4EF5A

Crystal structure of sting ctd
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
192
structure length
177
Chain Sequence
NFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPASSFSLSQEVLRHLRQEEKEEVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane protein 173
publication title Structural analysis of the STING adaptor protein reveals a hydrophobic dimer interface and mode of cyclic di-GMP binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 60
structure length 177
sequence length 192
ec nomenclature
pdb deposition date 2012-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ef5A02
4QXRA 5CFNA 5CFQA 4LOLA 4F5EA 4F5DA 5BQXA 4EF5A 4KC0A 5CFRA 4YP1A 4KSYA 5CFPA 4LOHA 4EMUA 4F9EA 4KBYA 5CFOA 5CFMA 4LOIA 4QXQA 4EF4A 4QXOA 4QXPA 4JC5A 4F5WA 4F9GA 4F5YA 5CFLA 4EMTA 4LOJA 4LOKA
chains in the Genus database with same CATH superfamily
4YJGA 2IHYA 1IBLB 3OZBA 1XAIA 4K9KA 4O4IA 3KJZA 1QWSA 3AR3A 2GKSA 2ZFUA 5AW2A 1DBPA 1UEXC 4XFJA 3IA2A 2P2NA 3EC2A 4PTZA 3ZWAA 2JD2A 1H3NA 4JP8A 4DUZB 3MJTA 4ZYTA 1TMYA 1ZUIA 4Z9YA 5IAOA 1ZXBA 2HNBA 4M1TA 1UJNA 1NVTA 2ZAOA 2BFAA 1L4KA 2HLDA 2V4MA 2G0NA 2V59A 2WZQA 4LG1A 1PN3A 4NBRA 3IVAA 4RXUA 4S1WA 3B6EA 4D8WA 1D2EA 1S2NA 2XUQA 5FWAA 4KK3A 3TZCA 5C4MA 1UUFA 1QDEA 4LHXA 3CKLA 5G1PA 4C04A 5LMUB 5DEOA 4TUYF 5EE5B 3A1VA 4TQAA 1KK3A 3HVKA 2XTNA 1EAYA 2PMDA 2X2FA 3PQFA 5CNKA 1U2DC 4D42A 1J5XA 1UK7A 4UNRA 1R1DA 2DHRA 3KZXA 3O31A 4NZNA 4PPNA 4Q48A 1Y37A 5CAEB 3RG8A 3D1VA 3HWSA 3ICPA 1JBEA 1Q1NA 3IE2A 1PV2A 3NC1C 3P2YA 1NSFA 2VJBA 4HDSA 4B81A 4YCSA 5JBQA 5HKBA 3LOQA 2WOJA 3DDOA 3G6WA 4Q4JA 4QGGA 1GR0A 2YW2A 3QG1A 3RU3A 2JAHA 3ZWBA 3IIJA 1KEUA 5ALDA 5B37A 1J06A 2BEUB 3CU5A 1D07A 2NTVA 3FKQA 2YYSA 1PFKA 1HM5A 3DKRA 1IIBA 1VCNA 1B15A 4N47A 5KOIA 3CX6A 3ROMA 5L4LA 2CVHA 5DZSA 3ORFA 3M4YA 1E3MA 2HDNB 1E9SA 2VCHA 5AI9A 5A6SB 4B3MB 1OFGA 1R64A 1Z2DA 1E1KA 1I4OA 2AG0A 3WK6A 2FI1A 3RYFB 4MUJA 1FPMA 3ZZUA 5JJIA 4B71A 2AFIA 3H2KA 4PSAA 1RCTE 3NDBB 4EX7A 1ZK0A 4LRQA 4HNQA 1G63A 4RCVA 5HIMA 3N7AA 2JIPA 4ED9A 4IHJF 3PDUA 4NFHA 1SCIA 1WHSA 2AEMA 3SBXA 4A2CA 4YRZA 3RWOA 5D01A 2R7NA 3JD3A 5CA1F 4QLOA 1U7ZA 5AI0A 4BNHA 2ZM5A 2XPCA 3DD1A 4FDTA 4MWOA 4KXXA 1T6XA 5G2OA 4LE2A 2QN2A 2EX1A 2W6OA 3HQ4O 3IQGX 4UAGA 3AHCA 3L8MA 3WLFA 3WWDA 5I45A 5JDCA 3K32A 5LJLA 1DAFA 1G66A 2H17A 4YWHA 1SCBA 3EWSA 2WHPB 4X91A 1NTRA 4LVUA 3Q5GA 3TE7A 4E2ZA 1XNRB 4PLFA 1XZJA 2NVUB 3ABQB 3FBGA 4LJLA 3SU8A 1CEXA 1IWPB 2CL6X 2RI1A 3AKCA 3QLEA 2R5WA 1XTIA 4ARVA 2DQSA 3DEIA 2XSZA 1VCHA 3IT0A 2A92A 4V1CI 5JZMA 1E1QD 4L0DA 2J7PA 3U62A 4BWGA 1RYMA 3TF5A 2XZOA 2W6IA 5EIHA 2PTHA 3P94A 3TIGA 4Q3CA 4WKGA 1XTJA 1KZ4A 5IVPA 2C5BA 4RXTA 2W6JD 3AR6A 4IHAA 1POWA 2WM3A 5EKUA 1W0KA 5J5VA 3WLIA 2WM9B 3JZIA 3K2IA 3BTUA 1CJVC 4H59A 4IDOA 2FEKA 3O4IA 4RHCA 2OV1A 2XGJA 2IV2X 4NCBA 4G9GA 2HJVA 5CDUA 5HP4A 2HF9A 2DP4E 1YQQA 3MJSA 1XAGA 1C3XA 4BO5A 2IEGA 3A70A 2WC1A 1N25A 4ZT3A 4IFEA 1KXJA 3O8RA 2VSQA 4XWTA 3LY8A 1U1GA 2RBKA 3WP0A 1X13A 2BKXA 1SO8A 3QSYA 1PWHA 1JHRA 3ROZA 4QEZA 2J3QA 2PD3A 3LXUX 5HFNA 1J1UA 1JLHA 3IAS6 3QFRA 1GFZA 3REFA 1E58A 1N2SA 1KBZA 3S55A 2WPNA 2J0VA 2Z2JA 5TXGA 1RU3A 1GCUA 1QH8B 1T29A 1NP6A 1U3UA 4PPQA 1WD5A 4JP3A 4OYHA 3P52A 1MCZA 3TDNA 4CKBB 3LF2A 1DADA 2VRBA 3FPLA 3QUBA 4BAZA 2BF4A 2IU4A 3IVCA 3I37X 3OT1B 4FYHA 3LBNA 2BELA 2Z08A 1UAYA 1JYSA 1XTZA 3OC0A 5BV2P 5F7OA 2QTAA 1QX3A 4XQGA 3B51X 3ZS9A 5FBLB 5BQXA 2Z6QA 5IVHA 4E5VA 1W4AA 2IUSA 3VPXA 2GYVA 3LHKA 2BDTA 4X7MA 3BGWA 2YV4A 1VPVA 2O4CA 2PKWA 2IUTA 4U7TB 4C7JA 3OC6A 4E1BA 1DSSG 2F1IA 2IHZA 3GGOA 4H3KB 4IF6A 2VR1A 4QAQA 4CG0A 5JAMA 5LMZA 4P4TA 2AS0A 1UXOA 4KBFA 1U81A 4LVNA 2OXEA 1L4NA 2REBA 3DV0A 4HTFA 4MITA 5DFAA 3U3KA 4OH7A 4ENTA 2PS9A 1FMLA 1U7WA 3EDMA 4TVSA 1GRNA 2ZE5A 1I6WA 1XRRA 1CB7A 4O8ZA 2J59A 3OIDA 1D0IA 4HT3B 1HDOA 1Z25A 3CRW1 2QSUA 1ELOA 3DJFA 3IVRA 3O8LA 4RQTA 4BO3A 2BBOA 5JCPA 3ETLA 2DZDA 2KYRA 4QBIA 2R6GA 3AUKA 4LHSA 2QKYA 5I01A 1K2WA 4MK4A 2R0QC 4D74A 3OZFA 1GTL1 3SHTA 4N8EA 1SU6A 3H6GA 4JR1A 3NPMA 3S99A 4P7FA 1Y9ZA 2WU1A 2H59A 2ZI4A 1ADYA 4NJEB 4D2IA 2HTEA 2JRLA 5JT1A 3DXYA 1I10A 1KVUA 1WEHA 4G41A 3N8NA 3EWIA 2Z4TA 5G0WA 3SEQA 1MXHA 1JDZA 1BEZA 5I6DA 4DABA 2PRJA 3ZGNA 2GMWA 2BBTA 3KU1A 1DIBA 2JGRA 3TKYA 3N2GB 5LP6F 1SB9A 3G0GA 4PR3A 4UFNA 3R9KA 1Q7BA 2JGAA 4EJSC 3EXHA 4L22A 3A3OA 2O20A 4UVHA 4ZOEA 4NMLA 2O8NA 1KFEB 3DYIA 1HFWA 1NR1A 1UM9B 4GKBA 2D74A 4N3BA 1Z37A 5E7QA 2WJYA 4I1RA 2IYYA 3UJ3X 5I7RA 2TS1A 4R05A 1Y89A 4PZUA 4I9GA 4CM7A 3C5HA 4X7BA 3CH6A 1MPXA 4AKIA 5TMDA 4QXOA 3WHPA 5KI6A 4B75A 1E89A 4D9CA 1KZYC 1JXQA 2VBGA 5A5GA 1CZRA 4RJJA 3GD5A 1W44A 1JSZA 2JIBA 1LDBA 3V8BA 5JEEA 4GL2A 3WGMA 5JAPA 5JXHA 4NV3A 3EZ9A 3QUAA 4P4UA 4NAUA 3WB2A 3WFJA 3ZWWA 1C3LA 3HTXA 2DUJA 4R81A 5T8KA 3NAMA 1XPRA 1GAWA 5JIBA 2Y93A 1MIHA 4P34A 3RNLA 3VHQA 3QW2A 3QE9Y 3AEUB 3I04A 1OAKA 3RC3A 2IHJA 3IO5A 5I7FA 5C81A 4J16A 2QENA 2QX6A 1ODLA 2WPDA 3FVTA 4DNQA 1RHKA 2YXPX 3QF7A 2PQMA 3N6VA 3OKCA 2GOYA 2VLIA 1A8UA 3BFJA 4NE2A 1EVEA 2PV7A 4UOQA 1BXRA 3AR4A 3JZMA 5CIWA 4PHFA 2I78A 1S3FA 2QMHA 3IAS1 3Q7SA 2ZSKA 4DBLC 2O9JA 2IWHA 1WMBA 1LDYA 1UQTA 1IHUA 1M8GA 2H52A 3CTPA 3PR3A 4R9VA 4YK7A 5I7AA 2LV8A 2XHZA 1VG8A 1Q21A 2DQYA 3Q7EA 4MQ4A 4RKEA 3UG7A 3WB1A 4AK9A 5JSZB 5H9VA 4B2IA 2ZKLA 3KWMA 2HJWA 5IUJC 1CZNA 1A1VA 1V11A 3MJCA 2HBQA 3PEEA 1DQSA 1JEQA 1W49A 3RS4A 4D0LB 3B1FA 5IAEA 1D9ZA 5CPBA 3U6BA 1RQ2A 2JB9A 3QENA 5DEIA 4L5CA 4PF1A 5C3MA 2JATA 3RADC 2ABWA 3FOWA 2X0FA 5G4KB 3CR8A 3UGKA 2DCUA 2F1OA 4YUYA 5FV4A 3OFND 2O6HA 1AA9A 1ZGCA 2NZWA 4LQ4A 2GAAA 3KQWA 4URFA 4B6PA 3VJRA 3BRWD 4NV0A 3R6TA 4NY1A 5JY6A 3PB3A 4I50F 1AXEA 3GZNB 1XD2A 2PL9A 5LB4A 3I1FA 3VKGA 1PR5A 4OPMA 5EKDA 2RBEA 2DLCX 2I6GA 4Q6BA 3QVOA 4DL9A 4X93A 4O63O 1Z8HA 5K09A 4X62B 2IW3A 1EXDA 1Z74A 1XQWA 4MWGA 4E22A 3S2YA 3WWZA 1OB5A 5LQAA 2XODA 1D8TA 1E1QA 3WSVA 3VJMA 3BJMA 2IX3A 2QX4A 2PS3A 2HRCA 1N57A 3FNEA 4GMHA 1AB5A 4EL5A 2BYTA 1I7SB 2KM1A 3F1LA 1JHOA 3MBOA 2I67A 2RH4A 2NZXA 5DOZA 3VPSA 5K0JA 4JYPA 4F9GA 2VHJA 7MHTA 1NG1A 1ZW1A 2HC9A 1FZTA 5FNVB 2QRMA 2O2SA 4L3VA 3DEZA 1X1TA 4G63A 1U6JA 4IVNA 3WZ2A 4MP6A 4DR2B 2IYWA 5FTMA 5LA6F 2X8LA 1VLQA 3LT1A 1KJYA 4HL6A 2FW9A 1NI5A 3UMCA 3LYLA 4B5LA 2H4XA 1JL3A 1W85A 3K30A 2O57A 3NTVA 4IIEA 1WZIA 4OA5A 3CUEF 5CM9C 3ICEA 3H2YA 1KOGA 1HRDA 2EBWA 1KYIA 2ZBUA 3G8BA 4YP9A 16PKA 1OR8A 5KDDA 3UFXB 2P4HX 3FMGA 1ZQ9A 3BK1A 1RQXA 3ORHA 1H0SA 3IHLA 4HAIA 2IEAA 2ZAMA 3IEXA 3AP2A 3KJNA 1Y7LA 2OG1A 4M9UA 3WYFA 2BOVA 5JBNA 1T5BA 5ALPA 2YS6A 4D9JA 2XNJA 1E3TA 3D1JA 2WAMA 5FLEX 1GO2A 1AK2A 2HDOA 3CRNA 1B8OA 4GR9A 4AUEA 4DNPA 2Y99A 2IKQA 4S24A 4WUTA 2JPDA 2AFIE 2WHYA 4H1WA 4NDAA 5F5NA 4JJ6A 3QLJA 3GGCA 4PONA 1ZC3A 3BGSA 3CLTD 3G8YA 1WW2A 4AZ3B 2VTKA 1II8B 1Z33A 2C99A 2VYCA 5F21A 3A4YA 2BFFA 1ZINA 4MKXA 1BAPA 1NXSA 4MGHA 4LXGA 5BWLA 3TQQA 1YKGA 2IT1A 3ZVMA 3GAMA 2H1CA 2VDOB 3SKYA 1LLDA 4M53A 4N0MA 2O7SA 4I0WB 5CU7A 2UKDA 5AVJA 1L6RA 1ZBQA 4KPUA 4NL4H 3ZGOA 5HYVA 1MORA 3BFPA 1CQWA 2P4EA 4LXXA 4BLPA 3W3AD 3W8RA 1E9BA 2O2JA 2GAJA 1TCAA 2Y66A 3BD7A 4LHYA 3KSRA 4WZ6A 2ZE6A 3NT5A 4X20A 1CZLA 1XGKA 3SBDA 4XM1A 3RU2A 2B4AA 3FWKA 3NHYA 4HRVA 5C8ZA 1JFVA 1H5UA 1MFZA 1S2GA 1V8BA 2JCXA 4FKMA 5IC4A 4EVRA 3SYLA 4DCNA 2VTEA 3C1AA 1PFGA 2IU0A 2A84A 4O4HF 1L3CA 2ZJZA 4MGIR 1I6MA 2FX3A 2VF2A 4KQEA 3CV3A 5JRJA 3A14A 3L8ZA 1J21A 3MILA 4MCAA 1CZKA 4YJ3F 3TOCA 3C5WP 5HE9A 4A82A 4ZVKA 1NBIA 3OFKA 3W7AA 4CU2A 3JWGA 3H2ZA 3FIUA 2X3FA 3H6HA 3CTMA 3G9UA 3HU5A 4LZZA 4P82A 3CLRC 3RWBA 3VVLA 4EP1A 5DWDA 3THXB 1I94B 3DB2A 2ENWA 2EEZA 1JEAA 2E18A 4QDTA 3VR0A 4NZMA 2CNWD 1W4LA 2PWBA 2DUUA 1W30A 2A67A 3HYCA 1XTKA 1MC5A 1DRVA 4PGAA 3EGXA 4M8IA 2PZAA 5FB3A 2WYUA 1DC3A 4X85A 4ZI7B 5FUMA 2HNAA 1UC4B 2CHQA 4UVGA 2IDJA 3HZZA 3TKLA 3ZWPA 5HM6A 3Q0IA 4HO1X 1O3YA 4JGIA 1G6OA 4RK5A 4FKZA 1TE2A 2IYRA 3UUFA 3OJWA 2PD4A 4EH1A 3AETA 3A36A 3FNQA 1NU6A 3WJAA 1YR1A 4QPCA 2CXTA 3G1TA 3RBXA 2IH2A 2AF3C 4KV7A 3PYXA 4R83A 1M10A 1MJGA 2SNIE 3Q8MA 2R11A 2Y2VA 1F4LA 1XA4A 5JNLA 1NW6A 1DARA 1R18A 1QVZA 3OURA 4M54A 2P9EA 4RDHA 1M75A 1HYHA 1S2MA 2WYHA 3QMVA 1ZI9A 2FZLA 3RJTA 4HNVA 5I7WA 5IN4A 2MSCB 3KJIA 4BX9A 1PBTA 5CDTA 1XZHA 1PEAA 3E3LA 1FBNA 4FMDF 2PMFA 4FZ5A 3BIWA 4ZXFA 4FUQA 1B6SA 2Z2ZA 3CLKA 3CVVA 1GRRA 1ESZA 1GRVA 2UZ1A 4RVDA 4ZQHA 3KTAB 4J4BA 3TG8A 2FR0A 4MW7A 3R74A 2XCRB 1N1MA 5A5EA 2I4RA 2F2TA 2WFLB 2Q3EA 3B5IA 3W5JA 3ZCVA 2HWKA 4IAOA 2VNSA 3FPEA 4HFMA 3WHIA 2ZWIA 2E89A 1US8A 3I58A 3F6YA 1B4DA 1RT9A 2V7BA 4HNAB 3U1VA 4I1VA 3I9V6 1EBBA 1G19A 1FFYA 1YJQA 3U49A 3D5EA 1YDHA 3SSMA 4RVSA 1SVLA 1RLTA 1V1RA 2WWWA 1OT3A 2KI5A 3V6LA 4CJXA 1IM2A 1XPOA 3P9IA 1Y8RA 3OFNA 4B1FA 1DJQA 3WY9A 4BMNA 4MRAA 1N8SA 1K06A 1R9GA 5AKEA 1T0IA 3KKMA 2ZI5A 1FU7A 3PGJA 1TZMA 1DOAA 3C1UA 2HXYA 3G5AA 3K4QA 3L4KA 1OH7A 4YR7A 2CF6A 1Q83A 4HNTA 3AF4A 2WNIA 1CY6A 3K5IA 4QBHA 3P4YA 5J2TA 1T8RA 4HRAA 3C3BA 1BRMA 1N78A 1IOZA 3L79A 3UANA 4Q4HB 2JCVA 2UVPB 3E9CA 3FLEA 5DXAA 3GRYA 4KFSA 4GI7A 4LBWA 4XQCA 4PHGA 3CN9A 3NBZC 5EZSA 1L5SA 5HKLA 3UVEA 4P7KA 4DUPA 3VKWA 2WK1A 1AQ6A 1F3LA 3HR8A 1MB9A 3HPQA 2BEWB 4FYMA 1GCAA 4KG7A 4RWZA 1M6VB 2GAFA 4BIMA 4BEBA 1BXGA 3DAYA 4MTCA 3NIDB 3MTBA 1RABA 1OTXA 2DR2A 4PAMA 5BSRA 3I5XA 3EIFA 6YASA 4BAGA 2DFVA 3H5RA 1NBAA 4PPFA 3AHEA 3RG2A 1GKIA 2BGUA 2R9VA 3FNFA 3PRKE 4ON9A 4A5OA 3CEMA 1G2QA 1ONBA 1HEIA 1WQ4A 2XNHA 4GEKA 2A6PA 3R75A 4JKYA 4QDXA 1Y5IA 3L93A 4PHTA 2A9PA 1A2KC 2Q0QA 3PHIA 4J1SA 4JYBA 1N36B 2Z6VA 2FPGA 3DMRA 2R7KA 4BWFB 3WL3A 2AC4A 1QGAA 4MP3A 2DPGA 3PDHA 5BOSB 5MGNA 4UUBA 4LOHA 3X43A 1UPAA 2R6AA 1JDVA 4KB5A 3NOOA 5KYXB 2B3DA 2XDYA 2X3UA 1JR2A 4MRSA 1AX9A 3U81A 3ZX5A 3F3MA 1S4MA 4WXMA 5KYUB 4R8KA 1JR6A 1TZ2A 2KX7A 3HJCA 4ICIA 2XZPA 2BGRA 4IG9A 4F6RB 4KL8S 1VXRA 4NK4A 1UJ2A 3RS3A 5BQ3A 3UC5A 5FL7D 3HJBA 1Z0AA 2JJQA 5IC5A 2D8AA 2ZEJA 4DLXA 3COSA 1EGHA 1A5ZA 2WIAA 2JFHA 3DOUA 2HSDA 1RLIA 3M5WA 5E3IA 3OP1A 1AHPA 1UBFA 2XCSB 2UXCB 1NJ5A 3RQSA 4CV3A 1SD5A 1G0NA 1QQ5A 2AKYA 3K0AB 4R51A 1NULA 1VGQA 5TPWA 2A5FA 4LHEA 4PZLA 3GGSA 5B3KA 1HETA 1NQXA 2MMGA 4NE9A 1W5BA 4FC7A 3RS9A 2WTUA 1L5HA 1LBHA 2ONCA 5AKGA 3L8DA 1QS0A 1T0JB 2F1RA 2WJAA 3OQJA 3WK7A 4IIUA 1THZA 1CVLA 4FYKA 4UUMA 2JZNA 1AOXA 1W29A 1MX3A 1SQ6A 3GJ8A 4XH9B 1ZK2A 1T6NA 3OUTA 3W3AA 4FTWA 4WNAA 5JVDB 2A5JA 4D96A 4BGDA 4N48A 4JI4B 4Q47A 5JCJD 5KVCA 3AFOA 4ZALA 4IL5A 3K5PA 5A9SA 2WA2A 1EK0A 4MA4A 2J5KA 1KP2A 4M7WA 4PBTA 4QUAA 4GYWA 1UC8A 3LM8A 1I4EB 2R62A 1J9ZA 2QU8A 3NIBA 2Z8YM 3RHFA 4DWWA 4H7HA 1NONA 1DG9A 2X9NA 4A0QA 1IE3A 3RVMA 1XP8A 2AFRA 2OQ2A 2V9PA 2AUTA 2IY8A 1NI4A 1LB1B 3AO0B 1U2DA 3AERB 1PFWA 3FFXA 1BU8A 1JILA 1M6HA 3NTQA 3FN4A 4MVCA 2DUNA 4I55A 2YUTA 4RPKA 5JALA 3D2LA 2J8ZA 1TJ5A 2GD0A 2WWRA 2HLNA 1YOVA 3QPBA 1SC6A 3GB9A 1O9BA 3ESZA 5AW1A 1JTVA 3U7GA 2CY0A 4BN0A 5F52A 5KX5B 5ENVA 1XU7A 3NX4A 1JPJA 1BKSB 1O54A 4OXYA 1OHHA 2G4VA 2VPTA 1KWGA 1N0UA 2QF7A 2PBRA 4QGAA 3TLJA 3QKUA 2QMUA 2O5VA 2JGKA 2W6MA 5LIPA 3FOFC 4A6DA 1IWOA 1YE5A 8AT1A 1TT7A 4UZSA 2H4YA 2GBGA 1I5EA 4NQRA 1AQYA 1QHSA 1AO3A 2IF0A 5IHPA 1FFXB 3ND6A 4TWZA 2VHYA 1GRCA 4QECA 2FPMA 4UHJA 5SZHB 3BB3A 1XK6A 2ZUVA 4IGKA 1UDWA 4HLQB 3SFZA 2W71A 4PLYA 2QLMA 1KZGB 4OX9Y 2FPIA 4I9HA 5IYZF 1CEEA 2C4HA 4A10A 5JATA 3GF4A 4WVLA 3UJ6A 1LJUA 3UH0A 4G89A 2HOQA 3FPSA 4BVGA 4BPBA 1A4IA 5J58A 1OLUB 2WAAA 2PAAA 3LDAA 4A2QA 4CF4A 5TB5A 1K4MA 4YAUA 5PNTA 5SZIA 1IAVA 1N9GA 2CLCX 3PHBE 2W2XA 3O74A 3P5BA 3KJHA 2IPAB 4CT5A 1WPXA 2B99A 4EY6A 1JX6A 3HI6A 3PFKA 4LOIA 1L4GA 1GFWA 3MJHA 1ZICA 1T4DA 1RIFA 4MR7B 3FUVA 4R8LA 5TS3A 1IXZA 5CVVA 1E9AA 1QFJA 2X6RA 2H5LA 1D1PA 1J90A 4LW8A 4B6GA 1O6FA 4MO9A 3WDLA 3ZH9B 4G1VA 4D3YA 3OX4A 2M98A 1YTLA 4NMMA 4EI2A 4YUXA 1XK7A 4KIWA 4ZRDA 2ZQYA 1DC5A 2QHXA 2XTAA 3FR8A 3JD0A 1PJ2A 4MEBA 2EFYA 4V2UA 1EDDA 1UMCA 3Q40A 4DXDA 2ACKA 4Q1VA 4CDNA 4F71A 1K7YA 2AMVA 3CNQS 3GJ3A 2IXAA 1YZQA 3ESBA 5ITWA 2PIDA 4MAAA 1I0IA 1ZM3A 1L4HA 2H92A 1NNSA 3T15A 3D1LA 3I2HA 4EOGA 1XG5A 2P41A 1WNFA 2J9RA 4N18A 4BE7B 3QF4A 2QVXX 2I6FA 3ZI0A 1WAMA 1T36B 1TIPA 2I7TA 3Q2KA 5EJ5A 5MHTA 1SQSA 10MHA 2OK8A 3GGGA 1QK3A 1MOQA 2L82A 2YMPA 4FMCB 4K6CA 1ZH0A 1LFDB 3R7SA 4QT4A 4F06A 3I23A 2VNHA 2P77A 5IKEA 1QIIA 2A9QA 2FQYA 4PZZA 3FIJA 4Q9IA 3LXMA 4OIMA 1UP4A 1H23A 3F74A 4J3FA 3O21A 2HU2A 4MV0A 1B23P 3AVYA 2QTMA 1JKFA 3ZV4A 5FBQB 5CITA 3PIDA 3E27A 4HWSA 4YECA 3RRMA 3A3PA 4C0AC 4CIAA 3DEKA 3ZQUA 1PQYA 3GJ4A 1UKZA 4JT2A 4AY6A 4KQIA 2FW8A 2QQEA 2R6DA 4TKUB 3T7CA 3HKBB 5EIEA 1AN0A 1VJCA 3QOXA 3VI3B 2CVPA 1YJ8A 3H0KA 5SICE 1JHVA 1G5RA 2VCEA 2B6NA 3PD1A 1XRJA 3A4VA 3BXPA 1DQPA 2LUOA 3QTLA 4NEHB 4RADA 4CLOB 3MNFA 1FXUA 4TLDA 3R0JA 4KGXA 1A8IA 1K97A 3RODA 1S2IA 3W7VA 2JA2A 2H5JA 4FT2A 4E88A 1T2VA 4CI0B 2ADMA 2PFGA 2EJVA 1ZIXA 4K9MA 3UV6A 4QU0A 5AJWA 2Q3BA 3L0IB 1R3DA 3C8DA 4LNHA 5JLJA 5EWJB 3P9CA 1TYZA 1SU7A 4A2PA 1OBVA 2PKXA 4NYJQ 4DV0B 3CZPA 2EDAA 4M1EA 1GQQA 5CLIA 1FP2A 2R1TB 5F35A 2YWFA 5C18A 5C7OO 3KQLA 2CFIA 2PX5A 1ZN7A 2G07A 4GP9A 1D04A 1WO8A 3LG2A 4JLSA 3X0DA 4RTMA 1P17A 1VHTA 4KEAA 9ATCA 1LC0A 2GT1A 3DH0A 3EVDA 3WX0A 2PMBA 5FL7A 2FN8A 4WEOA 3WGVA 1X7WB 1J9EA 2BMAA 3FWPA 2YN4A 3NTUA 4ETWA 3BGIA 4BKOA 4XKJA 5IAGA 4A92A 1L9KA 2EWWA 3H2IA 4ZYYA 2XAUA 2QPOA 2P78A 1SXJD 3WLMA 1GPYA 4PHHA 4XDYA 1C50A 5KNCA 2RHWA 1SOAA 3CPHA 1EWRA 4WN9B 3UC9A 2CV0A 4ZD6A 3NONA 4ILKA 3AB7A 3CLRD 3EFOB 1TU0A 3JQ7B 2IYFA 1XROA 1Z6ZA 4YYEA 1RWPA 4D56A 1L7VC 2GA9A 3QFTA 1UBJS 4EJSA 5KVVA 2FQXA 2Y0DA 4PM4A 3JCZA 4LGMA 2WTNA 2JI9A 1JQAA 1RWNA 2GHRA 3GEGA 1K8ZB 4GLFA 4RUKA 3HSKA 5G40A 3CSDA 5B53A 3X44A 2LIPA 2ONJA 1IXSB 2XUFA 4NX2A 5JCJA 1Z8DA 2H1HA 3HDHA 5KAPA 3DVQX 2NV0A 3RGWS 3QOFA 3D3WB 2EKLA 2VRWA 3EVBA 4EL0A 5IDYA 4QQRA 4N82A 1VDZA 2HFJA 3CLHA 2O1SA 1KA9H 5CFPA 1RMTA 4S2EA 2EJWA 5FEUA 2IYZA 2BGNA 2NUBA 5DIZA 3TLGB 4M1MA 4ENVA 1O6CA 2ZWMA 4W82A 4MWZA 3LQ2A 4OUDB 3AFIA 4QA9A 1YK0A 3SZOA 4J6FA 2UYYA 1E3EA 1AHNA 3AKEA 2C1ZA 1VKRA 2W8ZA 2BMFA 2O2DA 3R0ZA 1Y7HA 4U2DA 1U1CA 2GEJA 1NRIA 2H31A 2YIJA 4YAOA 3H5TA 4YQZA 4LBYA 3V9PA 3ZWNA 4JL5A 3N2YA 4LWPA 3WGLA 3RTEA 4QUIA 1HYGA 2CJFA 4IDHA 1E1DA 1RQ7A 5E38A 4KAJA 2Q1TA 1PFYA 4FGLA 2G09A 1YZ3A 2R8EA 2V6BA 3ITNA 2ZRNA 3P26A 4Y9UA 5DW0A 3T3PB 3T3GA 4BYMA 3QEJA 4GI5A 3UPTA 2J5RA 3IXMA 3VH4A 4RD2A 2FB9A 4PQEA 3P19A 4AM8A 3N87A 2GN0A 4WIAA 3KSZO 1PT5A 3DMGA 5EJGA 4PZ9A 1JFFB 4F12A 5FJIA 1KYYA 3GRVA 1JWAB 2IHTA 1PEKE 2ONZA 1TUBA 1UPCA 2Q9CA 3DCNA 3OQ1A 3V5NA 4AJ4A 1TIBA 1TM4E 3C6MA 3F6BX 4G84A 3ZDAA 2BONA 1GOTA 1NMXA 3EH2A 4PQRA 1XWIA 4HWRA 1QQTA 4KJXA 4NRDA 4ND8A 2J6HA 1XHFA 2YINC 4ND4A 3I1YA 1SQGA 5CCBA 2Q9AA 2XKKA 3H8WA 2BGIA 3DZCA 1LZLA 5IBPA 3TLZA 2Y9PB 2GHTA 5JI2E 3DS8A 1VA4A 2QMOA 4TZKA 1AS3A 1B1AA 2LDBA 4XSHA 5BSWA 1ZH8A 4E4TA 3KFXA 2IUUA 2JBAA 2BI7A 2C03A 5CG2A 3L9WA 4QZVA 4FFWA 4JLKA 1N8NA 3QG5A 1H9CA 4AWBA 3QRWA 3CNOA 3SJAA 2R6ZA 3P0EA 3ZXUB 4EBFA 1SCNE 1CNEA 2GRUA 1VIYA 1XCPA 1G9XA 4UVEA 4WOJA 1B0PA 1NWHA 4ARAA 1OH8A 5HILA 3AVXA 2QZJA 3CGWA 2JJ1D 4I5IA 4KMSA 3EF3A 4U3JB 2PXAA 4EQZA 2JFUA 2R6CA 4HWKA 2JIZD 1ZAKA 1Y1TA 1K08A 1Y3BE 2PL3A 5D7NA 5EWMB 3F8WA 4EB6B 1GGJA 4JUIA 3R6GA 4KI7A 3IDZA 5D51S 2BUCA 2ARKA 5TMPA 2BGJA 4G01B 3O8QB 2EW1A 4AYXA 2J87A 4P3XA 1E5QA 1IFXA 1LPNA 3DZDA 5DSXA 2QZ4A 1Q19A 1ZZGA 3ER8A 1XCOA 2H54A 3PRJA 5KNDD 4XJVA 2VI5A 4UTOA 4HS9A 3WLNA 2IS2A 1V7CA 3DYBA 5C32A 4DANA 3ZJTA 1JG4A 2DY1A 3BWMA 4K6KA 1XKXA 2N42A 2X2OA 3A9WA 3INYA 3LUAA 3C15C 3OZSA 2PGNA 1ODFA 1ZHFA 4M37A 3BM5A 3KXKA 3QXXA 3ZJ5A 3F6PA 4I5EA 5DLYA 4EYEA 3BFKA 3HFSA 3T9FA 3KPVA 3TLKA 4A8JB 2D0OB 2DHDA 2PO7A 4DXAA 1UANA 5ECWA 2R2AA 4AKTA 2IHKA 3NI2A 2EDCA 4XLTA 1JIQA 3P9PA 3CNBA 1MABA 1EFPB 1RM4A 2F3TA 2XT6A 3ESAA 3LL7A 4NONA 4RFVA 1IMOA 3DDCA 1F2UA 4HWPA 2HYIC 3LF1A 3CLSC 1GVHA 1I2DA 1Y4SA 5B12A 1L1EA 4CDRA 1QFYA 1OZHA 1FMJA 1P6QA 4U0JA 1QK4A 2PLFA 1TYDE 3OICA 4IIBA 2HDHA 3KQPA 4XUGB 3V2HA 1DKUA 4KO1S 5JAZA 1K5PA 2C83A 2JAQA 1IULA 1GXSB 1U3FA 3NV9A 5K99A 1YCHA 2I6QA 3OLYA 3BN3A 4Q4LA 2BSQA 4X8MA 4QQKA 1GUZA 1M1YB 4A15A 1R5BA 3H05A 1G7TA 2B94A 3CCCA 1IOWA 4ZI2A 4MVJM 1G21A 2CL5A 1K75A 3ETNA 2G7MC 4M99A 3IE0A 4OHZA 2AV6A 2WFAA 2GF2A 4PG4A 1FDWA 1OWPA 2REQB 4YDSA 1I4LD 2IA5A 3WNZA 4QOSA 4D6YA 3IBCA 5HF9A 4D1YA 4D5GA 2ID8A 3KJXA 1JJ7A 1XZBA 3W3AH 2BTOA 3MOGA 4HPJB 2Y1OA 3KVVA 1PK9A 4D3XA 3RJ5A 4HPWA 1V41E 3PP8A 3PRHA 5KU1A 1ZM7A 4IIYA 1E1LA 4Z0NA 3C7CB 1OYWA 1THTA 3NHLA 3N5CA 1X9HA 3B1WA 2B1QA 1HDYA 1A96A 3EDYA 3QKIA 4LXUA 5CNMA 4Z4FA 4LV6A 1Z6YA 4E6EA 3ADCA 4KQ6A 4KITB 2GN2A 1JLLB 1IQRA 2JLZA 2AXPA 3F4LA 4RABA 4X5OA 1MA0A 1S7GA 4GZ6A 4IDNA 5H68A 2RGYA 1GN9A 4FFBB 4AY3A 5IJWA 2AXQA 4QWMA 5CLHA 1FLDA 3VZPA 2WZCA 4UD2A 1P9WA 3QWIA 2QTTA 3C8ZA 4ZQBA 2VXBA 5HKKD 4LOJA 2C88A 4M83A 1C0LA 1ECJA 4ZVLA 4ESEA 3HCNA 4ZGBA 1A2OA 5AM3A 1SOVA 3EEIA 4RGQA 1Z29A 4BGEA 4L4XA 3LK6A 1LWNA 3JWJA 2BFEB 3DMHA 2IZ6A 4MGEA 5EJEA 4J0QA 3TM5A 1UADA 1HO3A 4R2KA 1X1BA 1WY5A 2PU7A 4WCDA 2B8EA 2PKYX 4J0KA 3U19A 1IRXA 2X9GA 5LZ2A 4QWWA 3ROEA 3OQIA 4WK2B 5HRCA 4TMTA 1W6RA 2ZUTA 2X8AA 4P3NA 5D3MA 1C3VA 1K3TA 1KPIA 2BCGY 4HN9A 3V2GA 3KOUA 3ZWMA 1RI2A 1T6YA 3H2BA 3CW9A 3HDQA 3JD1A 3PE6A 1MQ8B 3T99A 3DTNA 1L6IA 1T2DA 1QTQA 3MOIA 3O83A 2GDZA 1BVYF 2V0CA 3BZBA 7REQA 1AXRA 2B8JA 4BC0A 3IQXA 3HXOA 3QFFA 4H9GA 2I0FA 5HZKA 1OVGA 3CBQA 3N7UA 2ZR7A 4X1KA 1C3OB 2FWRA 2WTMA 2CXQA 3O4RA 3D9QX 3FLMA 1Z7WA 3KTFA 4AF8A 1W9MA 2CV1A 3TZEA 1VE7A 1RM0A 5FQOA 5KYYA 4P5DA 5L7WA 4IOLA 1FRNA 2V7QD 1MNAA 1SA0B 3KRTA 4I6GA 4MW5A 4TKVB 4WT7A 5K51A 2ZU6A 3ZVRA 1Z82A 5I7OA 3K72B 5HBRA 4RV4A 4WLVA 5FAXA 5B1YA 3IDAA 4Y0AA 3VU9A 2Y1WA 4EZEA 3FRIA 4EHNA 1W8IA 2JFVA 1ZM9A 4F4HA 2V6IA 1EDEA 2WKWA 3EW7A 3GCXA 3HA3A 2R1VA 3NWJA 4LECA 1ECBA 4NZOA 3O1HB 4V02A 2AYZA 2G77B 3WSTA 1DWPA 1FFDA 2FR1A 4OHWA 1NM5C 4NOJA 2QW8A 3MWKA 4RZ2A 4S0XA 1BZYA 1WBDA 2CDNA 1U94A 2W8BB 3PK0A 2NAFA 4N39A 1NURA 2IBTA 3NVKI 1IH8A 1NAIA 2PHZA 1GL3A 2BDEA 2YC2C 1WZUA 1T34A 5IVIA 3RWMB 2AX4A 3PT9A 1HE8B 1YQ9A 2HMSA 5BN4B 5TS2A 5JS7A 5E0OA 1ZKMA 2FV8A 3GA7A 4A6EA 4HJRA 1CY4A 1WHTA 1TT5B 3VO2A 1VBKA 3UJDA 1SK9A 4AZTA 2ANBA 2TECE 2GD2A 2Q1UA 3C8MA 4CPDA 2A8YA 4RGBA 3HJTA 4HSGA 1YSCA 3GNQA 3K1TA 4AJHA 1P5RA 1AE1A 4UMVA 1Z26A 3D4PA 3UUGA 4WZBE 2NZ8A 1YJBA 2M6LA 3EG9B 2JJ1A 3JWPA 3L07A 3TB4A 4JB2A 3TTUA 1DMRA 1JE0A 2G08A 2JS7A 4YBRA 1WULS 2VDJA 4WA7A 3IKVA 3WYNA 2QUAA 5EHQA 1HYBA 1EFDN 2VF7A 4EHAA 1B8UA 1PWEA 4MQ6A 2F90A 2IS6A 4UTPA 4RTLA 3FKSD 1KEKA 4J29A 5J5CA 5JLAA 4PX5A 1RAFA 1MC1A 3WGUA 3I2YX 3LP5A 5FR2A 2G83A 1L7PA 1YVDA 1FFHA 2C5FA 3OA2A 4KVGA 1EG7A 4AO8A 4YPVA 4CRWB 2M6SA 4W6ZA 2WT8A 3CE9A 3VZRA 4UZEA 1IHPA 3MSCA 2QD3A 2I9KA 3UAWA 1KPHA 4CR6A 2C29D 2YVLA 2HHCA 1RXSA 2VDPB 4OGWA 2CV2A 5F98A 2C96A 4Y2TA 1RJFA 3RS0A 3WK8A 3W5BA 4RF3A 4BRWA 1SHLA 1IZYA 2NU6A 4ND3A 4QIHA 4JQYA 3D4IA 4HUTA 3ANTA 4TV9B 5TV2A 1LVGA 4DHEA 3PQEA 2ERCA 2GZ2A 3R77A 1JQEA 4JN6B 4MYUA 2HSZA 3VC1A 3WO1A 2EOAA 4DBLE 4ZJZA 5AW0A 4F6CA 4RSGA 3WGQA 4R9RA 5F4ZA 2PUBA 4NZPA 1HPLA 4M46A 2HPHA 1RP1A 2JGIA 2NXEA 4AO6A 4XM2A 3IUJA 4TLAA 3L3BA 2XUKA 4CF3A 1NASA 1D4ZA 2CLKB 2ZRMA 3WNCA 1DMSA 1K8RA 3KPJA 4Z0PA 2RGEA 3GN1A 1X2EA 3RYHB 4KXQA 3SSOA 1KO8A 3C3KA 3CLUC 2AN4A 2WF5A 2OBFA 3NHKA 5T6BA 2YFHA 3AEYA 3P0JA 4M36A 1FMTA 5KNCH 5EEHA 5K3OA 4ZZ3A 3NP9A 2JGMA 2QS9A 4BFSA 5LFAA 1U3CA 2I1WA 4O2AB 1HRKA 1QAOA 5J2TF 3K6SB 4ZKDA 3CWCA 2OO5C 4PXAA 4MRVA 4GZMA 3E7FA 1NY6A 1GP2A 5C53B 1IZ8A 1KOLA 4GMGA 4I81A 4BDTA 2PXCA 3PYMA 4JU9A 1PTKA 2OTCA 1O95C 4RA9A 3GJYA 3EQZA 3I92A 4QO8A 1QCYA 1A7AA 3AR2A 3ND7A 4K40A 2CF5A 3SR4A 4JH0A 4YT8A 3GBSA 1E4OA 4V0QA 3AEQB 3H8VA 4KN6A 1DEAA 2NXNA 4Z7NB 3ETCA 3ZCRA 3U3OA 1QP0A 4NMXB 2V9CA 2VK2A 2WE8A 1EUCB 2ZREA 5FPPA 1QOQB 5G53C 5BYKA 3SIRA 1O2DA 3BDIA 2IEDA 4L95C 4MQBA 1SKUA 1FSGA 5LDHA 3STXA 2QTHA 4KE8A 4O08A 1R4NA 3HFRA 2O1EA 1O0BA 1WIWA 5K0ZA 5BY2A 2WIFA 1H6DA 2E6KA 1A27A 4H3HB 2FZ5A 4WVFA 3P32A 1NXWA 4BNJA 3K9CA 4EY5A 3IVXA 4OLAA 2ZTHA 1FJGB 1Y63A 1T1RA 3PL1A 2PR2A 1WR8A 5CFLA 1JN0A 3RIHA 3UT0A 1HORA 3OCYA 4KLRA 1LQTA 4CLHA 3EXIB 3E2MA 3M6XA 3VQTA 1DEOA 3UKJA 4Q7EA 1JR3D 1QGUB 2Q8PA 3N2KB 4L0MA 2RJ3A 4R2XA 5DTIA 1EINA 4CIYA 1IY1A 3EUEA 5ISMA 2G4LA 1CWUA 2B82A 4LDZA 1Q1ZA 2RE8A 1PIWA 3C7TA 1E61A 4KDCA 3ZLUA 5BSHA 1APBA 1OLOA 1U80A 5ALWA 5KYWB 1QRSA 3FVVA 3W9YA 1NXQA 3IBTA 1KYWA 4N7JA 1E98A 2BMVA 3K5WA 4EKYA 5F7XA 3TINA 1JQKA 4AX8A 1JIVA 2WHPA 3OJOA 4FOSA 4MLPA 3C24A 3PXUA 4J9UE 3I6MA 5ALYA 3DULA 4U02A 3FYDA 4OV6B 2A58A 2IDZA 3L4SO 5F2OA 3DPSA 1ZGJA 3EF0A 1LRLA 3DO6A 3GGDA 3GT0A 2I29A 3KVOA 1FS6A 3ZE9A 3EGIA 1J0CA 2H4FA 3L4EA 4AF6A 1MOPA 2WMYA 4DC9A 4PRLA 5TF0A 3DVLA 3KOMA 3SC3A 3CF2A 4MRNA 1YIOA 4UUNA 1WSWA 1NTOA 1YCDA 2B9EA 3GUYA 3JQ8B 4MPTA 5EMKA 4CQMB 4L2IA 3E8SA 4Q3KA 1LXCA 2V7QA 5MN5A 1ZOPA 3DT8A 1G21E 3W34A 4NTZA 2VPYA 4JQCA 4E5NA 1MT3A 4DM4A 1SCQA 3DBLB 2P62A 4IG4A 4P32A 4L9WA 4TVOA 1G3QA 1Z9BA 1DXQA 4F8EA 4JLWA 1WDKA 1DFIA 3PT5A 4R1TA 5M34A 1TI7A 1Y6RA 3ZUPA 1DOZA 1T91A 1UBHS 2MMCA 2NOAA 3KT8A 5JJCA 3GG2A 3HU3A 4I55F 3ECSA 4NBVA 4S35A 4MI9A 1TM7E 2A9KA 3X1JA 1Z06A 3U7FB 3AHGA 4KQWA 1FMFA 3C8HA 4LTDA 2F55A 2XMZA 1CUSA 1RKQA 1KMNA 2XWSA 1PR4A 4GBJA 1NUQA 1QH8A 4GWKA 4X7PA 5TEVA 1V16A 4AN0A 4ZFNA 4ZN6A 3I0NA 3WIEA 4EAQA 3N70A 4R4JA 4CKBA 4C03A 1JAYA 4GXRA 4C6HA 1MMFB 2EJCA 3DFKA 1AZTA 1HUQA 3GHHA 1XRQA 4L78A 2F00A 2C3OA 4O4JB 3SX2A 2ZS9A 1C5KA 3L5KA 4KQJA 4ALLA 2WB4A 4BPRA 3L0CA 4D43A 1IBSA 1YS2X 3MHPA 4EI8A 1FPQA 5ICEA 3OLCX 4U5QA 1ZR4A 2YHIB 1UEIA 3QLTA 4MVJG 4AZWA 1XTBA 4H7DA 1ABBA 4RTSA 1Q15A 1T8WA 3T4XA 4DDHA 1N6PA 1H9BA 2VQFB 2M2IA 4G4GA 5FJJA 4DAOA 4TWBA 4IQGA 4BX8A 2C1XA 3NV7A 1LRKA 4EMUA 3RASA 2FX2A 3LDFA 3MFYA 4XIFA 4A23A 3UJ8A 3UMFA 2GYUA 1GCOA 3NATA 4U8GA 2FEWB 5JADA 5DF1A 1A5TA 3F49S 5BV0A 3F5SA 2XCTB 3QVKA 1IJKA 1LX7A 1PZMA 2ZJ4A 4JP1A 3LJKA 1P4AA 1JYFA 2PPLA 1BE1A 1CF4A 1SBZA 2V6FA 3IMEA 2DLDA 5HOQA 1RLMA 2F9FA 2IPMA 3BTOA 2G0AA 5U4QA 2F3PA 4POOA 1M34A 4MV4A 5C8DA 2MDTA 4KN9S 3VTKA 1XTRA 3GAFA 1KOFA 2FW1A 5H59A 5JSFA 1JBQA 1EE9A 1GGNA 4EKDA 4WWHA 1KI6B 1JDSA 1SUPA 1UINA 2C2XA 4YXWD 4XWKA 3WMRA 2A9JA 4IDQA 4KSYA 4CUKA 1PYGA 2A14A 3FPJA 2CNLA 4KMOA 1AA6A 1DHRA 2D00A 1AF7A 4WXPA 2ZSUA 2XVAA 2Z2IA 4L5BA 1C1HA 2GPJA 4B85A 1S02A 5K3FB 1JB1A 2G5GX 1CY7A 1PDWA 1AGPA 1ITZA 2ZIZA 3GO4A 2D1YA 3L7MA 3UWMA 1TZBA 4KUEA 1I7DA 3RVPA 4MWDA 3O7MA 2YVUA 9ABPA 1LTKA 1TW3A 1XVVA 1NBMD 1KGSA 1RBYA 2BGTA 4LJ8A 2Y1KA 4ZHQB 4S1NA 3NPAA 1Q22A 4B45A 4RV9A 1TVKB 1PZHA 1USKA 4N5MA 3HY3A 1JLKA 2OBLA 3HEAA 4MRMB 1RYYA 2GF9A 4CCWA 2FDCA 2DOKA 2IYOA 2VUHB 2ZBRA 4N1AA 2JVIA 2P3SA 3CUYA 2DKOA 4GX2A 3ZU5A 1BKYA 3DHNA 4IO1A 1QGYA 3Q7TA 3BAFA 1EVJA 4IWNA 4GDMA 4AUNA 1B1CA 2F9LA 4G2TA 4X8HA 4H1UA 1FSZA 2PBFA 1VE9A 4N0DA 2GH1A 4IOJA 1UMKA 1QU3A 3OU6A 1D2RA 2PJDA 2A9RA 1LSOA 1QZZA 3PV0A 4AY4A 4A73A 4CGYA 1VXOA 2P0AA 3BS4A 5SY9A 4D4KA 3HN7A 3VUEA 1ZITA 2FHPA 2LW7A 3ANYB 2OA0A 5MFPA 1XCJA 4MX8A 4FBLA 2XYGA 4MEJA 2AXEA 3UHJA 3IPRA 3V3TA 4Q7MB 3TCKA 2AOTA 4AJ2A 1HDIA 3ET4A 3NHMA 2VNJA 1LSUA 3CUVA 5JJ5A 3P9ZA 5CK5A 2PE5A 2FA9A 1WETA 2DKNA 2G1UA 5JMPA 4QG3A 1UFKA 2EGHA 2WRZA 4BQFA 1JDPA 3RT9A 5KSWB 2H7XA 1DO8A 1GPJA 5JSZA 2PV0A 4V3CA 1NPYA 3W5VA 1YFKA 4J90A 4ATNA 4NNPA 2FEXA 5H4GA 4BV9A 3ADPA 5CD1A 4S1TA 2EHJA 4LJ4A 3DNMA 2G6TA 2HRDA 3A2MA 2IU3A 1WCIB 1XNQB 3RSSA 1ANKA 2XB8A 4EKEA 1F60A 3AVPA 1WCYA 1F8YA 1O97D 1Z4MA 1ZEMA 4IMRA 1PTJC 2JFPA 4IQ4A 4MYRA 5G4KA 3SJUA 2SKEA 4KWHA 3VYUB 5JI3E 1IATA 2H65A 4GGPA 5GOTA 2C4MA 3UJAA 4IUCS 2QR3A 3W6PA 3F9IA 3FNIA 2VJYA 1CP3A 3ANXA 3G0IA 3GZNA 2Z1MA 3OWXA 5DTQA 3V4ZA 3ZJ4A 4EHLA 1NPDA 1EM8A 1G291 2NVWA 3V9AA 3UATA 3G0DA 1WUYA 4FEAA 3RRBA 4TMXA 1SCUA 2RI6A 4N6NA 2IWRA 4B44A 5CW1A 2OBNA 3S27A 2N46A 3MMNA 1OIWA 2AMLA 1WRBA 3R5XA 3UUWA 1W5FA 2Z8YA 3EZ6A 3QEBZ 2B4QA 3KE9A 2FVYA 2ES4A 3H13A 5DASA 2NZ2A 4Q3DA 1RQPA 2F3UA 2NUTB 3RU7A 1MGOA 1ENOA 1J97A 1QE5A 1ZJ5A 4RPJA 5IM5A 4C30A 3FJOA 1JHQA 3QUCA 3GNLA 5D6NA 2BPOA 2K4MA 2VPXA 4FFLA 3WAJA 1QGOA 3IVMA 4U9HS 1D2NA 1U7UA 4JBLA 4YRGA 3NMUF 4LOAA 3DVAB 5FNVA 5T6MA 1DGQA 3PPWA 2LR0A 1YBFA 1VL5A 1R2QA 3SKXA 3HO8A 3BF7A 2H7YA 4YMLA 3HBNA 1BG6A 1UDRA 1XMVA 2DJ5A 1JSCA 2WE7A 2Z09A 3KXDA 3LA8A 3ABRB 3VU8A 4G5HA 2OFWA 3MLEA 4UEOA 3RSQA 1OXXK 2A78A 7YASA 3B5EA 1V4BA 3BVPA 3SXUB 4H4DA 3UFXA 2YVQA 3ISTA 3QLUA 4EK9A 3DXXA 3E84A 1CUHA 1DAPA 3R0XA 4A8JC 2DWPA 2Y1EA 3AJEA 3QPDA 4XASA 2Y8EA 2WFMA 1KSJA 2FK8A 1ZCZA 1AD2A 1TEXA 2WMDA 3U26A 4IY1A 4ZJYA 3GFPA 3IAHA 2XB4A 1SOWA 4D9BA 1KETA 1YS1X 1HSOA 3I1IA 2RIRA 3NYRA 2CVFA 3SM3A 4QULA 7ABPA 3IUPA 4U39A 4WLFA 3ZTYA 4AUMA 5BMVF 2E4YA 2EF0A 1NW9B 5KO2A 1ISFA 1AKMA 4MW1A 1K5DA 2ZJBA 3FLBA 1T35A 2G06A 3P9KA 4H6WA 2XWBF 3QXSA 4JY7A 4X71A 5F5XA 5BQPA 2JJYA 1YXMA 3H5AA 3PF9A 2P3OA 1F0YA 1II8A 3MMPA 1UP6A 3NHZA 4POAA 3R6WA 4TYMA 3W79A 4HQOA 3TN7A 4Y67A 1FFGA 1QIMA 1AN9A 1M7HA 1TAQA 3L1KA 4Q6WA 2N75A 5E1BA 4JYCA 3NHSA 3FFTA 2LD4A 5JUWA 2C97A 2ZTLA 2Q4BA 3K35A 4KXFB 4MRRA 3M3DA 1KP3A 1Z0DA 5A3RA 1N4AA 4RVFA 4L9AA 1QRRA 1GAJA 2PH1A 3M9WA 3MUNA 5LQDA 2JJ2D 3FROA 3ISVA 5FD8A 4D8XA 4JI0B 3OEED 1YASA 4U5XA 2OQIA 3DW1X 3ZK8A 5AK6A 1JFLA 3OEYA 1TCUA 3IUYA 1JT2A 1S5PA 2R6R1 2JGLA 1GSHA 1XXHA 3HVJA 4FQ7A 4QNRA 3T7DA 3R5FA 3IV9A 2WF9A 2EP5A 1XF1A 4B3XA 3DDHA 3ZWVA 4DM3A 3C16C 4D45A 3SVTA 1AGRA 2C2HA 1DQRA 2FX5A 1V3UA 1NGSA 2BH2A 2DM6A 3LNCA 4RK6A 5FTKA 5T4EA 4AJLA 4DJTA 4YXWA 1BCSA 2Y4OA 2QRKA 1ENYA 3LIIA 2AMYA 2P2LA 3W2EA 1ZH2A 5EMNA 3PWSA 4KV9A 1CZUA 4Q7KA 5J1TB 2G9NA 1LF5A 5J2UB 3UT5B 4EI7A 4J7UA 4ZQCB 6PFKA 4QBFA 2CXXA 1CUWA 5BNFA 2GZRA 2OSBA 4QYXA 5CB4A 4RBNA 4D98A 2MSLA 2ZRKA 3KS9A 3TWOA 1GEGA 1YS7A 5C1IA 4KAFA 4HOYA 4E5YA 2XBMA 4E11A 2FPPA 4FIDA 1Y0BA 1T2EA 1NBMA 1H22A 2HFKA 1JQDA 2WU3A 2V58A 4LK2A 4RIGA 2DQZA 2ZCVA 1A5SB 1N2GA 2C3PA 3A27A 3P2JA 3ZTWA 3T1TA 4XQEA 3U44A 1OB2A 3NTXA 3QX8A 4LKOA 4IWYA 4MCIA 1KXZA 2D1TA 3GVCA 1LBSA 2BRUC 3L1UA 3P2KA 4QUDA 5DHTA 3B70A 4K8OA 2C2GA 3WHKA 3PUJA 3F6SA 4XOIA 2JKZA 1ZRHA 4IILA 4MGYR 1QG4A 4MIEA 4FP9A 4RXMA 3AM1A 1Z73A 2AE2A 1XELA 1N6OA 4EQ6A 2RB5A 2M1ZA 3OAAA 4NZ9A 2XQFA 3LUKA 3SLGA 2VTVA 1ISPA 1MIOB 3B20A 3CW2A 4KE9A 5C0OE 2C5SA 3OOEA 3QKTA 2QL6A 3EPKA 1U8YA 1RRMA 1S96A 5K3DA 1YVEI 3GMTA 4GE3A 4KHZA 4JNCA 3LPDA 5LC1A 4BLOA 3H3JA 3I83A 4QSMA 1IEQA 3WWEA 3EAFA 4IZ6A 1C2TA 1RKBA 3F78A 4RMGA 1F5SA 2BMDA 1RMQA 2PZ8A 1DIHA 3BE8A 4JEMA 3T7KA 4CU5A 3BA1A 3I8OA 4NH0A 4OBEA 5LSAA 1JDBC 3HKEA 1KU0A 4O3MA 1U5BB 3M6UA 5KSPA 1ORDA 4RK7A 3WMGA 2JAUA 3OF3A 4G6ZA 3QWBA 3RRXA 1CUXA 1V71A 1EX7A 2ZUDA 1YZNA 1NXXA 1U2RA 1D7OA 4RE5A 1QVRA 3UMSA 3W4IA 1NW7A 2W2OA 3C43A 4I2VA 4LJKA 3R9XB 4PG8A 1E5DA 3DMDA 3RF6A 4Z8XA 1M2FA 3LX4A 3VDXA 3AUYA 3VBCA 1Y6FA 4OBWA 1GM5A 1QQBA 4JVNA 3I4LA 3AINA 3ILHA 1YKFA 3FVRA 3QTBA 4HHEA 2I6TA 3QJYA 2W2MA 5BO5A 3I6QA 3A31A 3MB8A 1QQ6A 4OMFG 3ETDA 5IKMA 1EUQA 1BMDA 1TUEA 3R9IA 4YMVA 1M34E 2XGGA 3AONB 3DLTA 3ZHCA 5KINB 3QNMA 1W8DA 2LWIA 2XXBA 2E48A 1MO3A 1SKQA 4K6FA 2QR5A 1CRZA 4ZCLA 4BMSA 3BJRA 1KNXA 2OZPA 4LGYA 1U3VA 3ZHOA 4EJ0A 1LLFA 1Y6ZA 3A06A 3DHYA 2ECKA 3B1KA 1CJCA 3P20A 4GMFA 4HGQA 1G1AA 2NM0A 4KTTE 5DHAA 3STTA 3ADKA 5B3JC 2C7BA 5CH8A 3W6UA 2UXDB 1GPNA 2Q4TA 4RPCA 3T9EA 2QVLA 3I4FA 1A88A 3SQWA 2FLWA 4OO3A 2QW0X 2O07A 1C1DA 1NM5A 5EJFA 4BGIA 2AFHB 1JXOA 1MJ5A 1M0TA 2JKVA 3H4IA 1LEHA 3DKVA 4M0MA 3SOZA 2ZKIA 3SYNA 3ZCUA 4OI0A 2UVPA 3BCSA 4I36A 5E6SB 1BC5A 3GROA 1H94A 2P4QA 3EEYA 5KYYB 1XFAA 3AK4A 4MIOA 1E2JA 1TMKA 4BLSA 3OX1A 5GY7A 2OV2A 3BMCB 4RH1A 4BRZA 5IFKA 2BEWA 3KB2A 1M6VA 4E07A 3PFBA 1D5CA 4NICA 5LQUA 2IHNA 5DXFA 2WUFA 1V9LA 1BMQA 1XOIA 2C42A 3PKJA 2PKQP 3QKRB 2CXNA 4JDUA 3LGSA 4G9EA 4LJAA 4DLWA 3AI3A 5BW4A 5CFMA 1NWCA 2B37A 4PQYA 4ZTBA 4F45A 2JCYA 4KR9A 2XHEA 4EG5A 1CJBA 1P91A 2WMNB 1CR1A 1FRVA 1TECE 2Y6UA 1GG5A 3A1SA 2MWMA 4Y8VA 2O5CA 1DC7A 3BSWA 4V0NA 1P8AA 4FNOA 3N0VA 1L7XA 2K7ZA 1Z0JA 3IP5A 3AUXA 4O4LB 1T9ZA 3PQCA 4NJMB 4L7QA 2C8VA 2XE8A 4MOWA 3H5LA 2HU7A 1VCOA 1KTIA 4PE5B 1C7QA 4ZCPA 2B61A 1TVCA 3ESRA 3INGA 1CDOA 3MTQA 2BBWA 3T12A 4A6XA 3K1AA 4JD5A 3V8RA 1N6LA 2VEDA 4O3FA 3U7QB 2GHQA 3HBMA 5K4GA 2GN8A 1T8PA 4W1RA 1NVMB 4CUZA 3OFSA 1CV2A 1QHHB 3LFHA 4NCKA 1C14A 3DOJA 4EJ2A 3SQNA 1KAEA 2P7IA 4HRXA 4X41A 5DTJA 1PHRA 2VJMB 1XEXA 2Q3FA 2J0EA 2PWYA 2VK8A 1V0JA 3LRXA 4V24A 1QH1B 2EGGA 2NIPA 3Q88A 1VKNA 2E4VA 2XNKA 1GZ3A 3AM4A 2GEVA 1IN1A 1UQUA 4AUKA 5BWNA 3KUKA 4RH0A 2D2VA 4JBNA 5ADHA 4OBXA 4ZT5A 2R96A 1MEOA 4M9ZA 2H1OA 4ND6A 2P5YA 3TLXA 5JWOA 1H4VB 2NU8A 4NU8X 4YT2A 2QMYA 3M5PA 1ZH6A 3AIMA 4JX8A 1Z6AA 4BO6A 1U1EA 1QYCA 1Z3CA 2B5VA 2ZYAA 3AGPA 4JLDA 3T0FA 3MJFA 1TAHA 3F6EX 3TZ6A 3U7EB 1USVA 3QTTA 1M2JA 2WR8A 4UXJA 3JVDA 3K9HA 1LJLA 1SIUA 1WBJB 1FP7A 1N34B 5JJKA 3UB2A 4FWTA 1Q3HA 4MS3B 2V4ZA 3X2EA 2DVMA 1GQRA 1MB2A 2YIMA 4GX1A 5CHYA 1CBUA 1YAHA 1AZWA 2JJ2A 3ME5A 1CR4A 4H7KA 4Q24A 4R2MA 4ZO8A 1T1IA 1JDNA 3X1ZA 5L6LB 1Z34A 3USES 1G59A 1Y9EA 5HTKA 3LCUA 4FEEA 3B2NA 4PG7A 4I4TF 1Z0ZA 2XTZA 5B6IA 1ECGA 1G8JA 1MENA 1OZFA 1QBGA 3FD8A 3FZGA 3MBKA 4IIFA 1GG2A 4OMCA 1NL3A 2J3HA 3E1GA 1E2LA 2OP0A 1F6BA 4N7RA 2WB2A 1H1LB 3GFFA 5TSDA 1W93A 3EEOA 1UMDB 2JK0A 3E22A 2LPMA 2OO5A 2VDKB 5G3ZA 5LU8A 1M5UA 1EWYA 3X2FA 1HKHA 3TRKA 3U0VA 2L2QA 4ZCRA 3F3SA 3MWDA 2PUCA 2OFFA 1O95A 1M0EA 3PX2A 3V42A 4D3FA 2AR9A 2R751 1R0BA 1V3QE 2JGDA 4MWCA 2GTIA 2GPAA 4IXTA 1KJIA 5CVUA 3VHRA 1HFJA 4MQFB 3WP1B 3WAKA 5JFGA 4FJ1A 4BFTA 5CT8A 2YOGA 5ANRB 1P0MA 3RFXA 2CLHB 3P0RA 3SVLA 3ANNA 2FUCA 1NVBA 5FPSA 3VZDA 4QYWA 2MR5A 5MDHA 2OILA 3AF0A 2CN1A 1XJQA 1M0WA 4RZUA 2G4CA 4N0PA 4N3NA 4P4SB 1Y8ZA 1JHDA 4PSCA 4ZC1A 3Q12A 3RTDA 2QW1A 1EKXA 4BX3A 1SKYE 4DMRA 1TF5A 1C9YA 2XXAA 5FI1B 1HA3A 1JQ3A 1REQB 3V8PA 1FFXA 4IH1A 2NQTA 4CM1A 5JSYA 2C8JA 3HCRA 4Q01A 4N9WA 1QG0A 1PR3A 4O2RA 4ZU6X 4IRMA 3JQGB 1SPBS 5ILGA 3FZEA 1GA1A 1RYNA 4HI0E 3KSBC 4D5EA 2FDRA 1W36B 3V00A 1ORTA 2BKAA 4QPZA 1GZ7A 3TTVA 4YMUA 3WYGA 3WGNA 2GYWA 4JP5A 4WBNB 2PY6A 4DSNA 4NCXA 2J6CA 3D7SA 1EFCA 3RU9A 2JCBA 4GOXA 4MVJA 4XYMA 3WS7A 1U6IA 2HI0A 4JBIA 4HDMA 2G7ZA 3HR7A 4OOFA 4JI2B 3CT4A 1QM5A 3NBMA 3ZVNA 3TSZA 2M1XA 2J4CA 5D3ZA 3ZU4A 2I4NA 4MR7A 2XE6A 1KQ3A 1MO6A 1V35A 2FW7A 3IV7A 1BCRA 3IERA 1ZSVA 1Q44A 5JH7B 1R7RA 3GJTA 4JI7B 3E9YA 4UTXA 1RBZA 3SVZA 1Q1QA 4TXHA 4HRYA 2W2PA 2OVFA 3ZGXA 3EPHA 3CJTA 5CW2A 4FR2A 1H3FA 4GXTA 2X9VA 2Y1GA 3CZ5A 1NKTA 3DC7A 3L02A 4LPSA 1TCBA 5F2EA 4BB5A 5EJ9A 3CRQA 1GLGA 3GEEA 2BT4A 2GD1O 4C5AA 2Q1SA 2HPAA 3EN0A 3T9AA 3EXFA 1GTMA 1XXHE 2AD5A 2HGSA 2GK6A 4GH5A 5I9TA 4Z2YA 1KPGA 2AIRA 3TW0A 3ZE7A 4MP8A 4F7DA 5I3CA 4DR1B 3S0JA 2OBMA 2R8BA 2SBTA 4WOKA 3DGEC 4EUFA 3PWKA 2FMTA 4D99A 4HH3C 4HATA 4RLHA 1YA4A 4WGFA 2GKOA 2VA9A 2IYVA 1EGAA 1SUAA 2YV3A 3DP9A 5FTLA 4JWKA 3RBAA 1VL8A 5AUNB 5F3DA 3LQQA 3HWWA 4KMMA 2LE0A 3WL4A 1VB5A 1Y98A 3G0OA 1RWBA 3RFUA 1XNGA 3B6JA 5BR4A 4AI6A 2JNWA 4FN4A 4WHMA 1E18A 1GYQA 2R48A 3PJEA 3KHKA 2OL4A 2PG3A 4OJMX 3UK6A 3EW9A 4GYYA 4KLAA 5SY4A 5BWOA 3U60B 3I05A 4U2GA 4I1OA 3H4VA 5EERA 1NBME 1NMYA 5IN5A 2LCQA 3L05A 4GU5A 4OF4A 4ZT6A 3THSA 1DXYA 2R25B 2R00C 2D1RA 2QWXA 2XJ9A 4LYDA 1DJLA 1UKCA 3R8CA 4WUVA 1YRWA 2B0CA 3HDGA 1JP7A 2WUWE 1CP2A 2NU9B 4BL5A 4TKUA 5DM0A 3NGXA 3HC7A 2ZIAA 5D1NA 3TQTA 2V98A 4NCNA 1CIJA 1KY4A 3GPIA 2FUEA 2J0UA 1JAHA 3HACA 3L0YA 3VKHA 4O2LA 5DSTA 3K2EA 3O4HA 4CLOA 1ACLA 1WE2A 4GNRA 2BZGA 5BW8A 2NO1A 1GADO 2P6PA 1M6YA 3DBHB 3FUTA 4QPDA 3WLHA 4CHTA 7ADHA 3NW9A 4QBTA 1VKJA 3WK4A 4R9UC 4LV5B 3S6JA 1CEYA 1YQUA 2QDXA 3M4NA 4NHEA 4YDQA 4BLUA 2I5PO 2IKSA 2PMWB 2OQRA 2GSWA 3UT6A 1LBEA 1YVUA 4GEGA 2C61A 2RGNC 2LKCA 2IYXA 2X1HA 5DPMA 3UN1A 3V80A 2JAPA 1P77A 2WV9A 1KC1A 1L7RA 3ZNOA 2IEIA 2P69A 5IJ9B 3OJXA 2PUGA 5P21A 3GA5A 2R1TA 4EGQA 3L9XA 2HBZA 1MGPA 4CM5A 1ZIDA 5JQWA 5K45A 3GMSA 2ZDGA 4TM8A 1JHPA 1Q14A 3V1YA 3JVUA 1RWWA 4I4CA 1IHXA 1QFXA 5EJMA 4UFPA 2HR1A 1T2CA 2P67A 3YASA 1U6KA 5JD6A 1YCGA 4XCQA 3HV2A 4MMXB 4TL9A 3UOAB 2I7XA 4PXSA 1R8JA 2SKCA 3CZQA 5CEEA 4KX5A 4L7VA 3TO5A 5IH7A 4RULA 1WZCA 4QFMA 3GAZA 2O14A 5ILQA 4KJZA 4OVKA 5CH3A 2ZDQA 3OM1A 4RHXA 4BNGA 4EHFA 3Q5DA 4TMFA 4OX9B 1RYEA 4XPIB 4LF5B 2HHHB 1P5JA 3FCUB 2QY9A 4Y6SA 5F2KA 2XMSA 2CXUA 621PA 3HKCB 1XYYA 1D0SA 3QVLA 4BJ5A 4E13A 4U2KA 3SMQA 5AXDA 1ENPA 3HA7A 2L69A 3FHJA 3G68A 3GFVA 4IHKA 3FNHA 4LY6A 4CG1A 5LYYA 1Y9JA 3JQAB 2NO4A 3QBVA 4TN5A 1PRYA 5GVSA 4N54A 3FOBA 1V45E 3ZDZB 3NYWA 3H11B 4FYPA 3K6JA 4OQDA 1TAGA 2ISQA 3D3QA 3WQRA 1FP1D 4BZQA 3HCCA 1E59A 2IHUA 2QVBA 4J49A 3D8BA 1Y5NA 2VK4A 4GLLA 2X77A 2PKQO 5CJPA 1K0UA 2DTEA 4PV7A 3NO4A 4BRSA 3HBFA 2C2OA 4OAPA 4R31A 4YMHA 1YJAA 3BE6A 3ENZA 3TLGA 1KI1A 2NPOA 4P92A 4X1YB 3FOZA 1M7GA 1INLA 2QOEA 3FNRA 1EUYA 3VNVA 3JAKB 3PUIA 1W75A 1Z4QA 4RVCA 1DNPA 3UO8B 1E66A 1ZK3A 3AP1A 5CVCA 1JH9A 3TQHA 1OWMA 2BFCB 2I66A 5KSYA 1RJ9A 4CTNA 1JAIA 3WYEA 1B26A 4IJQA 4QYTA 1YRAA 1JIKA 4LWZA 3M7IA 3AR5A 3KHUA 3ESXA 4EA7A 2WEKA 1K9SA 2HF8A 4CT0A 4P1ZA 5GONB 3X1KA 4LCEA 1UL1X 1AQIA 3GRFA 5EIAA 1ZMBA 1F7UA 1DWQA 2YFYA 3LHDA 1SULA 2PS0A 3B38A 2Z57A 4XDZA 1PEDA 3N5KA 1X7GA 2K5UA 4HVAA 2R44A 1U4SA 2EIXA 3NXKA 3RRNA 2VQ3A 3OPXA 3OD1A 1FLVA 5EY5B 3RS2A 4JVOA 2A7XA 3O2SB 2PMEA 1R12A 5SYMA 2O8FA 4NCAA 1X94A 3GRZA 1P8JA 4LDJA 1BMFA 1PL7A 1P72A 5TQ0A 3JSAA 1GSAA 3UHFA 3STVA 1NOJA 1EFAA 2C5GA 4O2BB 1SGWA 4I9NA 3NVDA 1SVSA 5JMWA 1OE0A 2HU8A 2CJYA 1PTJA 5DJ5A 3AU8A 3BG5A 3ZDEA 4B47A 5MN6A 2QLTA 3ERCA 3EUAA 3MIIA 2HRRA 3VNQA 2IPOA 4CR7A 2X2PA 4S04A 3WQHA 2C00A 2AN3A 4UULA 4GSYA 2P9BA 1G5QA 1BKDR 1OY1A 1TJNA 4HFJA 3N6RA 3MZ0A 1EVKA 6NULA 2H11A 3RREA 3SXJA 1C1YA 1MT0A 1K92A 4KBYA 4LXYA 1KZ9A 1CPYA 2MR6A 2JK1A 4IJ5A 3RNOA 1E2FA 3GARA 3TVDA 3M5CA 5IDQA 5HIIA 4U3JA 1EXWA 2EVWX 2EX4A 4H4EA 3IQFA 5A04A 5LYJB 5DE3A 3CZ9A 4J0HA 3WWOA 5IS2A 3PJRA 1OWOA 5JTTA 4QM7A 3IJ5A 1SY7A 2AG8A 3LQ1A 4LQLA 4ZT7A 1N0HA 3MA0A 3TNDA 1WXWA 2J48A 2QTVB 1DQZA 3FF4A 1Q0HA 4QUHA 2FG7C 2GEFA 3IIIA 4DRXB 4HAUA 3OTWA 1PJ8A 3HXPA 1QFMA 1UK9A 3MMSA 2EGUA 4M49A 4IM7A 3UV3A 4PCLA 3KE8A 3FHCB 4MULA 3H2GA 5CLLA 2XOXA 3JD4A 3DFZA 4R7GA 3FHLA 2O05A 4KPGA 4PVCA 4YX9A 3AOGA 4PC7A 4K9RA 2VG8A 1ZM4A 3TS1A 1DTEA 5D8DA 4Y2HA 4ZA2A 1QCZA 1HKUA 4XB1A 5AK0A 2WBLC 4LCJA 4MS4A 1MG5A 3KBBA 3EQ2A 4Y9RA 4PZ0A 2LBPA 4FOLA 3RGGA 4DSOA 4EGSA 3NWEA 1NJGA 3CUWA 5CA0A 1CCWA 2N0SA 3D6MA 4GOJA 3SIWA 4RPGA 5LQSA 2FLKA 2PAFA 4LAFA 4A8JA 1F7VA 1JVNA 1NC3A 4IV8A 3I64A 3AL2A 3SE7A 3JSXA 5L4SA 4G0WA 1NYTA 1YIDA 1TNDA 1FXWA 1AKEA 1EFPA 2AX3A 2RHGB 3EIWA 1RQGA 4ID9A 4PR0A 4C0HA 4PTYA 4G25A 7AT1A 3OLXA 1RM3A 5A4DA 3CVJA 3OKAA 3PC6A 3FX2A 1XVUA 1O5OA 4JOQA 4PLZA 3RPEA 1LPSA 4AWAA 3U4DA 2GLTA 4RSHA 5KTTA 2I7CA 3FRJA 4NBTA 1ZAYA 1B6GA 4MI3A 4G97A 4ETMA 4GLJA 4LPKA 4O1MA 5DK4A 5HJ7A 1AM4D 5IVKA 1NYLA 4RZSA 2WWTA 3T0IA 3B1YA 5KMGA 4K88A 4UPDA 3F5QA 4HMQA 1WNTA 2R87A 3CT6A 4XVRA 2Q41A 4AIRA 4BV2A 4MVJE 3CVXA 4CKWB 1P9RA 5CCEA 4DLTA 1H6AA 3OSZA 3TUIC 3KAKA 3AUSA 2PLAA 4AKSA 2REQA 4JMLA 3SF8B 2JFBA 3FZNA 1ZU5A 4DFDA 3SHOA 4EPVA 3AIKA 1EGQA 3DDWA 3LUDA 1YQXA 1L7OA 3NBQA 1PZEA 3FDXA 4OLBA 1JNXX 2EIHA 2ZYWX 4ZDJA 1G5IA 4I3GA 5HUHA 4I46A 5KQPA 1KR2A 3DZ8A 3A6HA 3ILVA 3NJ8A 4DHWA 5J4HA 4IQFA 5TVGA 4NBSA 3NUZA 1QX4A 4L9RA 2NWQA 1UBEA 5H81A 5AM0A 1FUUA 5FNVF 1KAOA 3RVQA 1L5ZA 1H2FA 1SKAA 4EJFA 4TV8A 2TYSB 3ZOKA 1RAGA 5BN3B 3IURA 4G81A 1Z8FA 2W2KA 3CRRA 3R3UA 4NOKA 4U2FA 1GZ4A 4Z3DA 3RB8A 1N32B 1KIFA 4FFBA 3T1OA 3IBGA 3UW3A 1RHMA 2F7SA 2C5LA 2VK1A 3OPMA 4HGRA 4PCAA 3ZEIA 4NMHA 1YK1A 1Z5NA 3LY7A 3CEJA 3GLVA 4FK8A 1VZ2A 5FFFA 4BO4A 4ZYWA 4YLYA 1FDUA 1KAGA 1OKKD 1IN7A 1NLZA 4NFLA 3TSAA 2Z4SA 2C9DA 1U3TA 5ECDA 1K88A 1E2HA 1SBHA 2HTFA 3O4GA 3PNOA 2FZ4A 3QX9A 3K6KA 4O5AA 3TRDA 3UYLA 4BNZA 4D97A 1CG6A 3CIOA 3GP3A 2IYEA 3M0EA 1U11A 1RC1A 1XJ5A 1DAKA 3BMNB 1NPTO 2PGOA 3DT9A 4XGRA 3OT5A 1U7TA 5BN5B 2BRUA 3OE4A 4UBOA 4C21A 2RHMA 1P4JA 4FCVA 5FBKA 5U1PA 4REMA 3IP6A 3MWJA 4TWJA 4Z9XA 3A9TA 4ODIA 3VOSA 3FTFA 4RTJA 1NDHA 2IYPA 1WV0A 3G2IA 3KX2A 3OPYA 4R41A 4DY6A 1O94C 1RXYA 4RPLA 1W96A 1JHZA 2AC2A 1L7AA 4X84A 1LDMA 1ZRNA 5BXQC 3CJRA 4YJ2A 2AFVA 4JA2A 3C2QA 3H9BA 2HBYA 3W5IA 1QYRA 4ALNA 4TT8A 3CNEA 4YGYA 4TLEA 3LDHA 4YRRA 1DAMA 4C0WA 3G02A 4MVJH 1VB3A 3FB1A 4MWTA 3WNVA 3OLQA 1M2VB 3IPCA 2QZSA 2J9ZB 1Z6QA 4OGLA 1Z2EA 3O1IC 3D81A 3GV0A 4PXYA 4TKVA 1XC7A 3HLYA 3CVWA 4IMPA 5I7HA 1KI3A 1BD4A 1ETUA 5EMMA 2CC2A 4IDEA 5IT9A 3Q41A 3MGKA 1CJMA 1YMUA 1H2XA 2G0TA 5ALMA 4FB4A 4QXAA 4QNMA 4V0KA 3ZYZA 3OVMA 1EK2A 1MX9A 3C7AA 4JQOA 1Y4DE 1Z22A 3DFMA 4PIVA 3EEFA 3WQQA 4IO0A 4NESA 5CFOA 4QDZA 3HB0A 4G0QA 4P3YA 3URKA 2EFCB 3RC8A 1YH3A 1EUDB 4GRDA 3FNBA 5B36A 1K6JA 5KYKA 1T1SA 1DRWA 1XN4A 2WTEA 2FEPA 3HVUA 4F2DA 3KQNA 4NYMR 5L8VA 1DXOA 5JYCA 3ZY4A 1TB4A 4DZRA 1DBWA 2VO1A 4LF7B 3R7LA 3UAYA 1WKVA 5JD3A 4BKMA 2YMLA 3E1KA 1YTUA 3L0ZA 4BNMA 3AWDA 1J7JA 5ER6A 2YX1A 1AT1A 1SXHA 4YCMA 5B3JA 2HEGA 1L5GB 4LX8A 5EC8A 1TD1A 4JJAA 5A03A 1Z6GA 2W00A 1XPJA 3N59A 1RCUA 5ADWA 4IJMA 4BAUA 1TT5A 2IXGA 5T67A 3OBIA 5A9TA 1N7JA 1NV9A 2I8LA 2IVZA 4RD4A 3V48A 2VZLA 2C20A 4C1NA 3ZNPA 4HY3A 2ICAA 4UPVA 2IH5A 3BMQB 5CDGA 5L3QA 4LYHA 4DPKA 3SS8A 3T7EA 2Q8QA 1CQIA 3W5CA 4Z8YA 3D8UA 4W5HA 1NNLA 2BGKA 2VYFA 2WYIA 2P5SA 2OCAA 3HPRA 5EXDA 4C1BA 3SEZA 5CGZA 2VXYA 4YRJA 1R9NA 3G2HA 4COKA 1TCCA 2VSFA 1CY1A 5AJZA 4G23A 1IEXA 3ORYA 5DM1A 3NIWA 1UBUS 1FE8A 3LS2A 5AI4A 1HF3A 2V97A 3JARB 5DHFA 3QXHA 4DQVA 4B6QA 2WAXA 4GDFA 1QHIA 4AJ9A 4ZICA 1GSOA 3UWKA 5LMNB 1HSZA 1IJEA 1DJNA 2CXHA 2H1RA 4OGKA 2I99A 1L8QA 4BBPA 4F91B 4ARBA 1ATIA 4RZIA 1EP2B 1U0RA 2JFXA 2DB3A 4BVEA 4EA8A 4JODA 5CBKA 1X8XA 1JMVA 1W5EA 4HPXB 4IMIB 1R6TA 4I8IA 1P61B 1J8YF 5C5EA 3G17A 2H18A 5CLGA 3C0KA 1ZGBA 4RKRA 5AYVA 3X1WA 3C87A 3DE0X 1J8VA 1IBKB 1P6UA 5JARA 2PWZA 4Z0TA 5A4FS 4Q21A 1CQJB 1W581 5EHNA 3A9SA 3RC2A 2B0JA 2GPNA 3W8EA 4WNYA 5HMMA 4E5KA 4CCYB 2AF4C 2OC4A 3B6KA 3A6KA 2XOKD 1FSPA 3V32A 5CB6A 2QAJA 1KI8A 4WKNA 4XR9A 3WZLA 1Z0FA 4EJ6A 5LQNA 3HMQA 3AQIA 3ED5A 3TW6A 5E1OA 3K96A 4MV6A 4NEQA 5B2FA 3H04A 1O08A 2CZGA 4RTOA 3R09A 3AEKB 1USIA 4QNNA 1DPFA 2HA4A 4ARUA 4HAVA 3ANLA 3QK7A 3NT2A 1JG7A 5KBYA 2ODWA 3ACBA 1C8VB 3JQRA 4W1PA 4BCBA 1OGJA 2VPZA 4II2A 4O2AA 3AR8A 4R3UC 1SXPA 5B2ZA 1LNQA 3AM3A 3K70C 1OLSB 2Q27A 1I9CA 2UYOA 3GT3A 4JJGA 3OE7D 1SCJA 3T4PA 4LNUB 3BICA 3HDJA 5TR9A 3OIVA 1CVRA 4R1MA 1HMYA 3RANA 2Y67A 1LNSA 2J3DA 3O84A 4JJIA 4C0SA 3AEQA 3B1XA 3R3WA 3SC6A 3B8HA 4KLNA 4FXPA 2A33A 2IE8A 4HR7A 2W2QA 4KKVA 4PLCA 5IT4A 3N7TA 3KL2A 1TLLA 4E5DA 1C30B 2B4TO 5C4GB 2OMEA 1DX4A 1C4WA 2QD4A 3NCHA 3QV1A 4HVCA 4UM9B 5AVSA 3QVTA 1Q2XA 3VHLB 1MB0A 3PKIA 3VZCA 2X0DA 4CV0A 5FWYA 2JH9A 2WT4A 3MF4A 2OB2A 4HNGA 5DCWA 1DKPA 1QANA 1WUKS 3LUCA 1HZJA 1L5NA 2J6BA 4MR9B 4B8YA 1HG0A 5KCZA 1ZH4A 1VSUA 2Y1CA 3W5HA 5MN4A 2DXIA 2MSEB 3CX8A 1HK7A 1LY1A 1ZN2A 1P2UA 2Q5LA 1RRPA 4RD1A 3ZS8A 3LKZA 2FG6C 4ESVA 1QGUA 4DMMA 3N2KA 4RK4A 1X92A 4E03A 5LM3A 4FLMA 1KAHA 1R3UA 3NANA 1P7ZA 4MW2A 4FSDA 3VHXA 2W2NA 1TX4B 2GCEA 3GLTA 4KO3S 4QELA 4UW9A 3GBVA 3U17A 2IZZA 4YPFA 1NF9A 5GP1A 4ZTUB 1W6UA 4QJ4A 3FYUC 4TXNA 1GPAA 3AT1A 5FFMA 2I3BA 1KWKA 2I2BA 4KPEC 3V8MA 4G8CA 1SKMA 4BLVA 3A25A 2DY0A 3I9OA 4GWLA 1JGTA 4CQLA 2QRJA 2IZOA 3W6OA 4BO7A 2TRSB 1GZVA 1E8MA 1YBVA 1C4KA 3RYIB 2Z9CA 1IJBA 1SG0A 2W6NA 3Q3EA 4G0NA 5KSZA 1Z4NA 1QMGA 4FR0A 4CN9A 1FDSA 2ZIEA 3DAOA 4J0GA 2CXOA 5HF6A 3E9ZA 5A2GA 4DLBA 4DUGD 4UHKA 3VSAA 3SWWA 1DC6A 2D1QA 3UHOA 3PZBA 5DLQC 3W04A 3CPSA 4BTVA 1WU7A 4ZOCA 1PHPA 2GPWA 2C0QA 4UBMA 4X1IB 1C1XB 4M89A 4P84A 3STHA 1DZIA 1IEVA 4BQIA 1YAJA 3PNPA 1AUPA 5KHLB 5L40A 1UIRA 3IEKA 1H5NA 4OU5A 3G8CA 3A0RB 1X1AA 1J2YA 2X4LA 1FYDA 3HRIA 5IZ4A 2W43A 1QR6A 3DDZX 1MAWA 3L7KA 1XTUA 1P0CA 3M49A 1TJYA 4V0OA 4YEDA 5EMHA 5F76A 3NOQA 1CIPA 1PJZA 4XSVA 1M2EA 3KV1A 3TQOA 4G0ZA 1V39A 1H5QA 4A26A 4PRYA 1GWNA 1XHLA 3UM9A 1OXSC 1P1CA 1TRHA 3ZCXA 1I0LA 1Q12A 4RJTA 4F3TA 2WDZA 1B8NA 2VBFA 1M67A 4REQB 3DSRA 3W77A 1NF8A 4C43A 4YUZA 4ZV9A 1GTRA 4HQLA 1F38A 4WK4B 5C35A 4HUQA 3K8ZA 1UFRA 1GU1A 4V03A 5AOVA 4TMWA 4B3GA 5CCDA 1DKOA 2I62A 2P1RA 1GNTA 2AQKA 1GT91 4RL4A 1UKYA 4YDHB 3R76A 3KSMA 1F2DA 2VHCA 4B48A 2P0YA 3RS8A 4MDYA 5D87A 3JYLA 4ISBA 1SIWA 2JLQA 4W1SA 1Y6GA 5H02A 1N2XA 3JAWA 1M2GA 1E92A 3LC0A 3A6GA 4G4JA 1UOOA 1CB0A 3FUUA 4Y6LA 2WIKA 4L76A 4CCAA 2X4IA 5J4KA 3FSGA 4MWSA 3A04A 3A1DA 2YHIA 2CJPA 2FWJA 1DT5A 2I2WA 2R00A 3KKZA 3ACCA 2ZXFA 3JQDA 3W06A 1HNXB 1MHTA 3PHJA 1D4AA 3CONA 3R7NA 1N4DA 4P8RA 2AEFA 5KZMB 3SHVA 3VU1A 5J40A 2O0JA 1SUDA 2PFKA 5E7IA 1DLIA 3OUZA 2N1MA 4MKGA 2VKTA 3RUHA 4ZZIA 2WSLA 2E4WA 2SHKA 3F1KA 4MVJF 3RV3A 1XVIA 4HGYA 1OD6A 4LC0A 1XKTA 3W90A 1AZLA 3ZZ1A 3C45A 4B6EA 5KOJB 5J5AA 4N3AA 1EX1A 1I1OA 4LDPA 1B2RA 1OFTA 2Q6LA 3DFUA 1XEWY 2RGNA 4LZNA 4E12A 2F3QA 2NX2A 1V5FA 4CKEA 3DBIA 2Q7XA 1T8YA 2H07A 2R6JA 3D4OA 1RM5A 1KI6A 3TLBA 1CKEA 4XW2A 3TGPA 3P8ZA 1N2IA 5DGXA 3ZU6A 3HZRA 1AUQA 4EHJA 3PPXA 2QD1A 2NT3A 5KDOA 3HCFA 3L0SA 5EWLB 1I7PA 1N0IA 1SR8A 3HI4A 1P73A 4P86A 2PPVA 1BQ3A 2WJ3A 2Z56A 3ELWA 3K16A 4IZOA 4JXJA 4OIFA 4PGGA 4NCHA 5DH9A 1I3MA 2OYCA 1SG9A 2B8NA 3C6XA 5T5QA 2HSWA 3H18A 3ZG6A 4X6XA 2XOKA 2PSFA 3CKKA 2GEDA 3Q8XB 3L6OO 5CNJA 5C5DA 3KHTA 4UHDA 2ZYGA 1C4XA 1T9DA 3OPYI 5H70A 4BU1A 4FFNA 2KPOA 5I47A 1DP4A 4G5GA 1TVKA 4KWIA 4INOA 3UGQA 1J2UA 1OX4A 5D7BA 1NDUA 3W2IA