4B6WA 4X57B 1YX5B 3PRPB 4J6IA 5BO4B 4BFRA 1SIFA 3QX1A 3RT3B 1WM3A 1EF1A 2L7RA 4IW0A 3O65B 4KZCA 1YJ1A 2KX0A 3VFKA 3RZWC 5TR5A 2MBBB 3B08A 4ICUA 3VTVA 5AZGA 2FIFA 1UGMA 2C60A 4JIOU 4K81A 1HE8A 3KVFB 4EZKA 2KFJA 2FCNA 1R4MI 4GSWA 2K8HA 2AL6A 1SE9A 4DXAB 2D3GA 2KMCA 4WQOB 1WXMA 2KDEB 3PRMB 2R2QA 3UQBA 2KANA 3DBLI 3L10B 5D7GA 2VRRB 2L3ZA 4XC2A 1I35A 3T8MA 3PHXB 1WJ6A 3GOEA 5G55A 5CHFA 1E8WA 4W9KA 3TJPA 4BKSD 4BKGA 2Y5BB 5E6OA 5J17A 3A9JB 4LCDE 4W9HA 3TL5A 2NVUI 5CX3A 2Z0DB 3APCA 4IM0A 3JSVB 3L17A 4PS8A 3ZNID 4BVUC 4EZLA 2JWZA 3UF8A 4KVGB 3DVGY 2KFKA 4GDLA 2BYEA 2MQJA 3H9DA 1UBQA 3S2AA 2ZCBA 2KOXA 3HK0A 3IHPC 2K1FA 4FN2A 4N9F4 3VVWB 3V61A 2N7EA 3ZDMC 4AWJA 2O6VA 4YL8A 1WYWB 4F1SA 1UD7A 1J19A 2WX1A 4GIVA 2KX3A 2LZ6A 2XBBC 2MRPA 3M95A 3N30A 4ASWC 2GBKA 4RMAA 4A3PA 2DZIA 2IY0B 3EC8A 2KTFA 4JLCA 4DHJD 2DZJA 2BPSA 3QK0A 4BBNC 2KJHB 4BOZB 1UZXB 3H7PB 4MM3A 1RLFA 4HPLB 1WI0A 4FA6A 2NPTB 1OTRB 4K1RB 5D6JB 1WM2A 3PPAA 2IYDB 5AZHA 1ZGUB 2N1WA 1GJZA 3ZRCA 4G50A 4WJQA 3OJ3A 3DPDA 1M94A 5D2MB 1EF5A 2JY6A 4DHJB 5DPWA 1GNUA 3AU5A 4KSLC 1GUAB 2KK8A 3ENEA 4XX5A 4HLEA 3QIJA 3CSFA 2MSED 1E8ZA 2MBEA 3QA8A 1R4NI 2CS4A 1OGWA 1Q1OA 4NJ6A 1YX6B 2EKEC 4IWPA 4W9IA 2ASQA 5DPTA 1V2YA 1I42A 2RR9A 3X0WA 1ZW7A 3APFA 4MDKE 2QHOA 3PVLA 1WGHA 2PJHA 1YQBA 4AJYB 2MBOA 4NPNA 2DAFA 4NY0A 1TBEA 2I1KA 3M3JA 2PE6B 1Q0WB 2BKFA 3QCAA 4GMVA 5C23A 4MJSB 4W9FA 4I6LB 4ANXA 2AWTA 2C7MB 3KUCB 2KN5A 2ZCCA 2IY1B 4LJPB 3KW5B 2W9NA 2J0JA 3NOBA 1OEYJ 2LGYA 2MBHA 3KYDD 1RFAA 4GDKA 4W9CA 4WAAA 2R2OA 2DENB 2REXA 2ZVOA 3ECIA 1WJNA 3VUWA 4HK2A 2J7QB 1WF9A 5JH5C 1V5OA 3DDCB 1QZEA 2D07B 2IO0B 3HM3A 2N1VA 4FJZA 4TV3A 1WGRA 3QQ8B 1A5RA 1V49A 2KWCA 4NQKE 1GG3A 2RD0A 1LQBA 3RYTA 2KMAA 1YD8U 2MBQA 2YLMA 4K7UA 4JQWC 1E8YA 4TQ0A 2PEAA 2PE9A 1IP9A 4K7SA 2FUHB 3RUIB 4EKUA 4EOYA 3UINB 4WWNA 3AI5A 2DX5B 2NBVB 3IBEA 2KJ6A 2LVQA 2DYOA 5AZFA 4KIKA 1WZ0A 3L16A 2JVCA 1GC7A 2DZKA 4M8NA 2L00B 1P0RA 2CKHB 2BYVE 1ZKHA 2O2VB 3MHSD 2IBIB 2LRUA 5LXIB 2J0KA 3NZSA 2C5LC 3WIMA 4G0NB 4FBJB 5KHQA 3SU8X 3V6EB 2KVRA 2KDIA 2RGFA 3PGEA 4FHKA 3TMPB 1WMHB 3PZDA 3H1UA 2LD9A 3L13A 2ZVNA 1Z2MA 3V6CB 2GBJA 3APDA 5J18A 4ZRKA 4OVVA 4RM8A 4MGZE 2JXXA 3QARA 4M8MA 5GMVA 3ZRFA 1WE6A 2MA9B 1WX9A 3K9PB 2I1JA 1V81A 2C7HA 2G3QB 4FULA 4IM3A 4KV2A 2JZZA 3R7RA 3TCAA 1J0GA 2N4FA 2NR2A 3L54A 3MTNB 1WXSA 2FAZA 4GOCA 4FJYA 1WIAA 2GOWA 4P7IA 3ZNGC 5IA7A 2M0XA 1F9JA 2HTHA 4IG7B 4TKNA 1V80A 2DHZA 4W9JA 3MJWA 4MH0E 4JL9A 3LJ3A 4E71A 3ZO5B 2FCSA 2XK5A 1XT9B 3WA0A 1L2NA 3V62A 3LDZE 2WDTB 3WANA 2L0TA 3W1YA 1FXTB 4GGQA 2MP2A 2WWZA 4ANUA 2KQSA 1XQQA 3A33B 4PYUA 3JVZX 2ZPYA 4WWOA 1C3TA 2BF8B 2V3SA 4BOSC 3PT2B 4DHZE 2O6VD 3GZNI 4WJPA 4KZ0A 3DCGA 4EEWA 2KZRA 2C9WB 4I6PA 4M0WB 2LI5A 4W9LA 3PREA 2KFKB 4GDLB 2KDBA 1WGDA 4IWOA 3SD5A 3TIXA 4E3CA 5DPRA 1RRBA 2GBMA 2RPQA 2O6VB 2ZNVC 2OOBB 4MELA 4TQ1A 4URKA 4XZ4A 2CU1A 4GU2A 4MGIE 2NBUA 2LWPA 4DWFA 4GB9A 1E5WA 2LGDA 3QHTA 3VH3B 1TGZB 2GMIC 2LASA 2MCNB 2ZPNA 4RM9A 1BT0A 3VH4B 2HE7A 2Z59B 4HPMB 2M8SA 4EZJA 4MEMA 2GBNA 2KWVB 4AJWA 2N9PC 3DBHI 3VHTC 3CMMB 3B1LX 4IUMB 2LXAA 1Y8RC 3JYUA 1RAXA 3HM6X 1WGGA 4HJKA 1UH6A 3IFWB 4NAWA 2DYBA 4PYZA 1MG8A 3VQIA 1WZ3A 2JRHA 2KLCA 3DBSA 3SDLC 4II3B 2LXCA 4HCNB 1L7YA 2G4SA 4HWIB 4ZDVA 2KXJA 3OLMD 3U7DA 1X1MA 2FCQA 3NZUA 1V86A 1P3QU 2BGFA 4TUUA 3PSEB 2G4DB 5CTRC 3M63B 1GC6A 3A9KA 3H7SA 2JUOA 3L0WB 2UYZB 3ZKJC 3UQAA 4G3XB 5IAAC 1S3SG 3ML8A 2DZMA 3PV1A 4GN1A 3NS8A 4EFOA 2BWES 3HIZA 4I6NB 3R7QA 1WFYA 2K39A 2BKRB 1KM7A 2LJ5A 3N32A 3PTFC 3P2BA 2N9XA 1E7UA 3A4SC 1G6JA 1NDDA 2J0MA 3NY5A 2BWFA 2ZZPB 4GDKB 3N3KB 3BINA 3OJ4B 2KTRA 3R3MA 3QAQA 4HCPB 3ZLZA 1LM8B 2ZEQA 3W1SC 4KDIC 2D2QA 5HKHA 2WYQA 2KLGA 2IZVB 5FR6A 4B9KA 4FLHA 5J2RA 3RCZA 1V9JA 5E6PA 4NNJB 4II2B 4W9DA 3A1QA 3RZFA 2A4ZA 1WRDB 2LVPA 3HHMA 3VDZA 2N9EB 4G11A 1WH3A 3KH0A 1UBIA 3SHQA 3UIPB 5L95C 4AUQC 1WY8A 3DBRI 1VCBA 4NJ7A 4K7WA 1H8CA 1P1AA 1TTNA 4ZRJA 2CR5A 2KWUB 1WJUA 3EECA 4A3OA 1KJTA 4CHKA 4HDQA 3VXWA 2DYMA 4KIKB 1P98A 2YVCA 5KHOA 1YIWA 3DVNV 2IO3B 3CSTA 3A4RA 4CO7A 2LGXA 2XEWA 4FHJA 3UGBB 5G2NA 4WJOA 3T9LA 2K25A 1E8XA 1VD2A 3A9JA 3PLUA 4F7ZA 2ZJDA 3C0RB 2RSUA 3JSVA 1KOTA 3DOWA 4AP4C 3EHVA 4ZRIA 2AYOB 4W9EA 1IYFA 2EMSA 2KHWB 4DDGD 4MSQB 2GBRA 1EO6A 3WAPA 5D94A 5C1ZA 5L83A 3ZIMA 2KKCA 2D10A 1WJ4A 1WGYA 2A5UA 2CHXA 2KDFB 1WR6E 2WX0A 3PLVA 4MSMB 4BKSA 4DBGA 2G45B 3VTUA 4ANVA 2KQ7A 2JF5A 3PHWB 3WAOA 4HDOA 5LXHA 4DDID 1NI2A 3K9OB 3VUYA 4GXBA 2XK5B 3L08A 3W1SA 1AARA 1T0YA 3Q3FA 3H7PA 2M4NA 1WXAA 4IC7B 2K6QA 3ZNHB 4CYEA 2MP2B 3WAMA 2IO2B 1U4AA 2NPTA 4B95A 3ZTDA 3QWZB 3AU4A 2CHZA 4LJOB 4WWPA 4IWQA 5JZEB 5EDSA 3V60A 4PS7A 1EUVB 3WALA 4BKTA 2K6DB 3DVNU 4EUTA 1C1YB 2JRIB 2M1MA 5LLIA 2FCMA 3UIOB 1E90A 1J8CA 2BYFA 2B3AA 1OEYA 4BBNF 2KNBA 4NQLB 2NBWB 3Q3JA 4KSKC 2JPHA 3I3TB 3EFUA 5CHVC 3X23A 3KYCD 3B0AA 3H6NA 5E6NA 5JHAA 1LXDA 5DCNA 3JW0X 3RULA 4MJSA 3KUZA 5CHWA 4MGYE 4W9GA 4PS3A 2IO1B 2JZ3B 2KD0A 3AULA 1PQSA 4ZYNA 2C7NB 3ZVVA 1H4RA 3CF6E 3OAWA 4OVUA 2CHWA 1XD3B 2MWSB 2NCNA 2MX2A 3ZUNA 2KC1A 1WX7A 1CMXB 1P9DU 2D11A 3ONSA 5DPSA 4ANWA 5JHBA 3R66C 1SGHA 4KDLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DK5 A;  2PPH A;  4NAW B;  3ZW3 A;  3U8Z A;  3NHE B;  5AEK B;  3QJZ A;  1NBF C;  2K8B A;  1WR1 A;  2KJR A;  3IG3 A;  2KC2 A;  2LRW A;  3ML9 A;  2DAJ A;  1WE7 A;  1WX8 A;  3IVF A;  2MLB A;  3ALB A;  4ICV A;  3M62 B;  2FID A;  4FAD A;  1Q5W B;  1WXV A;  1D3Z A;  3VUX A;  4AOF A;  1KLV A;  1V5T A;  2Z0E B;  1OQY A;  3ZNZ B;  1UEL A;  4WJN A;  3A9K B;  1E7V A;  3TBL D;  4F8C B;  1K8R B;  2N7D A;  3KUD B;  2NS5 A;  2HJ8 A;  2K8C A;  2L8J A;  3VAW A;  2HD5 B;  4IM2 A;  2KO3 A;  2O2V A;  1S1Q B;  2MW5 A;  4LDT D;  3U30 A;  3VTW A;  4DHZ B;  3DQV A;  4HVB A;  2OJR A;  2L0F A;  2UWQ A;  3ZDT A;  1ISN A;  2V4L A;  3AXC A;  2M17 A;  3BY4 B;  3DVG X;  4FJV B;  2KTR B;  4JGH B;  1WMH A;  1Z5S B;  4HXD A;  1JRU A;  2L05 A;  3ZTC A;  1V6E A;  2V1Y A;  2L76 A;  3PRZ A;  2LVO A;  3RD2 A;  2AEH A;  2FNJ B;  4E74 A;  2AL3 A;  1IPG A;  3QC8 B;  4A20 A;  4LDT B;  2JT4 B;  2LUE A;  4MGK E;  1LFD A;  2EMT A;  3D32 A;  2ZNV B;  3A1Q B;  1TZ1 A;  3PS6 A;  4B6W A;  4X57 B;  1YX5 B;  3PRP B;  4J6I A;  5BO4 B;  4BFR A;  1SIF A;  3QX1 A;  3RT3 B;  1WM3 A;  1EF1 A;  2L7R A;  4IW0 A;  3O65 B;  4KZC A;  1YJ1 A;  2KX0 A;  3VFK A;  3RZW C;  5TR5 A;  2MBB B;  3B08 A;  4ICU A;  3VTV A;  5AZG A;  2FIF A;  1UGM A;  2C60 A;  4JIO U;  4K81 A;  1HE8 A;  3KVF B;  4EZK A;  2KFJ A;  2FCN A;  1R4M I;  4GSW A;  2K8H A;  2AL6 A;  1SE9 A;  4DXA B;  2D3G A;  2KMC A;  4WQO B;  1WXM A;  2KDE B;  3PRM B;  2R2Q A;  3UQB A;  2KAN A;  3DBL I;  3L10 B;  5D7G A;  2VRR B;  2L3Z A;  4XC2 A;  1I35 A;  3T8M A;  3PHX B;  1WJ6 A;  3GOE A;  5G55 A;  5CHF A;  1E8W A;  4W9K A;  3TJP A;  4BKS D;  4BKG A;  2Y5B B;  5E6O A;  5J17 A;  3A9J B;  4LCD E;  4W9H A;  3TL5 A;  2NVU I;  5CX3 A;  2Z0D B;  3APC A;  4IM0 A;  3JSV B;  3L17 A;  4PS8 A;  3ZNI D;  4BVU C;  4EZL A;  2JWZ A;  3UF8 A;  4KVG B;  3DVG Y;  2KFK A;  4GDL A;  2BYE A;  2MQJ A;  3H9D A;  1UBQ A;  3S2A A;  2ZCB A;  2KOX A;  3HK0 A;  3IHP C;  2K1F A;  4FN2 A;  4N9F 4;  3VVW B;  3V61 A;  2N7E A;  3ZDM C;  4AWJ A;  2O6V A;  4YL8 A;  1WYW B;  4F1S A;  1UD7 A;  1J19 A;  2WX1 A;  4GIV A;  2KX3 A;  2LZ6 A;  2XBB C;  2MRP A;  3M95 A;  3N30 A;  4ASW C;  2GBK A;  4RMA A;  4A3P A;  2DZI A;  2IY0 B;  3EC8 A;  2KTF A;  4JLC A;  4DHJ D;  2DZJ A;  2BPS A;  3QK0 A;  4BBN C;  2KJH B;  4BOZ B;  1UZX B;  3H7P B;  4MM3 A;  1RLF A;  4HPL B;  1WI0 A;  4FA6 A;  2NPT B;  1OTR B;  4K1R B;  5D6J B;  1WM2 A;  3PPA A;  2IYD B;  5AZH A;  1ZGU B;  2N1W A;  1GJZ A;  3ZRC A;  4G50 A;  4WJQ A;  3OJ3 A;  3DPD A;  1M94 A;  5D2M B;  1EF5 A;  2JY6 A;  4DHJ B;  5DPW A;  1GNU A;  3AU5 A;  4KSL C;  1GUA B;  2KK8 A;  3ENE A;  4XX5 A;  4HLE A;  3QIJ A;  3CSF A;  2MSE D;  1E8Z A;  2MBE A;  3QA8 A;  1R4N I;  2CS4 A;  1OGW A;  1Q1O A;  4NJ6 A;  1YX6 B;  2EKE C;  4IWP A;  4W9I A;  2ASQ A;  5DPT A;  1V2Y A;  1I42 A;  2RR9 A;  3X0W A;  1ZW7 A;  3APF A;  4MDK E;  2QHO A;  3PVL A;  1WGH A;  2PJH A;  1YQB A;  4AJY B;  2MBO A;  4NPN A;  2DAF A;  4NY0 A;  1TBE A;  2I1K A;  3M3J A;  2PE6 B;  1Q0W B;  2BKF A;  3QCA A;  4GMV A;  5C23 A;  4MJS B;  4W9F A;  4I6L B;  4ANX A;  2AWT A;  2C7M B;  3KUC B;  2KN5 A;  2ZCC A;  2IY1 B;  4LJP B;  3KW5 B;  2W9N A;  2J0J A;  3NOB A;  1OEY J;  2LGY A;  2MBH A;  3KYD D;  1RFA A;  4GDK A;  4W9C A;  4WAA A;  2R2O A;  2DEN B;  2REX A;  2ZVO A;  3ECI A;  1WJN A;  3VUW A;  4HK2 A;  2J7Q B;  1WF9 A;  5JH5 C;  1V5O A;  3DDC B;  1QZE A;  2D07 B;  2IO0 B;  3HM3 A;  2N1V A;  4FJZ A;  4TV3 A;  1WGR A;  3QQ8 B;  1A5R A;  1V49 A;  2KWC A;  4NQK E;  1GG3 A;  2RD0 A;  1LQB A;  3RYT A;  2KMA A;  1YD8 U;  2MBQ A;  2YLM A;  4K7U A;  4JQW C;  1E8Y A;  4TQ0 A;  2PEA A;  2PE9 A;  1IP9 A;  4K7S A;  2FUH B;  3RUI B;  4EKU A;  4EOY A;  3UIN B;  4WWN A;  3AI5 A;  2DX5 B;  2NBV B;  3IBE A;  2KJ6 A;  2LVQ A;  2DYO A;  5AZF A;  4KIK A;  1WZ0 A;  3L16 A;  2JVC A;  1GC7 A;  2DZK A;  4M8N A;  2L00 B;  1P0R A;  2CKH B;  2BYV E;  1ZKH A;  2O2V B;  3MHS D;  2IBI B;  2LRU A;  5LXI B;  2J0K A;  3NZS A;  2C5L C;  3WIM A;  4G0N B;  4FBJ B;  5KHQ A;  3SU8 X;  3V6E B;  2KVR A;  2KDI A;  2RGF A;  3PGE A;  4FHK A;  3TMP B;  1WMH B;  3PZD A;  3H1U A;  2LD9 A;  3L13 A;  2ZVN A;  1Z2M A;  3V6C B;  2GBJ A;  3APD A;  5J18 A;  4ZRK A;  4OVV A;  4RM8 A;  4MGZ E;  2JXX A;  3QAR A;  4M8M A;  5GMV A;  3ZRF A;  1WE6 A;  2MA9 B;  1WX9 A;  3K9P B;  2I1J A;  1V81 A;  2C7H A;  2G3Q B;  4FUL A;  4IM3 A;  4KV2 A;  2JZZ A;  3R7R A;  3TCA A;  1J0G A;  2N4F A;  2NR2 A;  3L54 A;  3MTN B;  1WXS A;  2FAZ A;  4GOC A;  4FJY A;  1WIA A;  2GOW A;  4P7I A;  3ZNG C;  5IA7 A;  2M0X A;  1F9J A;  2HTH A;  4IG7 B;  4TKN A;  1V80 A;  2DHZ A;  4W9J A;  3MJW A;  4MH0 E;  4JL9 A;  3LJ3 A;  4E71 A;  3ZO5 B;  2FCS A;  2XK5 A;  1XT9 B;  3WA0 A;  1L2N A;  3V62 A;  3LDZ E;  2WDT B;  3WAN A;  2L0T A;  3W1Y A;  1FXT B;  4GGQ A;  2MP2 A;  2WWZ A;  4ANU A;  2KQS A;  1XQQ A;  3A33 B;  4PYU A;  3JVZ X;  2ZPY A;  4WWO A;  1C3T A;  2BF8 B;  2V3S A;  4BOS C;  3PT2 B;  4DHZ E;  2O6V D;  3GZN I;  4WJP A;  4KZ0 A;  3DCG A;  4EEW A;  2KZR A;  2C9W B;  4I6P A;  4M0W B;  2LI5 A;  4W9L A;  3PRE A;  2KFK B;  4GDL B;  2KDB A;  1WGD A;  4IWO A;  3SD5 A;  3TIX A;  4E3C A;  5DPR A;  1RRB A;  2GBM A;  2RPQ A;  2O6V B;  2ZNV C;  2OOB B;  4MEL A;  4TQ1 A;  4URK A;  4XZ4 A;  2CU1 A;  4GU2 A;  4MGI E;  2NBU A;  2LWP A;  4DWF A;  4GB9 A;  1E5W A;  2LGD A;  3QHT A;  3VH3 B;  1TGZ B;  2GMI C;  2LAS A;  2MCN B;  2ZPN A;  4RM9 A;  1BT0 A;  3VH4 B;  2HE7 A;  2Z59 B;  4HPM B;  2M8S A;  4EZJ A;  4MEM A;  2GBN A;  2KWV B;  4AJW A;  2N9P C;  3DBH I;  3VHT C;  3CMM B;  3B1L X;  4IUM B;  2LXA A;  1Y8R C;  3JYU A;  1RAX A;  3HM6 X;  1WGG A;  4HJK A;  1UH6 A;  3IFW B;  4NAW A;  2DYB A;  4PYZ A;  1MG8 A;  3VQI A;  1WZ3 A;  2JRH A;  2KLC A;  3DBS A;  3SDL C;  4II3 B;  2LXC A;  4HCN B;  1L7Y A;  2G4S A;  4HWI B;  4ZDV A;  2KXJ A;  3OLM D;  3U7D A;  1X1M A;  2FCQ A;  3NZU A;  1V86 A;  1P3Q U;  2BGF A;  4TUU A;  3PSE B;  2G4D B;  5CTR C;  3M63 B;  1GC6 A;  3A9K A;  3H7S A;  2JUO A;  3L0W B;  2UYZ B;  3ZKJ C;  3UQA A;  4G3X B;  5IAA C;  1S3S G;  3ML8 A;  2DZM A;  3PV1 A;  4GN1 A;  3NS8 A;  4EFO A;  2BWE S;  3HIZ A;  4I6N B;  3R7Q A;  1WFY A;  2K39 A;  2BKR B;  1KM7 A;  2LJ5 A;  3N32 A;  3PTF C;  3P2B A;  2N9X A;  1E7U A;  3A4S C;  1G6J A;  1NDD A;  2J0M A;  3NY5 A;  2BWF A;  2ZZP B;  4GDK B;  3N3K B;  3BIN A;  3OJ4 B;  2KTR A;  3R3M A;  3QAQ A;  4HCP B;  3ZLZ A;  1LM8 B;  2ZEQ A;  3W1S C;  4KDI C;  2D2Q A;  5HKH A;  2WYQ A;  2KLG A;  2IZV B;  5FR6 A;  4B9K A;  4FLH A;  5J2R A;  3RCZ A;  1V9J A;  5E6P A;  4NNJ B;  4II2 B;  4W9D A;  3A1Q A;  3RZF A;  2A4Z A;  1WRD B;  2LVP A;  3HHM A;  3VDZ A;  2N9E B;  4G11 A;  1WH3 A;  3KH0 A;  1UBI A;  3SHQ A;  3UIP B;  5L95 C;  4AUQ C;  1WY8 A;  3DBR I;  1VCB A;  4NJ7 A;  4K7W A;  1H8C A;  1P1A A;  1TTN A;  4ZRJ A;  2CR5 A;  2KWU B;  1WJU A;  3EEC A;  4A3O A;  1KJT A;  4CHK A;  4HDQ A;  3VXW A;  2DYM A;  4KIK B;  1P98 A;  2YVC A;  5KHO A;  1YIW A;  3DVN V;  2IO3 B;  3CST A;  3A4R A;  4CO7 A;  2LGX A;  2XEW A;  4FHJ A;  3UGB B;  5G2N A;  4WJO A;  3T9L A;  2K25 A;  1E8X A;  1VD2 A;  3A9J A;  3PLU A;  4F7Z A;  2ZJD A;  3C0R B;  2RSU A;  3JSV A;  1KOT A;  3DOW A;  4AP4 C;  3EHV A;  4ZRI A;  2AYO B;  4W9E A;  1IYF A;  2EMS A;  2KHW B;  4DDG D;  4MSQ B;  2GBR A;  1EO6 A;  3WAP A;  5D94 A;  5C1Z A;  5L83 A;  3ZIM A;  2KKC A;  2D10 A;  1WJ4 A;  1WGY A;  2A5U A;  2CHX A;  2KDF B;  1WR6 E;  2WX0 A;  3PLV A;  4MSM B;  4BKS A;  4DBG A;  2G45 B;  3VTU A;  4ANV A;  2KQ7 A;  2JF5 A;  3PHW B;  3WAO A;  4HDO A;  5LXH A;  4DDI D;  1NI2 A;  3K9O B;  3VUY A;  4GXB A;  2XK5 B;  3L08 A;  3W1S A;  1AAR A;  1T0Y A;  3Q3F A;  3H7P A;  2M4N A;  1WXA A;  4IC7 B;  2K6Q A;  3ZNH B;  4CYE A;  2MP2 B;  3WAM A;  2IO2 B;  1U4A A;  2NPT A;  4B95 A;  3ZTD A;  3QWZ B;  3AU4 A;  2CHZ A;  4LJO B;  4WWP A;  4IWQ A;  5JZE B;  5EDS A;  3V60 A;  4PS7 A;  1EUV B;  3WAL A;  4BKT A;  2K6D B;  3DVN U;  4EUT A;  1C1Y B;  2JRI B;  2M1M A;  5LLI A;  2FCM A;  3UIO B;  1E90 A;  1J8C A;  2BYF A;  2B3A A;  1OEY A;  4BBN F;  2KNB A;  4NQL B;  2NBW B;  3Q3J A;  4KSK C;  2JPH A;  3I3T B;  3EFU A;  5CHV C;  3X23 A;  3KYC D;  3B0A A;  3H6N A;  5E6N A;  5JHA A;  1LXD A;  5DCN A;  3JW0 X;  3RUL A;  4MJS A;  3KUZ A;  5CHW A;  4MGY E;  4W9G A;  4PS3 A;  2IO1 B;  2JZ3 B;  2KD0 A;  3AUL A;  1PQS A;  4ZYN A;  2C7N B;  3ZVV A;  1H4R A;  3CF6 E;  3OAW A;  4OVU A;  2CHW A;  1XD3 B;  2MWS B;  2NCN A;  2MX2 A;  3ZUN A;  2KC1 A;  1WX7 A;  1CMX B;  1P9D U;  2D11 A;  3ONS A;  5DPS A;  4ANW A;  5JHB A;  3R66 C;  1SGH A;  4KDL B; 
#chains in the Genus database with same CATH topology
 1UGJ A;  5AEK B;  3QJZ A;  1WR1 A;  3ML9 A;  1WE7 A;  1RWS A;  3M62 B;  3MJ5 A;  1PGA A;  1WXV A;  3VUX A;  1V5T A;  1LGR A;  3ZNZ B;  3A9K B;  1GAQ B;  1OFF A;  2N7D A;  2NS5 A;  4YSX B;  2HJ8 A;  3TEY A;  2WXF A;  4IM2 A;  4LDT D;  2O2V A;  5E6J A;  5FK9 C;  3VRB B;  2OJR A;  2L0F A;  3ZDT A;  1JWU D;  1TIF A;  1YQ3 B;  3AXC A;  4HRO A;  1DYQ A;  2KTR B;  2OHF A;  3ZJU A;  1Z5S B;  1JRU A;  2V1Y A;  3RD2 A;  2AL3 A;  1EM7 A;  3QC8 B;  4LDT B;  1TYG B;  4MGK E;  1D5Z C;  1MG4 A;  4US8 A;  1UUP A;  4NZL B;  1DOX A;  1SEB D;  3FC4 A;  1SIF A;  4IW0 A;  4KZC A;  4YTM B;  1YJ1 A;  2KX0 A;  1I7H A;  2MBB B;  2WNM A;  3RNF C;  1UGM A;  2C60 A;  1C77 A;  2AQ2 B;  4US9 A;  2K8H A;  2D3G A;  2KDE B;  3BWU D;  2K22 A;  1TT5 B;  2VRR B;  4XC2 A;  1ZDX A;  1I35 A;  3T8M A;  2N7J A;  3PHX B;  5G55 A;  1ZP0 B;  5CHF A;  1E8W A;  1N6Z A;  4W9K A;  3TJP A;  4BKS D;  5J17 A;  3A9J B;  4W9H A;  3TL5 A;  4EZL A;  4KVG B;  3H9D A;  2WDR B;  3S2A A;  3HK0 A;  3IHP C;  4N9F 4;  4DQO C;  2VH1 A;  2N7E A;  3P4S B;  4WH4 A;  4ARC A;  1WYW B;  3VRA B;  5G5H A;  4ACF A;  3ZGZ A;  2BVC A;  4LNO A;  3Q2A C;  2WHI A;  2MRP A;  4RMA A;  2DZI A;  3EC8 A;  4DHJ D;  2CU3 A;  2BPS A;  3U52 E;  2W82 A;  4LNK A;  4PK1 A;  2NPT B;  5AUI A;  1GJZ A;  2AQ3 B;  4WJQ A;  4DHJ B;  5DPW A;  4P1C C;  1QOG A;  2MBE A;  5H8Y E;  4WQM A;  3X0W A;  2PW9 A;  4MDK E;  2QHO A;  3E56 A;  4JPS A;  1YQB A;  1TBE A;  3M3J A;  4OHJ A;  2PE6 B;  3OWE B;  4GMV A;  2AWT A;  2C7M B;  1OEY J;  3KYD D;  4N58 A;  3GP7 A;  1GB4 A;  2IPK D;  2ZVO A;  3ECI A;  1WF9 A;  1WGK A;  5JH5 C;  2D07 B;  2IO0 B;  4RH6 A;  1QF6 A;  3QQ8 B;  4RGN A;  2KWC A;  1GG3 A;  2OJW A;  4KX6 B;  4JQW C;  4QAY A;  2NTS A;  4TQ0 A;  2PEA A;  3DHI C;  4L1B A;  2V0G A;  1IP9 A;  2JWU A;  3UIN B;  3AN1 A;  2NBV B;  1T6B X;  2KJ6 A;  1GC7 A;  4M8N A;  4HRS A;  3BYT B;  2IND C;  5LXI B;  3WIM A;  2C5L C;  2DLB A;  2MJD A;  3SU8 X;  1WMH B;  3PZD A;  3H1U A;  1C4C A;  2LD9 A;  4XYC A;  5J18 A;  4OVV A;  4MGZ E;  1D5M C;  5GMV A;  3QAR A;  3ZRF A;  2MA9 B;  1SSN A;  4FUL A;  2JZZ A;  3FIL B;  2KT7 A;  2NR2 A;  2PIA A;  1WIA A;  3ZNG C;  3RNE C;  5BYQ A;  5IA7 A;  4IG7 B;  4YTN B;  3LJ3 A;  2JSV X;  5HG2 A;  1XT9 B;  3H8H A;  1XLP A;  2OED A;  3LDZ E;  2L0T A;  2WWZ A;  2PKO A;  5HFY A;  3C19 A;  4XDC A;  2ZPY A;  2CJO A;  3I63 C;  2GLS A;  1SJH D;  2O6V D;  4AQ7 A;  4WJP A;  1J7B A;  2C9W B;  4I6P A;  2WQY B;  2KFK B;  4ZOH C;  5GXG B;  1QT9 A;  4E3C A;  3DHG C;  2O6V B;  4GU2 A;  5EE9 A;  2NBU A;  1ET6 A;  4S17 A;  1E5W A;  4J3O D;  2GMI C;  2ZPN A;  4RM9 A;  2EKI A;  2HE7 A;  2V9H A;  4YWG G;  4AJW A;  1XLO A;  3DBH I;  3B1L X;  1F77 A;  2LXA A;  3C8Y A;  1T0S C;  1RAX A;  2L1A A;  1WGG A;  3HM6 X;  3IFW B;  4YSZ B;  4NAW A;  2BW2 A;  1WZ3 A;  2JRH A;  3U7Z A;  3SDL C;  3ZXR A;  2LXC A;  4ZDV A;  2WXL A;  1V8C A;  2G4D B;  3E9S A;  3CIR B;  1L4D B;  3L0W B;  3ZKJ C;  4G3X B;  4KGR A;  1S3S G;  3ML8 A;  2DZM A;  5IN7 A;  3PV1 A;  3NS8 A;  3DHH C;  2AQ1 B;  1CK1 A;  3R7Q A;  2BKR B;  3N32 A;  4IDI A;  3P2B A;  3A4S C;  1G6J A;  1MVK A;  2J0M A;  4K3B A;  4GDK B;  3N3K B;  3KLS X;  5FR6 A;  4RF1 A;  5D3D A;  4W9D A;  3IAS 1;  1FO4 A;  1FRR A;  1YQ4 B;  2KAJ A;  3DBR I;  1XF5 L;  1TTN A;  2RMM A;  2CR5 A;  4N59 A;  2LGS A;  2YVC A;  2IO3 B;  5BMH A;  1SE2 A;  3SEB A;  3DBR B;  2ON8 A;  4WJO A;  2JU6 X;  2ZJD A;  2KAC A;  2RSU A;  1TJE A;  4RF0 A;  2BBC A;  2AYO B;  2WU2 B;  4B0M A;  5D94 A;  5L83 A;  2WXH A;  1SE4 A;  3ZIM A;  3AE2 B;  2A5U A;  2WX0 A;  1WR6 E;  1UWM A;  3AED B;  2H89 B;  2W3R A;  3WAO A;  4HDO A;  1T0Y A;  4LLG M;  3H7P A;  1N62 A;  2MP2 B;  1JRP A;  4WWP A;  2UU7 A;  2SAK A;  2LEK A;  1N5W A;  4PS7 A;  1EUV B;  3U4E G;  3WAL A;  4BKT A;  1J7A A;  4M00 A;  2QDF A;  1IGD A;  2BYF A;  3MHZ A;  4BBN F;  1PGB A;  4RFB A;  3EFU A;  3X23 A;  4A55 A;  3B0A A;  2LFI A;  3ZQ4 A;  4MJS A;  2ZW0 A;  1KRH A;  4RNA A;  5CHW A;  5IO9 A;  4PS3 A;  2IO1 B;  3ETR A;  1PQS A;  4ZYN A;  2IGH A;  3RNG C;  1P9D U;  5DPS A;  4PYZ A;  1PFD A;  1IBX A;  1DOY A;  3NHE B;  3ABV B;  2KC2 A;  4MAC A;  3ALB A;  1Q5W B;  1L0V B;  4AOF A;  3TEW A;  1OQY A;  1E7V A;  3TBL D;  1VZ8 A;  3NVZ A;  4F8C B;  1K8R B;  3KUD B;  1VDV A;  1QOB A;  2MW5 A;  3DQV A;  1WRI A;  3BY4 B;  3DVG X;  3RNB C;  4JGH B;  4HXD A;  3RNA C;  3ZTC A;  1V6E A;  2L76 A;  3N1Z C;  2AEH A;  2FNJ B;  2LUE A;  2GRI A;  3A1Q B;  1TY0 A;  1FNW A;  4NJC A;  1YX5 B;  5BO4 B;  4BFR A;  3QX1 A;  3O65 B;  5TR5 A;  3B08 A;  1P7F A;  2FIF A;  4JIO U;  4K81 A;  1HE8 A;  2RDB C;  1GPX A;  4WQO B;  1E0Z A;  1WXM A;  3P63 A;  2KAN A;  3L10 B;  2WXQ A;  5D7G A;  2YEP F;  4LK0 M;  2IJ0 A;  1HEZ E;  4BKG A;  4RGM A;  2Y5B B;  1ZDV A;  4A9A A;  2NVU I;  4LNI A;  2Z0D B;  1NYR A;  4M0W A;  4IM0 A;  4BVU C;  4PS8 A;  3ZNI D;  2JWZ A;  2VH2 A;  2MQJ A;  1UBQ A;  2KOX A;  4FN2 A;  2K1F A;  3VVW B;  3ZDM C;  4AWJ A;  3N1Y C;  1YN5 A;  4ZRQ A;  5C3J B;  2BS3 B;  4F1S A;  1J19 A;  4GIV A;  2LZ6 A;  1CJE A;  3AE5 B;  3N30 A;  3LXF A;  4ASW C;  1NYQ A;  1V1P B;  4DXF A;  5D3I B;  2IY0 B;  1K53 A;  2J53 A;  2V3N A;  3QK0 A;  3AE6 B;  1STE A;  1UZX B;  4HPL B;  4C4V A;  4K1R B;  1OTR B;  2R61 A;  3PPA A;  2QJL A;  2N1W A;  2JXT A;  1UF0 A;  1ZPS A;  4C80 A;  3EGR A;  1M94 A;  4KKJ A;  2ZW1 A;  1T0Q C;  3AU5 A;  2KK8 A;  4HLE A;  3CSF A;  2CS4 A;  1Q1O A;  2ICI A;  4W9I A;  2EKE C;  5DPT A;  3RPF C;  3AEB B;  2PJH A;  4NPN A;  4NY0 A;  1Q0W B;  5BMG A;  4W9F A;  4ANX A;  2IY1 B;  2W9N A;  2J0J A;  2CJN A;  4YXD B;  1HZ5 A;  2REX A;  2DEN B;  3NRZ A;  2KWD A;  1WJN A;  4HK2 A;  4OZA A;  3R2T A;  4ZHO A;  3DDC B;  3HM3 A;  4FJZ A;  1YN3 A;  2N1V A;  1A5R A;  4NQK E;  2RD0 A;  4L2Y A;  2KMA A;  1YD8 U;  1CZP A;  1JWS D;  1WYG A;  4K7S A;  4EKU A;  4EOY A;  1WZ0 A;  3URY A;  2JVC A;  1MFW A;  2CKH B;  2O2V B;  3MHS D;  2DNF A;  2IBI B;  2J0K A;  3NZS A;  4C7Y A;  3AV8 A;  2KVR A;  3PZ8 A;  2KDI A;  3TMP B;  1Z2M A;  2J4X A;  4R3D A;  2GBJ A;  3MFG A;  4RM8 A;  1SB3 C;  1WE6 A;  3RI7 C;  1J0G A;  1QLB B;  4O1N A;  2N4F A;  3MTN B;  4GOC A;  4YSY B;  4RGO S;  4FJY A;  3IAM 1;  3V3X A;  2BYT A;  3AB5 A;  4MH8 A;  1NI3 A;  2XK5 A;  2XNA C;  3WA0 A;  1L2N A;  2KVZ A;  2D3A A;  2WDT B;  3W1Y A;  1FXT B;  2KQS A;  2MEK A;  3A33 B;  1V1O A;  1BXT A;  1C3T A;  1TS3 A;  2V3S A;  2WDQ B;  2JZP A;  4KZ0 A;  2KZR A;  1HQR D;  2LI5 A;  2X8X X;  3BII D;  5EE1 A;  4JX1 C;  1RRB A;  2OOB B;  4XZ4 A;  1T5X D;  3I57 A;  1TGZ B;  1OQR A;  2QSD A;  3MC9 A;  1BT0 A;  2M8S A;  4EZJ A;  4MEM A;  2GBN A;  2KWV B;  4A90 A;  2BB6 A;  3JYU A;  4HJK A;  5BYR A;  2HTM E;  1IGC A;  2GB1 A;  3OLM D;  1X1M A;  3NZU A;  1V86 A;  1JQ4 A;  1P3Q U;  2BGF A;  3WCQ A;  3PSE B;  3M63 B;  1JAL A;  2UYZ B;  3UQA A;  4GN1 A;  1E7P B;  2BWE S;  3HIZ A;  2BS4 B;  2LJ5 A;  3EFC A;  2J42 A;  2WXK A;  2N9X A;  1E7U A;  4HKZ E;  1YNT E;  3NY5 A;  3NZ3 A;  3AE7 B;  3BIN A;  3OJ4 B;  3NUH B;  2D2Q A;  5HKH A;  1PYW D;  4KGS A;  4B9K A;  4FLH A;  4A8X C;  5E6P A;  4P6V F;  1A70 A;  2LVP A;  4BAX A;  4G11 A;  2D3B A;  1WH3 A;  1H8C A;  1P1A A;  3MC8 A;  3ZXV A;  1WJU A;  2IGG A;  4HDQ A;  3V05 A;  5KHO A;  1RFK A;  3DVN V;  1QOF A;  5AUK A;  2Z8L A;  5H92 C;  1L0Y B;  5G2N A;  3T9L A;  3EA6 A;  1E8X A;  1VD2 A;  3AM9 A;  3PLU A;  3SFE B;  3JSV A;  1KOT A;  3DOW A;  3EHV A;  4W9E A;  2KYW A;  4DDG D;  4DXG A;  1KFY B;  5C1Z A;  2KKC A;  4ZYS A;  4DBG A;  1KLU D;  3RFZ B;  2KQ7 A;  1ZE3 D;  3PHW B;  2M19 A;  5LXH A;  4CQN A;  1JCK B;  3K9O B;  1QOA A;  2DWQ A;  4GXB A;  3W1S A;  4IC7 B;  2K6Q A;  1FFU A;  2JYE A;  3P1M A;  1F52 A;  2HDE A;  2K6D B;  3DVN U;  2M1M A;  3UIO B;  2FCM A;  1B9R A;  4NQL B;  3AH7 A;  2KMM A;  5CHV C;  3KYC D;  2GI9 A;  3Q8A A;  5DCN A;  3RUL A;  1NEN B;  3KUZ A;  4MGY E;  3AUL A;  1FNV A;  3ZVV A;  3DBH B;  3OAW A;  4OVU A;  5IKC M;  1WWT A;  1WX7 A;  2D11 A;  2KC1 A;  1SGH A;  3AE4 B;  4DK5 A;  2YEP B;  4NAW B;  2VZK B;  1C4A A;  1NBF C;  2K8B A;  2KJR A;  2DAJ A;  3IVF A;  2MHJ A;  2FID A;  4FAD A;  3UI3 A;  2Y5C A;  2Z0E B;  1WXQ A;  4WJN A;  2WXN A;  1VJK A;  1RM6 C;  4Q2J A;  2K8C A;  2L8J A;  2KO3 A;  3U30 A;  3VTW A;  3MP9 A;  4DHZ B;  4HVB A;  1VLB A;  1XLN A;  4OVZ A;  1KTK A;  1ISN A;  4FXC A;  4FJV B;  3ZJT A;  2L05 A;  3PRZ A;  2LVO A;  2PMV A;  4E74 A;  3Q3N C;  4A20 A;  1TS2 A;  2JT4 B;  1LFD A;  2ZNV B;  1CQV A;  1TZ1 A;  2QEJ C;  1FM0 D;  1JRO A;  1SJE D;  3RT3 B;  1D3Z A;  3RZW C;  3T3O A;  3NVW A;  5AZG A;  1BUI C;  4IKG A;  3KVF B;  2KFJ A;  2FCN A;  1R4M I;  4GSW A;  3U2S C;  1SE9 A;  3FKY A;  2R2Q A;  3T3N A;  3DBL I;  2LHE A;  1FXA A;  4WWM A;  1WJ6 A;  3GOE A;  2SEB D;  3PZ7 A;  3ZYY X;  1R4M B;  4MT5 A;  2W54 A;  3APC A;  1MJD A;  5EE0 A;  3L17 A;  4GDL A;  3DBL B;  2ZCB A;  1NEK B;  3V61 A;  1B1Z A;  4YL8 A;  1K50 A;  1KLG D;  3GE8 C;  3HRD D;  1FRD A;  3M95 A;  2GBK A;  3AEF B;  4JLC A;  2DZJ A;  4BBN C;  2KJH B;  4NAM A;  3H7P B;  2WXI A;  4MM3 A;  1RLF A;  1XEE A;  1WI0 A;  4FA6 A;  4LTU A;  2IYD B;  5AZH A;  1ZGU B;  3ZRC A;  3DPD A;  1EF5 A;  2JY6 A;  1GUA B;  3ENE A;  4XX5 A;  3QIJ A;  1E8Z A;  4A3O A;  4NJ6 A;  1R4N I;  4ANU A;  3P4Q B;  1I42 A;  2FBW B;  1V2Y A;  2RR9 A;  2D5G A;  3NS1 A;  1ZW7 A;  3APF A;  1ESF A;  3KQ4 A;  2DAF A;  2BKF A;  3BZD B;  3GB1 A;  1T0R C;  4MJS B;  4XGA B;  2W3S A;  4I6L B;  4LJP B;  2KN5 A;  3KW5 B;  1R7S A;  2L32 A;  3NOB A;  3Q8F A;  2MBH A;  1RFA A;  4W9C A;  4WAA A;  2B76 B;  3DWM A;  2J7Q B;  1N5X A;  1V5O A;  4C00 A;  1QZE A;  1IBX B;  1LO5 D;  2E6X A;  2WXR A;  3RYT A;  2MBQ A;  2YLM A;  4K7U A;  1E8Y A;  4TMA B;  2FUH B;  3RUI B;  4K3C A;  4WWN A;  3AI5 A;  1UNS A;  2LVQ A;  2DYO A;  2E3T A;  5AZF A;  4KIK A;  1HA5 A;  2L00 B;  2LMC A;  2LRU A;  4PT5 A;  1I4P A;  2LHD A;  2INC C;  2RGF A;  1WSP A;  2AX5 A;  1HXY D;  3Q8E A;  2ZVN A;  4RCO A;  3V6C B;  3APD A;  4ZRK A;  2JXX A;  4M8M A;  1L6V A;  1WX9 A;  3K9P B;  1FFV A;  3R7R A;  4WAF A;  3TCA A;  2HJ1 A;  3L54 A;  1WXS A;  2FAZ A;  4P7I A;  1F2R I;  2M0X A;  3TEX A;  2DHZ A;  4HEA 1;  3MJW A;  1I4H A;  4MH0 E;  4E71 A;  1ZXI A;  1HZ6 A;  3V62 A;  4M02 A;  1D4B A;  2EEL A;  4GGQ A;  4WWO A;  3AE9 B;  2BF8 B;  3PT2 B;  3P4P B;  4DHZ E;  2INP E;  3DCG A;  1HTQ A;  4M0W B;  4ZRP A;  4ITK A;  4REZ A;  1XCQ L;  3PRE A;  4ZHP A;  1WGD A;  4IWO A;  3SD5 A;  2Y3A A;  5DPR A;  1E9M A;  2GBM A;  3N20 C;  2ZNV C;  4TQ1 A;  4URK A;  1ZOY B;  2PLP A;  2WP9 B;  1YJJ A;  4GB9 A;  4DWF A;  3QHT A;  2N0S B;  3TSS A;  2MCN B;  3VH4 B;  4OZC A;  4OW0 A;  4C4V B;  3IT6 B;  3VHT C;  3BVG A;  1UH6 A;  3GE3 C;  2DYB A;  3DBS A;  4II3 B;  1F1H A;  4HCN B;  1L7Y A;  4HWI B;  2WXJ A;  5LNK 1;  2KXJ A;  3U7D A;  2NTT A;  1FD6 A;  2FCQ A;  2M56 B;  3BYY B;  3DWG C;  1GC6 A;  3A9K A;  3H7S A;  4GLS C;  1XCT L;  3FAH A;  1SIJ A;  1C76 A;  3HUI A;  4EFO A;  1WFY A;  3VR9 B;  2K39 A;  1KM7 A;  5T8I A;  3HVZ A;  3AMZ A;  2BWF A;  3R3M A;  2KTR A;  1C9F A;  2MJE A;  2ZEQ A;  4B0E A;  2KLG A;  1JWA D;  3RCZ A;  3RZF A;  1WRD B;  2QC8 A;  4JE3 B;  3VDZ A;  2N9E B;  2JX5 A;  4XE0 A;  3KH0 A;  1UBI A;  3SHQ A;  1WY8 A;  2QMT A;  1VCB A;  4NJ7 A;  2MJ3 A;  4K7W A;  3I9V 1;  2KN4 A;  4M01 A;  2KWU B;  3AEC B;  1KJT A;  1L4Z B;  1TKY A;  3Q6B A;  4CHK A;  1QKZ A;  4OZB A;  2DYM A;  1P98 A;  2PVO D;  3A4R A;  1YJI A;  4CO7 A;  4FHJ A;  4HKQ A;  3UGB B;  2J52 A;  1V97 A;  2ONQ A;  3A9J A;  4F7Z A;  2K5P A;  1SBB B;  5FR3 A;  4AP4 C;  5G5G A;  4P16 A;  1IYF A;  2KHW B;  2QIL A;  3KWL A;  3WAP A;  3AEE B;  2D10 A;  1WGY A;  1YN4 A;  2KDF B;  2WGS A;  3PLV A;  4MSM B;  4BKS A;  2G45 B;  3VTU A;  5C2T B;  1AW7 A;  4ANV A;  2JF5 A;  4KGT A;  5EE3 A;  2XN9 C;  2XK5 B;  3L08 A;  4AS1 A;  3Q3F A;  2M4N A;  1WXA A;  2I38 A;  1ROE A;  1U4A A;  2NPT A;  4B95 A;  3ZTD A;  1KF6 B;  3W5V B;  3QWZ B;  3AU4 A;  2DBY A;  1D5X C;  3SFD B;  4HJG E;  5EDS A;  3V60 A;  3GS2 A;  1RYJ A;  1TY2 A;  3NJT A;  1C1Y B;  3B2F A;  1E90 A;  1J8C A;  2B3A A;  2KNB A;  2NBW B;  3Q3J A;  4KSK C;  2H88 B;  2G1E A;  3I3T B;  1VZ7 A;  4BZA A;  3O13 A;  3H6N A;  1TKG A;  5JHA A;  1K52 A;  3JW0 X;  2WDV B;  4S0R A;  2WXG A;  4RGT A;  2KD0 A;  2M0A A;  2C7N B;  1H4R A;  3CF6 E;  3NG0 A;  2CHW A;  1XD3 B;  2MWS B;  2MX2 A;  1SE3 A;  1NVI D;  3ONS A;  1CMX B;  5JHB A;  2Y5P A;  4KDL B;  2PPH A;  3ZW3 A;  1AWD A;  3U8Z A;  3IG3 A;  1F2R C;  2LRW A;  1WX8 A;  4XDD A;  2MLB A;  4ICV A;  2WXO A;  3OG5 A;  4YT0 B;  1KLV A;  1MI0 A;  1UEL A;  3N1X C;  3VAW A;  2HD5 B;  2PVG C;  4IOI E;  1S1Q B;  3CWI A;  3KWV A;  2QCZ A;  4ARI A;  1N61 A;  2UWQ A;  3W2D A;  2V4L A;  2M17 A;  1C79 A;  1WMH A;  3P4R B;  4XWT A;  2X38 A;  1IPG A;  1SXT A;  2EMT A;  3D32 A;  2ACZ B;  3PS6 A;  4B6W A;  1DGJ A;  4X57 B;  1JWM D;  3PRP B;  4J6I A;  2V3P A;  3FIL A;  3VFK A;  1WM3 A;  1EF1 A;  2L7R A;  2LJI A;  2FUG 1;  4ICU A;  3VTV A;  3NVV A;  3BK1 A;  2RPV A;  4EZK A;  3BVM A;  2I2Y A;  2AL6 A;  4C56 C;  4DXA B;  3LB8 C;  2KMC A;  3PRM B;  3UQB A;  2WLB A;  2L3Z A;  3P42 A;  4LNF A;  4L23 A;  5E6O A;  4LCD E;  5CX3 A;  3JSV B;  3UF8 A;  3DVG Y;  1EU4 A;  2KFK A;  2BYE A;  1EU3 A;  2O6V A;  2WU5 B;  4JWU C;  1UD7 A;  1C4P A;  1MPE A;  2WX1 A;  2KX3 A;  2XBB C;  2QIE B;  4A3P A;  2KTF A;  3HVD A;  3MC0 B;  4TSS A;  4BOZ B;  4LNN A;  3Q69 A;  1JWB D;  5D6J B;  1WM2 A;  5HI1 A;  4G50 A;  3OJ3 A;  5D2M B;  1F0Z A;  2W55 A;  1GNU A;  2VZK D;  4KSL C;  1E6E B;  3QA8 A;  2MSE D;  1OGW A;  4YTP B;  1YX6 B;  4IWP A;  2ASQ A;  3BVZ A;  1ENF A;  1ZUD 2;  1P7E A;  3PVL A;  1WGH A;  3LYY A;  3RNC C;  4AJY B;  2MBO A;  3TUO A;  2I1K A;  2IDY A;  3QCA A;  5C23 A;  3TEZ A;  2K0P A;  2RDG A;  3KUC B;  2ZCC A;  3Q3M C;  4H2A A;  3R8B A;  2KDM A;  2LGY A;  1FXI A;  4GDK A;  4C7Z A;  1MHX A;  2R2O A;  3VUW A;  1L5P A;  5HHD G;  1FPY A;  1EWC A;  1FMA D;  1YMH E;  4TV3 A;  2BS2 B;  1WGR A;  1V49 A;  1KH0 A;  4A6Q A;  2JQR B;  1LQB A;  2MH7 A;  1Q10 A;  2N9L A;  5BYS A;  2PE9 A;  1TZO A;  2LUM A;  2L52 A;  2DX5 B;  3IBE A;  1T3Q A;  3IT4 B;  3W5U B;  4EE2 A;  2K9X A;  3L16 A;  2DZK A;  1J7C A;  1P0R A;  2BYV E;  1ZKH A;  2BB5 A;  1PGX A;  4KKI A;  4FBJ B;  4G0N B;  5KHQ A;  3V6E B;  3NVY A;  3PGE A;  4FHK A;  1FCC C;  3L13 A;  1PUT A;  4WUR A;  1QIL A;  1M4V A;  3AE8 B;  2BQQ A;  2LGI A;  2I1J A;  1V81 A;  2C7H A;  2G3Q B;  4IM3 A;  4KV2 A;  2KQ4 X;  2PTL A;  4HPP A;  2GOW A;  5IP4 D;  1F9J A;  2HTH A;  4TKN A;  1V80 A;  4W9J A;  4JL9 A;  1ET9 A;  3ZO5 B;  2FCS A;  1DOI A;  3WAN A;  1I4X A;  2MP2 A;  1XQQ A;  2JYT A;  4PYU A;  3JVZ X;  4BOS C;  1HTO A;  4WIP A;  1ZXH A;  5FKA C;  3GZN I;  5IOI A;  4EEW A;  4W9L A;  4GDL B;  2WXP A;  2KDB A;  2Q5W D;  2FE8 A;  3ZJV A;  1JML A;  3TIX A;  2D3C A;  1MHH E;  2RPQ A;  4MEL A;  1QQR A;  3GZN B;  2CU1 A;  4MGI E;  2LWP A;  5I4D A;  1AYF A;  1I4Q A;  2LGD A;  3VH3 B;  2LAS A;  4XWW A;  2TSS A;  4HPM B;  2Z59 B;  1I4R A;  3IXS A;  1FNU A;  4MM3 B;  2N9P C;  1GOZ A;  3CMM B;  1FCL A;  4IUM B;  1Y8R C;  3Q14 C;  3Q8C A;  4N6E B;  1MG8 A;  1C78 A;  3VQI A;  2KLC A;  1R4N B;  5TSS A;  2G4S A;  1XO3 A;  1EWY C;  4TUU A;  5CTR C;  1N60 A;  2JUO A;  2V4I B;  1TS5 A;  2IGD A;  5IAA C;  3RMK C;  1TS4 A;  3R2I A;  4I6N B;  3PTF C;  1L6U A;  1FEH A;  2L83 A;  1IUE A;  1NDD A;  2ZZP B;  4HCP B;  1L0X B;  3QAQ A;  3ZLZ A;  1LM8 B;  1YOV B;  3W1S C;  4KDI C;  2WYQ A;  2IZV B;  5J2R A;  1OQQ A;  1V9J A;  2G9H D;  4NNJ B;  1GB1 A;  4II2 B;  3A1Q A;  2A4Z A;  3AEA B;  3HHM A;  3PO0 A;  4D2K A;  5L95 C;  3UIP B;  4AUQ C;  3Q3O C;  1UWX A;  4ZRJ A;  3EEC A;  1PDX A;  3VXW A;  3EUB 2;  4KIK B;  2BTE A;  1YIW A;  3CST A;  2BT6 A;  2LGX A;  1TKE A;  2XEW A;  2INN E;  3B2G A;  1FIQ A;  2K25 A;  3AEG B;  3C0R B;  3AE1 B;  4ZRI A;  4P1B C;  2EMS A;  4MSQ B;  2GBR A;  1EO6 A;  1WJ4 A;  1ACC A;  2CHX A;  1K51 A;  3Q8B A;  2WS3 B;  1XLQ A;  5BMI A;  4DDI D;  4USA A;  1I4G A;  1V1P A;  1VR9 A;  1NI2 A;  3VUY A;  3N9Y C;  1AAR A;  3ZNH B;  4CYE A;  3I5J C;  3WAM A;  2IO2 B;  2N9K A;  2NMQ A;  1SF0 A;  1Y56 A;  2CHZ A;  4LJO B;  4IWQ A;  5MPO A;  3W9C B;  3J9C A;  5JZE B;  4EUT A;  2JRI B;  3L4P A;  1VZ6 A;  5LLI A;  3B9J A;  1D6E C;  1OEY A;  4JWS C;  2JPH A;  3SR6 A;  5E6N A;  1LXD A;  1JW9 D;  2K3U A;  4UDU C;  5JXV A;  4W9G A;  1E10 A;  2JZ3 B;  1BML C;  3VR8 B;  1XXG A;  2RDH A;  3AE3 B;  3BK2 A;  2WXM A;  2NCN A;  1N63 A;  3ZUN A;  4ANW A;  3RN9 C;  3R66 C;  1VRA B;  1AN8 A; 
#chains in the Genus database with same CATH homology
 4DK5 A;  2PPH A;  4NAW B;  3ZW3 A;  3U8Z A;  3NHE B;  5AEK B;  3QJZ A;  1NBF C;  2K8B A;  1WR1 A;  2KJR A;  3IG3 A;  2KC2 A;  2LRW A;  3ML9 A;  2DAJ A;  1WE7 A;  1WX8 A;  3IVF A;  2MLB A;  3ALB A;  4ICV A;  3M62 B;  2FID A;  4FAD A;  1Q5W B;  1WXV A;  1D3Z A;  3VUX A;  4AOF A;  1KLV A;  1V5T A;  2Z0E B;  1OQY A;  3ZNZ B;  1UEL A;  4WJN A;  3A9K B;  1E7V A;  3TBL D;  4F8C B;  1K8R B;  2N7D A;  3KUD B;  2NS5 A;  2HJ8 A;  2K8C A;  2L8J A;  3VAW A;  2HD5 B;  4IM2 A;  2KO3 A;  2O2V A;  1S1Q B;  2MW5 A;  4LDT D;  3U30 A;  3VTW A;  4DHZ B;  3DQV A;  4HVB A;  2OJR A;  2L0F A;  2UWQ A;  3ZDT A;  1ISN A;  2V4L A;  3AXC A;  2M17 A;  3BY4 B;  3DVG X;  4FJV B;  2KTR B;  4JGH B;  1WMH A;  1Z5S B;  4HXD A;  1JRU A;  2L05 A;  3ZTC A;  1V6E A;  2V1Y A;  2L76 A;  3PRZ A;  2LVO A;  3RD2 A;  2AEH A;  2FNJ B;  4E74 A;  2AL3 A;  1IPG A;  3QC8 B;  4A20 A;  4LDT B;  2JT4 B;  2LUE A;  4MGK E;  1LFD A;  2EMT A;  3D32 A;  2ZNV B;  3A1Q B;  1TZ1 A;  3PS6 A;  4B6W A;  4X57 B;  1YX5 B;  3PRP B;  4J6I A;  5BO4 B;  4BFR A;  1SIF A;  3QX1 A;  3RT3 B;  1WM3 A;  1EF1 A;  2L7R A;  4IW0 A;  3O65 B;  4KZC A;  1YJ1 A;  2KX0 A;  3VFK A;  3RZW C;  5TR5 A;  2MBB B;  3B08 A;  4ICU A;  3VTV A;  5AZG A;  2FIF A;  1UGM A;  2C60 A;  4JIO U;  4K81 A;  1HE8 A;  3KVF B;  4EZK A;  2KFJ A;  2FCN A;  1R4M I;  4GSW A;  2K8H A;  2AL6 A;  1SE9 A;  4DXA B;  2D3G A;  2KMC A;  4WQO B;  1WXM A;  2KDE B;  3PRM B;  2R2Q A;  3UQB A;  2KAN A;  3DBL I;  3L10 B;  5D7G A;  2VRR B;  2L3Z A;  4XC2 A;  1I35 A;  3T8M A;  3PHX B;  1WJ6 A;  3GOE A;  5G55 A;  5CHF A;  1E8W A;  4W9K A;  3TJP A;  4BKS D;  4BKG A;  2Y5B B;  5E6O A;  5J17 A;  3A9J B;  4LCD E;  4W9H A;  3TL5 A;  2NVU I;  5CX3 A;  2Z0D B;  3APC A;  4IM0 A;  3JSV B;  3L17 A;  4PS8 A;  3ZNI D;  4BVU C;  4EZL A;  2JWZ A;  3UF8 A;  4KVG B;  3DVG Y;  2KFK A;  4GDL A;  2BYE A;  2MQJ A;  3H9D A;  1UBQ A;  3S2A A;  2ZCB A;  2KOX A;  3HK0 A;  3IHP C;  2K1F A;  4FN2 A;  4N9F 4;  3VVW B;  3V61 A;  2N7E A;  3ZDM C;  4AWJ A;  2O6V A;  4YL8 A;  1WYW B;  4F1S A;  1UD7 A;  1J19 A;  2WX1 A;  4GIV A;  2KX3 A;  2LZ6 A;  2XBB C;  2MRP A;  3M95 A;  3N30 A;  4ASW C;  2GBK A;  4RMA A;  4A3P A;  2DZI A;  2IY0 B;  3EC8 A;  2KTF A;  4JLC A;  4DHJ D;  2DZJ A;  2BPS A;  3QK0 A;  4BBN C;  2KJH B;  4BOZ B;  1UZX B;  3H7P B;  4MM3 A;  1RLF A;  4HPL B;  1WI0 A;  4FA6 A;  2NPT B;  1OTR B;  4K1R B;  5D6J B;  1WM2 A;  3PPA A;  2IYD B;  5AZH A;  1ZGU B;  2N1W A;  1GJZ A;  3ZRC A;  4G50 A;  4WJQ A;  3OJ3 A;  3DPD A;  1M94 A;  5D2M B;  1EF5 A;  2JY6 A;  4DHJ B;  5DPW A;  1GNU A;  3AU5 A;  4KSL C;  1GUA B;  2KK8 A;  3ENE A;  4XX5 A;  4HLE A;  3QIJ A;  3CSF A;  2MSE D;  1E8Z A;  2MBE A;  3QA8 A;  1R4N I;  2CS4 A;  1OGW A;  1Q1O A;  4NJ6 A;  1YX6 B;  2EKE C;  4IWP A;  4W9I A;  2ASQ A;  5DPT A;  1V2Y A;  1I42 A;  2RR9 A;  3X0W A;  1ZW7 A;  3APF A;  4MDK E;  2QHO A;  3PVL A;  1WGH A;  2PJH A;  1YQB A;  4AJY B;  2MBO A;  4NPN A;  2DAF A;  4NY0 A;  1TBE A;  2I1K A;  3M3J A;  2PE6 B;  1Q0W B;  2BKF A;  3QCA A;  4GMV A;  5C23 A;  4MJS B;  4W9F A;  4I6L B;  4ANX A;  2AWT A;  2C7M B;  3KUC B;  2KN5 A;  2ZCC A;  2IY1 B;  4LJP B;  3KW5 B;  2W9N A;  2J0J A;  3NOB A;  1OEY J;  2LGY A;  2MBH A;  3KYD D;  1RFA A;  4GDK A;  4W9C A;  4WAA A;  2R2O A;  2DEN B;  2REX A;  2ZVO A;  3ECI A;  1WJN A;  3VUW A;  4HK2 A;  2J7Q B;  1WF9 A;  5JH5 C;  1V5O A;  3DDC B;  1QZE A;  2D07 B;  2IO0 B;  3HM3 A;  2N1V A;  4FJZ A;  4TV3 A;  1WGR A;  3QQ8 B;  1A5R A;  1V49 A;  2KWC A;  4NQK E;  1GG3 A;  2RD0 A;  1LQB A;  3RYT A;  2KMA A;  1YD8 U;  2MBQ A;  2YLM A;  4K7U A;  4JQW C;  1E8Y A;  4TQ0 A;  2PEA A;  2PE9 A;  1IP9 A;  4K7S A;  2FUH B;  3RUI B;  4EKU A;  4EOY A;  3UIN B;  4WWN A;  3AI5 A;  2DX5 B;  2NBV B;  3IBE A;  2KJ6 A;  2LVQ A;  2DYO A;  5AZF A;  4KIK A;  1WZ0 A;  3L16 A;  2JVC A;  1GC7 A;  2DZK A;  4M8N A;  2L00 B;  1P0R A;  2CKH B;  2BYV E;  1ZKH A;  2O2V B;  3MHS D;  2IBI B;  2LRU A;  5LXI B;  2J0K A;  3NZS A;  2C5L C;  3WIM A;  4G0N B;  4FBJ B;  5KHQ A;  3SU8 X;  3V6E B;  2KVR A;  2KDI A;  2RGF A;  3PGE A;  4FHK A;  3TMP B;  1WMH B;  3PZD A;  3H1U A;  2LD9 A;  3L13 A;  2ZVN A;  1Z2M A;  3V6C B;  2GBJ A;  3APD A;  5J18 A;  4ZRK A;  4OVV A;  4RM8 A;  4MGZ E;  2JXX A;  3QAR A;  4M8M A;  5GMV A;  3ZRF A;  1WE6 A;  2MA9 B;  1WX9 A;  3K9P B;  2I1J A;  1V81 A;  2C7H A;  2G3Q B;  4FUL A;  4IM3 A;  4KV2 A;  2JZZ A;  3R7R A;  3TCA A;  1J0G A;  2N4F A;  2NR2 A;  3L54 A;  3MTN B;  1WXS A;  2FAZ A;  4GOC A;  4FJY A;  1WIA A;  2GOW A;  4P7I A;  3ZNG C;  5IA7 A;  2M0X A;  1F9J A;  2HTH A;  4IG7 B;  4TKN A;  1V80 A;  2DHZ A;  4W9J A;  3MJW A;  4MH0 E;  4JL9 A;  3LJ3 A;  4E71 A;  3ZO5 B;  2FCS A;  2XK5 A;  1XT9 B;  3WA0 A;  1L2N A;  3V62 A;  3LDZ E;  2WDT B;  3WAN A;  2L0T A;  3W1Y A;  1FXT B;  4GGQ A;  2MP2 A;  2WWZ A;  4ANU A;  2KQS A;  1XQQ A;  3A33 B;  4PYU A;  3JVZ X;  2ZPY A;  4WWO A;  1C3T A;  2BF8 B;  2V3S A;  4BOS C;  3PT2 B;  4DHZ E;  2O6V D;  3GZN I;  4WJP A;  4KZ0 A;  3DCG A;  4EEW A;  2KZR A;  2C9W B;  4I6P A;  4M0W B;  2LI5 A;  4W9L A;  3PRE A;  2KFK B;  4GDL B;  2KDB A;  1WGD A;  4IWO A;  3SD5 A;  3TIX A;  4E3C A;  5DPR A;  1RRB A;  2GBM A;  2RPQ A;  2O6V B;  2ZNV C;  2OOB B;  4MEL A;  4TQ1 A;  4URK A;  4XZ4 A;  2CU1 A;  4GU2 A;  4MGI E;  2NBU A;  2LWP A;  4DWF A;  4GB9 A;  1E5W A;  2LGD A;  3QHT A;  3VH3 B;  1TGZ B;  2GMI C;  2LAS A;  2MCN B;  2ZPN A;  4RM9 A;  1BT0 A;  3VH4 B;  2HE7 A;  2Z59 B;  4HPM B;  2M8S A;  4EZJ A;  4MEM A;  2GBN A;  2KWV B;  4AJW A;  2N9P C;  3DBH I;  3VHT C;  3CMM B;  3B1L X;  4IUM B;  2LXA A;  1Y8R C;  3JYU A;  1RAX A;  3HM6 X;  1WGG A;  4HJK A;  1UH6 A;  3IFW B;  4NAW A;  2DYB A;  4PYZ A;  1MG8 A;  3VQI A;  1WZ3 A;  2JRH A;  2KLC A;  3DBS A;  3SDL C;  4II3 B;  2LXC A;  4HCN B;  1L7Y A;  2G4S A;  4HWI B;  4ZDV A;  2KXJ A;  3OLM D;  3U7D A;  1X1M A;  2FCQ A;  3NZU A;  1V86 A;  1P3Q U;  2BGF A;  4TUU A;  3PSE B;  2G4D B;  5CTR C;  3M63 B;  1GC6 A;  3A9K A;  3H7S A;  2JUO A;  3L0W B;  2UYZ B;  3ZKJ C;  3UQA A;  4G3X B;  5IAA C;  1S3S G;  3ML8 A;  2DZM A;  3PV1 A;  4GN1 A;  3NS8 A;  4EFO A;  2BWE S;  3HIZ A;  4I6N B;  3R7Q A;  1WFY A;  2K39 A;  2BKR B;  1KM7 A;  2LJ5 A;  3N32 A;  3PTF C;  3P2B A;  2N9X A;  1E7U A;  3A4S C;  1G6J A;  1NDD A;  2J0M A;  3NY5 A;  2BWF A;  2ZZP B;  4GDK B;  3N3K B;  3BIN A;  3OJ4 B;  2KTR A;  3R3M A;  3QAQ A;  4HCP B;  3ZLZ A;  1LM8 B;  2ZEQ A;  3W1S C;  4KDI C;  2D2Q A;  5HKH A;  2WYQ A;  2KLG A;  2IZV B;  5FR6 A;  4B9K A;  4FLH A;  5J2R A;  3RCZ A;  1V9J A;  5E6P A;  4NNJ B;  4II2 B;  4W9D A;  3A1Q A;  3RZF A;  2A4Z A;  1WRD B;  2LVP A;  3HHM A;  3VDZ A;  2N9E B;  4G11 A;  1WH3 A;  3KH0 A;  1UBI A;  3SHQ A;  3UIP B;  5L95 C;  4AUQ C;  1WY8 A;  3DBR I;  1VCB A;  4NJ7 A;  4K7W A;  1H8C A;  1P1A A;  1TTN A;  4ZRJ A;  2CR5 A;  2KWU B;  1WJU A;  3EEC A;  4A3O A;  1KJT A;  4CHK A;  4HDQ A;  3VXW A;  2DYM A;  4KIK B;  1P98 A;  2YVC A;  5KHO A;  1YIW A;  3DVN V;  2IO3 B;  3CST A;  3A4R A;  4CO7 A;  2LGX A;  2XEW A;  4FHJ A;  3UGB B;  5G2N A;  4WJO A;  3T9L A;  2K25 A;  1E8X A;  1VD2 A;  3A9J A;  3PLU A;  4F7Z A;  2ZJD A;  3C0R B;  2RSU A;  3JSV A;  1KOT A;  3DOW A;  4AP4 C;  3EHV A;  4ZRI A;  2AYO B;  4W9E A;  1IYF A;  2EMS A;  2KHW B;  4DDG D;  4MSQ B;  2GBR A;  1EO6 A;  3WAP A;  5D94 A;  5C1Z A;  5L83 A;  3ZIM A;  2KKC A;  2D10 A;  1WJ4 A;  1WGY A;  2A5U A;  2CHX A;  2KDF B;  1WR6 E;  2WX0 A;  3PLV A;  4MSM B;  4BKS A;  4DBG A;  2G45 B;  3VTU A;  4ANV A;  2KQ7 A;  2JF5 A;  3PHW B;  3WAO A;  4HDO A;  5LXH A;  4DDI D;  1NI2 A;  3K9O B;  3VUY A;  4GXB A;  2XK5 B;  3L08 A;  3W1S A;  1AAR A;  1T0Y A;  3Q3F A;  3H7P A;  2M4N A;  1WXA A;  4IC7 B;  2K6Q A;  3ZNH B;  4CYE A;  2MP2 B;  3WAM A;  2IO2 B;  1U4A A;  2NPT A;  4B95 A;  3ZTD A;  3QWZ B;  3AU4 A;  2CHZ A;  4LJO B;  4WWP A;  4IWQ A;  5JZE B;  5EDS A;  3V60 A;  4PS7 A;  1EUV B;  3WAL A;  4BKT A;  2K6D B;  3DVN U;  4EUT A;  1C1Y B;  2JRI B;  2M1M A;  5LLI A;  2FCM A;  3UIO B;  1E90 A;  1J8C A;  2BYF A;  2B3A A;  1OEY A;  4BBN F;  2KNB A;  4NQL B;  2NBW B;  3Q3J A;  4KSK C;  2JPH A;  3I3T B;  3EFU A;  5CHV C;  3X23 A;  3KYC D;  3B0A A;  3H6N A;  5E6N A;  5JHA A;  1LXD A;  5DCN A;  3JW0 X;  3RUL A;  4MJS A;  3KUZ A;  5CHW A;  4MGY E;  4W9G A;  4PS3 A;  2IO1 B;  2JZ3 B;  2KD0 A;  3AUL A;  1PQS A;  4ZYN A;  2C7N B;  3ZVV A;  1H4R A;  3CF6 E;  3OAW A;  4OVU A;  2CHW A;  1XD3 B;  2MWS B;  2NCN A;  2MX2 A;  3ZUN A;  2KC1 A;  1WX7 A;  1CMX B;  1P9D U;  2D11 A;  3ONS A;  5DPS A;  4ANW A;  5JHB A;  3R66 C;  1SGH A;  4KDL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...