4EF5A

Crystal structure of sting ctd
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
192
structure length
177
Chain Sequence
b'NFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPASSFSLSQEVLRHLRQEEKEEVTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane protein 173
molecule tags Immune system
source organism Homo sapiens
publication title Structural analysis of the STING adaptor protein reveals a hydrophobic dimer interface and mode of cyclic di-GMP binding
pubmed doi rcsb
total genus 60
structure length 177
sequence length 192
ec nomenclature
pdb deposition date 2012-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ef5A02
4EMTA 4YP1A 5CFMA 5BQXA 4EMUA 5CFQA 5CFNA 4JC5A 4F9EA 4LOHA 4F9GA 4LOLA 4LOKA 4F5YA 4KC0A 4QXOA 4QXRA 4EF4A 5CFPA 4QXPA 5CFOA 4LOJA 4EF5A 4F5EA 4F5WA 4F5DA 4LOIA 5CFRA 4QXQA 5CFLA 4KBYA 4KSYA
chains in the Genus database with same CATH superfamily
3QU9A 1JNYA 4TV8F 3I83A 3FCOA 3ZU4A 1OLUB 4HGYA 5KX5A 3NXKA 1DUVG 2VTEA 4OEHA 4BPBA 4OUKX 4G0YA 1TYZA 4XCVA 4G81A 3U61B 4PZ9A 1A2KC 3ELDA 2CXTA 2WDPA 2PHZA 3VV3A 4CIBA 1YR9A 4R9UC 3URMA 3LPMA 1N57A 1C7JA 2WJ4A 5C51B 3F9CA 1N7GA 2FY8A 5ANRB 5UKDA 1CG6A 1EK2A 2BEUA 2J9FA 4BOYA 3TINA 2OO5A 4MQLA 1ZNZA 1KGDA 3LZDA 4DZRA 4NFLA 4F60A 3N2KB 3A6JA 1W59A 1WHSA 1C9EA 2N1MA 2ZE8A 3ZWWA 2YHBA 3NASA 3EEYA 5KQRA 1SXJA 1JG2A 4DIBA 2ZYGA 3OCVA 3PC3A 3CG4A 4CM4A 2YXDA 5JBQA 4BAGA 1EB8A 3UAGA 3LDGA 4R7ZA 1F6WA 1NQUA 1YRWA 4ZI5A 1PJSA 1OHHA 2IPOA 5I48A 3NJRA 4H1UA 3QHAA 4MROA 1RAIA 4AZVA 3VI4B 1LK7A 3L41A 1O9BA 5IJ0B 4M9UA 3FLBA 3FHOA 4W63A 1TJ5A 4BO3A 3G82C 4KL8S 4WLEA 3TSWA 3VDMA 3ANSA 3C6QA 5IJAA 3KQPA 2XYVA 4Q24A 1YI8A 4IGFA 1JWLA 1M8PA 1ZDMA 2Y99A 3DOJA 2LW7A 2FZVA 4JJFA 1PG0A 5ILOA 4QAJA 2X0DA 1HGXA 2FUEA 1QH8B 3NYWA 4TROA 1PQPA 2ZJ2A 4YRFA 3K9CA 1J8VA 5ALXA 5DYIA 1P81A 3INNA 1XD8A 3LCCA 2HC9A 4QNMA 3SS8A 1K66A 3EN0A 5K8IA 3ORYA 3MYYA 2CHEA 2W6QA 2HDWA 3GLUA 3KFXA 3KU1A 4IJVA 2IBTA 2JIQA 2BLNA 1O58A 1GVHA 1PR9A 2X9NA 3QP9A 4NCAA 2SCUA 2JFVA 1JL3A 2VSXA 1OH7A 3R3XA 1PYGA 2JHAA 4ARZA 5F2NA 1UZNA 1XD2A 2ODQA 3AWIA 5EQTA 3T3DA 3LKVA 1ABEA 1YCDA 1IBCA 1P19A 4MEJA 1PSZA 1FBTA 5L3SB 2CXXA 1KMHA 3DNFA 3GI1A 1OLXA 3PFHA 5BSFA 1Z63A 4YMTA 1A71A 4IJ6A 3V3KA 4CG0A 4BVAA 3WFIA 2XTZA 2QVGA 1K88A 2H52A 1JKJA 5KJCA 3OQNA 2W11A 5CNJA 5TARA 5HCNA 3DFIA 4G36A 4FX5A 5DBHX 5CK4A 2UVPA 1VHDA 3QOWA 3WLRA 2EHDA 5E9JA 2AIRA 1HQDA 2PSSA 5TPWA 2FEMA 1FMTA 3HCRA 1RWMA 1S9DA 3DUFA 1GKUB 4IYRA 1JHDA 3AVUA 1ZXXA 1AB5A 3NHRA 2YWGA 4GUDA 4IY1A 4N01A 2QSJA 2G28A 4OYLA 1P7PA 2XT6A 4OQLA 2VA9A 3FB1A 1E6WA 2EU8A 3RGGA 1QB7A 2WPDA 2PL5A 3O9MA 3V2UA 2H5IA 1QQ5A 4CUKA 1NVUQ 5A5GA 3R4VA 3ANTA 3VISA 1VIVA 3CNHA 2V7VA 5CEEA 1GV1A 2VJBA 2IC5A 1C1XB 4D0NA 4F6LA 2YWEA 1UAAA 1J25A 3LQ4A 2XODA 4FYJA 2DSNA 2QM8A 4HFMA 2PR7A 3C8DA 5FWDA 4EIWA 4XRRA 1UXJA 3PEYA 5JZOA 1QIIA 3TLGB 2B4TO 3ZE6A 2PSEA 1W2GA 1X9GA 2PUEA 4N8EA 1R6TA 1T6BY 1EVJA 2QSZA 4Q82A 3K8OE 3VSDA 4NSNA 4AM8A 1K3FA 1QDEA 2V0NA 5AI8A 4B4VA 2WM3A 3C7CB 4ZEVA 2ZSKA 3LDUA 2IX9A 3ZVNA 1XTTA 5DHFA 5IKMA 3K71B 5HQJA 1O6ZA 4O25A 1W73A 3DXYA 2QRLA 3GUCA 4CG1A 1N3YA 1ADGA 4YAOA 2ILTA 4FFRA 5B53A 3PE6A 4FB4A 1YAJA 3K32A 1P1BA 2ZXFA 3NANA 4E51A 5KYGA 5LMCA 1MQSA 5DKFA 4Y6PA 3BGVA 1WMSA 4MLPA 4PYJA 2VSFA 3VKHA 5AW4A 5IAAA 2CDRA 2P8SA 3O26A 1EGHA 2A9KA 2RI6A 4RFSB 4QPPA 3C1OA 4EHAA 1BU5A 4QUBA 3QXSA 4MZDA 2IV2X 1JEDA 3ZXXA 3JASA 2AI3A 3MW8A 4RVSA 4NAHA 1OAKA 3CS3A 1V7CA 4E2ZA 3EDYA 2PFSA 4L8LA 1IAVA 1B0ZA 2QMZA 3PA8A 3QXHA 3S2IA 2F8SA 1E4OA 1ITZA 4ITVA 4OX9B 2W2VA 2WUGA 1G6OA 3O94A 1BJRE 5BQOA 3ZWQA 1AG9A 1JGTA 1SU4A 4GEGA 1QHNA 2ZETA 4B46A 4OI4A 2BKVA 2O4CA 4F3TA 1P2GA 3EQZA 4ONEA 4TUYA 2IODA 1QO7A 1ZA1A 4LXGA 3WC4A 4RHFA 1QE0A 1A5SB 2QLMA 1ODLA 3K0FA 1Z88A 2ZT6A 1TPYA 3JVDA 3OFJA 3AESB 3ORSA 4OQ4A 3D54D 4PZZA 4J3NA 3FGNA 2BC9A 4E2FA 4GO1A 4ADSG 1XMOB 1K6XA 3UW3A 2PQMA 1JR2A 4ZAYA 1JDPA 1UR5A 4EF5A 1UKZA 2GEKA 2PX6A 2X8LA 3EY9A 2BT4A 4KDCA 1PJCA 5JJLA 4MV8A 4M2LA 1H0RA 3EF1A 3KK0A 3WIEA 1QIGA 2R60A 1C4WA 3P9NA 4QDKA 2N46A 3I9NA 4RK6A 3K0EA 3D1LA 4Q03A 5BVHB 2O6LA 4LJ6A 4NFSA 1VB5A 3ST7A 3H3FA 1IJEA 1A7JA 2HIGA 1RXWA 1I7LA 2LCIA 3W04A 2P0YA 3K9NA 4YX9A 4NZNA 3ITKA 3PTAA 2P67A 1G6Q1 3WIBA 1UZMA 3AOGA 1PD1A 1YOVB 3K94A 2CXRA 2HUNA 4BTLA 5K4HA 2WU0A 3HI4A 3QYPA 5IAKA 5L7TA 4UHHA 5G3ZA 1YU9A 4TTAA 3TQIA 6REQB 3TKLA 1ZQ9A 2DFKB 3RSHA 1PX0A 4D02A 3PFKA 3UT0A 5HG0A 5JEDA 1RXIA 2MYTA 5CCEA 2CJWA 2AXPA 1OTXA 3UMYA 1QP7A 1SA0B 1OPXA 2I7TA 3GFRA 2QRJA 3SDSA 4KXFB 2QZJA 5FR1A 4X24A 3RSSA 1OFUA 1QGOA 4ZK2A 3F6EX 2Q5EA 3IDQA 3NP7A 1VM6A 5IC6A 2VEDA 4IDBA 4MW2A 4NECA 3AESA 3TB6A 1QANA 3GJ8A 4E94A 1ZR4A 2HMUA 1SQFA 1J90A 1SVIA 3EMDA 4CKYA 2H1FA 3OFND 1OXBB 5IARA 3ICWA 3JQRA 2ADOA 1I2MA 4JWTA 1DC4A 5DX8A 3T7DA 2VOEA 2GD6A 3LMKA 4PC1A 4UZFA 3G88A 1V2GA 1VI6A 1RQRA 3EIUA 3O5AA 3ANNA 4YIKA 1CRWG 3K0CC 4AF7A 3TVDA 2ZPAA 4QUEA 2J0EA 4G2TA 2VQDA 4BNFA 3RODA 1GNVA 3AH8A 2GD2A 2P65A 3E53A 3Q4GA 4KR0A 5TGZA 3F74A 1SQGA 3UPUA 4RF3A 5DP2A 3AFOA 4TV8B 4TKVB 4CLOB 3H13A 3WQQA 5IULC 3P2IA 3M2TA 1IZYA 3C39A 1ZL0A 3ZEIA 1T0IA 4LOKA 3FI0A 1R9MA 2PYIA 2C77A 3IMEA 4BO6A 4PWZA 1LB1B 1YXMA 4BO2A 1KJZA 1V7QA 3I76A 4M1EA 2WYVA 3COSA 5JCOA 3V6LA 4BLOA 3V97A 1PE0A 1TMOA 1UOQA 2ZS9A 2GVNA 3AW8A 1PWHA 4GOJA 5ECDA 3RK0A 4EY5A 4ARVA 5G1OA 4COOA 4UFPA 3BWYA 4ZD6A 5EVCA 2G1AA 1RLJA 1MQ9A 1OI2A 2G72A 5EWLA 3V4PB 4BLTA 4INZA 3SXUB 1O0SA 4ZV4A 4NVRA 4Q1BA 4D4KA 5K0NA 1DGQA 4Z9AA 3IBTA 5DM1A 3GHHA 2QUAA 3R44A 1WHTB 2AZXA 2XV1A 4DB4A 1ORVA 3Q8XB 3FZYA 221PA 1EFRA 2FFHA 2R44A 3P96A 4ZGGA 1T1IA 3ENKA 2OV2A 3PXEA 1P74A 3P9YA 1XRJA 4TVSA 4WBNA 3W5BA 4Z7OB 2ZGVA 2PTHA 3WS7A 5IT4A 4IF6A 1BU8A 4QHYA 3AERB 3LBAA 4NBVA 5BPFA 4JOBA 1XA3A 3PFNA 4NDAA 4XDZA 3U3KA 1TVKA 4NOJA 3SS9X 3L0YA 1X87A 5I7RA 2CVZA 3MGAA 1VI5A 4FE3A 2C2KA 1XVTA 3RIXA 3RSCA 4OJTA 4RVUA 4L4SA 4L85A 1JT2A 4YACA 1E92A 1EVLA 3GJ0A 5JYDA 4P9NA 4W5QA 2ACKA 2ZXUA 4INAA 2XMQA 3VKVA 3RVNA 3MWEB 2X40A 4HYQA 2C2OA 3K4HA 4MARA 3M0EA 4P3KA 4FSDA 4E4RA 1RMQA 1G63A 1ZC3A 3P5BA 1ODFA 1YZLA 5KNCD 3ZV3A 4OQPA 2DLCX 3DL4A 3EBPA 4BNXA 5BW5A 3VDXA 2LKDA 3CGGA 5KUTA 4DLUA 4LE1A 4Z4FA 1GPJA 4CCYA 4IHJF 1HG0A 1FNCA 1WXDA 4JI1B 2JKZA 1C7FA 1RI5A 5B6IA 1XZDA 3ABRB 4GD3Q 3WBBA 2YNMD 5GONF 1U31A 2J7KA 1FFEA 1CLUA 2GCPA 4ZCQA 2C5SA 3UCFA 5KNBA 1JS1X 3AKZA 4DLXA 2R8ZA 4NPCA 3F2VA 2HK8A 1R6UA 1T4DA 1U5BB 3A1WA 2JJMA 3KEMA 4PFQA 3PEEA 2JI8A 1Q0PA 3UHPA 3AVYA 4XTCS 3EDRA 1TTPB 1IWBB 3CLKA 3EXIA 4HNQA 4H17A 2WIJA 4Z99A 1J7KA 4FFSA 1GFZA 1RYDA 4J16C 4I9UA 4LZPA 5FCDA 2OAP1 5H9WA 2C5FA 4YQYA 4D9FA 1NW5A 1VGQA 4P0PB 2W2KA 2WIBA 1QE5A 2AL7A 3IGFA 3IMGA 1OW3B 2YQ5A 3DVRX 3IILA 1JLSA 2I3GA 1E9FA 5CT9A 4TL8A 2ZREA 1HQCA 3DZIA 3JX9A 1QHHB 3JWGA 4KE7A 2PRYA 5LLSA 5JC1A 1I01A 1E1QD 4QQFA 5AP9A 3OUUA 1XXHA 5KJ6A 2YFHA 4XQEA 2ROQA 2AFIE 3I04M 4H6VA 4I5GA 3AEXA 3KG2A 1SMKA 1NLMA 1W85B 3HG7A 1PGQA 4QOGA 3OF2A 4HAXA 4H0NA 1THMA 1G0OA 3O4GA 3O2QB 2BM1A 2QTAA 3GGCA 2QUKA 3PIRA 3MTEA 1NQTA 3ABQB 4WBNB 3IT3A 5IKPA 3OQIB 5KVVA 3SD7A 1GXSB 3U80A 3X2FA 2QRVA 5KCMA 3ZNQA 4HWRA 5L9AA 3S68A 1MO6A 3QQ5A 1UEXC 2WILA 1GR1A 2YHIA 1YJQA 5AW5A 2QGNA 1P7ZA 3MYRA 2WB4A 3PE3A 4ED9A 4ZKDA 1FFBA 1G8SA 4LJ9A 5F3DA 2JA1A 4AIIA 4KP7A 4CL0A 1ZLXA 4FYYA 3DFFA 4C1NA 2B7CA 1Q16A 1CZLA 4PZ0A 4IILA 5SYAA 1UKEA 2NZYA 3RWOA 3U7HB 1FE8A 1ONNA 2JIBA 3O8OB 1CHNA 2R2AA 1JHOA 2ZS8A 3WHIA 2MR5A 2OMKA 1X1BA 3HB9A 3R0XA 2B4AA 3SNHA 2AW3A 2EZUA 1H2AS 2I2WA 3VU8A 4J94A 3DEIA 1DS6A 1DKQA 5AW1A 3NIWA 4X97A 1EP2B 5GINE 5IM4F 2HGZA 4O29A 3FMPB 1JFVA 4OP3A 3RVRA 4HAZA 2W6OA 1NDHA 1KY2A 2NSJA 3VR6A 3IQEA 5KTMA 3RYFB 4P4GA 3CR3C 1B7GO 1S3SA 3JARA 5T3YA 5K3BA 5T5QA 3TQCA 1G5HA 2QMOA 4EUKA 3I2KA 1ECPA 2C7GA 3DP9A 4PG6A 1Q44A 1YB2A 5B7GA 3WKBA 1F06A 3IULA 3TE7A 1YZYA 4D0LB 4M1SA 4JP5A 2VEOA 5AUOB 2Q5JA 3OQHA 4MAMA 1WX1A 1QVAA 4J0JA 3KSMA 3N2IA 5CXUA 1G4UR 2BM8A 3ZJVA 4IS3A 5IXJA 4NCHA 4QXPA 4XI9A 1OYVA 5ALOA 4DDVA 5JAOA 2C58A 3GJRA 2BDEA 4AZ0A 3FJYA 4X0EA 1DE0A 1MABB 1R6AA 2ON6A 3AZOA 3PHHA 1A04A 3NHFA 4HQFA 4IVRA 4XLLA 5CP8A 1TKBA 4CV3A 1J0XO 1ZD9A 1IVYA 4RGVA 2ZUUA 1YRHA 2O3QA 4H7HA 3O3CA 4MLZA 5K45A 3QX8A 4AY6A 5HGXA 3FHCB 2CE2X 1IY2A 1H8ED 2IS2A 4RSHA 5LCXA 5A5FA 3LYAA 3T5AA 3GLIB 1JU4A 1E8NA 3N8GA 3WK6A 1SUFA 3N8IA 1QUFA 2WUFA 1EPUA 3N2EA 1GKYA 2WWXA 4IV8A 2CFSA 4NYJQ 3G7NA 2P2LA 3FF1A 2VWHA 3I9OA 3MXOA 3DDZX 2O1XA 5CYGA 4B5KA 5J1SB 2IYSA 4A8JA 1JRLA 3EH2A 4UPEA 5EHQA 4XWAA 2JFNA 5DHRA 4WZAE 2PRKA 3R7NA 1GNSA 4PHFA 3OCCA 5JS2A 1VPTA 5FTLA 3JATB 4N6OA 1NBOA 2NUPA 2YN2A 3JYQA 5JNSA 1SVOA 5CHEA 1RPTA 3U7RA 4H1VA 1MU0A 3KNZA 4R9NA 1AKQA 3JYNA 3UB3A 4Q66C 4BLWA 4PWYA 5ESWA 4OCZA 3WDLA 2XLCA 2BUCA 2Z4SA 1W93A 2A9JA 4WN9B 5G40A 5CFQA 2JLXA 4UM5A 3HKEA 3U4CA 4RELA 2BMVA 3F0TA 3GFPA 1HYEA 1KOGA 2QU8A 5EAIA 1H22A 2FJUA 1RBZA 4R1LA 2YXLA 1BDBA 3UO8B 5IAOA 2I1WA 4CQNA 1TQHA 2CYCA 3OE4A 5CR9A 1NFQA 3UYLA 1UDXA 3HSSA 5CVVA 4UNPA 4WFJA 5HM8A 3W5AA 3ITEA 4UBMA 4V3CA 1NQOA 3MCWA 1EE2A 1RTKA 3C8ZA 1WWKA 3HDYA 3LRXA 4HAIA 2EBUA 3AF3A 1GM5A 1T3LA 4MA0A 4YRDA 3WGGA 2X9VA 3IP3A 2J6IA 2P6NA 3WLHA 2XBMA 3DTVB 1M8KA 3IAM1 4B09A 4HNSA 5BR8B 4MUYA 4YA6A 1C4XA 5CYPA 1V1MB 3WSVA 4PAGA 4LQDA 2YOGA 4CF6A 4X6UA 2E48A 3F7MA 3CF4G 3UWSA 4TT3D 3G9TA 4C7MA 4JSRA 2XNKA 4RVNA 1J2TA 3K30A 1P2SA 4QVGA 4U00A 4UEOA 1A7AA 5L3RA 3ZYZA 3X1YA 4LNUB 1JJVA 1UAYA 4N6GA 4MJ3A 4XIFA 3H7IA 1PI3A 3KJHA 1Q74A 1XAIA 4Y9UA 4ZRNA 4ZHQB 5C7IO 4FIZA 4P32A 1EDZA 4FMCF 4X9XA 4MW5A 2PKYX 4D8UA 4ILEA 4W8GA 1ZNXA 1CF4A 2QJTA 3ZQJA 1G291 1GTZA 2GHRA 1FTQA 3BHJA 4TRMA 3W3AD 3HM2A 2W2OA 4MRPA 1XZEA 2CLIB 1Z38A 2AZ4A 3FVQA 1H3NA 5DHSA 1WHTA 2PGIA 1OJLA 4M9XA 5U4QA 4JLKA 4QKQA 4CMGA 4KR9A 4HDSB 1RADA 2XA2A 4HGQA 2WSBA 4TL7A 3F7OA 4R16A 2CJWB 4E0BA 1A97A 2FSGA 2C82A 2VF7A 3DL0A 1K8ZB 3LQYA 4I50B 5CH8A 3JTMA 5KQPA 3CWCA 1VP3A 3R6TA 1GPUA 2YDXA 3H1FA 4CFYA 5TGTA 2NNWB 1JE1A 4JCCA 1IJFA 1W4BA 2Q7OE 2LKCA 2BH2A 3H8SA 4BN4A 5E3IA 1C3LA 4ZZ1A 4EAAA 1NVKA 4FYVA 3V8MA 5EIAA 3B1FA 2R6ZA 3OE7A 2KLBA 1N92A 4KGXA 2AF4C 1KAMA 3BIWA 3X44A 2G9ZA 5IBCA 4KIJA 2WHRA 3U1VA 1ZVJA 5E9WA 5F1KA 1G16A 3LQQA 1JI0A 3I5MA 1G21B 1OX5A 3BGOS 2PGNA 3ZQ4A 3CEPB 1RNLA 3VR6H 2A8YA 3GCGA 4DWWA 2R1VB 4EA7A 4CLRA 2Y0BA 2G80A 1LQTA 3K09A 2AXNA 1NX6A 3OY7A 4UAGA 1CVRA 2YICA 4KWCA 2KMLA 3EIEA 1NXVA 4C88A 4CF5A 1RC8A 5KKAA 2XNDD 2I67A 3VTKA 3SC2B 3ZLJA 4J4HA 4OQXA 5KTOA 3Q8LA 3J81A 2VR1A 4NYJR 2GXSA 3DOEA 3EEFA 1Z7YA 3DLCA 3KUDA 2BPOA 3KUXA 3P0IA 2A30A 3TOZA 1E1RA 4NMXB 4D44A 4IIFA 2H0AA 4MX8A 4LKOA 4EGFA 4HLQB 4JLNA 1OWNA 5F5XA 3IFSA 1U7TA 4TLCA 5L6LB 4ENSA 4G5RA 1XKXA 3VH3A 3B3JA 3NYRA 1Z62A 5AOCA 4MUBA 1XL1A 4AL4A 3MD0A 3OH8A 4E5YA 1V39A 2XCRB 4R05A 1YRBA 1XVAA 3I61A 2R1TA 3IIJA 3V1UA 5AHRA 3IL2A 3SLKA 3THYB 1VSVA 3NEPX 2Q6OA 4JZYA 5INTA 1UF9A 2CV2A 3FMGA 1TVMA 1J8MF 1L6IA 1XZQA 4DVJA 3NTXA 4I3FA 5LQUA 1JE0A 2AB0A 4XX0A 3M6VA 4ID9A 2OENG 3RF7A 4KXMA 1Q1ZA 1T6YA 2QZSA 3H5RA 4PM4A 1K75A 5B1EA 2XQIA 3IR6A 1ZJ5A 1KBOA 1YT5A 2H57A 4HADA 5C8ZA 3QUCA 1H3EA 1MXFA 1JPVA 1JQBA 4HXFB 3CKMA 3FPSA 1SCDA 4GI5A 4S24A 3UFBA 4NZPA 3WZMA 5C5EA 3CLHA 2XKAA 3S8YA 5AVZA 3SS7X 4J43A 4UZEA 3NB0A 3L0CA 4Y0VA 4NULA 2WFAA 3VTAA 1JKJB 1REQA 2O2EA 3CB2A 4FW9A 4KXVA 3WIUA 3SJBA 5SYMA 4W6ZA 3ASUA 4TT3A 4CHGA 3KUCA 3GMDA 5CDUA 2K2QB 2IHYA 3ACDA 3WSTA 1FUKA 1YF3A 3M2PA 3O31A 1A9ZA 3NFYA 3N7TA 4K26A 3TOXA 1KMQA 1KRXA 4Y18A 1J0AA 2RH5A 2X15A 3VR3D 3JQBA 3AI3A 2FEXA 1LS1A 1GFSA 2DKOA 1DRWA 1FY2A 1H2HA 3FDZA 4U3JB 2XXAA 5CX1A 2WR8A 4EF6A 2HL6A 4H16A 3H5TA 1N6NA 1DV1A 1P4GA 4Y9RA 2CHVA 2PS0A 3AK4A 3PKZA 5KVCA 4QBGB 1D5CA 3E22A 4WA8A 2DCMA 3W5DA 4EKYA 1CSEE 1CJVC 2PKRA 2Z1MA 3AZQA 4HLUA 3WL7A 1Z15A 2GFQA 4WERA 3PNMA 5BWMA 1VQ1A 3JAWA 2DXIA 3AUSA 1C8VB 2RFLA 1Y7LA 3NBZC 4R8KA 3F6SA 3AR5A 4RD3A 4MPPA 1GG5A 4D99A 1NMEA 1TEHA 3MWEA 3K9HA 4LMAA 1AA9A 5A0TA 2FRVA 3O03A 3BM5A 3KO8A 3AUAA 5AKXA 5JXGA 1DC3A 3GK3A 3E35A 3HVKA 3LU1A 1V8PA 3M6AA 3PC6A 2P6OA 4M8SA 4Q3KA 5EMNA 2VYQA 3TR6A 4DCTA 4AS1A 4KKXB 2VPWA 1N3BA 5B4VA 2EDCA 2I78A 4L9WA 4D4GA 2D2VA 1TTQB 1V6SA 4G4SP 1HBJA 3FPJA 1GUAA 1Z5GA 1I24A 2PUWA 5EA2A 3SC4A 1HL7A 4KZPA 4X1IA 1IATA 3V1KA 3CWQA 1WNFA 2P9HA 5TX7A 4C21A 1J6UA 5K5EA 1SQ6A 2D5LA 3GRCA 3NHJA 4N65A 1WQ4A 3D43A 4NCJA 5I4BA 5JAZA 1VLJA 1Z0AA 4O0LA 2A0YA 3Q0EA 1DEAA 1FJXA 4R5HA 4FJ0A 2ISSD 3EPJA 2DY0A 3TQTA 4B3GA 3MAJA 4AG3A 3KLBA 1U2SA 1XYGA 1X8JA 4TS4A 4AN4A 2ZPTX 4M0KA 1QTQA 3K0SA 5KNDH 3KXLA 3UK7A 5BV7A 1UBHS 2EFEB 1DSSG 2H1CA 3HNPA 1ZZGA 3GL9A 4JDUA 3RTAA 1RRFA 3N5KA 2AC2A 4EUSA 5DW3A 1EFKA 3OZCA 4EMBA 1XCJA 3VYUB 2O8EB 4KLAA 3AV0B 5BN3B 1ACJA 3KQQA 4J7UA 2IEAA 3B38A 3BXEA 2A5GA 2A67A 2ZE7A 1GNQA 5LNK1 4WPGA 1ZMRA 5T67A 2HF8A 4HVAA 1HNZB 1E1YA 3KSUA 3AVPA 3M6LA 3ZCVA 1CEXA 1GFWA 2GXQA 2PUTA 1HYGA 1O89A 1SCKA 1QC5B 1VJ1A 3COVA 3QE3A 4LSMA 5SY6A 2OPBA 4YEDA 3PFBA 1MG0A 3A0UA 1O9GA 4M0FA 4R2KA 3X43A 2FZLA 2GYVA 1KJYA 4U2FA 4QU0A 1RYBA 1KMIY 2O0HA 2R1VA 2NZWA 3L6EA 3QVTA 1TI7A 4PLVA 1WCYA 5HF6A 3UMFA 2Y2UA 3IBGA 1C2TA 1YI1A 5IEBA 3T9DA 4I6GA 3NHLA 2JD1A 3N76A 5JMOA 1W34A 1JG3A 3TVYA 1SZJG 1NHWA 3RIHA 1F7VA 4US1R 4WZBE 2D3TA 1QIDA 2AG0A 3UMGA 1SBNE 4N4AA 2D0OB 4HD8A 4HGOA 1SHLA 1CE8A 2WD9A 2RARA 5DVZA 4JI6B 1R0BA 2VHVA 2WSLA 2ZI6A 5FOSA 1QTRA 3RGWS 2FPGA 3A4MA 3LM8A 3R7SA 5L40A 2G3YA 4Q02A 4ZV9A 1QIJA 5C31A 1N6KA 4EUNA 3IUSA 5EZYF 2HDNB 2W43A 3D4PA 1TUIA 2Y0EA 4XXHA 1CR1A 2FQXA 5AJZA 2QLBA 3GG9A 4OHPA 1HM5A 1POXA 1X7YA 2F48A 3KPJA 4F56A 4PG4A 1T3GA 2B4KA 1OI4A 3FFBA 2NTEA 1SUEA 2QZPA 3FUUA 4PRKA 3FNHA 3PYXA 3VAYA 1EUZA 2XZTA 2VAMA 2ZWPA 2NO5A 4MVCA 2QG4A 2WAXA 3NDJA 4R83A 4YWJA 2IWRA 3T38A 3UGKA 1YFZA 4JROA 5BT9A 3RT1A 5EMLA 4ZO8A 2XZOA 3MINB 3L07A 2R8RA 3QFSA 3BH7A 3JWJA 3AQIA 3OPNA 5C1IA 2WK1A 1JLRA 2X3UA 4A2WA 4QEDA 1YE8A 2NZ2A 3ZPXA 4DNFA 2YMPA 3HRKA 4Q18A 3LA6A 4DQ0A 2ZYWX 5HNKA 1N0VC 2IBMA 2GNOA 3I9LA 5LM3A 2VQFB 1U9CA 4YP9A 2XRZA 2Y1FA 1JW9B 4K05A 4A0HA 2W90A 1F8FA 1VXRA 4IXDA 1WPQA 3Q2IA 3U7IA 1JBQA 3HO6A 2Z3WA 2PSHA 2P0EA 2QZ9A 4LHZA 4XVRA 2W70A 1F8YA 1TECE 3G7UA 2Q9BA 3QLUA 4MQUA 4RHYA 3QSYA 3HQ4O 4PX2A 1Q14A 5F7ZA 2VDLB 3AW9A 3RHFA 3EYAA 1GUZA 5E3HA 1YQUA 1ZD3A 2EFYA 3LD9A 2PRJA 3G0BA 3PG5A 1DEKA 3LCRA 1IPFA 3A32A 2F8TA 3RASA 4ZCRA 4GGPA 3E5RA 3JZIA 4MCAA 4M99A 3T3MB 4F5DA 3MWFA 4P3OA 1IXZA 3A28A 4TWRA 1T3HA 1TVCA 5EHGA 3RVKA 4PG8A 3TR5A 3ONNA 4CDMA 2ZM6B 4ESHA 4O4IA 3C48A 4BVJA 2HQOA 3IAFA 4GE3A 4K9PA 5I8PA 3OCZA 3MHPA 4FHZA 4B6RA 1V48A 1RHMA 5EPUA 3PZBA 5DMHA 4MR8B 3QLTA 4PSKA 1XKTA 4X00A 3W8NA 3O84A 3IAAA 5AHKA 2YV4A 1MEOA 1QVWA 4XOIA 5HXAA 1ISIA 3FNBA 4LWZA 4KFUA 3AU9A 5JZ9A 1MT0A 2WKWA 2WP8J 2Q1XA 4AQYB 2IEZA 3PXGA 3SF8A 5JATA 1V1MA 1P4HA 3PFIA 2VDWB 1U1DA 1U7ZA 2LCQA 3QVJA 4ROSA 4QXQA 1ZINA 5EJIA 5B1IA 5TT0A 3TPFA 1JAHA 1USKA 1VA5A 4BNWA 1O95A 4DQUA 2EW1A 1FB5A 1M6EX 2GEBA 3EY4A 2H1RA 2LR0A 1HH4A 3LBYA 3N9IA 4IJWA 1BN7A 4WFKA 4E5DA 2QUZA 2QN8A 4ROTA 4WVFA 4Q01A 1XALA 3NDRA 2PBLA 4A0GA 5LIRA 2ZRDA 2AN3A 1MEEA 1RC0A 2X7HA 4QA9A 4DREA 5IZCA 2DWOA 3HJBA 621PA 2XWPA 2ZJFA 3M1LA 1L9KA 2HV8A 5FNVB 4D8XA 1I2BA 1QPZA 1KVQA 5KJEA 1H8HD 2Y1DA 1XVUA 4NJEA 1C7EA 2JK0A 4YBRA 5EN4A 3VI3B 2AN9A 4IQ8A 3A1EA 4Q7EA 1DUIA 4CI0B 4F84A 1U2GA 2YTZA 1QH1B 2Q5OA 1UKBA 5L3VA 3HM9A 4X41A 5JC8A 1DBWA 3R2JA 4PQEA 3VZRA 1YB6A 2GRAA 1QRAA 1FFXB 1ZK1A 2AZMA 2JFGA 1KJNA 1TT5B 1R5NA 3TMKA 4U2GA 3WK9A 1Z8NA 4A26A 4BNKA 4BUJA 1P5JA 4MUJA 4NQRA 5E6UA 3FOFC 2QX8A 3S55A 4NTZA 4W8OA 4HVLA 2ATCA 2JZNA 1TRKA 4I3GA 2W2QA 2D7DA 1RQ2A 4B6EA 1FFWA 2HA0A 3JVIA 3O7MA 5CA0A 4C5CA 3MTAA 5H70A 4MVWA 5LXTA 4WZBA 4ETMA 2QYOA 1B8OA 3QBTA 1UBCA 2PSDA 5J4VA 1KDRA 4FKBA 4R40A 1W75A 5A3SA 1E2MA 3DDOA 1E9SA 1SBQA 4BX0A 5JEEA 1SC1A 2XUFA 4XGKA 1HC7A 1RAHA 4WOPA 3U3XA 4PBTA 1N8KA 3PR2B 5BYAA 5HQTA 3QKWA 3M6MD 5J2UA 1TD9A 1I80A 2WWIA 4L6CA 4RV9A 4FFMA 2DHEA 3FUCA 2WSYB 2QEQA 1V9CA 2FWIA 3OPYI 1ZGZA 3IELA 3ZR4B 2FPGB 2O5RA 2RIRA 4MSUA 2D0PB 4DLBA 4DYHA 2AOVA 4I50A 4BQQA 3VNVA 1XTSA 4KGZA 4RV5A 5B2ZA 1L5KA 2WFLA 4CNBA 4EWLA 1LA2A 1OBCA 1WUJS 4O0MA 5JCPA 1MW8X 5DASA 1YB5A 1WR8A 4PTYA 2HPHA 2LTAA 2HFJA 4JBLA 2HA7A 4RNDB 2PL9A 1DG3A 3SG0A 3X1DA 3PE4A 4A5SA 2BGNA 2NUTB 4HRVA 3BE4A 3M3HA 4IOLA 2X41A 1E7MA 3RFFA 3RAEC 1Z33A 2ZJZA 3UV3A 4KHZA 4M86A 2ZM5A 2F1KA 2FW9A 1I0ZA 3BICA 3VYVA 1Q17A 3H2JA 4DHEA 2CHUA 3R3SA 5DBEX 5LOVA 4WK6A 3CVWA 4EFLA 2Z08A 2XB2A 2XRYA 4UCQA 2Z4TA 1NYLA 4DCVA 1XZPA 3DBHB 4RHTA 2ODPA 3PENA 4QECA 3VZQA 1ND5A 3JPYA 3AI2A 4KQ1A 1PR4A 3TD9A 2BSAA 1SCJA 4EG4A 3ZZUA 5ALYA 3QG1A 2Y76A 3T4PA 1ELOA 2P6RA 5DBIA 1BKYA 4V0NA 2FSIA 2QRUA 4KUGA 5C4MA 3D3WB 3A14A 2VN8A 4QPCA 5DEIA 1P2DA 1ZL2A 2ASEA 1TU3A 2OFWA 3DDHA 1MR3F 3I0MA 2KQUA 3Q3VA 4YGYA 1GPWB 3ZE0B 3R5TA 1Y6GA 1Y9AA 2JAHA 3JQAD 5I8ZA 1A9TA 2FKNA 1VHQA 5BT8A 4PO3X 3TZHA 3FZEA 2HBYA 2AC4A 4IGKA 1OD6A 4KI0A 3QE0A 3DP7A 5EEHA 3I4LA 1E1NA 2XB8A 4DOMA 2ZUBA 3GP3A 4HN4B 1E1DA 3B5JA 3BZUA 3Q2KA 1RXSA 1VFPA 3CBGA 3CWZA 3CY6A 4CV0A 1P7VA 1SVKA 1XMXA 4I1UA 1HLGA 3LYLA 2FUG6 2BGUA 2FI1A 3DF9A 3EW9A 4KEAA 3OA2A 2VPZA 4MKFA 4ZGBA 5A4IS 4OHYA 4IDAA 3PNQA 3UCEA 3LLCA 4KPUB 3IBYA 4MDFA 3BTUA 3OTQA 2E4YA 2H1VA 2HQBA 2J0VA 2R1ZA 2H08A 4N3CA 3TLCA 1I7DA 4UDXX 4LF5B 4M1QA 4IDFA 1DAKA 1QYIA 5TQJA 2GFHA 4WA7A 3RPEA 3T5CA 1ZW6A 2DWCA 4Z86A 4ZQCB 1JIKA 3SQMA 3P9KA 2B1GA 3SF8B 4XX0B 4F38A 2Z2YA 2VAWA 3U49A 3DHYA 3W79A 3A1DA 1UBNA 3U3OA 3DUWA 4G3XA 4KQCA 4O4LF 3PGKA 3RUCA 5HSGA 4LJ8A 4DV7B 2O8CB 2TMKA 1A9YA 1X19A 2Q6LA 3GLIA 1XSEA 2AZDA 1J07A 3E3AA 2CDAA 1RZRA 3D4IA 1FUIA 3O8BA 3EULA 4LYHA 1VZ3A 3NS7A 2QX4A 1F17A 1B6GA 1K7YA 5FTWA 3USES 3Q8KA 1DJQA 5KOYA 2BKUA 4KLNA 1GCAA 4JI0B 3F49S 1ZWKA 3KXKA 3TCKA 2FP3A 2C1XA 3BE6A 1C4OA 1XZAA 3HADA 4B80A 1CWUA 3BDAA 1I4WA 1UBRS 3SVTA 4FT2A 4KQIA 5KWIA 4LHYA 4UQOA 4YAIA 1LH0A 2RAUA 5JUWA 1LFDB 1R50A 1WG8A 1WMAA 5KMGA 1ZOIA 2C3OA 5LQCA 4AP5A 2GGSA 4S05A 5B2FA 1YRYE 1XN4A 4UE6A 2Z6VA 3SE0A 1E1KA 4IDNA 1LLDA 1B8NA 2CUZA 2GCOB 2X0FA 1K86A 3RT7A 4BNDB 3QLEA 1XRRA 1YCGA 1FDOA 3V5NA 2HRBA 1VPEA 4RQBA 1W0JD 3U4QB 5FOWA 1KTVA 1DDGA 5C8YA 2DUJA 1GTSA 4BWGA 1QVVA 2DF8A 1TVKB 2VO1A 4BDTA 4I36A 6GPBA 3FFWA 2BM9A 5DGXA 3WKDA 2EJTA 2JK1A 2BKXA 2EW8A 3DF7A 3U31A 1RCFA 2VJKA 3SHFA 4XR4A 1JT9A 2F3RA 3VR2A 1ATZA 5BUZA 3MELA 3QY9A 5IG2A 3C6BA 1AY0A 2VJAA 1FU8A 1SFRA 1W2HA 4FHFA 2RI1A 5JZMA 3HUTA 4IIEA 5DGTA 3NGXA 1XHLA 2C4NA 5IZ4A 2R6DA 4Z0PA 4HAWA 4BO5A 2ZZNA 2OFXA 3TQRA 3TGWA 2NMVA 4RGBA 4DQKA 4V3BA 4Z2YA 3O8NA 4AIRA 2H4JA 3BJIC 1ZMBA 1EA5A 5CGZA 4RPIA 1M1NA 2FMHA 4EA8A 1KQPA 1U9IC 3A31A 1THTA 3P0EA 1JDTA 5IU6A 2JI4A 4KXWA 1TCUA 2CDNA 2IPMA 2QXYA 2WIAA 1N6RA 2NO6A 3LHIA 4RSMA 1OA1A 1XU9A 1A27A 3M4NA 1FDRA 1P1RA 3C3JA 4O4JF 3NHUA 4XQGA 5EUMA 1IBRA 2POCA 3ETJA 3AB3A 3VO9A 4JKYA 3WL6A 1QC5A 1F9AA 3F4LA 3KKNA 4GRIA 1PK8A 1V96A 2IITA 4ZI7B 4NX2A 3L6DA 1DINA 2X0RA 3RIGA 1YA6A 2AUMA 1RP7A 1WS6A 4ISCA 1N1DA 3ESYA 3KKLA 3BGWA 4YJ2B 3RKSA 5AQ1A 4PYOA 1MJGA 4OJQA 2OZKA 3W5IA 2HA2A 1L7OA 5GWXA 2VTBA 1E9CA 2NXNA 2R4UA 4H7EA 2QL5A 4BB0A 3MWDB 2OGTA 2YZMA 5HTKA 3T52A 3NHYA 2V7TA 4P3XA 3PJDA 3KYCA 1G5RA 1X1RA 3E7WA 2LPMA 3ZIAD 5KHAA 1U7XA 3DE0X 1IRXA 4RK1A 1OT5A 2AV6A 3S7TA 3AQ4A 5CPFA 4RD6A 4MKGA 2JEOA 2WWRA 5DYYA 1AUOA 1QP8A 1CP3A 2WTAA 2R8OA 2WD8A 2OMEA 3TTWA 1TFRA 2EV9A 2ODTX 1GQRA 2Q4RA 1O57A 3ESAA 3I9KA 3A06A 2PS3A 3P4UA 5AXCA 1XRNA 4E6PA 4AY5A 3H3XA 1XNJA 5DF1A 2D1QA 3HP1A 4DCSA 2BFPA 4O2AA 3HXOA 1YFLA 4HZUA 1MJGM 1EBFA 3AF4A 3DL2A 3INRA 2GRUA 2HX1A 1TRHA 3MJSA 3AM4A 3DZJA 4OI1A 4P86A 4TUYB 5C8DA 5I9NA 1KSGA 4JV5B 4N3AA 3SY8A 1ZK3A 1D0VA 3FKQA 5FPPA 3S2UA 1GY8A 2Z5VA 2H63A 5A03A 1NT2A 2VZ0A 2FQQA 4ZVRA 3ENZA 2R86A 2QLNA 1F2DA 3JPWA 4HK4A 4HN9A 3MC1A 4UVEA 4IFBA 1XTPA 3H5IA 1U2ZA 2DHRA 2EKPA 2PT9A 2QXTA 3FBTA 3KJQA 3MFYA 3QY0A 3V8RA 4DY4A 4URXR 1AH2A 1SOUA 3QPDA 4JJZA 1OGYA 2QRHA 1K4MA 4P3YA 5F7OA 4O3MA 4MW4A 4PSUA 1IUOA 1SVUA 1KMCA 5EJAA 4ZAWA 5FULA 4UASA 3T7SA 3TLYA 3WYFA 4YRGA 2XCTB 1K8YB 1HFWA 4X7BA 3OCXA 2VP5A 1E4EA 3FPGA 4ZKEA 1NZJA 3TE6A 4FJ2A 4MB0A 4O59O 2B8NA 1I14A 5C37A 5L53A 3A1UA 2LZ0A 1QBGA 1MRSA 3N59A 1USGA 3FPHA 4LHWA 1UDRA 4QDTA 4U8GA 4R69A 1Q2XA 1HQKA 5D00A 1WP4A 1HOTA 4HDMB 1WZIA 3KJIA 2ZUDA 1UBEA 4CHTA 3H1GA 4MB6A 3DKKA 1GRNA 2ZJ1A 2MSLA 2PA0A 3TS1A 1CJSA 4NYMR 4F86A 3JAKB 2AOTB 3QV2A 5IEJA 2AK2A 2W00A 3QQPA 5BP7A 4G0MA 5JD3A 3NHBA 1XLVA 2NXCA 1R4MA 3PXUA 3SIXA 5BORA 4C4SA 4RDXA 5JI2E 2BKEA 1DBPA 2DH6A 1H5UA 2H4ZA 1CNEA 1GDDA 1H5QA 4TQUS 2Q07A 3W7VA 1DJMA 4F12A 5SZKB 1BCRA 1E2LA 2DRIA 3KZCA 4Z3DA 1DADA 1A4XA 4REOA 2O07A 1Y8ZA 1WTAA 2QKYA 4DGSA 2JC3A 3C3AA 4JN6B 3PXXA 3FYUB 4G9GA 4RKWA 1U2GC 2GDZA 2XD4A 2H54A 2HEIA 4XIGS 3RFCA 4EKGA 2HT6A 1KA9H 3NGLA 3P2YA 1Q0SA 4MR8A 2ZSAA 3M9XA 4BVEA 5MN5A 3VJRA 1BYUA 4P84A 3HP7A 2JAPA 1NW6A 4EATA 2GAFA 2FPOA 2V6IA 3WGJA 2HWUA 5FEUA 5KDOA 5JARA 1T2EA 1N36B 2DCUA 1CUAA 2Z2IA 5CDFE 1J49A 4JBYA 2ZUFA 1P9LA 3RU9A 3IRVA 2BGKA 3LF2A 3MB8A 4K7JA 2P79A 1N2SA 4EPVA 5I51A 3CJTA 2Q5LA 3C98A 1VMIA 3C0KA 1FDWA 3JXEA 3A10A 5ALPA 1V3VA 2DUWA 4YQEA 1IMJA 5AKLA 2B94A 4ND7A 4NCXA 3FCEA 2WYHA 4OJNA 1IQPA 3IUNA 4U63A 3ZCQA 3QIVA 3TQSA 3E27A 4J1QA 2XB9A 1X9IA 3DDSA 1SG0A 4M21A 3WY9A 2B8EA 4L6AA 4NXNB 1QQBA 3NEJA 3HWX1 1AMUA 4I55B 1ZIDA 1OKKA 3SBXA 4RMHA 2HTEA 4JNKA 2XZLA 1CDDA 5D85A 2VTDA 4HB3A 4I50F 1VA4A 3C4JA 4L0DA 2QE7A 3JSAA 3I34X 1JLLA 4IM7A 4DDMA 1OIVA 3AVWA 1VMDA 5JH7F 1GRQA 2A2ZA 3W9BA 5AMXA 4BU0A 2HMVA 4JUAA 2FW6A 2O2XA 1IC6A 2Z09A 1G2IA 4FEGA 4GL4A 5C7YA 4OGKA 3TN7A 1RU3A 1TGVA 4P2GA 4OHVA 4Z9FA 2NPIA 4RTNA 3SCZA 5BN5A 4JC5A 2G09A 3PEFA 3V34A 3ZHCA 2V7GA 5FEMA 3OJLA 1FPMA 5LSAA 4YHBA 5A4FS 4G4SO 2UKDA 4JEIA 3AMVA 2G82A 3NBMA 3EH1A 4V1CI 3E9QA 3D31A 3OT5A 1LKZA 4V0LA 1H2ZA 4U7TB 4UBKA 2XD9A 2QQ0A 1Q1EA 4F4CA 3BTOA 3P0HA 3NTQA 1OQAA 3OIGA 1EFHA 3G79A 3KQTA 4NI5A 5FA6A 4N47A 4GI7A 4LTMA 1Z4LA 2WPNA 3GZ4A 4ZT5A 5HJ2A 3W8RA 4BQOA 4OD0A 1TK9A 2JA2A 1QQTA 2VYVA 2GA8A 4LYAA 1U6IA 2Q21A 3I0ZA 3QKIA 5CA1A 2W6IA 3I30X 3LIPA 3LPAA 3BCSA 2O8DA 4RLFA 1J97A 2VJQA 4N40A 5DK6A 5E1MA 2EFJA 1C8KA 3GZJA 4AJNA 2R47A 5KU7A 3IODA 4R9SA 1XWWA 3O4JA 1GZ3A 3QGMA 4OFZA 3KSAC 1G0NA 1WPGA 4L5CA 4IIHA 5KI6A 1NXPA 4EI8A 4TLDA 3EWIA 2ISCA 4J8PA 4TZTA 4LECA 1RJ9A 5JS6A 1R0CA 2ZQZA 4PFSA 4LJYA 5AVSA 1W2WB 1HDOA 1W35A 2Z9DA 4L51A 3NM5A 4Z9BA 1WV1A 5JECA 4GS5A 2Y92A 1PVOA 4FJ1A 5I5GA 2ZYVX 3CO5A 4D6PA 4LQ4A 4FHCA 4E6EA 1TQDA 2G25A 1NQ5A 1JEYB 2IS1A 4MH0R 2G83A 5EE3A 4X61A 2VF2A 1UWCA 1KVTA 4KTTE 3N87A 2XT9A 3OKFA 1W0KD 5JR3A 2FG5A 1T4BA 2IVZA 2JIDA 3JR7A 2GK7A 2UZ0A 5K4AA 3SEZA 4YPVA 5HTOA 4A10A 3TG8A 3UJHA 2C9DA 3CGWA 1OX4A 1PFWA 1A8SA 1R9JA 1WDMA 3ZH9B 2OQIA 2HWWA 4OHWA 1SBHA 4IG4A 5MN4A 4KJZA 4TVKA 1G19A 4KO3S 3W6NA 2Z4RA 1R5OA 4OA8A 1R0YA 4PW0A 3SHQA 1V3QE 3OOEA 4EOGA 1WUIS 2JH3A 1HUQA 4TVBA 1ZNWA 5J43A 2NU9A 2DWPA 2ZUSA 3V8BA 1OWOA 4IWXA 1X1TA 1W6UA 1T4CA 2QLFA 5AK0A 2PTGA 3KT6A 4YMLA 4F11A 2ONKA 2ACVA 4OK3A 1E6CA 1R0RE 4IJUA 1N2JA 1SC4A 5JRZA 5F4ZA 1Z6PA 5U9CA 4P4TA 4UTPA 1GADO 4YJDA 4CTKA 3TKAA 2RAVA 2YJZA 4WN9A 1ZN7A 5FOTA 2ZJ4A 4BXOA 3IP5A 2P6MA 1IZ7A 1SUDA 2ZVJA 3LVRE 3HJHA 1QGUB 1T25A 2I3AA 1FQKA 2Y1GA 5ETJA 4XWGA 1QR6A 1ZH0A 2IV7A 1ODJA 4AC9A 4JGGA 4ETIA 2XE8A 3ADPA 3KP1A 4JIGA 1JIQA 521PA 1SVLA 5K3EA 3QKRB 3HDTA 3V4ZA 1N6LA 4ZTZB 2A4KA 4UNQA 4ZO4A 1NXXA 1DC7A 4W5WA 1NOJA 1F1BA 2VXBA 2C1ZA 4NS4A 4U0KA 1SIBE 5KTPA 3WV4A 2FMTA 1P62B 1Q95A 4X93A 5FF9A 3QBJA 4PYRA 2D4AA 2HSWA 2B9VA 3RKUA 1LSOA 2VJNA 5IW8A 1P45A 2VP9A 4KK3A 5EEGA 4YO8A 5KMGB 2ZRLA 3A2MA 4BQNA 2JANA 3AFHA 3JQEA 1NJ5A 3BGSA 4J7AA 2IUFA 2PMDA 1JG7A 3QSGA 3HEMA 1BWSA 1A3CA 1BMFA 4DLWA 3KQNA 2VSQA 5CH3A 1Y5MA 1XKLA 1KZ4A 4QBIA 4WJKB 2WM9B 3GRVA 2NU9B 3IQFA 2C2XA 5HZKA 4OP1A 2KE5A 2C2GA 2H51A 1QG0A 5GOZA 1O6CA 4X84A 3W2EA 1FZTA 1KJ8A 2PH3A 3CISA 3Q98A 3OFVA 3T12A 2D5BA 1HKUA 1SUBA 2JI9A 2WT9A 1RC1A 4RFVA 4UHDA 2MU1A 4RIIA 3CIOA 4Y9DA 4RLHA 1QLWA 2VPPA 2HU8A 5YASA 3CM0A 3GNLA 1JEYA 1D2CA 1FYFA 1KS9A 3LOUA 2G8LA 2CUTA 4JEUA 1A96A 3QJYA 3NETA 2R68A 2W0SA 2P75A 2WP0A 4NBLA 4GZ5A 3RARA 3B7WA 1RZRD 2WF8A 4L4UA 3CXUA 3D3QA 2WKRA 4BEVA 4L08A 4EB0A 3WAJA 3S1SA 1ZRMA 3VPGA 3M1AA 4A8HA 1UH5A 2XDQB 4Q1EA 4OF4A 2H2HA 2XUDA 4BC1A 1RMTA 2F55A 3O0DA 2I6FA 2F67A 3GDGA 3IPCA 4KK4A 4R2JA 1AGYA 1I7QB 1SXJD 3EHDA 3OT4A 1ZH2A 2DFLA 1NC3A 3L4JA 2I6SA 2OV1A 5CBPB 4LE0A 2Q2NA 4W1SA 4MW1A 5KNDA 1XPRA 1II9A 1CY8A 1JEQA 1W8DA 4RMGA 3RBAA 4NMMA 5GTDA 2XVAA 3ZNNA 3UW1A 4YRSA 3H4VA 1Z7EA 2GNAA 3EW7A 1QCDA 2J0SA 4MICA 3TCXB 1YS6A 1HZZA 2G71A 5C2JB 3QA3E 4TMFA 4CYMA 1XZNA 4EGQA 4B40A 1PFKA 2VH5R 1O94C 3ZNPA 3X3HA 3IQWA 1L3IA 1IBLB 2B6NA 1O95D 3MJDA 1QTNA 1BQ4A 3HZHA 4X63A 1YE3A 1ZVMA 2C3YA 1RXYA 4ITRC 5FHQA 1HK7A 3LSTA 3OAAD 4KWIA 1UM8A 2GM9A 3HLKA 5KTNA 1JZTA 4L9RA 4O4JB 5HKKD 3GN2A 1D1SA 2G1PA 3VUEA 5DNAA 1XMIA 4JXJA 1EUQA 3NU1A 3SC2A 3IPLA 3JQPA 4G24A 3AF6A 2PLAA 3EEOA 3HE3A 2FXIA 4PCLA 3RJZA 3FPAA 3A4IA 1T9HA 4DILA 4IMJB 1FFAA 3PJFA 5AVTA 3M4JA 4J4TA 4N0EA 2FX2A 1Y63A 3DAOA 2ZS7A 3IVCA 4B6GA 4UTOA 2AMFA 4CR7A 1RT9A 1ACLA 3B3QA 3PWZA 3R5JA 4CKBA 5HRUA 4LIPD 2L17A 2O1WA 1XV5A 2O3RA 3DH0A 2E4AA 1AK9A 1A2OA 3W3AA 3VR2D 7REQA 4F3CA 2XNCA 2GT1A 3A1TA 3TTXA 3GRKA 4XOUA 1QOZA 2FE1A 4CCSA 3H5WA 4MRSA 4OREX 2BF4A 2VBFA 3SMVA 2VPYA 3WSWA 1IU9A 5A4AA 3S7ZA 2ZWIA 4P3NA 3UPTA 1KL7A 4L8YA 3QIAA 1D2EA 3DEFA 1JG6A 2YJNA 1GITA 3BK1A 2VOJA 4DLRA 4EHBA 1Y4ZA 4KOEC 1NLFA 2FUCA 1MB2A 4WECA 2V6MA 4PLYA 3WGOA 3CEJA 3GVXA 4BJ6A 3EXHA 1T2DA 1MIOB 1LSJA 3NNSA 1RFLA 4I46A 2VXOA 2HEGA 2X2FA 4GLBA 2FMIA 5DDIP 4F04A 4CLDA 5B57C 2ZSJA 3DPSA 1T8TA 4G07A 4POAA 3S1AB 2ETVA 3DTYA 2VDNB 3SR3A 3IB3A 4BVFA 2MSDB 2V7BA 2MDTA 3I9JA 2GZMA 1JXOA 3G6KA 3O9VA 4NU6A 3V1NA 3EIHA 1P91A 1YHZA 2Q41A 2HCTA 3R3UA 1C14A 3LBHA 1IJBA 4WY2A 5EWMB 4A8PA 1CBUA 2RH8A 4AKTA 2K87A 3P27A 4KUHA 1C1DB 4YJHA 3ZE8A 4EK9A 5GQSA 3ZWXA 5JI3E 2IU4A 3GNTA 2FX5A 3OLQA 2Z2JA 5JZBA 1HMPA 3O3NB 5JU6A 1P5HA 3R5KA 3O3OB 1EXVA 2BZGA 1HORA 2PAFA 2Q3BA 1GCGA 2R8XA 2WJIA 3FIUA 4FCTA 4K6MA 4PV7A 3GPBA 2BEVB 1TZKA 1BX1A 2A5LA 2XXAB 2NSLA 1T4MA 2JH9A 4IVPA 1WMDA 3M33A 1YZUA 1TMYA 5A02A 3SN6A 1T1EA 3G8YA 1QH9A 4LXYA 3R9IA 2CB9A 4MA4A 4W5OA 4UAJA 2WJYA 3LP6A 4O2BF 3ZHQA 3UC9A 3RK4A 5JFGA 1ND6A 4O4LA 3MSXA 3SDZA 3L8YA 1JDSA 3S0JA 3BE8A 1K6EA 3FW1A 1JB1A 2XNSA 2ZQ5A 3QLVC 5HX7A 1XDDA 2QTLA 3JQ8A 4E2WA 5ALWA 1TZMA 4W9MC 2XUIA 1TPZA 3DMTC 5LA6A 3WLFA 5F23A 3Q7QA 4QPZA 1T10A 5FO0A 4IZOA 1JG4A 2XMGA 1UWKA 4GMFA 5K99A 3ET5A 3HXQA 3UBMA 5JH7A 1T34A 3LVQE 5K4GA 2AGVA 2F9LA 3PWSA 3SXUA 3ZU2A 5EIBD 4G0VA 4CKEA 3FTCA 4YREA 2REQA 1ORIA 3A4NA 1PQYA 4AP6A 4BUCA 3KPVA 1Z2DA 2WNHA 4JLOA 1ATIA 2BI4A 5A4MS 3EX7C 4XEUA 1CQPA 3GA0A 5BUQA 3CG0A 4PLCA 2NVUB 4B4WA 1LSUA 4PQGA 4Z9XA 3INYA 3TLKA 2FQ1A 1K92A 2ZW9A 3I01M 3W4IA 4F2GA 4OQZA 4X8HA 3ELUA 4R71A 3M3DA 3KZKA 2Q8QA 3IDOA 2JASA 2AT1A 1AQ6A 3KYIB 4RVDA 5AJWA 5D5HA 1NMQA 1ULZA 2O2GA 4KUEA 3VR1A 4DBLE 5AQEA 1ISFA 3PNOA 5FBKA 3SKXA 4HNUA 1LFAA 3EPRA 3CUYA 4HDRB 3STVA 5I7FA 2CLHB 2G08A 1A72A 4MV5A 5KYVA 4HDCA 4NMWA 1M6VA 5DOZA 5FTKA 4MQFA 4CR6A 1SQ0A 2Q8PA 2TS1A 3TDMA 5CIWA 4RF2A 1EBUA 2OHJA 3AHCA 1PUIA 3BRWD 4HRXA 3WGLA 2WM8A 4FFWA 2DERA 4QBHA 3FHJA 2PL1A 4H18A 2FWBA 1QXSA 2XUPA 4LVUA 3W2FA 2XZDA 5J5CA 2CVFA 4K9RA 2OYRA 3RFTA 1J1IA 5THKA 5HRAA 3OLZA 4N76A 4JB8A 4S04A 2IT1A 4ZC8A 4W7IA 4PZYA 2ZB2A 2IEBA 1G21A 3LUFA 4MWDA 4QDJA 4G97A 2GSWA 2G06A 1X13A 2YV1A 1OZGA 1C9KA 1WNTA 1XXLA 3ESRA 3N0TA 4GMHA 4X6YA 4XB1A 3TJZA 4B73A 4LFAB 3ADKA 3H42B 2ZVDA 4PAQA 3OMLA 4KWHA 3UV6A 2WFZA 4KOAA 2VCYA 4WXHA 4EVSA 4BV8A 2IYVA 3OQIA 4M22A 2BTQA 1YBAA 1PFYA 2C7VA 4HH0A 3HXMA 3CNQS 2P6PA 8AT1A 1ZONA 1U0NA 4C20A 3WYDA 3VKFA 5KNLA 2W8ZA 2V55B 3L0IB 3CSSA 1Z4OA 3GGPA 4NPAA 4U39A 1VE1A 2PPLA 3GJXC 3RBXA 4Q9AA 4C14A 2HCRA 4WFQA 4DR6B 2N9UA 1I5EA 2HMSA 5AYVA 5ESXA 5AIAA 3MAGA 5GV8A 3OFSA 1EDOA 4HI0E 1IONA 1JV2B 3MJFA 3FNEA 4P22A 3DBRB 1U3UA 2ZYHA 3OHPA 4PZDA 1PWXA 2GM3A 3H11B 3PIDA 1OWLA 3RIMA 1MX9A 4E3WA 4TOIA 3ICEA 3J80A 4C7BA 2SNIE 1BWQA 1OIXA 1WABA 1BCSB 3IIEA 3D1VA 3W9UA 4DVGA 1YGPA 2BHSA 2ZIGA 3I28A 3ZXYA 5BXQC 1N2HA 5CVDA 2RGBA 3BRCA 3C74A 1UXOA 3I32A 3PRKE 2JW5A 1QG6A 3BEOA 1R1DA 3FDZB 4HDQB 2J9RA 4EBFA 2ECPA 4EQ6B 4CG2A 4ECEA 5HZMA 3C3CA 3OZEA 4RZXA 5ICGA 1ZGJA 1TUGA 1UJ4A 5A0VA 1BJKA 1E3TA 1FK8A 2PYZA 3UMSA 3QRWA 5AWFC 1XVLA 2JCSA 3WK8A 1RWVA 2AUTA 4QXMA 3AUYA 2DT8A 2O3SA 1U6KA 3ECAA 2EJVA 2GZDA 4QREA 5ALRA 3MJTA 4K3UA 3DR3A 4U4AA 4XM2A 3A2KA 2B5WA 2C5EA 2QLTA 1YIDA 4C2AA 3CZPA 1ZVQA 1L7PA 2SICE 4GQAA 3PJEA 4DYVA 2AEEA 1LBIA 3F71A 1L5GB 2FLKA 4G41A 4HWPA 1O3YA 4HH3C 1QSGA 1ZMXA 4NBTA 4YCDA 4XM1A 1VCMA 2ZU0C 3ICVA 5T8KA 4F06A 1XNQB 5JTUA 1U0GA 2HSGA 3RG2A 3IXQA 3D02A 2C9BA 2A6PA 1VCHA 1UZUA 1Y3BE 2RGDA 3H0CA 1OC2A 4RFLA 1GAQA 2JIMA 4FGSA 1DPFA 4MGYR 2F4NA 1RVDA 3WISA 3NPMA 1TW3A 4N18A 3V1TC 4YQFA 1XCBA 2AD1A 4GM1A 3ZWDA 4JNCA 4C0BA 5HE9A 5FLYA 3Q12A 1NI3A 1R2QA 2VH1A 3RJ9A 2P9EA 4FWIB 5E8JA 1H6AA 1VG1A 3P9QA 3SZGA 5T4BA 2YR0A 1KR5A 4MWBA 1DU4A 3C87A 2WF6A 3NAGA 3RJTA 2YY7A 4HGNA 3SZ3A 3TI9A 1ENOA 1D07A 3C3DA 1Y1KE 1Z82A 3CRVA 4FI3C 4HC4A 3WKEA 5BMVB 1PJRA 2BGLA 3PD7A 5LP6C 4MDEA 1V8DA 1HNWB 4C0JA 5DTJA 4U9HS 1BAPA 2FXVA 1H1LB 1U11A 2HLNA 3A4VA 3HB4X 1EP3B 4UU1A 3I42A 1OXUA 5IYZF 4NRDA 2WSMA 4F7DA 1FIUA 1N5MA 5E7IA 3SQNA 3R5HA 3R1IA 1S1CA 2MINA 4GC9A 4Z7JA 5ENZA 1PR3A 4GKBA 4EARA 5KYTA 5LD2C 1GN8A 4YP0A 4YI3A 3BD7A 3R5XA 1UFQA 4BCBA 1D2GA 3CLVA 3L8FA 2F43B 3UB2A 1M6NA 4V02A 2NPFA 3K9BA 1GO2A 1ESEA 5KZMB 5MGBA 1IK4A 1Q0ZA 3CJRA 3CXRA 4FHEA 1Z4MA 1OROA 1P1FA 1EFVB 2N47A 4KO4S 3UAOA 4OBEA 2J4CA 3DGEC 4YS6A 3OU6A 3UTCA 4F4HA 4R1OA 1Q3TA 2YFQA 5C18A 1DEHA 2DQSA 2ZVPX 1XD2B 4P31A 1EM6A 3RROA 1Z3IX 1M83A 5BUCA 3IJRA 2OXIA 1T2CA 5H68A 4JFAA 2F17A 1Y8QA 1DZIA 3OP4A 1HOXA 3QEMB 2J46A 1PNVA 2VJCA 2AF3C 4UBNA 1AKNA 3WIOA 4PX9A 4C4TA 4I5FA 5GM2A 1YQEA 1GNTA 1L5FA 2C94A 2XTMA 3BRQA 3C3XA 1NN5A 3GUVA 4DQXA 1V45E 4GRAA 5KEIA 1F5NA 1GZDA 1JQDA 3GLSA 2LE0A 1ZR2A 1Y42X 3ZD8A 2J09A 4CDRA 3GLGE 2NN3C 5HFJA 1KQNA 2X8AA 4M9SA 2LCFA 1S01A 1ZICA 3EC2A 4HAYA 5JSYA 3Q3HA 2K7ZA 1KDZA 5M04A 4ALKA 5K6RA 2XR1A 1JYEA 2VHTA 1NUQA 5J2UB 1X1CA 2CJXA 4PPYA 4AUKA 3A4TA 1MLDA 1WTCA 3NRBA 3NWJA 3Q2OA 2PM8A 2IXBA 5CHYA 2OAGA 3I3OA 4J1SA 4PICA 3DBIA 2QMQA 2AK3A 3G13A 4C0AC 1T2FA 1II0A 1T15A 4QYWA 5LQMA 5JCJA 1YB1A 4IXNA 3VJMA 4BFVA 4ZC1A 4DT1B 1UPCA 3ZHBA 3R9XA 1QR2A 4UJ3A 3W4KA 2QD1A 1BVRA 5EHIA 5SZIA 2WVJA 2AE1A 2OP0A 1L8LA 4JUBA 4TGLA 4AJ4A 5IXSA 4DR1B 4MUEA 1OLSA 3DTVA 2XITA 2Q2OA 5LQSA 4EB3A 2PUAA 3UJAA 2PL3A 4YMWA 2C5LA 4P33A 3MBOA 1YQQA 1WXFA 1PT7A 5BSUA 3JQ8B 2CE7A 3RU7A 2SKEA 2YXEA 3UWKA 1CT9A 3AG6A 5F1OA 1XZLA 1LD3A 1W19A 1AF4A 5AI9A 3VR5D 3QWAA 4RK4A 1C1HA 1D2NA 2G9RA 1LS6A 1E9RA 4LS3A 4PSAA 1A88A 1HSOA 1O87A 4KQHA 5JPIA 3LCVB 3IIMA 4F4FA 1SZCA 2JFXA 3IOEA 4W5JA 2D13A 4EJ0A 1ZC4A 5BSHA 4KYTA 4ZU1X 2Z6AA 3A05A 4NCBA 3UK2A 4O8CA 2D2IA 5IH7A 1E59A 2HCJB 5E4FA 1QHHA 4ZAXA 4C3VA 1PNRA 3LG2A 4YDSA 2XOKD 4N41A 2N0SA 3FFTA 1FSZA 2CVHA 5L7YA 3AVTA 3LOPA 3RYCB 5EJ8A 3HY4A 2H8GA 4RK7A 2JIZD 3SIWA 1CDZA 3BIOA 3C45A 3E9YA 4GOKA 2XOEA 3B2QA 3WOHA 4JA2A 1SXJC 3OTIA 2I2BA 1E2IA 2GAAA 3KKOA 5BQPA 3LFUA 4HY3A 2XWBF 3D6HA 1OREA 1G5QA 4I5DA 4WOKA 5CJ2A 3NO4A 2C3UA 2GTHA 1OXMA 1IPEA 1N6PA 1UMDB 1GGNA 4D98A 1P72A 3OQJA 4FR2A 4NJMB 4JLPA 2A9VA 4D7AA 1ZGBA 3WG9A 5KWEA 1YUBA 2GRJA 3SK0A 2IYOA 4MP6A 1GZHB 4QFMA 1AQNA 1DRKA 4DR7B 1US8A 4Q3NA 4QNRA 3MWJA 1X15A 3TK1A 1IDOA 3AU8A 3M6WA 4TV9B 2ZRAA 4L6IA 4CLHA 3KZVA 1I51A 5T4HA 3BFXA 4ZOLF 5JO0A 5LD2B 2WYWA 1V5GA 4JZKA 3PR3A 1NIPA 3K09C 4DXDA 4CLEA 5E3JA 3WP1B 1AKEA 1E3EA 1ONBA 1PJZA 1K3TA 4UXJA 3KOMA 5ELXA 2MYNA 1SUSA 3A2LA 1RMYA 4HYTA 3QWIA 3PCRB 1NGSA 5ICCA 3TLJA 1RZUA 3F5MA 1SKYB 5KTKA 1DQYA 1F0YA 1TZJA 2O06A 2Q3JA 2TRSB 3WMEA 1NTRA 4B6SA 4JU8A 1ORTA 5AM1A 5CLQA 5G1NA 5L6MB 4Y0AA 4BIMA 4TLLB 2POQX 1K97A 4DG8A 3RYFA 4TXLA 1TA9A 1VJ5A 4LC1A 5EWMA 1CZNA 2E49A 3F9RA 2GO1A 4W4TA 4A27A 4AWXA 1AS0A 3HCNA 3F46A 4N7RA 4Y2TA 5ER6A 3DQQA 5IT5A 3IA7A 2K4MA 3IEUA 5C4IA 4J1NA 2RGYA 1WM1A 1VSQA 2D1TA 3HY6A 3HSKA 3ROEA 2BRUC 2GH1A 1AV7A 5FHRA 1T24A 4RETA 4Y98A 1KIMA 1FQJA 2FR8A 2G5GX 3GLHE 4NS1A 2F3TA 4BV2A 1GA6A 1OBVA 4DSOA 1K68A 4TV9A 1HNXB 5BSKA 1SXPA 3S27A 4M88A 4HP8A 3A2NA 4NL4H 3GLTA 1I6LA 1OTYA 2QUBA 3HJRA 3RDPA 3WLOA 2UV8A 2I9KA 3GEBA 3I73A 4W9NA 3BKWA 1QHXA 4F8EA 3HSYA 2X9QA 1SVNA 5CRIA 3ROFA 2DP4E 4GLLA 5AIBA 3S81A 1P4SA 5TMBA 1IVSA 1K3UB 2XJ9A 1RJDA 2Z30A 2ZTVA 3RR2A 4C4RA 2ZTLA 1C7ZA 4QLOA 1OTHA 3CE6A 4D3ZA 2PD3A 4Q9HA 1JR3A 5LKAA 3GCXA 3GXOA 3IUYA 4UCFA 3MWKA 2BD0A 2ATXA 3KSDO 1UMDA 2IS6A 4PX5A 4WIAA 4KAAA 2J7PD 3UJBA 1GTVA 1ZHFA 2PX0A 4K8OA 4OGGA 1THZA 3W0LB 4EAQA 5ARBA 4NZMA 3AT1A 3AUFA 1YTLA 2EFHB 3UWPA 1LPPA 1W4CA 2E18A 1SCQA 3C8UA 3I9FA 5LZ9A 5A06A 5DM70 1W85A 5A9TA 1H2EA 1O7JA 3VV2A 1KAQA 3UJDA 4DA6A 1E18A 3V32A 4EPYA 4QM6A 2J33A 4RKQA 8GPBA 4JASB 5AVUA 4EYKA 1Z8FA 3E2MA 3MT8A 2IOFK 3I2YX 4FI3F 2BTQB 3MJVA 4NOKA 2Z04A 4UTZA 1E5QA 5NLLA 4ZT7A 5A0FA 1AQLA 4ER3A 3L4BA 3QOYA 3LT4A 1W4ZA 1T2AA 1BROA 1P7WA 3O1HB 4IQGA 4S3MA 2QHXA 1OYWA 2VZLA 1RHKA 1EUDA 1HYHA 3CRW1 5TQ2B 5FBVB 1YJBA 1XB2A 1P8JA 3F3MA 3KJNA 4OMCA 3VPSA 4DDWA 3OKPA 2AS0A 3NIBA 4Y67A 2B99A 3N8DA 1M6VB 3KVOA 2OHIA 1IEXA 2VLBA 2JFHA 4RXMA 4URYR 4AVYA 4MKXA 5E7MA 2AQHA 3STHA 1P39A 3BWVA 3HGQA 1A50B 1VIMA 3G7SA 3H11A 3O7WA 3V7UA 4LFBB 4IEEA 1LF0A 2ZI7A 2VRCA 1G6HA 4BO4A 1D9XA 5AM0A 2ZWVA 2L18A 1Z0SA 2RHJA 3CB4A 1JILA 4JQSA 2VNSA 1DIHA 2C1EA 3KPUA 3NT2A 1PUXA 2IHTA 1IWPB 2M98A 2V5VA 4C4AA 4UTRA 2XMZA 5LUBA 1QDLB 1DCMA 4GZLA 2HHHB 1AKVA 3ZY3A 3PHLA 4L4XA 1AKRA 1ODIA 2PX2A 4X1YB 5BN4A 1B3BA 2H9IA 2J1LA 3IB6A 1BD3A 3O1JC 5DX0A 4S1PA 4JY7A 3L8MA 4DRZA 4UUQA 1TOAA 2ES4A 3INTA 2EWVA 3G2NA 4R8LA 5E8RA 3WK5A 5CDTA 1XYYA 1IXRC 2HU5A 1QYXA 4JXKA 1TNDA 5BW8A 4BLQA 4BDSA 2E6KA 3TQFA 1M0EA 3DOOA 3VU1A 4QSMA 3OZ7A 2Q62A 3ITDA 1PK9A 1GPNA 3LECA 1XTIA 2MSEB 1TUEA 3BXFA 4G1FA 4ZI2A 1JJ7A 1KH2A 4DE5A 5JBNA 2WMNB 3O6VA 3FKJA 1QO0A 1RBYA 1QM5A 2W6JD 4DCJA 5BWCA 2HWKA 3ZXSA 4EPRA 5LUAA 1XRSB 4OGLA 3BJMA 3M9WA 1P9OA 3H9QA 5AUNB 1LY1A 5HJ7A 3H2ZA 1KSFX 2D0DA 2BEKA 3BMQB 3F6BX 1UPXA 4UOQA 5T4FA 5K7SA 2YINC 2YN0A 4HB2A 3HR8A 5D8DA 4YLYA 1XC7A 1KQOA 3SYLA 2C57A 1QLJA 1JECA 2XX3A 4PBSA 3FOBA 5MN6A 3DS8A 3O2JA 4HRYA 3TJRA 4C76A 2XYGA 2JJQA 4QLAA 3V4FA 3NHZA 3OM9A 4MVYA 2FN4A 3UGJA 2V5UA 5B1HA 4MP3A 1TO1E 1LEHA 2D1YA 2INGX 3IEKA 4ZVTA 1C3VA 4G4IA 1F9EA 4RFSA 3TWOA 2XQVA 5AVYA 3EGVA 1KZ7B 1NZFA 1M2VB 2HBZA 3SZMA 2C83A 2VDVE 3CNBA 2UAGA 4ZOEA 5LQAA 2PT7A 5EHZA 2ISQA 4LRTB 3I9V1 5GJCA 1WSAA 1R6BX 3PEVA 2D54A 1Y1RA 2H11A 2XIJA 4KQWA 5A7GA 3UANA 1CJKC 1YZQA 4HUJA 4WY8A 5E9QA 5EQFA 3ZE7A 1YQXA 1IULA 3QXJA 5KIAA 4G0XA 4HWKA 4XPIA 2COUA 1DAMA 2FFQA 4ND5A 4IRXA 3TXAA 4E15A 1CZOA 4FYIA 4F8YA 2LGJA 4EKIA 5AKYA 1FTNA 1GSIA 4KAXA 3O91A 5K8TA 1EEHA 1JF8A 4X66B 2WTNA 4YAGA 3AGPA 3LUBA 4N5DA 3MINA 1QCYA 1Z73A 2RKOA 2UVQA 5K8JB 4LI3X 1XZHA 3BMQA 3QA9A 1HNNA 1DWPA 4GXTA 3BRWA 4MV9A 4ZQGA 4WT7A 1QHEA 2XGOA 4Z1MD 4ZV7A 4Z4CA 1JTVA 3LFTA 2XUQA 5C46F 3IAUA 2OBFA 4WINA 5IT9A 4LF6B 4UZSA 1O97C 2Q5IA 4PCVA 5BQ3A 2LUOA 3WGNA 2V3VA 3OICA 1T5SA 4C2BA 4CMAA 1UWLA 1OYOA 1P29A 2QI9C 1HR0B 2PWPA 2O8DB 2VK1A 4CCWA 3GRFA 5TSDA 5CLFA 2XYHA 4RADA 1TKAA 1ZPDA 5TIIA 4BNVA 3RS7A 3HKBA 3E8MA 3FFAA 5ED4A 4H31A 4JELA 1L3BA 1D09A 4Q9IA 5G0WA 4Q34A 3L1UA 2C92A 2HRQA 2SECE 3V42A 2V6FA 3SGLA 3C97A 3MJHA 3H9EO 2ZR7A 1T6NA 1J1ZA 1II8B 4NQZA 5JS1A 3EFHA 3UK0A 4Q1VA 4DXAA 2DHCA 1CJBA 1SHUX 2IA5A 3C8HA 3NBUA 2QJFA 3TZEA 4C07A 3AP3A 4R41A 1WW2A 1LTQA 4G5GA 3CTPA 4DLVA 2G4CA 5D84A 4YR9A 1KC1A 1LDEA 1YBVA 4UMVA 1DFHA 1EQAA 2C4TA 5ERXA 3C7DB 3BMCA 3E9EA 5G02A 4PGFA 3THYA 3SI7A 1R37A 2M6SA 4FYKA 4NJOA 2Y1CA 3QPWA 1ZD8A 1Z4IA 2HNBA 4GECA 2XYRA 4JT9A 3UOWA 3HZRA 5JYEA 2I6TA 4OO3A 3LW8A 1FJHA 4HWTA 4LJ7A 1H65A 3MVEA 3I5YA 3FVWA 3B52X 3LUHA 4WCVA 3T3NA 4MUNA 3O92A 4X1KB 5IKEA 4D81A 2I62A 3W1WA 5L8VA 2XB6A 3K92A 2V0GA 1NM5C 1L7QA 2PZLA 5KYYB 4MEAA 2J32A 4BJ3A 4IBOA 5I7SA 3ZGZA 2GWRA 5SZHB 4D82A 4MINA 4F2WA 5KHLB 2HXSA 3OPVA 4FB5A 1NVDA 3A1NA 2HYDA 1JQLB 2GEJA 5GIPE 3NTVA 4EYEA 2NTVA 2IQ5A 3WZLA 4E5NA 1LW6E 2GZAA 3HA3A 1U1GA 3UGTA 1YIAA 2JFWA 3QK7A 3W2HA 5KOJB 4JYBA 4D6YA 2XUAA 4RF4A 5KPJA 2RAFA 1KYYA 4B6PA 1O54A 5JADA 1T9BA 1QOQB 1SJ9A 3L9XA 3HL4A 4AJLA 4ACAA 5ALEA 3MXTA 1D6MA 2AQKA 5FRDA 3MOGA 2AVNA 2IELA 1QFYA 3L7NA 1UBOS 4YASA 1I3NA 3CPEA 1VGRA 4IIVA 3DR5A 1KYZA 1QHIA 1UPFA 3KU4A 3RC3A 4AZWA 1RQGA 3H4MA 1NRXA 4R2XA 4RVOA 2E7ZA 3ZDRA 4JYZA 1FC0A 1JHYA 4KB5A 1FTGA 1O0CA 2GHTA 1DX6A 4C4OA 1DTSA 1EXDA 3QUTA 4GR4A 4YV7A 4DJJA 5EC8A 4E7OA 2JLQA 1BN6A 2DBYA 3QJ5A 2CLEB 2XUKA 2JCGA 3A3NA 1RFGE 4LRWA 3KKQA 2QMHA 2ZR8A 2NT4A 2N75A 3AJ9A 3WGQA 3ZLUA 3ONDA 2QB5A 4WZAB 4NABA 5AESA 4BNYA 4LOJA 2BR5A 3LDAA 3PKJA 4GT1A 3KVRA 1LBSA 4LVNA 4IIJB 2R2GA 2QNRA 2ZSBA 3IT1A 4CR8A 2R96A 4J07A 2BBSA 1L7NA 1HE1C 1ZOLA 2OLEA 1ODSA 2B4QA 3DKIA 4IIUA 3HKEB 3HVRA 1KAHA 1NSYA 3OF3A 4FVTA 4G5YA 3RCBA 3SVZA 3K0CA 1RM3A 4IFIA 4AF8A 4ALJA 5KNBD 3GC6A 2PXAA 1U9YA 2YVQA 4LQLA 3T7EA 2FZEA 3OO0A 3UEOA 3N75A 3GWZA 1NP3A 2B30A 1QZTA 2IP1A 1GL3A 3C8MA 2CV1A 5TPZA 4ZT2A 4LMBA 5DM60 2I1VB 4RHUA 3WJ1A 4OHBA 1CY6A 4KREA 2AXEA 4TV8A 2DKNA 2H3HA 1RKUA 1VLMA 2IH5A 3KQLA 4S12A 3GJYA 3KZMA 5JH7B 3FN4A 2PMEA 3O74A 3T95A 1YS7A 3JAKA 3OCYA 4KN9S 4L74A 1KEZA 1T13A 1JAXA 1EE9A 2FFJA 2ZQYA 4HO1X 2VJMA 1SZPA 4TSKA 3UMBA 2VYND 4BNMA 4DYDA 2IH4A 1ZJJA 1KZ6A 3ENVA 1KU0A 2H85A 1YJXA 2WV9A 4QOIA 2ONJA 2IYYA 2REBA 4FZ5A 3ZCSA 1MJ5A 1L3CA 4B4DA 2H6EA 1V25A 1H4VB 2VF4X 4ALIA 4NNJA 4UM9D 1EK1A 1N9GB 1SEVA 2PKCA 3GA5A 1FMLA 4XYGA 5KSZA 4CWAA 3V4LA 3W5HA 2X0JA 2QTNA 2MMCA 3HU1A 1Q15A 4GP6A 4BFSA 1NV8A 2YYZA 4OHRA 2KM1A 3OEHD 1BXRB 2GPTA 5TDHA 4OK6A 2II6A 3FA2A 3LT0A 4QUDA 1W30A 3CX4A 4N0MA 4D74A 1VZ2A 1G8FA 3ZHVA 3FZQA 1P0CA 4AXXA 4ZYWA 3BXHA 3ZDEA 3G8AA 4ER0A 3U1BA 2ZWOA 4UBOA 3E3OA 4PRZA 1E6LA 4GP7A 5LBUA 2PRSA 5B7QA 2WV7A 2ET6A 1VBMA 1XO1A 3TR0A 3CCBA 4AZ3B 4XIJA 1L2TA 4IEFB 4MV3A 4WY5A 2PJRA 1Y4UA 2BFMA 3FVTA 3VSEA 3W1EA 5EZ6B 4DSZA 5IDYA 2CFRA 2UZ4A 2NGRA 3D7RA 2X1VA 3ZWYA 3HXPA 4DUGA 2YRFA 3WRXC 1R27A 3GUYA 3I23A 5E1BA 1G9TA 1RKQA 5JXHA 3GUUA 4EYSA 3ROPA 3KKZA 1G8GA 4K40A 2C4UA 1WB6A 2WM2A 1FS5A 4ZAFA 3AF5A 1RPNA 2HUPA 1F6BA 1HZJA 4CEHA 1M34A 3PICA 4CM8A 1T1SA 1BXGB 2CF6A 1IUKA 2ZBDA 5C9ZA 2ZANA 3EDMA 1H42A 2IEDA 2C4VA 3QI7A 1DP4A 3X1JA 3QI2A 1ZVKA 2BF7A 1XCLA 2P2DA 3EB9A 4Y2VA 4KE6A 3T7TA 4E5KA 5B4UA 5C5IA 2R8YA 2IX3A 3AY7A 4QU8A 3RSZA 2X5KO 3E15A 3DE4X 3H5NA 1L4MA 1L6RA 2GI4A 7ADHA 1I1HA 2DHDA 2E4VA 3GEEA 4GNKA 1QWSA 1M2OB 1ZBDA 3BN3A 4HSGA 3B1JA 3ZWVA 3QELB 4JS0A 4H6XA 4DMLA 1RAGA 1YRQA 1HFKA 4F5ZA 1K1EA 1LSSA 4L75A 3K2QA 1NRJB 5DXJA 1O97D 1PT5A 1W581 5JASA 1KZYC 4MWOA 2ASVA 4P4SA 1NVWQ 1EDEA 1XP8A 2MHCA 2J4DA 2A1UB 3TB4A 2ZRCA 4EENA 4OGFA 3SJUA 1DBQA 2CCKA 5IK2A 3TMYA 4YJ3B 1KZHA 1YC2A 3K15A 1H4SA 2JI7A 3IVMA 2P7IA 1NDQA 3HJUA 3P2JA 3QW2A 4DBVO 4DPMA 1J1UA 3UJPA 2JHCA 1JPUA 1GKKA 3MGGA 4DF3A 4ZYXA 4DHWA 3UN1A 2WI8A 2J5XA 2REQB 1GARA 3EQ8A 3GIWA 3SZOA 4AW9A 1DKNA 2WMOB 3MEQA 3TAXA 1CQZA 3A37A 3GDWA 4KX5A 4RIHA 1DPGA 3BJRA 3JQ9C 3KRTA 1S0UA 2VXYA 4TPKA 4EG3A 4DA4A 4CQMA 3CONA 1DMSA 4LYJA 3EXEA 2LXNA 4TL6A 2BFCA 1M1YE 3QX7A 4PZAA 3MIIA 3ND9A 4MITA 1ZUD1 2JAWA 2YIJA 2ECQA 3GEIA 4LCEA 2PVPA 1PW7A 4FN5A 4LDQA 5JDIA 1GYRA 2XGMA 5HOQA 1GGEA 3NLLA 3PHIA 5K6AC 2EKQA 3PJRA 4PLFA 1CZUA 4QWMA 4EX7A 1U1CA 4FNMA 1HRDA 2OKGA 2RH4A 4AJOA 2QN7A 4LTNA 3QPCA 4D3DA 5F9HA 2A58A 5DO9A 5JJCA 1T5HX 3ETGA 3RLFA 2HU2A 4I8IA 4D9HA 4QD3A 4MQ4A 4M1YA 2CBGA 4OAOA 3O8LA 3JD0A 4W6QA 4DDHA 1P17A 5E6UB 3VPFA 4BASA 1UPAA 4IWYA 1L4HA 4DCUA 5TMPA 4TKLA 1KZGB 4KC0A 3ODGA 4KNWA 1R4NA 5CPBA 1EFPA 2EC5A 3ZGLA 4JT4A 4OYYA 1IBKB 2B3TA 5F21A 1SBZA 3HBJA 3PC8A 3KTOA 4MS1A 4A6DA 1SN7A 1MD9A 1DX4A 4YCAA 5LA6F 2Q1TA 5IWAB 1MMFB 1XZJA 2ODWA 2FMUA 3AUTA 1UBLS 3DMHA 2P2YA 2UYCA 3QPBA 2QV0A 1P9RA 4BAUA 3DWIA 2CKDA 1L1RA 1TQ8A 2H9YA 1G3UA 4BO1A 1VDZA 3TSZA 2QYSA 1NFRA 1AGPA 2Y9PB 3ILYA 4ENQA 2W6ID 5LZ4A 1H9AA 4C0XA 3ZX4A 1Z6GA 4E2XA 2CL0X 3BAZA 1YR6A 4B71A 4CIXA 1UODA 2BMJA 1OR8A 3TOSA 1E0KA 4DEXA 1T5BA 3HJCA 4G0ZA 3N7UA 3M9LA 2HF2A 2QNIA 4NBNA 4AYXA 1HETA 4YRQA 5DI3B 1VPVA 4MIYA 1VPLA 2ZSHA 3JTEA 3TMAA 4Y8VA 1FDSA 2NUAA 1S9HA 2ZYUX 4D0SA 3OD1A 5CLHA 3CUKA 3KXPA 4JX8A 1T9CA 5JZSA 5BQXA 3OZIA 1NA5A 3LA8A 7ABPA 2ZJ6A 3QKRA 1KKLA 4H7JA 4UPVA 5THQA 2ZT7A 3T3OA 3BCHA 3AGQA 4J91A 1I32A 5DYGA 3DZ8A 4PO8A 4BP9A 4ASUA 2HR1A 3WYCA 2ILVA 2QDKA 3CVJA 1KERA 2QTHA 3D3WA 4I7EA 4MUMA 2B4YA 1YFJA 4DMHA 4U0JA 4M0EA 4QT0A 3PT9A 3W9SA 5M5BA 1M2VA 4BX2A 3NOOA 5KX5F 2NQTA 2GTPA 3A7EA 4JR2A 4JJ6A 4RZSA 1SIOA 4KE8A 3K2BA 1A9XB 1E5XA 4GRDA 4Y1RA 2P8JA 2HMAA 3BB3A 3PHBE 3WMWA 2HSZA 4KR7A 1UXGA 5EJ2A 3V8PA 4F1KA 1DIOB 1OAAA 1S5PA 5LQNA 1HEIA 5FQNA 1JHAA 4H0CA 2OO5C 4RS3A 2D74A 3F7NA 5EE1A 4Q5IA 3WLAA 3FWKA 4J29A 2AI2A 1RI3A 4K87A 3WXBA 5IVKA 1AUQA 2P9FA 5U4XA 3X2SA 1Z5NA 1GPKA 1ZIXA 3BBPA 4HLNA 5DT2A 1W44A 3SMQA 3W5UA 4BGDA 2WSSA 2VUSA 4MVJH 3V8NA 2MSKA 2I76A 3AJ8A 5K0TA 2OG2A 5HIKA 3QX3A 3HBFA 4HGZA 5JNUA