4EF8A

Crystal structure of dihydroorotate dehydrogenase from leishmania major in complex with phenyl isothiocyanate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
313
structure length
313
Chain Sequence
SMSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSKSCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGLSMRENVEMCKRLAAVATEKGVILELNLSCPNVPGKPQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQEEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Target sites for the design of anti-trypanosomatid drugs based on the structure of dihydroorotate dehydrogenase.
pubmed rcsb
source organism Leishmania major
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 111
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.3.1: Transferred entry: 1.3.98.1.
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 4ef8A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ef8A01
3O63A 1G4TA 4M19A 3NL2A 4U28A 2B7PA 2H90A 4M5PA 3T40A 1KFCA 4PFMA 3Q37A 4KFOA 4EVZA 4JX4A 4M6PA 4JX5A 1OFEA 4TX9A 2G95A 1ADOA 1FWWA 3LDVA 5D32A 2TMDA 3L5LA 5FF2A 1GPWA 3PUOA 3I7QA 5IBXC 3IGSA 1SPQA 4AWTA 3W1XA 4K36A 5FF0A 2ATMA 2AAMA 1NVMA 4JTEA 3W86A 5BMWA 1G7VA 1ME9A 1FCUA 3QSRA 2Y7GA 1RD5A 2ISVA 1YXDA 3UZJA 1OK4A 2DP3A 3BO9A 5IBXA 3W7IA 2V2DA 2V5LA 5CKSA 1R2SA 2VEMA 1LDCA 3W87A 5BRBA 2V2CA 3TW6A 3KOFA 1VRDA 4GXMA 1TCDA 5K3VA 1SW0A 2Y61A 3KXQA 3NPXA 1R47A 3STCA 4NJIA 4Q33A 3DHFA 2E5CA 1JUKA 2HSAA 1H7RA 1OJXA 4S2CA 2FLIA 3TXZA 4TIMA 3ELFA 3QW4B 4R33A 5EL1A 2ZRUA 2WNNA 1H5YA 1KLYA 1DORA 3TJXA 4GWEA 3DU0A 3W7OA 1HG3A 3EWWA 1TTPA 1ZAIA 1Q6OA 4JTJA 3LCWA 2ATSA 2ZFAA 1H63A 3P7YA 5C54A 3M44A 3AO0A 1L9WA 1K8XA 1XL9A 4ZQCA 2X16A 4A21A 2VFEA 5BNKA 4HNNA 1C8VA 2CLMA 3LCXA 3EB2A 4M7TA 4UFIA 3FFSA 3P8JA 5AOUA 4I7VA 3F4WA 5D30A 1ZAHA 1I2QA 3RNDA 3WJWA 2TSYA 3C2EA 1GJPA 2ZZ7A 3GDMA 4X22A 3MBDA 3LI1A 2WJZA 1TRDA 4IX0A 2QR6A 5HUPA 5FF7A 4MZ8A 1J5TA 3W7NA 4CQAA 3EKZA 3W7CA 2B7NA 4MYXA 1QO2A 4OBTA 3O6YX 2YR1A 2Y7EA 2J6XA 5U4NA 3GXTA 4NXKA 4O1CA 3QYQA 1QPQA 4YLWA 1YTKA 2QKFA 2WSQA 1LTDA 2WNQA 2X1UA 3LRKA 3GKAA 1QAPA 1QR7A 4RX0A 4DBDA 2FIQA 2GPTA 3UWZA 3EEGA 2GVLA 1TJPA 3W73A 3BG3A 1SW3A 4O53A 3L0NA 3Q94A 2C6QA 4O1AA 1JCXA 3ABOA 1K03A 2JK2A 3B05A 3C8FA 2B4GA 1ZCOA 4MVAA 4P61A 3NQ6A 2GVGA 2J9XA 3W7QA 3MW7A 1KFKA 5ABTA 3RMJA 2CLOA 5CZJA 3UWVA 3EWZA 1YXCA 1PVNA 1WDWA 2VEIA 4FNSA 1N8FA 4WZHA 2EHHA 3CM4A 3M41A 3NL3A 1TPVA 2PE4A 5CGQA 5DXXA 1GOXA 1FBAA 3QPZA 4HKPA 4S2BA 2LLEA 5K9CA 4X2RA 4HPJA 3LX9A 4FIRA 5BMXA 3A5FA 2B0MA 1I2PA 3A9IA 3MO7A 4IMFA 4JDYA 1FCVA 4AAJA 2C16A 3W1UA 2AQWA 3R8RA 2ZDRA 3UD6A 4ZL1A 1G4PA 2Z1BA 3GXNA 4I7WA 3FEMA 2E09A 3THAA 3E49A 4JTIA 3R5EA 2GQAA 3WJSA 5DCDA 1WBJA 1IGSA 1RQBA 4FX7A 4UTTC 4O4VA 3NL5A 2D73A 4CCDA 4UTJA 2ZRYA 3W2JA 3U6WA 3C2VA 5AFDA 3LXAA 1U5JA 1VPXA 2G96A 1BKSA 1D3GA 2VFGA 3NA8A 1NF7A 2NWSA 1XFBA 1WOAA 4LRSA 4UTTA 4HT3A 2QEZA 3GDRA 1L6YA 3P8IA 3PBUA 1XXXA 1PCKA 3DI1A 3YPIA 1P0KA 4IMDA 2A0NA 1LRTA 1FCQA 3DHDA 3IGXA 1HO4A 3T44A 2QCCA 5KMYA 2NX9A 3S1UA 3RLVA 1B9BA 1HUVA 1UCWA 4NXSA 1JCJA 2XN1A 1SFLA 4MJZA 4MLJA 1J4EA 4JNMA 1MSSA 3GKFA 3BPWA 3TDFA 5A5WA 1R30A 3P80A 5K9DA 3JS3A 3W2NA 2A4AA 5CG7A 1XDMA 1TPC1 3TAKA 3WK3A 3OVRA 3ABQA 1FUYA 2YFOA 2B7QA 3OIXA 3TW7A 2FPYA 4JIPA 4UTKA 3FKRA 2A5HA 3GIYA 2C14A 4UNLA 4NUWA 4LVAA 4EF8A 2DZTA 1QPNA 2CZDA 3EX3A 2O7QA 3HG4A 4CNPA 4L4MA 2ZZ4A 1AK5A 3NPVA 2YFNA 1CW2A 4JN6A 1ONRA 4RXFA 4KWVA 2C1HA 1H61A 4TMCA 2P0OA 2EF9A 4QJ1A 1L2UA 3HG2A 3TC7A 4CLMA 3GAYA 1PL9A 4I9AA 1F7BA 3G1HA 4NU7A 3A21A 3TMLA 5LNVA 4AF0B 3SIZA 4FIQA 4AVFA 1EEPA 4KFPA 4GJ1A 1OX6A 5AYYA 4BF9A 1LROA 2RH9A 5AHNA 1I4NA 2A21A 2VXNA 1LLWA 1JUEA 2ZQ0A 2DZVA 4N9EA 3NQ2A 3ZS4A 3CQ0A 4NJJA 2F7FA 2JGQA 1FDZA 1EIXA 3HQ1A 3W1TA 1YPFA 3TCEA 4JYDA 2VFIA 1T99A 3N9RA 4BI7A 5AC7A 2RFGA 2R14A 1W3TA 2CU0A 2O7SA 5G1TA 2QCFA 5HQEA 3PBWA 3C3NA 3PVFA 2NX1A 3UQNA 5LHEA 5HNRA 3N14A 3G1FA 3IIVA 4QIUA 2Z2UA 1KFJA 4PODA 3W1PA 4PCFA 5I3KA 5AHIA 3S1VA 5HMSA 3B06A 3O1NA 3M5VA 4QM1A 2ZZ6A 2CZFA 2TPSA 4UR7A 3LHUA 4A29A 5D2WA 3EWUA 5EKYA 5I3GA 1OFDA 3FJLA 2ZTKA 3BLIA 3LXCA 1OK6A 2FB2A 3QC3A 5F2MA 1VHCA 2WV8A 3KHJA 5AC8A 3OA3A 1FX6A 3I65A 3W88A 3QQ0A 1H60A 1YDNA 3W7MA 3VI2A 3RU6A 5LHFA 1XM3A 2QAPA 4UTMA 1JCYA 3DFSA 1SZNA 1A5SA 3W70A 3GAKA 3I6RA 1VH7A 2QCMA 1ALDA 1XBVA 2ALDA 3NG3A 1O4UA 1KLZA 3PBYA 3EX2A 3QF0A 4MOZA 4Y96A 2DORA 1IXQA 2NUYA 1K3UA 1YXYA 3NM3A 3W7DA 1KW1A 1P5BA 4ZMGA 1L6SA 1Q3NA 1BWKA 4UFLA 3SGZA 1B3OA 4QNWA 2QDGA 3DBPA 2H3DA 4MYAA 4IMEA 4M6QA 1WV2A 5KINA 1FWRA 4JTFA 3TSBA 1GVSA 4JEQA 4JY9A 2ZTJA 1W1ZA 1GTEA 4LTSA 3QEZA 3LCIA 5MHBA 2Z0IA 4LY8A 1EX5A 3P84A 4TO8A 4NJKA 4XBKA 3NL6A 5DBUA 3DZ1A 5LKYA 4Z1DA 3LGEA 5DXYA 1ICSA 3UY8A 3NZRA 3R89A 4I7UA 3NXFA 2V5BA 1NAL1 3IIZA 5D2YA 3SR7A 3F1QA 1HFBA 1SU5A 2JKAA 4XTIA 2R8WA 4M7SA 2E68A 3GVGA 1H1ZA 2Z6JA 5LNWA 3BW4A 4LC8A 3DFTA 1Z41A 4BWLC 1KFBA 2J27A 4LUIA 4DO4A 3BG5A 3TC6A 3TE9A 1PHWA 4O16A 2GJLA 2DU2A 4OV4A 2OJPA 3LTYA 4S1FA 3B0PA 5HULA 3G1VA 4BWLA 4IUOA 5D37A 3M16A 4XQ6A 1I2NA 3PB0A 4MY8A 4NNAA 5C2XA 3ZR4A 3EXTA 5AC6A 3S8HA 2E5DA 5TIMA 3GR7A 3EX1A 4LVBA 3T4CA 4K37A 3HGOA 3OVPA 1DV7A 1YTDA 2V82A 4NZJA 5D09A 3QMTA 5FEWA 1EUAA 3VE9A 4WX2A 4AHQA 4JX6A 3IGUA 2F84A 2BSLA 6ALDA 1G67A 4Q32A 5U7SA 1JJKA 4YWIA 2WSYA 1JCLA 4FB7A 1VCGA 4MFEA 1EP1A 2H8XA 4IGHA 1YLVA 3NGJA 1C9DA 1UASA 4MKNA 4E2DA 3W2UA 1KTNA 3CPRA 4BI6A 1RPXA 2OT1A 4OHQA 5AHEA 1EP2A 4DPPA 4DEFA 1KTCA 3W74A 3W84A 2G97A 3G0SA 4CCEA 4AEOA 4TU1A 3BVJA 1VCVA 3WFAA 1QPOA 1NEYA 3FIGA 1H7OA 1K7XA 2C13A 1QFEA 2J9ZA 4AH7A 5D02A 4QQ3A 4JS3A 2NXGA 1VYPX 2XFWA 3HPXA 1HTIA 1VQTA 2CLFA 4GUJA 2JKPA 3BLFA 1OHLA 1F73A 3QPYA 1A50A 2QCLA 5DY3A 3VNDA 3P5YA 4QAIA 1LOLA 3DFNA 1M7PA 2A85A 1KFLA 4MJMA 3UWYA 3DFQA 1SZFA 2NV1A 4FX8A 1G6CA 3W07A 3HB9A 4Q4KA 5EA9A 2JKEA 4EWND 2Q3RA 5EBUA 4NX5A 4MY1A 1S5TA 3LCLA 5AHMA 2FB3A 4JTUA 4UXDA 4ZVJA 1SSDA 1KBJA 3USBA 1G4EA 3HOJA 2W0UA 5D05A 3O6CA 2DZWA 3W23A 4ZQNA 4UC5A 1VLIA 4NNBA 5KZMA 3EWXA 2VFDA 2BZNA 1OABA 5CPMA 3PC0A 3TUUA 5DY2A 3FS2A 1F6PA 3W7RA 5KZEA 3KRSA 5F4SA 2TRSA 2CZ5A 3HF3A 4N2YA 4ZQPA 3GNDA 3E9AA 4MY9A 4KFNA 4M6VA 1OVDA 3BK0A 1ME7A 3SY5A 3HGRA 3L0KA 2A2IA 5H91A 1FY6A 2ZRWA 1ZHAA 2Q3OA 4RR4A 1RQHA 1GEQA 3W7JA 1XUUA 5SWUA 1ME8A 4O52A 1EPXA 4U4MA 2YX0A 4MZ1A 4OE7A 1VCFA 2GVJA 1OFQA 3I7RA 3V75A 3UWWA 4JXCA 3CU2A 4WOZA 3MBFA 3TH6A 1F6KA 4HSOA 4L4LA 2V81A 4H6KA 3PY2A 1JRCA 2P1FA 1PHQA 2J88A 3LM7A 3MP4A 4GUFA 5BOOA 4ML9A 2GOUA 4GBUA 1NFBA 4MPQA 3LBCA 4OT7A 2XN2A 1ZENA 3ANYA 2NXHA 3UXAA 2GUUA 3E0IA 3MUXA 4FX6M 1LBLA 4IMCA 4A3UA 1S5VA 1WOBA 3INPA 3HMJG 3NQAA 3E02A 4MZYA 1QOQA 2PC4A 2Q8ZA 1EWDA 3NQGA 3W7KA 2FPVA 4FEZA 3IRDA 5C55A 3WJZA 3A5VA 1TSIA 2JBMA 1K02A 3NQEA 3NQMA 2W79A 5HR6A 3CWOX 2Y85A 1X7FA 1M7OA 1ZFJA 3ABSA 2C3ZA 1TPB1 2ZRXA 3LERA 2W6RA 1EB3A 2OZ0A 4AXKA 5T26A 2Y89A 3HPSA 3STEA 4JDBA 3W1LA 3FLUA 5TQLA 2YXGA 3W2MA 1YDOA 2UV8G 1I8JA 1OFOA 3JR2A 4IX2A 3UY7A 4N4PA 4AWSA 2A1YA 1QO5A 1W5QA 2VOMA 5E93A 1S5WA 2DJXA 1Q6RA 2ZZ1A 4O13A 2FJKA 3TK7A 5K7JA 1W31A 1PV8A 5D2TA 3EXRA 1KBIA 2GQ8A 2RHGA 2ZA1A 4KKXA 3TA6A 3GXPA 5HINA 3BV4A 4XWUA 3P60A 3W1MA 2E5BA 4DQWA 4HNUA 2A7NA 3O6DA 1DL3A 1SO6A 3D0CA 1TB3A 3IIXA 2Y62A 4AHOA 1TPFA 4H4IA 4ORIA 3TAOA 3KAOA 3TIMA 5LSMA 1GYLA 1FWTA 3DXIA 4POCA 2QCGA 3L68A 1GT8A 3SW6A 2PRHA 3S5YA 3LI0A 4NVTA 2X2GA 1H1YA 4LV4A 4A2RA 4FO4A 3F4NA 4DBEA 1VJIA 3IVUA 1GG0A 1JQVA 1SR9A 2E77A 3LHZA 1EP3A 3MI6A 1UUMA 3LCHA 1N7KA 3HG5A 1TREA 4PTNA 1WXJA 4UNKA 3NR0A 5G2WA 2PURA 3BARA 3M5YA 5HJLA 4C1KA 1SZEA 4UMBA 4RV8A 4XBSA 1G69A 2V30A 1TYGA 1UBSA 2V0TA 1TPEA 2CLEA 3I68A 4LS2A 1S3HA 1OG0A 4AB4A 2EKCA 3P62A 3BGJA 4ADSA 4LRTA 4LV9A 3BW3A 1F76A 1V5XA 3S42A 1W56A 4YCPA 1H7WA 3O16A 3IVTA 4WY0F 2ZZ2A 1F5ZA 5J5DA 3HJZA 1HL2A 1K8ZA 3T7VA 3UZ5A 1G4SA 3TMQA 3KVLA 5HUOA 3LTSA 3TQVA 3L2IA 1GVQA 4ADUA 4GUGA 3NO5A 3LOTA 5F4WA 1N55A 2QAFA 2R94A 5G2IA 1TPWA 3UXDA 1ZY9A 3LTPA 2YPIA 2FFCA 3DAQA 3W76A 4O0ZA 4UTUA 2X1TA 1LRQA 1ICQA 1KV8A 4UMAA 3T55A 3B0UX 3L5AA 1QPRA 6TIMA 3E96A 1KFEA 3DH7A 4JGDA 3W6YA 2G5WA 4JTGA 4UIOA 1U83A 2OX1A 3EX6A 3SSJA 5K9XA 4CQ8A 1OYAA 4JTKA 3CTLA 4WY0B 1K7FA 3KRUA 5TBOA 4A2SA 1XI3A 4FNRA 1TTIA 4O1BA 4NNCA 4BI5A 3SJ3A 2DZXA 4H3DA 4EIVA 3S9YA 1UUOA 3DGRA 3GDLA 3S1WA 3NPWA 1XUZA 3LRLA 1Z48A 5I3HA 1FDYA 5LZLA 1KM1A 3O05A 2QCDB 2J9YA 4WXZA 4O28A 1W54A 5D38A 4O1DA 4K38A 5DLCA 3MJYA 5C5YA 2I1OA 1C29A 2RDTA 4J9JA 3I7SA 1PCWA 1DOSA 2A6NA 3NM1A 3GZ3A 3EX4A 4Z0SA 1FCBA 4Z08A 2CZEA 4YL2A 3PR2A 3GDTA 1VS1A 5HR7A 3STGA 1JUBA 2DZUA 1VGAA 4JTHA 3CHVA 4O11A 1T96A 3QW3A 3ATZA 5D33A 3CC1A 3PSWA 4IJBA 1FWNA 2A6LA 3QRHA 2ZYFA 4WXYA 5J5RA 3QSTA 4Z1CA 1HO1A 3NQ8A 4O15A 5FEPA 3STFA 1THFD 1WAUA 3QJAA 2Z6IA 5F1VA 3W7LA 2C0AA 3PUEA 1SO4A 3QMSA 1R46A 4LW7A 2NUXA 4ZQMA 5EY5A 4IPIA 3S6DA 1D3HA 1Y0EA 4GNJA 5CPLA 4LVDA 5D03A 3C6CA 3LV5A 3O15A 4IXXA 2PCQA 3C61A 3B03A 4Z1AA 2I14A 4LT9A 5F2GA 2WKJA 1VYRA 3CEUA 3H54A 3S5OA 1AW5A 3T78A 3NOEA 3UPBA 1DKWA 5FESA 4NZFA 3NQDA 5G4EA 1QMLA 3C56A 1A5AA 4N6EA 3SECA 4K7YA 4CNNA 4RJEA 3TFXA 4O17A 3U8GA 1QDSA 2ZZ5A 3M5ZA 3N9SA 1AG1O 1JCMP 4PL1A 2WPBA 3UWUA 4CCCA 1SUXA 1H51A 2V9DA 3LCFA 2P10A 1AW2A 2YSWA 3NQ7A 2YDAA 4O4WA 1KM3A 4IQLA 2ZBTA 1XBYA 3GX9A 3THQA 3TSMA 1MZHA 5LNUA 1Q45A 4JIQA 2YZRA 3FJ6A 5C6MA 5AHFA 1B4KA 2FTPA 5G5IA 4GUHA 4NJGA 1F05A 4HPXA 3SFKA 2PRLA 1B4EA 1W8SA 3W1NA 1GWJA 3QM3A 4DF0A 3A23A 3C2FA 1DJQA 3HIJA 5I3JA 1LRNA 1LBMA 4XTDA 2CLHA 4C1LA 1H7PA 1I2RA 2FPTA 1O5KA 2HS6A 1TV5A 5FF4A 1OX5A 1RZMA 4UR8A 1TPDA 3W22A 1KM4A 3R2GA 5HWJA 4LVFA 4E0CA 3N2MA 3NPUA 2BLEA 1BTMA 4GFSA 1JULA 4JTSA 2RDWA 1UB3A 2V2HA 2VELA 5AYXA 5CZTA 4WY0A 4DF2A 2QCNA 4UFHA 3PG8A 3OEXA 3PBVA 4NQ1A 1LYXA 2CLLA 3W1RA 3W2LA 3M5XA 2XN0A 5D2VA 5AB3A 3MYPA 5DCEA 3GB6A 1WYIA 1EA0A 1VLWA 1XCFA 1VR6A 1W3IA 3G3MA 1I45A 4R34A 4K7VA 3WJXA 3G22A 4DO5A 2QCDA 3CWNA 1EWEA 1NSJA 1W5MA 1XBXA 3Q2DA 3G3DA 2Y70A 5HWNA 1IXNA 3KVMA 3PS7A 5LNSA 3O8AA 3R13A 4OV9A 2ISWA 1NF0A 3VFLA 3BLEA 3KVJA 1A5CA 1PE1A 1SZGA 1RVGA 4Y90A 3GYEA 4WQ6A 1P1XA 3UNDA 2E6YA 1SW7A 2C15A 1KM5A 1JRBA 3CEPA 4R53A 1TJRA 1ZNNA 2GQ9A 4O19A 2QJIA 1MEHA 3EXSA 3ATYA 1Z42A 4O50A 3FA5A 2NLIA 1LOQA 1F2JA 5KSWA 2BWGA 2GJNA 2CLIA 3MMTA 4LVGA 4E2BA 4JY8A 2A7RA 2KZHA 1KM6A 1WQ5A 1H50A 1QCWA 4MUZA 4JR5A 5EMUA 1RR2A 4UUIA 2IQTA 3TXVA 1VYSX 1Z44A 3N2XA 2DJLA 4HNTA 5F1UA 3IIOA 1XC4A 2CLKA 5KITA 2ISSA 3NVTA 3WK0A 3B04A 4UTLA 5FI8A 3KVKA 1GYNA 1DQXA 2OMAA 4FF7A 1IXPA 3PF3A 3G18A 3QQ1A 4YMZA 2VEPA 5A8GA 1SO5A 4ADTA 4TR9A 3P61A 3PSVA 5DELA 1YTEA 3LXBA 2E6FA 2ZA3A 4PH6A 3U2OA 3B8DA 3P82A 2PRMA 3W9ZA 3C0JA 3M6YA 3G1XA 2ABAA 4YXGA 4IOTA 4CNOA 4N4QA 2DZSA 1GVOA 3UWQA 3L67A 1H62A 1L6WA 2I9EA 4CQ9A 4UTWC 2Q8LA 1DBTA 1X1OA 3VE7A 1QNVA 1O60A 1I2OA 3EKLA 1TV8A 3DENA 1W5OA 1FXQA 4LU0A 4LS0A 5G2HA 3KRZA 4ZQRA 2C18A 4Y9AA 1E51A 3WJYA 4R7JA 1IF2A 4UTWA 2QJHA 3OHIA 2ZRZA 1TMHA 4NJHA 3G1AA 4AWUA 3NQFA 5K2ZA 3A22A 1YDVA 3SGUA 1OF8A 1JCNA 4NT0A 1GVFA 4TMBA 4DXVA 1P0NA 4BR1A 3GK0A 2X1RA 2NV2A 3LCGA 5LGXA 3LLDA 2Y7DA 2HMCA 5AHLA 2C19A 2CW6A 4GUIA 4UMCA 5D2XA 4PEKA 3LRMA 1LLZA 1KM0A 1LOSA 2Y6ZA 4ZZ9A 3W85A 1QOPA 2E6AA 4A22A 3M1ZA 2WSRA 3V1PA 1FWSA 2YW3A 2OT0A 3LHYA 4Z1BA 2EAWA 3B4UA 1TIMA 3W75A 3LBMA 1QWGA 3PUDA 3KFTA 3W3OA 3HG3A 3RLUA 1YADA 1P4CA 2FQIA 3BG9A 1TO3A 3LHWA 3R12A 4DO6A 3B0VC 4JYFA 2NUWA 7TIMA 3PULA 4BK9A 3PM6A 1GQNA 5AN7A 2HTMA 4EOUA 3NEVA 2DZPA 4Y6GA 3BW2A 3PAJA 3P81A 3DKJA 1X8FA 4O12A 4IMGA 5CSSA 4O8RA 4B5NA 1ICPA 4RKAA 4IWWA 1FQ0A 5F4XA 5K4ZA 1GVRA 3MHGA 4ZQOA 3P74A 4N6FA 4HNVA 1GZGA 5E1QA 3PB2A 4WOQA 1DQWA 1OF6A 3C4UA 2NX3A 1MEIA 1OX4B 4AMAA 2YW4A 2CFFA 3LB0A 1PS9A 5DBTA 4LNYA 2WO5A 4RCXA 4RZ5A 1OFBA 1ZAJA 3TU9A 3OBKA 4HHPA 3CT7A 4MIMA 4NX0A 4X3ZA 3GR8A 3IEBA 3AJXA 2J24A 3G8RA 1O95A 3DI0A 3G0UA 1O94A 4FNUA 5I3IA 1VZWA 1MEWA 1MXSA 4W9TA 1LP6A 2VEKA 4UTHA 1KV5A 3C2RA 3WK1A 2YYUA 4WD0A 1SQ7A 3TROA 1B57A 4RLIA 3IVSA 3LV6A 1CX9A 3MI3A 2CWNA 1W5PA 3FYPA 4XKYB 3MYOA 3VKJA 2VC6A 3TQKA 3NAVA 3F03K 3W72A 2HS8A 3BGGA 1Q6QA 4LOCA 4O10A 4PL2A 3S0CA 1AW1A 2ABBA 3ZWSA 1EUNA 4O18A 3OG3A 3SI9A 4QITA 5H2ZA 1OFPA 3W7EA 3MHFA 4N02A 3LHTA 4RZ6A 5HWMA 4OQVA 1A53A 4AHPA 3W7PA 3NDOA 4LC6A 1JR1A 2X30A 3DFPA 3HBLA 1ML1A 4D2JA 3WK2A 3TQ0A 1XKYA 3JRKA 1T8XA 4PC8A 5CZ0A 3M7WA 3TKFA 1GTHA 3L0GA 2BXVA 1UJPA 4JTTA 4K8EA 3Q58A 1IIGA 3HGSA 4G1KA 2A7PA 1TRIA 4QSHA 3LHVA 4FNPA 3FOKA 3W2KA 1AL7A 3HGJA 2WOQA 3W1QA 3HO8A 1IXOA 4HIBA 5DCBA 3H53A 3TNOA 4DF1A 1G7UA 3HPZA 1KM2A 3NNTA 3W7GA 5FF3A 3M0ZA 3GNNA 1LORA 3M47A 4N9DA 2H3BA 2ZZ3A 4OU1A 1GG1A 3TJLA 3K30A 2QUUA 1ZALA 2QUVA 3O06A 2QUTA 4K8HA 4P2VA 5GVJA 2E6DA 2AGKA 4K39A 2JGYA 1R2RA 4YCOA 1TTQA 4RK8A 4GC4A 1BEUA 3W83A 1O5XA 2V8ZA 2VFFA 3C52A 4O0KA 5CPOA 5G1YA 4O54A 1WA3A 2Y7FA 2E1DA 1LZOA 3A24A 2QDHA 3N34A 2B7OA 1SSGA 3QMRA 3P67A 2FDSA 4Z0JA 3TSDA 4FXSA 4MFDA 5F2IA 4EF9A 4FNTA 4LWWA 3MWAA 5G4WA 5AYZA 3S1XA 2EPHA 2BX7A 2ZRVA 2TYSA 3QFEA 5LGZA 3TFCA 5CSRA 4JICA 4OGZA 1JVNA 2QF7A 3L66A 4X9SA 5I3FA 2VFHA 2X1SA 4XZ9A 1VHNA 3MHUA 3W7HA 1H7NA 3S5NA 2YCEA 1YYAA 5EPDA 2R91A 4UCGA 5L6UA 3DFOA 4WJEA 1V7YA 1SFJA 5FEXA 5FEZA 3SZ8A 1JQXA 2NWRA 3N3MA 2YGYA 1OYCA 3P5ZA 1K8YA 1CI1A 1KTBA 1OFRA 4UTIA 3TX9A 1DHPA 1OX4A 1TPUA 4K6AA 3CIWA 2QJGA 5EYWA 1X1ZA 4WUIA 2RKXA 2VENA 3PG9A 1H7XA 3MI2A 1D9EA 3S5ZA 3NQVA 3PWAA 1PIIA 1W0MA 5L9FA 3EWBX 1YPIA 3M9YA 3M43A 5K4XA 1LCOA 4FHAA 4IPJA 4JD4A 3ZWTA 2QCHA 3IIPA 3LLFA 3QZEA 3H55A 5LNRA 5DN1A 3UYCA 3TR2A 4UFJA 1VC4A 3KX6A 1BWLA 3FYOA 2NXIA 4QNEA 4KWWA 5CPNA 3OVQA 4UFMA 1WBHA 5KTLA 4XKYA 3MP3A 3G24A 1TQXA 3ABRA 3CLMA 4DPQA 8TIMA 1WX0A 4GRSA 3IV3A 5CZSA 2WQPA 1M6JA 1TTJA 4DELA 4ORMA 2ZA2A 5D04C 3G1SA 3G1DA 1T0OA 3NQCA 2NZLA 4XUGA 1DJNA 5KZDA 3W71A 1FXPA 1TV7A 3CIXA 1OFAA 1IIHA 3NYZA 1TPH1 4JYEA 4O57A 1TQJA 1RV8A 3L21A 4JTLA 4LUJA 2YYTA 1W3NA 4AF0A 1R2TA 4ONVA 1F74A 5IM51 1W37A 1FDJA 5E0KA 3N73A 3L9CA 4RXGA 3NZ1A 2Y88A 2OCZA 1XBZA 1ZJIA 1Q6LA 2EGZA 3VCRA 4LS1A 2WNZA 3GDKA 4N9BA 1A5BA 5BW6A 3UPWA 3EWYA 3CB8A 1XDLA 3N19B 4ICNA 1RQEA 1OYBA 3TV8A 4GE8A 2H6RA 4HSNA 4FXRA 3QH2A 3L5MA 3FKKA 4MLRA 2QCEA 4E38A 4QISA 3O07A 1AMKA 1DVJA 1AL8A 1KA9F 1LM1A 4HN4A 4UFKA 1W5NA 3RF9A 4N9CA 1MO0A 1SO3A 3E12A 2VKZG 4BFAA 3MP5A 1J2WA 3G1YA 1M5WA 3RK8A 4Y8FA 1LBFA 4OWGA 2BTMA 4PA8A 4O14A 2ZCGA 3G8EA 3C2OA 3G0XA 3GLCA 3ZFHA 2H8ZA 3W1AA 3L65A 3DKLA 4ALDA 4IXHA 5F2LA 2Y63A 4FNQA 2RDUA 4RZ4A 1K7EA 1X6UA 3RFAA
chains in the Genus database with same CATH superfamily
3ARYA 1G4TA 4M19A 1NWUA 4PUNA 3NL2A 3B40A 4M5PA 2PU0A 2OYMA 2Y1HA 1DXEA 2DUXA 4KFOA 3GXIA 3LSBA 2TMDA 3L5LA 5IBXC 3GZAA 1YEYA 2VCCA 4K36A 2OZTA 4FF5A 5HMDA 1V93A 2AAMA 3M0HA 3VOGA 3W86A 4CN1A 5B7YA 1JDCA 1VFHA 1FCUA 4Z2GA 1RD5A 2YCLB 3IARA 2ISVA 1YXDA 1OK4A 1S2WA 3BO9A 5DT7A 2J66A 1R2SA 1XKJA 3URAA 2V2CA 3TW6A 3KOFA 1XFCA 4GXMA 3UW6A 3ZR5A 2Y61A 1OCJA 3KXQA 2AL2A 3NPXA 1EBGA 3WD4A 3BCFA 3BSMA 1JUKA 2HSAA 3CGTA 3TXZA 2VM8A 3ZT6A 3TJXA 2GJXB 3P2VA 2RUSA 1TTPA 4L64A 1ZAIA 4JTJA 4YYFA 1H63A 1Z32X 3SSZA 4YYCA 2RJHA 2Y2WA 3RPTA 2X16A 2VFEA 4NAEA 2CLMA 3WL0A 3WNKA 1DIOA 1T5AA 2PUZA 3EB2A 1YNYA 3FFSA 3P8JA 1KRAC 1ZAHA 1I2QA 3RNDA 2TSYA 3C2EA 2ZZ7A 3MBDA 5HUPA 3W6LA 2QR6A 5FF7A 1V8EA 1HN1A 4CQAA 4MYXA 3WLTA 1JYWA 4DWSB 4PCTA 1VPYA 3DBNA 3GXTA 4F0MA 4KRTA 3BOLA 1M04A 1JDDA 3LRKA 5D8ZA 3H4GA 5XINA 1J18A 1O5RA 3S9IA 2GPTA 3UWZA 3EEGA 2GVLA 5LYRA 1O1HA 4O0QA 3W73A 3L0NA 2C6QA 1MI3A 3TN3A 1R9ZA 1JCXA 3ABOA 1K1DA 2JK2A 3B05A 1UP2A 4MVAA 2ZICA 1TKKA 3K1GA 1MW0A 2C79A 4L9ZA 3W0KA 3GTFA 3QR0A 3EWZA 4ZFMA 4JKKA 3EDJA 4PMNA 5LA0A 4H2CA 3CM4A 3NL3A 4UTFA 1U30A 1EDQA 3TEVA 1GOXA 3GHRA 4S2BA 3LX9A 5ECVA 2ZUVA 4HOWA 5BMXA 4BQ5A 4AG0A 1OD8A 3W1UA 1EHAA 1VRXA 3R8RA 4JFTA 4QE1A 2FH8A 1DJZA 1NTHA 4ZL1A 1RK6A 3B8TA 1W9VA 3VM7A 3WX7A 2WKGA 1JD9A 3FEMA 2MANA 5EGRA 2GQAA 2DIEA 1WBJA 3AISA 3VFCA 1B1YA 1RQBA 1RBOB 4KF1A 1IHIA 4V2XA 5JU6A 3C2VA 3LXAA 4XSLA 1BKSA 1NF7A 2NWSA 4PUEA 4LRSA 4HT3A 1R3TA 1V3KA 3RHGA 3PZMA 4DVOA 4IIDA 3GG8A 1J01A 3IGXA 4CU7A 1QNRA 2PBGA 4NXSA 1SFLA 2ZUWA 3GKFA 5K9DA 4U5KA 3ZT7A 4J28A 5EMMA 1US2A 1TVLA 1BXBA 4FLRA 3WK3A 4AC1X 3OVRA 4ZE4A 2YFOA 2B7QA 1AH0A 1I75A 3TW7A 4UTKA 3F4VA 3UYIA 3AXMA 6A3HA 5FJJA 1JZ6A 3UU0A 3EX3A 4CNPA 3MUIA 1Q2SA 1BSIA 2ZZ4A 1EH9A 1AK5A 2FZBA 2EPKX 2E9MA 3S2JA 1D8WA 1VFMA 4RXFA 2BVDA 1HGWA 3MDWA 1M9HA 2XFRA 3SO7A 4TMCA 4Y9OA 4CLMA 1F7BA 1JPIA 4JIHA 4NZ5A 3CLWA 1RJRA 1I0DA 1CTNA 4KFPA 1UQZA 3SCUA 3AROA 1R5YA 3OW1A 4H6RA 4I90A 2UZ9A 1OX6A 2R9RA 1LROA 2RH9A 3E1F1 2A21A 4N9EA 3NQ2A 5AYIA 3ZS4A 3CUFA 3R79A 4NJJA 3K4AA 2F7FA 2JGQA 2UWFA 2VFIA 2XVKA 3N9RA 4XBJA 2R14A 2WM0A 3NVDA 5G1TA 4Q8UA 3CMFA 4L1GA 1KGUA 3PVFA 3QY8A 2NX1A 2F6UA 1Z8AA 3MUCA 3IIVA 1KFJA 4PODA 3W1PA 2O9PA 4G7EB 4HGXA 4PMVA 4S3FA 3S1VA 3L12A 1ZLPA 3M5VA 4QM1A 2QGHA 3ZXWA 2CZFA 4Q8TA 3LHUA 3BTNA 1X6NA 3EWUA 1M53A 5EKYA 1OFDA 2ZTKA 3LXCA 1OK6A 1BFNA 1CB2A 3WDQA 3TCSA 4G56A 4WLCA 3KHJA 2UY3A 4QG6A 4FR6A 1H60A 3W7MA 2NQ9A 1EKOA 3LU2A 1JF5A 4QDMA 1PZ1A 1DWJM 4AZ5A 1SZNA 3QYSA 1A5SA 1JDEA 3G1RA 3I6RA 1W8GA 2QCMA 3GH7A 2GUBA 4BEUA 1LT8A 1F3EA 3NG3A 2A3AA 3NWRA 2FMOA 3THCA 2O9OA 4MOZA 2ZUUA 3AMGA 2DORA 1E9IA 2CKRA 1SJAA 3U7BA 5JUVA 2EQDA 3AXHA 2WLYA 3NM3A 5I07A 3QGVA 4DYKA 4DWDA 1L6SA 9CGTA 1PKYA 3KWSA 1EJWC 1GOQA 3QKZA 2QDGA 1FKWA 3DBPA 2FZNA 2F2HA 2BHUA 1WV2A 1FWRA 4JTFA 4RPPA 1ONXA 3SCSA 1D3CA 3A64A 3P84A 1AJ0A 2P50A 3B0XA 5DBUA 3DZ1A 4JHMA 4NY2A 5DXYA 2CWXA 3M0YA 5IXEA 3UY8A 3GFZA 2YIHA 4I7UA 2V5BA 3RGTA 3UVAA 3ZYZA 4FR1A 3IIZA 3PPCA 5D2YA 3SR7A 1EYEA 3F1QA 1SU5A 3S9ZA 5I02A 4M7SA 4WDTA 4XD3A 1WP6A 3LLXA 3BW4A 3K13A 3GW3A 3QGKC 1RSCA 1BG9A 5C9WA 1ADDA 2A3CA 2DDXA 4DO4A 4LUIA 3BG5A 4IPLA 1JZ7A 1XPGA 3TE9A 3S83A 3KL3A 1R87A 2DU2A 3M64A 3RLGA 4PULA 2PP0A 1TIWA 4C6JA 1RXOB 3H2OA 3OGSA 5HQMA 4AX7A 3G1VA 4V1XA 1B31A 4IUOA 3KBWA 3UJ2A 4XQ6A 4J4KA 4DWSD 1I2NA 1HQTA 5C2XA 5AC6A 3EXTA 1AA1B 1XLBA 3GR7A 3WF2A 1ISZA 3T4CA 4OVXA 1DV7A 2GL5A 2IPGA 3GD6A 3W24A 1AQ0A 2YDSA 2BBFA 5FEWA 1EUAA 4I9MA 2BSLA 3VIFA 4F2TA 4AYSA 1JJKA 3RJYA 3BV7A 2WSYA 1WXYA 4MFEA 2C71A 4BHYA 1CGYA 5E9XA 3B8UA 1YLVA 3NGJA 4MKNA 2OSYA 4E2DA 3CPRA 3WUEA 5IDZA 3VPLA 1EP2A 1RALA 5TAOA 2BP1A 1RY0A 4BA0A 4QHRA 2VCAA 1MDRA 2OEMA 3B9OA 1NEYA 3FIGA 4S3BA 2C13A 5HQLA 3V35A 1VYPX 2VZTA 4Y9MA 3HPXA 4RE3A 4GUJA 3UEQA 3UNTA 3BLDA 3VGBA 1ENUA 1VFOA 2XINA 3MA8A 4UBPC 1SJCA 3VNDA 1EO7A 3MY9A 3T4WA 1XSIA 3CQKA 3H4WA 1G6CA 3RU8X 4EWND 2PD9A 2E25A 1WUFA 2Q3RA 1XH2A 3AHTA 4MY1A 1Q6GA 4AIUA 2YBVA 5LA1A 1U1UA 1E0TA 3M0MA 3WMLA 4ZVJA 3H12A 1KBJA 3USBA 3HOJA 1BYBA 2DZWA 4UC5A 3EWXA 3QFWA 4BKNA 3ZMRA 4ROPA 2FFIA 5CPMA 3IAPA 3WD2A 5DY2A 1F6PA 3A6OA 1D2KA 4DI8A 2WK2A 2PWFA 3BZGA 2PI6A 1VBRA 4ZQPA 2BB0A 1Z89A 5FA5A 2NSOA 4KFNA 4M6VA 4B9YA 3IUDA 3SY5A 1KKOA 2J8FA 2DT0A 4C6IA 1UR1A 3WZ0E 4D6HA 1ZHAA 3VNJA 2Q3OA 5CJNA 2OG9A 2BHZA 3W7JA 1XUUA 2EPMX 4O52A 3OHMB 4QJ5B 3KOYA 5CXPA 3V75A 3UWWA 1JZ5A 4XAYA 2V3GA 3CAVA 1JRCA 1XIGA 3LM7A 1R3YA 5BOOA 3KDOA 4XO6A 3TC3A 3UXAA 4HSHA 3E0IA 1PKNA 1LBLA 3GNXA 1TZ9A 4IMCA 4L65A 3GVQA 1OC7A 3INPA 5D9NA 4HYRA 3NQAA 4HYWA 5DT5A 1EPVA 2WVVB 3CH0A 3NQGA 1GHSA 3W7KA 2OSXA 4DZHA 3WJZA 1LLOA 3NQEA 3NQMA 5HATA 5HANA 3CWOX 1AFSA 4AYGA 3L4YA 3DERA 1ZFJA 2C3ZA 2ZRXA 3WBXA 3I3EA 5HXMA 3VIKA 2OZ0A 2D24A 3W2MA 1W9BM 4V1YA 1I8JA 4IX2A 3F7JA 3RCMA 4N4PA 4NYUA 1QO5A 3GHTA 4KERA 2GGGA 2FJKA 3TK7A 1TWDA 3VDBA 1XLEA 4Z2JA 3KCOA 4ZGYA 4JL2A 3EXRA 1KBIA 2RHGA 2ZA1A 5C9UA 3TA6A 4C1NA 3RM8A 1V6WA 4BQ4A 3P60A 3W1MA 4BCEA 2W66A 4DQWA 1L6FA 2A7NA 2XIQA 3HQOA 4XB3A 2EPNA 3S6TA 3O6DA 1CNVA 3VKAA 1DL3A 1SO6A 5AC4A 1TB3A 3LG3A 4L5ZA 4M6UA 3H2FA 1XYAA 1BRLB 2CLPA 4ORIA 2VX4A 3OOQA 5LSMA 2GVYA 1P6BA 4INFA 3WMSA 1N82A 1TVNA 4Q22A 2QCGA 3L68A 5CAHA 3LD5A 4H83A 3LI0A 4E3VA 4GC3A 2YLAA 1H1YA 1FWIC 1VJIA 3HURA 4S38A 2OEJA 1EP3A 3FV9A 3MI6A 5M5DA 1UUMA 1TREA 1WXJA 4GCXA 3FSUA 1J0JA 1WDPA 1DJIA 2XUCA 2WHMA 1SZEA 4MDOA 3AIVA 4L80A 4RV8A 3RO8A 3ZLGA 1TYGA 1UBSA 4ZO6A 4HHHA 2VX5A 4DLFA 4JTDA 4JEJA 3SUVA 3BW3A 5CPQA 2E7FA 3KOWA 4HCHA 2V69A 1K4GA 2ODOA 3IVTA 3KS5A 1YIXA 4JQ4A 1A0DA 2IKIA 4YPJA 1BF2A 5I6SA 3UZ5A 2V63A 3TMQA 5CC5A 5HUOA 3LTSA 5LIUX 3L2IA 1GVQA 4ADUA 3OGRA 4GUGA 5I3DA 3NO5A 4HZ8A 4KWOA 2QAFA 4IP7A 4J3UA 1KXVA 2D0HA 3AIBA 1ZY9A 3MMUA 1ICQA 2HQAA 4Q6JA 4PFHA 2F61A 3SEPA 1QPRA 4KEUA 1OB0A 1JYNA 4Q4OA 4JTGA 5AC5A 4LAOA 1POKA 4CQBA 4WY0B 1K7FA 4GGBA 1TWSA 2VEFA 5TBOA 4A2SA 4HD5A 1PTGA 1UR3M 1UOZA 2HVMA 4EIVA 2FZDA 4M80A 3GHSA 3VDHA 3S1WA 3NPWA 1XUZA 3VMOA 1KKRA 4PYSA 1Z48A 1CLVA 2ZX9A 1FDYA 1W17A 3AS0A 2Z1VA 2PFHA 1W54A 4O1DA 4K38A 5DLCA 4WJXA 2BNJA 4KWSA 3GUWA 3GU1A 1DOSA 4WK9A 2NQZA 1GORA 2P3ZA 1Z7AA 3SCRA 1CXIA 2QW5A 1GKQA 1OIFA 3PR2A 3V18A 3BC9A 3STGA 2REQB 4ERIA 2DZUA 2FTWA 1MVYA 1VGAA 2YKKA 4TTUA 4A8NA 1GQLA 5CLWA 4P8UA 3FW6A 3H7VA 4Q8VA 4TUFA 2QMJA 2A6LA 1PKMA 4FAMA 2ZYFA 5C9ZA 5J5RA 4WGXA 2J62A 1HO1A 3PN8A 3NQ8A 2NT0A 4JTRA 1SVDA 3STFA 1WAUA 2CHRA 5F1VA 1Y65A 3BE7A 3FNDA 3CJPA 3OP2A 1EC8A 1F61A 4HPNA 3CWHA 1SO4A 4LPCA 1UQYA 1R46A 2NUXA 1XH0A 5EY5A 3S6DA 2JALA 1UD6A 5DMLA 2QDDA 3LV5A 1Q6CA 3QV6A 4ILSA 4LT9A 5LIWX 1QW9A 5E6YA 2WKJA 3WF3A 3WN6A 3KOZA 3AUJA 3R7MA 4X9YA 3RILA 1QMLA 4H9XA 3RJXA 5CJMA 2ZWYA 4CNNA 2WQDA 3TFXA 4WHBA 2OO6A 1OC5A 3D3AA 2WBKA 5EMLA 3U8GA 3I4KA 1QDSA 3N9SA 3M5ZA 3F5KA 5JBEA 2WPBA 4Y9NA 1UZ1A 4YN5A 4KBXA 1VEOA 2CNCA 3VOFA 4AD2A 1IWAA 2CHOA 1US3A 2V9DA 2QT3A 4L6DA 2YSWA 4ZBCA 3NGFA 4UQEA 1TR9A 1VBGA 2ZBTA 3GX9A 1A3XA 3TSMA 5LNUA 1Q45A 1S3TC 4JIQA 2DSZA 2VGGA 4B4FA 3G6LA 3GQYA 3HQNA 4K2SA 4HPXA 4MG4A 1YE6A 1CLKA 4Z2HA 1O6IA 3EWCA 3PZ9A 1GWJA 3QM3A 4DF0A 4V33A 1OGGA 2DY3A 3C2FA 5I24A 4KRZA 1EDGA 1DJQA 4U5IA 1UBPC 1XLGA 3VUSA 4AEEA 4XTDA 1H11A 4QLLA 1E9LA 1O5KA 5B80A 3VZZA 1M01A 2HK0A 1OX5A 4PMUA 1HZYA 3N6QA 4BEQA 5G4HC 3GG1A 5KZ6A 1BTMA 1MNZA 4GFSA 4JTSA 3NSMA 2RDWA 4YTQA 1TMLA 3VKKA 1JXJA 5CZTA 2HRWA 2I5IA 2EPLX 3TWAA 1X97A 3URQA 1AD1A 3GB6A 1WYIA 1EZWA 1OCNA 1WUEA 1VLWA 4EKJA 3SUUA 2W9MA 1YBQA 1I45A 4R34A 2IXUA 4UQ9A 1UZHA 1DWHM 2X05A 2FGBA 4D8AA 3W28A 3GXDA 1W5MA 2INZA 2GK1A 4R88A 3U57A 2FKPA 4U31A 2J7DA 1IXNA 4OOUA 3O8AA 2ADAA 4OV9A 3GHUA 1NF0A 1JIBA 3VFLA 1EJVC 4LAZA 1PE1A 1SZGA 4B3KA 2C15A 1A80A 3TTEA 4HNOA 2E28A 3ITTA 2BHYA 1XPYA 1WZKA 2XWDA 2W27A 3CO4A 4W8AA 4DLMA 1Z42A 4O50A 2GJNA 3EOOA 4PMZA 3CZGA 3KL5A 2DIKA 4LVGA 4JY8A 3LBOA 1KM6A 1X6LA 4MUZA 4FSAA 4JR5A 5EMUA 4UUIA 2IQTA 1VYSX 5C7VA 2WC4A 3NSXA 4DJDA 5F1UA 5HMEA 1AJZA 3S6OA 4XV0A 3C2YA 3BUVA 1FWAC 3KVKA 1GYNA 2YA1A 1F6YA 3UVIA 1IXPA 2CIPA 3QQ1A 4YMZA 2VEPA 2X0YA 1SO5A 4B4HA 1GUVA 5FKYA 5A8QA 3KLLA 4FLQA 3B8DA 1AQHA 2ABAA 3SQLA 1QBBA 4B3ZA 1PPIA 1BKHA 4N4QA 3L67A 3HN3A 2PDNA 2I9EA 3FDKA 3OZPA 3AS2A 1VFTA 1QHOA 1O60A 4WKHA 1W5OA 1FXQA 2G3NA 4LU0A 4XAFA 5G2HA 3KRZA 2W3ZA 3S46A 4KWUA 4Y9AA 4QDPA 4UTWA 4AY8A 1F4AA 3OHIA 3WQEA 4NJHA 3VNKA 4C91A 5EFFA 3MCNA 1JCNA 3ANVA 4KEVA 4DXVA 3GK0A 2X1RA 4F48A 3KBJA 4FOUA 2YL6A 2X7WA 2ZX6A 1CGUA 5AHLA 3R8GA 4GUIA 1R3WA 3RO6A 3SCQA 3RX2A 2WSRA 3SADA 2GOKA 1DP0A 4AZ7A 1XH1A 4DJED 3CPGA 2POTA 1QWGA 1RVKA 4KPLA 6CGTA 1ELSA 4I9JA 3W02A 4BZYA 4UCFA 2FQIA 1TO3A 1V51A 2F6KA 5A6BA 4UQCA 1PSCA 5E9AA 1BD0A 2OKOA 4XKMA 3ES7A 3W00A 4AD5A 3EGJA 3VIJA 1M7XA 3PM6A 1KRBC 2VO5A 1FVPA 3NEVA 3WDHA 1H5VA 3VYLA 2QJMA 3P81A 3DKJA 4O12A 4GJIA 1LF1A 1E0UA 1XHGA 3TP4A 1WKYA 3A47A 1UP0A 3VCCA 4ZQOA 4Q4PA 3P74A 4W5ZA 4H9YA 2XSAA 1ISYA 3H4XA 5DO8A 1PBGA 4NILA 1B3WA 3M0JA 2X0HA 3BAXA 2WWDA 1PS9A 2WO5A 3CL8A 2Z1SA 3TU9A 4HHPA 3FY1A 3UF9A 4JFUA 5LIYX 4W87A 1WZLA 3GR8A 4XG1A 4FALA 3PJWA 3TW9A 3KP1A 1O95A 3G0UA 1O94A 1MW2A 3K8MA 3W37A 1MEWA 1DWGM 1LP6A 4UTHA 2QJNA 3ZQ9A 3D3FA 4HVXA 4PUUA 2GDQA 4UWMA 3TROA 3IVSA 3CXOA 1CX9A 1W5PA 3MB9A 4LYKA 3BAYA 2WHLA 1FHLA 1AZ2A 3W4RA 1MXDA 3BGGA 3WNLA 3EB3A 2WMIA 2YB1A 4LOCA 1DYSA 3QVQA 1NDVA 3DOPA 3W7EA 3LHTA 1JF6A 1XLLA 1A53A 4OQVA 4K8GA 4LC6A 4GINA 1KCZA 1TA3B 3HBLA 3U3HA 4PC8A 3TQ0A 1TFVA 1T8XA 1XKYA 3OJGA 1EEXA 1S2CA 1GTHA 4K8EA 4H7CA 3AWOA 1IIGA 2HNHA 1LJYA 4G1KA 4QSHA 3LHVA 3OO2A 1AL7A 4W84A 2WOQA 3M0LA 3S2NA 1VFSA 1TX0A 2EKGA 4HIBA 4DWSC 2ZC8A 5BROA 4UNIA 5DCBA 1B0IA 3T42A 1G7UA 1FWDC 1TZ7A 1VENA 2ZX8A 3URNA 1LORA 1R8LA 4L1WA 2F38A 4GY1A 2PDXA 3RXZA 1MRQA 2H3BA 2ZZ3A 3AMKA 4HN8A 3TQPA 2PTYA 2QUTA 5DMMA 5B7ZA 1VF8A 2PWHA 3EDEA 4REQB 1R2RA 1LQ0A 2O4MA 1B3VA 1S2TA 1ECQA 4DN1A 5CPOA 1T41A 4H2HA 3CMGA 2Y7FA 1F3TA 3N34A 1SSGA 4G2DA 1Q7ZA 2HJPA 4IL0A 2X2YA 4EF9A 3IPWA 5G4WA 3DUGA 3N29A 5LGZA 1HP4A 1HXJA 2QS8A 3O0KA 2GWNA 3L66A 4X9SA 3ORWA 2VFHA 4GOAA 1RLCL 4Q4QA 3W7HA 1A5UA 3S5NA 4ERAA 4H9VA 3ALGA 4OIFA 4HJWA 1V7YA 2J6VA 2YBTA 5AY7A 2WSKA 2NWRA 5LXXA 4ATLA 3BJTA 4HMEA 3U4AA 5HOSA 4PR4A 2PSNA 3P5ZA 2HNEA 3LA4A 1RK5A 2DVTA 4KGLA 1TPUA 5G1MA 5A1AA 1IEQA 5EYWA 1X1ZA 3PTMA 4WUIA 1H7XA 3MI2A 3R25A 5L9FA 1HW6A 3VK5A 1XIMA 3JZUA 1HL9A 3GNOA 4MB3A 4IPJA 2QF8A 1W32A 3RUBL 3IIPA 2R1NA 3PPHA 3GFXA 3H55A 5LNRA 4WVXA 3OVGA 2R1PA 4OUEA 3KX6A 2OKTA 2VOTA 4W5UA 4BJHA 1WBHA 5H6HA 4X63A 2OSWA 2J7BA 2Y0FA 3ABRA 3T08A 4DPQA 1FH8A 3GC5A 4GRSA 5CZSA 1UUQA 1M6JA 3LEPA 5D04C 4GABA 3UG3A 3G1DA 1RHCA 4XUGA 5KZDA 4AZGA 1IIHA 3WBAA 3NYZA 4JYEA 3VABA 4O57A 4X0NA 3VVGA 2YYTA 1W3NA 1NQ6A 4AF0A 2A79A 5IM51 1W37A 3L9CA 1OSEA 2Y88A 1HJQA 4F3HA 3EEZA 1FWFC 6XIAA 3L4VA 2V6AA 3LENA 4N9BA 1A5BA 5BW6A 5DF0A 3N19B 4DB7A 3A4JA 3P93A 4MB4A 3TV8A 3E2RA 1FHVA 1QI5A 3A13A 5BWFA 1LL6A 2H6RA 4L9XA 3T0AA 2ZVRA 3QH2A 1LT7A 3FKKA 1KXQA 4KRUA 3TYCA 4L4OA 4E38A 3O07A 3TZNA 1LM1A 1RLDA 2VKZG 4BFAA 3QTGA 3MSDA 4C6OA 5BRPA 2ISDA 4A8RA 4JQ2A 3UBPC 3SUTA 2KAUC 2ZCGA 3SIMA 2VYOA 2NV9A 3DYPA 1FP9A 2ZXBA 4B92A 2Y63A 5ABHA 3HJEA 3RFAA 4XZNX 3O63A 2FGLA 2B7PA 3T40A 3DFHA 1PUDA 1KFCA 1NDYA 3Q37A 3AOFA 4JX5A 2O0TA 2J4GA 4TX9A 2G95A 1ADOA 3LDVA 3ARVA 3GH5A 1GPWA 3PUOA 3IGSA 4GLEA 3PNUA 1RP9A 3GG0A 1BQGA 1XLKA 3EPMA 2PDBA 3OYZA 2Y7GA 2DP3A 2PDJA 2OFJA 4S3AA 3LMYA 1UWQA 2Z4GA 5BRBA 3ICJA 3OBEA 4HHMA 2WMIB 3L23A 1R47A 1ZBVA 4P7LA 1H7RA 2CKSA 4S2CA 4TIMA 3ELFA 4R33A 3DECA 3DFYA 2ZRUA 4PMDA 3T1GA 1KLYA 2HVOA 4I8YA 1GNXA 1AVAA 3LCWA 2ATSA 2WCGA 5C54A 4W86A 1J79A 1K8XA 4Y8EA 1Q85A 1U33A 3MUY1 1D8CA 4M7TA 4UFIA 5AOUA 1UR8A 2D2OA 3IJDA 4I7VA 1C7SA 1Q6FA 7REQB 1MFVA 1FFQA 3GSMA 3GDMA 1GJPA 5FJPA 4X22A 4CNTA 1TRDA 1NU5A 2CXGA 4RPQA 1K9DA 3ITVA 4Q7IA 1U5HA 3KWXA 1QI3A 1QT1A 4OBTA 3SRKA 1PDZA 2YR1A 4DZIA 3SJNA 4NXKA 2QHAA 3QYQA 4O1CA 2Y8VA 1JXKA 4IHCA 2QKFA 1LTDA 2WNQA 4XISA 1QAPA 4MGGA 1E1CA 1QR7A 3PP7A 1L0PA 4OJYA 4RX0A 4W7UA 1R0MA 1EJ7L 5HJYA 4O1AA 2E4TA 3XISA 3C8FA 2B4GA 5M2FX 4S3JA 2GVGA 1KFKA 1REQA 3RMJA 3IV8A 3CQHA 5CZJA 2NLYA 1YXCA 2KX9A 4BF5A 1M68A 3GU2A 1S38A 3MO4A 1AZ1A 4IJCA 1VIWA 1N8FA 1U2YA 2ZDSA 2HPMA 4HKPA 4DUOA 2LLEA 4X2RA 1GZ1A 3CYVA 2OPJA 3ZSTA 4GVIA 4K68A 2C16A 2WCAA 5A69A 3UD6A 3SUWA 1G4PA 4EX4A 4ENLA 2Z1BA 2P0IA 4I7WA 2E09A 5CBBA 4H19A 1F9CA 1Q65A 4H6QA 4E4UA 3AC0A 1RCOB 1IGSA 1QOXA 3C0SA 3MKCA 4FX7A 4G5DA 1AQMA 4O4VA 4Y7EA 4DJDD 2YJQA 1KR1A 2PEVA 1JDAA 3W2JA 3U6WA 2F2KA 2BY3A 2L5HA 3CUGA 1V0KA 2VFGA 1XFBA 2D2HA 4C6LA 1JPHA 1XXXA 1PCKA 3DI1A 1FCQA 4PSRA 4D6JA 3S1UA 1HUVA 1JCJA 2J74A 3STPA 3D47A 3M7SA 4MLJA 1J4EA 1P6WA 1MSSA 3TDFA 5A5WA 1R30A 1UH4A 4B5TA 3WH6A 1DQUA 4IIHA 4E6MA 1XDMA 5FJOA 5ABEA 1TPC1 3IANA 3OIXA 3OYXA 2A5HA 3GIYA 1HVQA 1GQIA 4LVAA 3TN6A 1BPLB 5F7UA 1X98A 2QYGA 2R82A 1CW2A 4JN6A 4IFOA 2PMQA 4TVDA 2GVEA 3RPDA 4MM1A 3P0WA 1XD1A 1BYDA 2ESCA 2G3FA 2XH0A 3TMLA 3A21A 3UA3A 2ASHA 4AF0B 1K6WA 5LIXX 4LQ1A 3MTWA 3UXKA 4QLKA 4KQNA 2VMFA 4GJ1A 4BF9A 3N15A 4WDUA 2VXNA 1JUEA 2DZVA 1P0BA 2AKMA 4LB3A 3HQ1A 3W1TA 4I5UA 4Q4SA 4JYDA 5CH9A 4NL1A 5A6BD 2CU0A 4XK2A 4XZWA 2QCFA 1UR4A 3RCYA 1B3YA 1GKPA 5HNRA 2ICSA 3GY1A 2D23A 3B06A 2YBUA 1V7AA 2WAGA 5D2WA 1QWKA 1R6WA 5F2MA 5HBFA 3JW7A 2XM1A 2OWCA 5JBDA 3OA3A 3V1HA 3FCPA 3I65A 3W88A 3B9AA 3QQ0A 3TN5A 3VI2A 2H9AB 4UTMA 3TONA 2I57A 1ZJBA 3PK7A 5T9CE 1AH3A 4H8VA 1ALDA 2DZBA 2ALDA 3G6MA 2XJ7A 5ENLA 1KLZA 4WR3A 4MNJA 1KCXA 1E9ZB 1A3HA 5CGTA 1IXQA 3WFZA 3MCMA 4AD4A 4MNMA 4L1XA 3W7DA 3L4UA 3LN3A 4ZMGA 4RDZA 2PLMA 3BSGA 2EJAA 3NXLA 4KCWA 4UFLA 3OQEA 2ZUTA 2H3DA 4C5ZA 5KINA 2IXVA 2W5FA 1P7TB 1V3HA 1XSKA 4JY9A 1W1ZA 1R7OA 3LCIA 3H24A 3PTKA 3VA8A 2QNEA 1EX5A 3WQ4A 4NJKA 3SM0A 1W1TA 2OR2A 1K9TA 3SAZA 3WCZA 2ONEA 3E5BA 4Z1DA 2DH3A 3U0HA 3WLHA 1LUCA 2EG6A 4A8LA 1NAL1 3COTA 4C6MA 1V3JA 2R8WA 5E0FA 3H2CA 4JTAA 3H2MA 1QHPA 5LNWA 5DRCA 3OZMA 1V6VA 3DFTA 1AODA 1MRAA 2G37A 4A05A 1J0IA 4KCTA 1HJVA 2WYSA 4PE8A 2WCSA 4R9XA 2OJPA 5HULA 2PDCA 3NDYA 1C8YA 4GISA 1UKPA 4BWLA 2VC5A 1PEZA 5EMJA 4XVDA 3M16A 3AYRA 3ARUA 4NNAA 3WEZA 3T09A 2E5DA 2C91A 2AGTA 3EX1A 4K37A 3OVPA 1YTDA 2IUZA 4WJ8A 3TYEA 2D0FA 1CDGA 4WX2A 5H8MA 1KO0A 3R94A 3A4WA 2F84A 6ALDA 1G67A 1SMDA 1NIUA 4Q32A 1XYCA 2OX4A 4X2PA 3XIMA 2ZUMA 2JEQA 3AHZA 1JCLA 4FB7A 1HJUA 3GIQA 4LUYA 4IGHA 1C9DA 1UASA 3NZQA 1RPXA 3OU8A 4P7RA 4DEFA 3VNLA 3W84A 4E2OA 4MNLA 2G97A 1DIEA 3LYEA 3BVJA 3WFAA 3K1DA 1K7XA 1QFEA 3O3RA 4AH7A 5D02A 4IQJA 4B16A 4NP7A 1GKRA 4D1JA 4PRTA 1IQ8A 1F73A 1DWAM 5HNUA 3DFNA 1V0NA 5JBFA 1M7PA 1KFLA 3UWYA 4FX8A 2QVHA 3HB9A 5EA9A 4YTSA 2JKEA 4NRSA 4NX5A 3TTQA 5RUBA 1S1PA 4JTUA 3A4XA 4UXDA 4W88A 1DIKA 4FOJA 4RV3A 4GFIA 2XVGA 3B9EA 3L4ZA 1E15A 3W23A 1VBUA 2BZNA 1OABA 6REQA 1P0DA 3PC0A 3TUUA 4B5UA 3W7RA 4RNJA 5KZEA 3KRSA 3HF3A 4E2VA 1Z69A 4EP8C 4N2YA 3WD3A 4MY9A 3S2MA 3BMWA 1ME7A 1E6XM 2A2IA 5H91A 1GW9A 1JFHA 1ZZMA 2PP1A 4Q4MA 3CV1A 5T91A 4IL2A 1QK0A 4O1FA 1J8VA 1RQHA 4MADA 2BMBA 3DX5A 1W1PA 4Z1YA 5CGMA 1ME8A 4OE7A 3PNZA 2GVJA 3I7RA 4GYKA 2GLKA 3A4AA 3QGAC 4HSOA 3G5EA 4H6KA 4H6EA 4GQ0A 4GUFA 2GOUA 4GBUA 1NFBA 1EX1A 3D6NA 2NXHA 1V08A 4Q8WA 2AMXA 4FX6M 3T0BA 2VP8A 4D9PA 1Q4NX 1S5NA 1OCBA 4QQUA 1WPCA 4MZYA 1F8IA 3THDA 5DX7A 3GTIA 4FEZA 2YA0A 3IJIA 2W4XA 3A5VA 1TSIA 2ACQA 3V0SA 2OYKA 1XJBA 1E4MM 1X7FA 4IG2A 4C6PA 1TZZA 2W6RA 4LH8A 4AXKA 3WEMA 4AFYA 4C6CA 3HPSA 3STEA 3TN4A 2YXGA 2YL9A 1XIBA 2CESA 2ZE0A 2GSEA 1OFOA 3UY7A 5C9RA 4KESA 3AZRA 3VCNA 3N1AA 1S5WA 2J7FA 4O13A 5K7JA 3LGDA 4UQDA 2DUAA 1E0WA 4HB7A 3B8WA 5J8LA 2X7VA 3GXPA 3Q67A 2Z29A 4TVCA 3TWBA 1XS2A 3N17A 5LIKX 2GWGA 1L8NA 3D0CA 4GXPA 5CBJA 3GVWA 4DO7A 1UD3A 4AHOA 2FTYA 1P6CA 1O12A 4CU8A 1Y7VA 3CL7A 3PJTA 2PA6A 3O2LA 1EXBA 2CC0A 4PTWA 3BGAA 1XYMA 2PRHA 3AI0A 1KC7A 1XSJA 1BF6A 4M29A 2PWUA 3CNYA 3R1ZA 3IVUA 4XX6A 1JZ8A 1CLXA 1E55A 3V16A 1SR9A 4HCDA 1A5OC 5FL1A 3VDAA 3LCHA 3HG5A 3P6LA 3C0QA 5G2WA 2VUYA 2PURA 4RNHA 5CC3A 3MZ2A 3M5YA 4ZOBA 5HJLA 4MUPA 4QSFA 2DVUA 3E0FA 5IOBA 4XBSA 1G69A 2CLEA 3WMBA 3I68A 1S3HA 1OG0A 4ACZA 3T8QA 4XSMA 2OEKA 1SM9A 4WSJA 4AUBA 2D2GA 3VKCA 3O16A 1OWQA 2PU1A 2ZZ2A 1F5ZA 5J5DA 4C7DA 5FACA 4C6KA 3DESA 3KVLA 3UR7A 1QBAA 4GI9A 5GJNA 4AZ6A 1JFXA 1CBGA 1N2VA 1N55A 3IK2A 4JAWA 5CLTA 3WD0A 3M4HA 3REQA 1SZRA 4I8DA 3O0FA 3E0VA 1KV8A 3T55A 3L5AA 1TWZA 1MQPA 4HA0A 3SN0A 2Z1KA 3VD7A 3CHDA 2RDXA 4AY7A 3EX6A 3SSJA 3PZGA 1HT6A 3DN5A 3CTLA 4JTKA 3KRUA 3CHEA 3F5LA 1XI3A 7TAAA 1TTIA 4BI5A 2DZXA 4DYEA 4IGMA 2OQHA 3S9YA 1C93A 5FAJA 4J3WA 8XIMA 4OBSA 4PCPA 4NZ3A 3GNRA 3SCOA 4L7ZA 1KQZA 5REQA 3WQCA 3BLOA 1JAEA 1KM1A 4O28A 3SCTA 1HVXA 5D38A 5C5YA 2I1OA 1C90A 3ME3A 1L6GA 1PCWA 2JE8A 1DJWA 3ARPA 3LPFA 1AJ2A 2VDIA 3EX4A 4Z0SA 3QBUA 4FLOA 4X0VA 4XIMA 1E6SM 4D72A 1HL8A 2CZEA 4X60A 4YL2A 3GDTA 2Q8XA 5GNZA 1VS1A 4QTGA 3UT0A 1JUBA 3ZVHB 1QI2A 4JTQA 6REQB 3PJXA 1T96A 4S3GA 3QW3A 3SFWA 4GQBA 3PSWA 4JPGA 5EBAA 3QRHA 4WXYA 3KLKA 2FZMA 3B0YA 2XIIA 2Y24A 2ANUA 2PDQA 1W3JA 2QUNA 4M82A 3QMSA 2PS2A 3WQVA 3IACA 3NTYA 3ISIX 4EPBC 3CQIA 1UWUA 3EDKA 5CPLA 3C6CA 1A5NC 4PGLA 3VOIA 3VM5A 1XGZA 4IXXA 2I7GA 3C61A 3UXIA 4CN4A 1V3IA 2I14A 1HNYA 1O7AA 2Y8UA 3MWCA 1VYRA 3LNPA 2DSWA 3NOEA 3UPBA 2XDFA 4NZFA 3NQDA 3WBWA 1NH6A 5HJXA 3UR8A 4GH1A 2ZX5A 1VP5A 3KCJA 1AG1O 5FJRA 4N7QA 4PL1A 5GNXA 3H6OA 4W8BA 5DFAA 3VKDA 4GIRA 2YDRA 2WZEA 2WBGA 2Q71A 1H51A 1UR0A 3ZT5A 1XRSA 4O4WA 1KM3A 4GHRA 4IG2B 4IQLA 2PDWA 1E6RA 3THQA 1MZHA 2BOEX 3VO0A 3CTTA 3BAJA 3FJ6A 2FZ8A 1S1RA 1B4KA 3MVIA 2Z1XA 1JDFA 1CGTA 4NI8A 3UFYA 2VRJA 4B5VA 1LWHA 3QZAA 1W8SA 3A23A 3F5JA 4OBRA 3HIJA 2WPGA 2FMNA 4AZBA 1LRNA 4H8NA 3SB0A 5MKGA 3VTRA 1UIPA 2DH2A 5M17A 2FGZA 1HKJA 3W22A 3B97A 5HWJA 3WQ8A 3PZQA 3N2MA 3ITYA 4LANA 2YLLA 3EMQA 3W38A 2VELA 3BQ6A 5AYXA 4UFHA 3S47A 1GW1A 3PBVA 1ONWA 4NQ1A 2CLLA 4AVNA 1YKWA 1KD0A 5DCEA 1PTAA 3O7UA 2PDUA 3RDKA 1IEXA 3APGA 4JL1A 4HU3A 1D7KA 1E6NA 4YU1A 1VEPA 4K7VA 5M1TA 5E5CA 2QCDA 5KETA 2Z2AA 4AVOA 3DEQA 7XIMA 3FVMA 3C5QA 3VDGA 2Y70A 3VIGA 4HHLA 2XG9A 3H2AA 3OLEA 1R3RA 3EWDA 3K8LA 5LNSA 5AKQA 3VC5A 1A5LC 1UP3A 3M0IA 4HQVA 3WUGA 1UKQA 3KVJA 1A5CA 4U2YA 1XLCA 2P8BA 3UNDA 4EWJA 2E6YA 1SW7A 1CCWB 1KM5A 2RGMA 2J8GA 1ZSXA 3CEPA 3AJ7A 1TJRA 1ZNNA 4O19A 1PX4A 3ZJ7A 1MEHA 4O8AA 4CCZA 4IGSA 1RCXB 3FA5A 4DIAA 2AL1A 5J04A 2OLAA 1UPMB 2CLIA 4H8HA 1DXFA 4DJDC 5TD4A 3VD9A 3MMTA 4AX6A 3NQBA 3NO3A 2KZHA 2JIWA 1WQ5A 2HE8A 3B8SA 3M0KA 1HX0A 4EPKA 2ZIDA 3P3BA 2DV0A 1MQRA 3QHNA 2ZKMX 2GJPA 1XC4A 3IIOA 1B2YA 4G9PA 4LYPA 4U33A 1BG4A 3OLIA 3B04A 1FKXA 1UD5A 2HXTA 2OMAA 4Q3MA 1W9PA 2VZVA 3XINA 3G18A 5HDRA 1PYMA 4ADTA 3DYOA 1PXGA 4TR9A 4MJ4A 3PSVA 2VDHA 1YTEA 3LXBA 5DELA 2E6FA 2ZA3A 4TX6A 1VFLA 4PMOA 3U2OA 3EDFA 4EANA 2VTFA 3G1XA 3QN3A 7ENLA 1WE5A 2J78A 4P8WA 2P3EA 3GIPA 3N4AA 5DMYA 3UWQA 3WL1A 1E6QM 4M0XA 2Q8LA 4UTWC 1DBTA 1Y5WA 3CHFA 2PTWA 4NSBA 4LS0A 5D9OA 2FDMA 2YB4A 4IPPA 2C18A 1E51A 4R7JA 1B30A 3PJUA 1EGZA 3FXYA 2VZUA 4GY7A 1TMHA 4AWUA 2HVNA 3NQFA 4W4QA 5K2ZA 1O68A 2I17A 4J40A 1OF8A 2BVWA 4NT0A 4DM1A 4RE4A 4BR1A 2GZXA 4QLJA 3LCGA 3LLDA 5XIMA 2CW6A 5MF5A 5D2XA 3LRMA 4B2DA 3U5UA 4GXWA 5BXRA 4D71A 1LOSA 3W85A 1FWSA 2EAWA 3B4UA 3SGGA 1O66A 6PTDA 1W91A 3PUDA 2XTKA 3HG3A 3LS9A 4MSSA 4IIBA 3BG9A 1J6PA 3EPOA 1RP8A 1Y5VA 1E70M 4I6VA 4DAFA 4BK9A 2HDJA 1V03A 1IWBA 2VURA 4KIRA 2VC9A 4EOUA 4Y6GA 4NAFA 1E40A 3QTPA 4RKAA 5K4ZA 2CETA 3H7RA 3WLJA 4HNVA 3SQSA 2XHYA 2NX3A 3ZLHA 1OGBA 1OX4B 3L7RA 2CFFA 3ARXA 4RZ5A 3ZO9A 2DQXA 1OFBA 2V3EA 1ZAJA 3CT7A 1P48A 4PRWA 2PDPA 4X3ZA 3OIHA 3AJXA 4F0HA 1OQFA 3DI0A 3WH7A 4AZHA 1J10A 1UWAA 1UYQA 1MXSA 3PBMA 3WDPP 1CXHA 1JYXA 2VEKA 3S2CA 3HFTA 1KV5A 2MUCA 2GDUA 3N2BA 3V0UA 1J5SA 1EL3A 3LV6A 2OWWA 2RGLA 4KCVA 4CD7A 4XKYB 4HPHA 3VKJA 4KT2A 3NAVA 3F03K 3W72A 1IE7C 2CBUA 2OWXA 1A49A 2PLCA 2EEXA 4O10A 3S0CA 3ZOAA 2VDGA 4OECA 4W89A 4QITA 4ZENA 1OFPA 4N02A 4AHPA 3M46A 2O55A 2V68A 1EHNA 2FZ9A 1J6OA 5CZ0A 1DTUA 2OODA 4NYYA 3FHAA 1XQKA 3L0GA 2C0HA 1UJPA 1FWEC 3SRFA 3MS8A 3CAQA 1H0GA 2W62A 4WKFA 1TRIA 4LUSA 4CNUA 1QW8A 5IFPA 5D4YA 3FOKA 3W2KA 3JU2A 4GK8A 1J9YA 3AHXA 1ITCA 1IXOA 4DBWA 1C7TA 1JCTA 1PWMA 3HPZA 4IICA 4LGXA 4M81A 1EO5A 3M0ZA 3M47A 4FZIA 5JQ9A 3BAIA 4CD4A 3WNOA 2IKGA 4WSHA 4OU1A 2J7HA 3N2TA 2QUUA 1ZALA 3O06A 3W6MA 4K8HA 4DJFA 1XIHA 4ATWA 1JEZA 3WG6A 1UHVA 1GGOA 1R9XA 1O5XA 3MMDA 1R3SA 2INFA 2V8ZA 2VFFA 3C52A 3QV7A 5G1YA 3BMVA 3UZYA 4WF7A 4QX4A 1LZOA 4NZ1A 2QDHA 2B7OA 2WC7A 3QMRA 3MMWA 4PTXA 1UA3A 3P67A 1Q2RA 2AKZA 4Z0JA 4FXSA 2IKJA 4MFDA 2VI0A 4GQRA 4LWWA 3POCA 4NHVA 4PCNA 4UZSA 8A3HA 3CZJA 2FHCA 2BX7A 2ZRVA 3WY1A 5I5RA 5CSRA 2WHJA 1TUFA 5H8UA 1XW8A 3GRIA 4DUXA 1H4PA 4XZ9A 4XZLX 3CUZA 1X39A 2YCEA 1E3ZA 4NI3A 3MT1A 5GJMA 5GNYA 5L6UA 4J3SA 4RDWA 3DFOA 4WJEA 1JQXA 2DZAA 1OT2A 2WKLA 2QV5A 3MUZ1 2V5KA 3S1GA 3ARWA 2GDVA 2PWDA 3LMZA 2AL2B 1C9WA 1KTBA 1OFRA 4UTIA 3TX9A 3VGFA 4JFVA 4URIA 4XD5A 2QJGA 1UZDA 1ZTVA 3S5ZA 3II1A 3TA9A 4JTCA 1XRTA 1UD2A 3RN6A 1A47A 4GZEA 1LCOA 4FHAA 1VFUA 4LAUA 3SY8A 4JD4A 3ZWTA 3LLFA 4NAEB 3SCNA 3WYZA 3CZKA 2ZADA 4LSBA 3FYOA 2NXIA 4QNEA 4C5YA 2DEPA 1H49A 4UFMA 2VRQA 2YCKX 5KTLA 3OBAA 3MP3A 3L2LA 4GI4A 1TQXA 1EGVA 4XD6A 1UMLA 2V3FA 1TTJA 2D3LA 4LF2A 3G1SA 2FVKA 2ZOXA 4IUGA 3NQCA 2NZLA 1DJNA 4DX3A 2GSJA 2QPUA 1TV7A 1Q8AA 3H26A 4R9OA 1E9YB 4DXKA 1TPH1 1J96A 2JF6A 4JTLA 1R7AA 4ONVA 1F74A 1FDJA 4KEZA 3N73A 2P8CA 4RXGA 2OCZA 3AIUA 1XBZA 1Q6LA 4H04A 4LS1A 2WNZA 2POZA 4WEVX 3UPWA 4UOJA 4E8DA 2QULA 2J7CA 3H8AA 3KM8A 4UQAA 2VR5A 5A8OA 3AU6A 1JNEA 4MLRA 5A6JA 1DVJA 1H1NA 1KA9F 2NVAA 2IW0A 1W5NA 5A2CA 1XISA 2WB5A 5EB8A 5ABFA 4ML4A 1M5WA 4RDVA 1GOKA 4Y8FA 1GYMA 4OWGA 5C71A 3AMDA 4F2BA 1HF6A 3G8EA 5DEZA 2H8ZA 1M41A 4ALDA 2OGYA 2WXDM 4C60A 3CK5A 4U28A 4J5NA 1MMFA 3CMJA 3E0LA 4XUYA 4EVZA 4M6PA 3ZM8A 1UWIA 4LXFA 1B54A 4ZB2A 2XVPA 1EXPA 5FF2A 1QNPA 1UMYA 3E3HA 3WQWA 3W1XA 1ZBCA 1TWIA 8XIAA 1NVMA 4B5SA 4DY1A 1G7VA 4US5A 3KEHA 4AQLA 3QSRA 2DUZA 1WAWA 3W7IA 1ZUAX 1BGGA 1NDWA 1FWJC 4I9TA 3ARTA 2VEMA 1LDCA 3W87A 3TVAA 4QEHA 3HTWA 3PAOA 2CBJA 4NJIA 2E5CA 1RPKA 1E73M 1OJXA 9XIAA 1V6YA 2FLIA 5FAGA 5EL1A 1OBAA 1H5YA 1DORA 4GWEA 3W7OA 1HG3A 1SJDA 1Q6OA 2YCIX 4G7FA 3NZPA 3M44A 3AO0A 1SFSA 3TLLA 1XL9A 3EMZA 4LUSB 4A21A 3DCPA 3VX0A 1C8VA 4K1GA 4EE9A 1YRRA 4ECLA 3SCWA 4GNKB 3WLMA 2WSPA 4FMVA 3WJWA 2WJZA 3PZTA 3W01A 1J5TA 3WNNA 3W7NA 3EKZA 1QO2A 4GYJA 3O6YX 1U1HA 1CGXA 4XO7A 4YLWA 3DG6A 4IMAA 4D8LA 1RA5A 1XCXA 3GKAA 4ZTYA 3CZLA 1W3LA 4MWAA 5FSEC 5M3WA 4DBDA 3VX1A 2FIQA 1TJPA 3V5CA 3BG3A 1SW3A 1XLHA 1UKSA 3CYJA 1WKFA 1ZJAA 3W53A 4P61A 1ZCOA 3NQ6A 3G2GA 2BVYA 4JIEA 3MW7A 2O9RA 2CLOA 1PB0A 2UY2A 2UY5A 4I6KA 4AWEA 2IS7A 4PTDA 4FNSA 5E09A 4ZR8A 4WZHA 3TNBA 2EHHA 1KBBA 1TE6A 3TR9A 1JI2A 5DXXA 3QKEA 3IUIA 3L2MA 5K9CA 4FIRA 3OA5A 3A5FA 2B0MA 3MO7A 3W81A 1TVPA 2YXOA 2AAAA 1FCVA 2AQWA 1US0A 2ZDRA 2VWSA 1V4YA 2Z2BA 3FYYA 4QR6A 3R6IA 4Q8QA 3Q65A 3THAA 3WELA 3WJSA 2W61A 5BRQA 3NL5A 2D73A 4CCDA 2ZRYA 2GGIA 1U5JA 2G96A 1D3GA 2W92A 2NT1A 4UTTA 3GWQA 1L6YA 3P8IA 2PDIA 3YPIA 1P0KA 4IMDA 3MSRA 1TCMA 4J27A 3DHDA 2QCCA 5KMYA 2NX9A 5A2AA 2ACRA 2XN1A 4MJZA 4JNMA 1ZL1A 4UOQA 3BPWA 3P80A 1A3WA 1JL8A 3JS3A 5E0CA 1KRCC 2A4AA 5CG7A 1FUYA 3ARQA 1UH3A 4JIPA 3EBVA 3BZJA 3D46A 4UNLA 3G77A 1QPNA 3WKZA 3CZ8A 3ITOA 3TYDA 2CZDA 2O7QA 3HG4A 4L4MA 3NPVA 4CVUA 4KWVA 4GIEA 2C1HA 1H61A 2P0OA 4QJ1A 1L2UA 4BQ2A 3TC7A 4E4FA 2W91A 2VGFA 3U2CA 4I9AA 1NWRA 1KXHA 4NU7A 5LNVA 4FIQA 3WQFA 1EEPA 4QS6A 1WCGA 4B2DD 5HAOA 5AYYA 4H8UA 1FHDA 1HKMA 5AHNA 4UQBA 1R38A 1LLWA 5I09A 2RAGA 2ZQ0A 3CQ0A 1DPMA 1FDZA 3VNIA 3ID7A 4E8GA 2PDFA 3UPMA 2VD8A 3TCEA 1T99A 5BU9A 4ZE5A 1JG9A 2G3MA 5HQEA 2NW0A 2HBVA 1QJWA 3EOEA 3C3NA 1PZ0A 1S39A 1PAMA 5LHEA 3BSHA 3G1FA 5ABGA 4TV6A 5HMSA 3PWIA 1XRFA 3HPAA 2ZZ6A 2NSXA 4R85A 2VD9A 3D5HA 3FDGA 4F79A 5I3GA 5IHRA 3KBMA 4GGHA 2FB2A 1E71M 1M65A 3MV01 3GVRA 4WCJA 1W9UA 1CXLA 4H9TA 5AC8A 5JH1A 4DZ5A 1AD4A 1XLIA 1PJ9A 1GHRA 3EA1A 3RU6A 4CNSA 1CGWA 4YHEA 5C8BB 2QAPA 2WW5A 3IUHA 1EF3A 4WKAA 3GTNA 4IFRA 1JCYA 3DFSA 4GO8A 4JQ1A 2XGBA 3I3BA 4GQGA 3GAKA 1QU4A 4Q7BA 1MW3A 1VH7A 2J77A 1XBVA 3CO8A 3PBYA 1FHUA 3EX2A 3QF0A 4Y96A 4OZOA 3PZNA 2CERA 3DGBA 3U2ZA 3N12A 3QLLA 2QPXA 3CIVA 4JHOA 4A4AA 3T0CA 2PC8A 1P5BA 3WUFA 4QBXA 3UZZA 1Q3NA 1BWKA 4DM2A 1B3OA 2YXXA 1KWKA 4YVPA 4IMEA 2IPFA 1UOKA 4IIGA 3TSBA 1GVSA 5FIPA 5C2CA 2ZTJA 1GTEA 2I5GA 2GSHA 4C90A 1ZBWA 3NL6A 3UCQA 2J13A 1PDYA 3GBEA 4GNVA 3LGEA 5BZAA 3TOPA 1ICSA 1GK8A 3B8IA 3NZRA 5CEWA 1EF2A 1ZCCA 4S39A 2QUMA 1HFBA 2ZC1A 1NY1A 1HKVA 2VC7A 3O6AA 1KGWA 3GVGA 1H1ZA 3WQOA 2D69A 3I4EA 4CUCA 2PZ0A 5I03A 4DXXA 1RBLA 4BWLC 1KFBA 2J27A 1GVIA 4HZMA 4IP5A 3TC6A 4U2ZA 3LQLA 4O16A 1W9DM 1CEOA 3IK4A 4L4PA 5I78A 2ZUNA 3B0PA 1UROA 5D37A 1FWGC 2PP3A 2GGEA 4H00A 3PB0A 4JNZA 4MY8A 3FK4A 5TIMA 4LVBA 1V02E 3HGOA 4DJFD 4NZJA 5D09A 1CYGA 2VVNA 2ALRA 3WF1A 4AHQA 4JX6A 2V67A 2O9TA 1XD0A 2BV9A 3CV2A 5U7SA 4W7VA 4YWIA 3WSUA 4C1NB 4YWSA 2HCVA 2H8XA 1VIZA 3BCJA 4A3RA 4B5WA 4BI6A 4OHQA 2OT1A 5AHEA 4F8XA 6ENLA 1UZ4A 1KTCA 2PD5A 4CCEA 4AEOA 1QPOA 2WWCA 3TJ4A 2XFWA 1V0LA 4G7EA 4H7ZA 5FD0A 1HTIA 1VQTA 2CLFA 4YS1A 5E70A 4KH2A 4QAWA 5DY3A 3P5YA 2CYGA 2DVXA 4LUTA 3CAWA 3VGGA 2A85A 4MJMA 3KP0A 3DFQA 2HXUA 5IDIA 2QIWA 4H01A 5EBUA 1GOMA 5AHMA 2DT2A 3KOXA 4YJ5A 1SSDA 1U5VA 2W0UA 3O6CA 4ZQNA 4LFYA 5AZ0A 4NNBA 5KZMA 2VFDA 4MB1A 2BASA 1YNPA 3GO2A 3VD3A 1UKTA 5BOFA 4EK7A 3FS2A 4Z2KA 3T6CA 5F4SA 5T9BG 3AZTA 3FJNA 1XDJA 2I5QA 3GNDA 3VIPA 3V3WA 4XAZA 1BYCA 3E9AA 1OVDA 2QIIA 3L0KA 3AYSA 1PO9A 5A6TC 3RRXA 1XYLA 3B3DA 1FY6A 2NQLA 3UCDA 3GVVA 2P53A 4D6FA 3WLPA 4DAIA 1KGXA 2XH7A 1E6PA 3AAMA 1E6ZA 1EPXA 2G8ZA 1QASA 2FHBA 3GH4A 3CU2A 4WOZA 1GOOA 3MBFA 4J2MA 1S46A 2V81A 3WH9A 3KTSA 2J88A 2IPWA 1BGAA 1XRVA 1WDRA 2QMKA 4DRSA 4ML9A 4MPQA 2INEA 3TYUA 1WO2A 3E74A 2XN2A 1AH4A 3ANYA 2GUUA 2WZHA 3MUXA 3U5YA 4Y9PA 1QNOA 4A3UA 1S5VA 1WOBA 3HMJG 2OO0A 3BWWA 5AECA 4MWAE 3HZ3A 1XWYA 1QOQA 1EWDA 4GCAA 4LBUA 1TWWA 2FPVA 4TX8A 5C55A 5DQPA 5HR6A 3QHOA 3GC4A 2Y85A 2PGFA 3HFYA 1K4HA 3ABSA 4PCSA 1TPB1 1EB3A 3PPGA 1EA9C 4GPNA 3OZYA 1ODZA 4JDBA 3AQUA 2BDQA 5TQLA 2IPJA 3FN9A 4PB3A 3VXGA 1VJSA 3JR2A 1MXGA 4GVFA 2A1YA 4AWSA 1W5QA 2VOMA 5E93A 1DWIM 2DJXA 1Q6RA 2ZZ1A 1EJTC 5HNNA 1PV8A 4LEFA 2GQ8A 1J11A 4QJ3B 2FHFA 1NP2A 1DJXA 4GI6A 3AFBA 3QY7A 3CZEA 1O1ZA 2VNCA 1SYTA 4HNUA 1JI1A 1OCQA 1WDDA 1OM0A 2YDQA 3WLOA 3AICA 7CGTA 4YVVA 3AIWA 1EC7A 4GJJA 1TPFA 4H4IA 3KAOA 4P7NA 4F9DA 1FWTA 4NRRA 4POCA 5D9MA 3WLIA 4LAMA 4ZB5A 1HJWA 4US5D 1M7JA 3SW6A 1Q4WA 1W3HA 3S5YA 4NVTA 3UERA 4A2RA 4FO4A 2Y8KA 4A3YA 3GBDA 1GG0A 2E77A 4UB9A 3LHZA 3MPGA 3EMCA 1N7KA 4PTNA 2BXZA 3RX4A 3KHDA 4C1KA 3VKBA 1CECA 3A12A 2Y5EA 4UMBA 1VEMA 2QQ6A 3UP8A 1TPEA 3PTQA 3GC2A 3C3UA 1IR2A 2IQDA 2WJDA 4AB4A 3MJMA 3BGJA 1S5MA 4ZOCA 4ADSA 4LV9A 4W8LA 4B15A 1F76A 2E40A 5HMFA 4YCPA 4JN7A 3T2QA 4WRHA 4LB4A 1JD7A 4E8CA 3HJZA 3F4CA 1G4SA<