4EFEA

Crystal structure of dna ligase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of DNA ligase
rcsb
molecule tags Ligase/ligase inhibitor
molecule keywords DNA ligase
total genus 103
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4efeA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4efeA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4efeA02
3T1YB 2UXBB 4DV2B 4DR1B 1FJGB 3PN1A 3NBYB 4DUZB 3S24A 1TAEA 4DV6B 4DV3B 3SGIA 1P8LA 4PZ6A 3BABA 4LH6A 4LF5B 3GB8B 4LFCB 1IBMB 1DGSA 4GKJB 2HHHB 4GLXA 4OX9B 1TA8A 3T1HB 4TOIA 4JI7B 3UQ8A 5LMUB 4JI4B 4CC6A 2CFMA 5FPRA 4AQYB 1P16A 3TY8A 1CKOA 4EEQA 2Q2TA 2OWOA 4EFEA 4DR3B 4CC5A 1N33B 5D1PA 4UCUA 3OTOB 5BR8B 4DV0B 1XNRB 2HVSA 4NXMB 4JYAB 4DV4B 3VNNA 4JV5B 4JI5B 3BAAA 1XDNA 1N32B 2UUBB 4UCSA 4UCRA 4LFBB 2UXDB 4DR7B 2HIXA 4JI6B 2VQEB 4B3TB 4UCVA 1N36B 1CKNB 1X9NA 4KHPB 2VUGA 4LH7A 3RTXA 2UXCB 4K0KB 4GKKB 1XMOB 4JI8B 4JI2B 4DR6B 2UUCB 1S68A 3BA8A 1XK5A 4DV7B 4DR2B 3RR5A 4LF6B 3TY9A 3KYHC 5FPOA 4DV5B 5IWAB 3GDEA 3W1BA 4DV1B 3GJXB 3BA9A 4LFAB 4JI1B 1HNWB 4LF7B 1IBLB 1I94B 4UCTA 1N34B 4JI0B 4PZ8A 1HNXB 1A0IA 1B04A 4EFBA 2Q2UA 3L2PA 1HR0B 4DR5B 1IBKB 2UU9B 4X62B 4YHHB 2E5LB 4NXNB 5D1OB 1V9PA 4X64B 3QWUA 1HNZB 2HVRA 2HVQA 4B3MB 4UFZA 3TY5A 1VS0A 3JSLA 4YY3B 2F4VB 1XNQB 4X65B 3W5OA 4DUYB 4E6NA 1CKNA 5DISC 2ZM6B 4B3SB 4B3RB 1XMQB 4LF8B 4EQ5A 1FVIA 1ZAUA 1J5EB 5D1OA 2HIVA 4DR4B 2VQFB 4JI3B 1CKMA 4DRFA 4X66B 4LF4B 4LF9B 4PZ7A 3JSNA 4UCOA 2UUAB 3NBZB 3NC0B 3W1GA 5LMNB
chains in the Genus database with same CATH superfamily
1ZX3A 1US6A 3OW2U 4KFMA 3L9DA 4AQYH 1N56A 4DR3O 4PA4A 4DUZO 4FU0A 2QTSA 1EKFA 3QVNA 2DPIA 3EFFK 1IVSA 4C2MA 4IWYA 1GK9A 1HR0H 3OGCC 4TWKA 1NZ6A 2WLIA 1IBMB 2CKZB 1M4UA 3B8NA 2EIYA 5B3SC 3AG2C 3CXCU 3W7SA 4NXNO 3KHGA 1DF5A 1SQQH 1IYDA 2RDJA 4EFEA 3TIGA 5EWFA 2W9BA 2OLSA 4MVOA 5BR8B 2NNUA 2QGNA 5T14A 3G6XA 2XHBA 1THZA 5DMXA 1GN6A 4O3NA 3RYHB 3BAAA 1YJWV 4J9PA 4CKEA 2LW1A 2UXDB 4R7CA 1OBDA 2WSSG 4YJ2F 2OIGA 2FPGB 3Q8QB 4J9ZB 3CCMV 1N4CA 5IWAH 2FJZA 1ZL8B 1I2LA 1R6NA 5KFAA 2ATLA 5J2TB 4GKKB 3AG3C 1WA8B 4DR6O 5EZYF 3K9AA 4DR6B 1I1LA 3OTFA 5CMUA 3KALA 4UVBA 2UXCO 4QE7A 5C8YF 5CA0F 4O82A 5EIBD 1AI7A 3T4DA 4I0XA 2ZE7A 5BPHA 2F4VO 4QIWA 2C35B 2XGQA 3KYHC 1X59A 4GZRB 3A0BZ 3BA9A 1GLVA 3O65A 2W6OA 1TUBB 5KFFA 4BIUA 2DZDA 2R93A 2NU6B 1GYFA 3FB5C 1MNGA 3UO2A 3E22A 2VRZA 2QF7A 4Q8EA 5KT3A 1Y1VA 3OFNG 5KFLA 4A2AA 2FPIB 3ML0A 2BCCH 2HFEC 1EM1A 3LDEA 1XNQO 2FPPB 2ALZA 4O4IB 1FPOA 4DUYH 2ADPA 4JYCA 2D3OW 4X20A 4PELA 3N43B 1DTOA 3GTPA 1CKNA 5JJJB 3RYIA 3RN4A 2AGPA 3RYCB 4ETSA 4B3SB 1ULZA 2ODTX 2M05A 2ZNJA 2R7MA 2F66C 3CJHA 1FKAO 1JX4A 1W59A 4RNMA 2QSAA 3T9AA 3BQ2A 4YJ3A 2NLJC 5D8DA 2JJ1G 1NQTA 5JJEB 5IYDO 4QWAA 1RJRA 1Y1WA 3LMLA 1XNRO 2EZOA 2Q5ZA 3T1YB 2EJ2A 2YYAA 3JRWA 2WA3A 4DR1B 1XMOO 1F7YA 1QLEC 3IFXA 4XYMB 5J2UB 3F7YC 2JA5A 3FAVB 1KUTA 4XBFA 3E22B 4Q0YA 5CA1F 2XIGA 3RGZA 4FBTA 4JV2A 4MV7A 4F4ZA 2R70A 4PDRA 5F9NA 4IRDA 5A2QW 2W0FC 5H6RA 3TIIA 3APOA 3UO3A 4CC6A 4QWBA 4EB6B 4ECVA 3HKDB 4DV0H 3SYOA 5KHIA 2HHFA 3IJ4A 1Y6XA 3R23A 3OR6C 2B63A 4ED3A 4ME6A 5LP6C 3ABMC 1XEQA 4O7VA 2XNDG 5EYPB 1SS3A 1PV0A 5LA6F 4DR6H 2E75B 5JUMA 1Y67A 4JAUA 3AYHB 3N2KA 3VQXA 1MA1A 3HOYG 2FKXA 3RF2A 2YUAA 4F50A 3BG5A 4PDMA 2GUZA 2EX3A 4DV7O 3QO7A 1VQOV 3U55A 4O2AB 4MTOA 4GX2A 4FFRA 3HKEB 4Q45A 4J9QA 2ODMA 4MA0A 4R6ZA 2QKAA 4BW5A 3SNOA 3P32A 1OCOC 3MWDA 2E76B 2ARHA 3HXLA 5LP6F 2PGGA 1JXLA 4WCEV 1KJ8A 4NZMA 1KBHA 2NUAB 4LFCH 5EOYA 4DR1H 2CNVA 1V51A 3IGAC 1Z5WA 4I50F 5BR8H 1H8HG 3K0DA 3ZHQA 1NBMG 4C5CA 1MZFA 2FK2A 3CB2A 1VQ5V 1HNWO 2L35A 4MVMA 5C1PA 1N0JA 1BJTA 4UFZA 1AP6A 5KMGA 3ABKB 1E4EB 4D6TH 1VS0A 4LMYA 5KFHA 1YHQV 1XNQB 2QJ1A 1D2DA 1RPOA 4DV4O 3LDCA 5I5TA 3JRXA 4DR5O 2AQ4A 2ZM6B 4DRXB 4NB5A 2CTQA 4FFMA 3H40A 1GN2A 1JKJB 5KLVH 4O4JB 1OZ0A 1KJQA 2W6JG 4A3FG 1ROPA 5EBMC 1G6UA 2FB5A 2ITDC 3BRCA 3K9SA 4LWSA 5B5EZ 2HEPA 2JS3A 3M99B 4IHJF 2NU8B 2EJ0A 4LF5O 4DR4O 1W0KG 5LMNB 2Z5UA 3J7AK 2I87A 4PWQA 4HYKA 1SQPH 5E25A 1UNNC 3TQ1A 1J5EH 2QDOA 4B08A 3WO1A 4O4LB 2WYOA 2KG7A 5KX5F 5JCOC 4DR5H 1Q90D 1AI4A 4GKJB 4OGQB 4CZZA 2KKWA 2VQFO 5BWWA 1JJ2U 1QLNA 3V6HA 1GO3E 3MR6A 1BGYH 3T9BA 4X64O 5ITZA 1IBKO 1R3IC 3JALB 2ZE6A 1S97A 3FKIA 5IT9W 4X88A 1HNZH 2QR4A 1WSCA 5DQIA 2HVSA 2D2CB 2V59A 5DQHA 2YXLA 2Q6AA 4NTYA 3K79A 1XDNA 4UUGA 2DAAA 3AK3A 2VQEB 4O3RA 4XDKA 1DV1A 1Q82W 2HDKA 3M4IA 2YEVB 3OEHG 2AHYA 4NTXA 4P2ZA 4UVCA 4ZI7F 2ZDHA 5BWVA 2R93G 4TQFA 4AILC 1FXKC 3ICXA 4CKCA 4FS1A 3CJHB 4HBNA 3RR5A 1OHHG 1CE8A 1WJZA 2YDEA 4KHPH 5KFGA 2EULA 3CRAA 4LFAB 1BXRA 3CRCA 3L71H 1SQGA 2VUMA 3SYPA 2WLLB 3CCLV 1XMOH 1L8DA 4J9KA 1VBGA 4EFBA 3ZN1A 4GKKO 2OTJV 1HR0B 4M7EA 2XUMA 4ABMA 4DR5B 1XMQH 4APMA 2NVXA 1VKZA 2W9AA 3CXHF 3K04A 4JI6O 4DV5O 2CDYA 4FFPA 1RK6A 3GWOA 5EWGA 5K1PA 4DV5H 2IJJA 2X0SA 4HQ6A 1T5EA 1IBMO 4IHJA 3W5OA 1Q6UA 1U97A 4DUYB 5CB4F 3N8DA 5BWRA 5KFZA 4EEYA 1JVMA 3J80N 2BSKA 2ZR2A 2DWDC 5L1IA 2UXXA 4JI8O 5EDWA 2C2EA 4LF8B 3MFHA 5FR9A 2M6YA 4ECRA 3H1IH 1A48A 1JQ0A 3MAQA 3HKDA 1J5EB 2ATKC 3GQCA 3OHBA 4YIOA 2FTKA 2KSWA 2EILC 5LA6A 2GBOA 1WCMA 2UUAB 1I6UA 4TUYA 4RQFA 1BMFG 3JCUZ 4DV0O 1IXBA 3ABLC 3K3WA 2BE3A 2QM7A 4DUZB 3N44B 4X89A 3ETQA 5IYZB 2WE6A 3H1LH 4E4EA 4PZ6A 2IP4A 4LC1A 3DTGA 4MTEA 4P9OA 3GB8B 5BWUA 1OCCB 3K59A 1B06A 2RN9A 3MR2A 5GW7A 4Z1VA 1NJIW 1OV9A 4MVUA 5JQGB 4PD4F 5ITZB 2QM8A 2C28A 3ETDA 4O4LF 3TY8A 3FX7A 4U3JA 4QJFA 2WTFA 1F4MA 4A93G 4CC5A 4RU9A 1KP2A 3B4SA 1EZVH 2YICA 5KFEA 3HT5A 3K5NA 5C3EG 4XDJA 1K4DC 1YDXA 4O2BB 3GIMA 1DV2A 3MD0A 1MOFA 4LSXA 5IYCO 3M8AA 5L1LA 3PZPA 1XILA 5TISZ 4YHHO 3ZHTA 4GCZA 3FKIG 1KB9F 1YXBA 3LNNA 3MHHC 4YY3H 3T5LA 3RB6A 4CBCA 3E8HA 1MG1A 5DAAA 2DQ0A 1XMOB 2ZXWC 4LCUC 4MA5A 4HNUA 1I0HA 4TQDA 4XYLB 1M9NA 1SQXH 3HOWG 3H3VH 1BCCH 4FLWA 3SJBC 2CW7A 3ZMUA 4F6RB 2QYZA 5DG8A 4DV1B 4DUZH 4JV5O 4O4HF 4GC7A 1R6TA 1S77D 5KFMA 1JOYA 1HP8A 4JZ2A 2W9CA 4ZI7A 3E5NA 1SZXA 1GH6A 1AILA 2ZKOA 3PVXA 1I94O 2GPWA 4MV6A 1N34H 2GV9A 2R92A 2Y4RA 3J81W 2JDIG 2JK5C 3ETGA 2E2HA 4JYAH 2O03A 4JI5H 3H0GG 2EIKC 3WG7C 3WFVA 4J10A 4GX0A 4WFGA 3FMAA 1F4NA 1TUEB 4B3RB 3PR4A 2IU0A 4FS2A 5H80A 5H5NA 4FFNA 3L74H 4QWCA 4Z1MG 2P4VA 1CQJB 5KFVA 4FM2A 5CBGA 4CE5A 2W7PA 4LNUB 2LGWA 3I5DA 2UXBH 2YXYA 4C7UA 3I56V 5H6QA 3AEIA 5AG2A 1SETA 3QO5A 3NR7A 2ZDQA 4A3IG 1FJGB 3FD9A 3PN1A 3NBYB 1L2ZA 4ZIBA 4F4WA 3V4SA 2P6JA 1AUVA 4EG0A 2V7QG 4JI4O 3U11A 1KECA 3G6BA 4WHXA 2EIJC 2M7WA 2EILB 2R82A 4MS2A 3OM3B 2ZIMA 4TOIA 4B3MO 2V5AA 4CH3A 4GKJH 3GV7B 3HKCB 4QIWE 1P16A 1KYOF 1L1FA 5J2UF 5IDJA 3H1HH 4EEQA 1JDEA 1N33B 4FLYA 2P22C 3OHAA 5H9CA 3KXYT 3E8BA 4ED8A 1FJGO 1AJPA 3STLC 5FNVB 2XAGA 4JYAB 3LP8A 4JI1O 4LFAO 2JGDA 2YL2A 1K92A 3OTOH 1VP7A 5DEDA 3OSPA 1JMKC 2ZINA 3QZ8A 3OUSA 3K5IA 1EN6A 1H2LA 2XCLA 1AJNA 4DW1A 2W7OA 3KZIZ 3JZFA 2FL4A 4JAVA 2CZGA 3RV4A 1KD1W 1Z2NX 1QU7A 2HG8A 1VIBA 4ED2A 4I55B 4RO2A 3U0ZA 1IBLH 2W9BB 5C1OA 4H13B 1GM8A 5B1AB 2UUCB 3ZRWA 2C22A 5LOVF 2AHZA 1MZEA 1O9GA 4J80A 1MSWD 5LYJF 4O84A 1BNCA 2OTLV 1RSOB 3W7WA 1N32O 4ECTA 1Z2OX 4CMFA 4LF7B 1I94B 2OH2A 4FZ1A 1BHBA 2CGOA 4RUCA 2Q0OC 2BQUA 5BMVB 1GRJA 4ICGA 4JAAA 2FK3A 4RNOA 1VF7A 4BAYA 5D1OB 1R73A 1A9XA 3QWUA 1WR2A 1KC8W 2HVRA 4YP3A 1KBLA 4YY3B 3GTMA 1VQ9V 2PMZE 4J9LA 2DQ3A 3KKYA 3UYYA 1NR7A 5CA0B 1H2KA 1K33A 1R1BA 1VQMV 3M9MB 3ASNC 5EZYB 3HB9A 5BYAA 4EQ5A 2CGNA 3CRMA 5J2TF 3ASOB 2ZE8A 1N32H 2PMZA 3R5FA 2A79B 1NS1A 3FAVA 3GWKC 4LP8A 2RDCA 5KAIZ 4CS4A 3UT5A 5LMNO 2VQFB 4RWUA 2JVDA 4CH5A 1G4YB 1B33N 3K03A 1WN7A 1KJIA 3T1YH 2EIJB 4CH6A 3EXAA 4DR4H 2XCAA 4A3DG 1AB3A 3RYCA 3W1GA 4CKBA 4FLVA 1AJQA 1GM9A 2HJDA 5KFQA 3L75H 5KHGA 1KP3A 4DV2B 1TAEA 5LXTA 2QK4A 3IAYA 3KCYA 3GLKA 2Y4UA 1KC7A 1P8LA 2BOCC 3BCCH 5KT4A 1M93A 4LF5B 3WWIA 2E3CA 1WP8A 2IMWP 2BTQB 4GLXA 1F51A 2CTWA 1CEZA 2XT9A 3U54A 5B1AC 1BSMA 5KHKA 3CSXA 3HO8A 2Q2TA 4K8ZA 4QWEA 3DGEA 4DRXA 3VMMA 3RVZA 5I5XA 4J42A 5KFOA 2Q68A 4DV0B 5L3DA 3CPWU 3T9FA 3L4KA 4DW0A 3JARB 3T9EA 4ECWA 5IWAO 2XD4A 5I60A 3ABKC 4DR7B 1YJ9V 5KG6A 1V54B 4KHPB 2VA2A 4LF4H 4LF9H 5LOVB 2JA8G 2NN4A 3RGBA 1NTKH 4UB8Z 3CVZA 3MHSC 4I55F 2VQFH 1KEEA 4J9RA 5KFJA 3D36C 4BR6A 3H0GA 1RJPA 3RFRA 1AR1B 2Q7GA 2P06A 3T54A 2WLMA 1M1KW 4DV5B 5I5UA 2FK1A 2LJ2A 1J5EO 3JD2A 4TV9F 3N27A 5BMVA 5EZYA 4PZ8A 1A0IA 1MABG 2EBOA 4C5AA 1ZWIC 2YI9A 3TGUH 3OR7C 4O4HA 1UPGA 4R8UB 4F4YA 4MVSA 2E5LB 5D5PA 3K3VA 1TWHA 1UC8A 1Q43A 2JEXA 1SKVA 2MCTA 1JJOA 4TQRA 4YHHH 3FFQA 2CUGA 4IZOA 4M0JA 3PJSK 4TV8A 1K83A 3A2FA 2QKSA 4Q4CA 3R65A 2X5RA 5DISC 1IURA 2UUAH 1CQIB 2C00A 3DC5A 4RQEA 1M56C 5B1BC 3ZIAG 5L1JA 4FM9A 4A5UB 4TV9B 3P3PA 3RFCA 4P9PA 3AG1B 1R3JC 1K7DA 3OUFA 4RB1A 2XASA 1VQKV 4J0MA 3L73H 4WFBV 4B7EA 1S5LZ 3JAKA 4X66O 1R3LC 2IH1C 2EINC 1ET0A 5FD5A 3G71V 1FXHA 2UXBB 4EBCA 5DN6G 5IE9A 1M57C 2EIMB 4DV6B 4O7ZA 3GILA 5LMNH 4DO2A 3HKZA 4MTGA 4O83A 1H8EG 3OGIB 1VARA 2PZSA 3LDDA 1FAFA 4G2KA 3ZRVA 3U9TA 1AROP 3AW8A 4BIOA 3CHXA 3CWBH 5LMUB 4DAAA 5LBQA 4TV8B 2ZXWB 3L70H 2F43G 2ZQMA 4U3FH 1WA8A 1XL6A 3HOZG 4A3EG 4X66H 4W4KA 2OIEA 3P30A 2QE7G 2JGUA 3CCQV 4NXMB 4PDLA 4BBSG 1WCMG 4JI5B 4ECUA 5A2QN 3AK1A 5B1OA 4BIZA 2YZMA 2IJHA 3UKMA 4DLKA 5BWXA 2OT5A 1VBHA 4JI6B 1IX9A 2WWWA 2KB1A 1N36B 1X9NA 1N8RW 2WB1E 5I5WA 3SPIA 4X62O 4K0KB 1VQ7V 1S0MA 5FD6A 2B63G 1S3JA 1XQ8A 4HAMA 2UXCH 4PA3A 5KUMA 1M6VA 1Q7YW 2GDSA 2FKLA 2WAQE 4DR2B 4I7ZB 3HB3B 5IYCG 4IGGA 5KFDA 2WLNA 4QJFB 3VA7A 1KMIZ 1GSHA 1VF5B 2DYRB 1FXKB 1AP5A 2JA6G 3WU2Z 2VPQA 3ABLB 3JZ6A 2V1DA 4LFAH 4MTFA 2CNUA 5C44G 1S76D 1ZLZA 1G2WA 5DM6V 1Y76A 4NXNB 1V9PA 2CH7A 1Y1WG 4IAJA 2A1HA 4N21A 3K0GA 1XOUA 4PI0A 4PBCA 4RZRA 3MWMA 3D3QA 1YIJV 1Y66A 1JIHA 1NU1H 3UM7A 1JFFB 3J7AU 2COJA 2R72A 1SYXB 4L1KA 3EPIA 5JVDB 4NXMO 1VAJA 3RB0A 4YAKB 1WB7A 4BWSC 2AXTZ 5BYBA 4ZHQB 4WD3A 4DV7H 2I80A 3B09A 4JI4H 5KG4A 2WPDG 5DG9A 3G6YA 1RK5A 5D1OA 3ABUA 1I50A 5B3SB 3ZHVA 1P7BA 3DTUB 2VQDA 4WFAV 1NKDA 4X66B 5F9LA 3TQTA 3C3SA 2KSDA 2AGQA 1GKFA 1EUDB 1OCRC 2HGWA 3Q1KA 4CS3A 3V4ZA 3S24A 3CD6V 2YIAA 4JUZA 2W9CB 3B2EE 4MW3A 1D5NA 1URFA 4DR2H 2A3QA 2LW7A 5I5SA 3MR3A 4LH6A 3VPBA 4X65H 3G6VA 4IIJF 1BQ0A 2ETNA 5CB4B 1K8AW 2YWVA 2PI4A 1QQCA 2DMXA 5L3BA 1KTAA 5IJ9B 1B6QA 3WWHA 2JEGA 4W4LA 1HNZO 2Y0SA 1ZHQA 2KQXA 3GIDA 4AQYB 3CRRA 3TW7A 2R7NA 2E5LO 3UFXB 1N36H 3THOA 1NR1A 1FFTB 4FMTA 4LBEC 1GO3F 4XDLA 2ZM6H 2W71A 2VS0A 4DL4A 1ORQC 3T1YO 1OCRB 5LHHA 1JX9A 3NUAA 2JA6A 4TUYF 3VOUA 4RZQA 3JASA 1S9FA 1M0TA 1BT8A 3T5HA 4TM5A 4B3TB 1SQFA 3V6JA 4D7TA 3IC9A 2Q7HA 2XAFA 4A3MG 1RYRA 4J7KA 3OMIB 1VQLV 2UVRA 4ZI7B 4O4IA 2ABJA 3TXSA 5FL7G 4G3IA 4YQWA 3SJQC 1QR8A 3HOUG 2PUSA 4D7SA 4CH4A 5HBRB 3CE2A 3SPCA 4X64H 2Y69C 1HWYA 2QWPB 5FPOA 1KQSU 3N6XA 3WB1A 4RUFA 3I4NG 5LP6A 4UB6Z 4PA6A 2YIBA 3LUTB 5DGHA 1WPBA 5EK0A 4BXXG 3RBEA 1I7FA 4JI2O 4K6NA 3DSQA 4YAJB 3Q8SB 1HNXB 4JV1A 3KAKA 1S0VA 4TVIA 2JGDB 2R8GA 2VUMG 1YEWA 4I50A 4A3GG 3CC2V 3L4JA 2R7ZG 2K1EA 3G4SV 2CTRA 3HBLA 2W0XA 4EBEA 1KKDA 2E5LH 4LSAA 5KT2A 4J9MA 2F4VB 4FBUA 3RV3A 4X65B 4BWAA 4E6NA 2R7ZA 2UXDH 3ZX6A 5LOVA 1Y14B 2Y0PA 3GTLA 1PPJH 1BQZA 2IM9A 2H3OA 1XMQB 2BSKB 1E4GT 2HR3A 2YSUB 4CHIA 4MV1A 3GB7C 4UV9A 3SYCA 1V55B 4JI1H 5I47A 4NR1A 1SA0B 5JCOA 3HKBB 4MVZA 3T2MA 1ZSPA 1FYJA 2PBZA 1VQ6V 3NC0B 5BY1A 5BZBA 3AG7A 1VF6A 2HVKC 3VQYA 3DTFA 1YTFB 1XL4A 3H1KH 3ZEDA 4FLTA 3RB4A 4YB8B 5CB4A 4Q20A 3T5JA 4J9SA 5EYPA 2UXDO 1ZHSA 2LQTA 5GONA 4JTCB 4B3SH 3X2QC 4O2BF 3AK2A 3G8DA 4EYHB 1AUXA 4OX9B 4LFCO 2WLIB 1UC9A 4DR3H 1A3GA 2R87A 5FPRA 1CKOA 5KG2A 3MDSA 5KHHA 1HW7A 2YRXA 2W6QA 3OTOB 2YIBD 4HNVA 2RJZA 4JTAB 5LMUO 4LF8H 3KHHA 2UVUA 4N23A 4O86A 2YCHA 5KS8A 2Q0AA 4LF4O 4LF9O 3RW0A 1K5SA 1E1QG 2J6UA 2J6SA 5I5YA 5KFKA 5LP6B 2ZNIA 2A9HA 1Z2GA 2ZT9B 5IP7G 1W0JG 4O4LA 2X0LA 4A2BA 4ASUG 4DV6O 1GSOA 3J80W 1PP9H 5K2MA 2NR5A 2PY5A 1N0NA 3BA8A 1ZTEA 3IN5A 2W6NA 4XX0B 2BQRA 2EIKB 4I5SA 5CM0A 4FLXA 2PYJA 4LF6B 3JAKB 5KMGB 4ZHQA 2ASDA 3KREA 1FKAH 2VA3A 1SCUB 5KAFZ 4AYBE 2O57A 3GTGA 2LFSA 1C30A 3CEIA 1Q3EA 3KCXA 5CA3A 2UUCO 3SJAC 3PW4A 3LQSA 5DG7A 1B04A 1OCOB 3FB7C 4RAIA 4R7RA 4QNHB 4DL5A 2WLHA 4BW9A 1BHAA 4KL1A 4FLZA 4LR3A 1Y76B 4WBNF 1XUQA 2FB9A 4B3MB 2VR1A 2H8PC 1I5YA 4JPRA 3TK1A 3Q2OA 3RAXA 3I55V 1K4CC 4TUYB 4DIMA 2W57A 4YXWG 2V4RA 2Y69B 3ZMTA 3MWEA 1JFFA 5GTHZ 5JVDA 5DQGA 1N33O 1K1QA 4IWXA 2R8JA 1I3QA 5IJ0B 2WA4A 2PVPA 2IW5A 4PDBA 4NYEA 3CEBA 3B40A 1LNQA 1AR4A 4FGRA 2XAJA 2WLLA 3U9SA 1WNSA 2BTQA 4X1YB 4GLWA 5KG1A 1KKCA 3ZHUA 2A0LA 3Q8PB 4R8UA 2QWOB 4IR1A 4FE2A 2VQEH 1O9HA 1P49A 4QE9A 1NH2D 1HDJA 3OUZA 2NVYA 4AYBA 3KAJA 4B3RO 1TGOA 4O7YA 5HV6A 4FVMA 2XCPA 3PW2A 5KFUA 1UJWB 3H9VA 2ZDGA 4NXMH 4ZOLA 3A8TA 1YZBA 2CK3G 1NTZH 1XI1A 3N40P 1RP3B 2ZE5A 5L3CA 4JI7B 1FJGH 1ZL8A 2CFMA 4HZ3A 1PX2A 2F95B 3AG3B 4ECQA 1Z5VA 1EZJA 2DYRC 4ZHQF 4IRCA 3JZIA 1KU9A 4GKKH 4A3JG 1T36A 4FIPC 3RYHA 4MV3A 1SFOA 3QZ7A 4ED6A 1YSCA 2K9PA 4JV5B 2HVJC 2ZIOA 1XHZA 3FYIB 2HIXA 4WFFA 1O75A 4DK1A 4ZKIA 1W93A 5DLGA 4WFEA 3RVYA 5C8YB 2R6FA 1QVGU 1RM1B 2R8IA 3PR5B 4FFOA 2XAHA 4LF8O 3SR2C 1M7JA 1K73W 1N34O 1IBMH 4KP4A 4O2AA 2JA7A 1DK1A 1A0GA 2AZ0A 2Q69A 3H20A 2XAQA 3CCUV 4RB0A 3GTOA 3OMAB 4X9QA 1GAXA 1K97A 1QVFU 3GJXB 2FYUH 3QFFA 2Q7DA 3HPLC 3CRQA 1H38A 1BZKA 1N34B 1QBZA 2WAQA 5E1AC 3AG4C 1KUQA 4Y8VB 2FLPA 3ZRXA 3VPCA 2A7WA 4QGPA 4YHHB 4PV1B 5DGAA 4EYIB 5BPFA 2ZD9A 3OUUA 4DQNA 1L0NH 3CYOA 3GVMA 3K58A 3JD1A 3F7VC 1RYSA 1VMGA 3BQ0A 1K34A 2DYSB 1FXVA 1ZUQA 1M57B 1X4TA 5FJ8G 2QA4V 4OXSA 2GLTA 1EN4A 1BS3A 4MV4A 4JI7H 1TVKA 1Y74B 1FVIA 2EINB 4JF3A 1ZAUA 4I9QA 4JGSA 2DLNA 5DLFA 2Q7EA 2COIA 1PNKA 3WB0A 4ZOLF 2F23A 1A32A 3RBZA 2R7KA 2HJFC 1EKVA 2FE3A 4UCOA 2MK3A 3NBZB 5HNEA 3LSQA 2DW4A 2DABA 3BACA 1YITV 1YCIA 1IBKH 2UUBH 3NGDA 3K5MA 2Z3YA 2R85A 1VF6C 1PNMA 4U3JB 2RF4A 4O2AF 1EFRG 4F4XA 4EGQA 1EYZA 1LR1A 2R84A 2UUAO 3F8NA 4LFCB 3OD4A 5LMUH 3HOVG 4YJ3F 5I5VA 2W6IG 5IYBO 3E35A 3HKBA 3ZMSA 2P5OA 1WAZA 5KX5A 2YC0A 4DV3O 3T99A 4I4TA 4YIPA 1PNLA 2X6BA 4DK0A 1W96A 3RT3C 3GIIA 2NU9B 1R3KC 4FLUA 4K8XA 2WDTA 4O4JA 3BVOA 2XTAA 2EZPA 5KT5A 3T1HH 1S0NA 1EHIA 4RCNA 4MW8A 4UCVA 2F1MA 4DR2O 4HR7A 4PA9A 5BXZA 5CA1A 1Y1VG 5KFRA 4DYLA 4BBRG 1K1SA 4A3LG 1DF4A 1WP7A 1R6KA 3GV8B 2B5UA 1P4RA 4DL7A 1COWG 1PKXA 1GN3A 2VWJA 3WG7B 1DAAA 3CX5F 2WB1A 3SI8A 1N36O 3M7MX 5H2FZ 5IJ0A 4PDVA 5K3WA 1HNWH 2AGOA 4R8CA 4TSFG 4F6RA 3WWJA 5KFPA 3W1BA 5HFLA 3NXSA 1P7GA 4X1IB 3DAAA 5E79Z 4HNAA 3OTOO 3BPZA 4J7ZA 2HP8A 1WB8A 2I8CA 3JASB 3R5HA 1PL4A 2DYSC 1IBKB 2BQ3A 4YJ2A 2XOKG 3ZRSA 3UT5B 3SPGA 2BR0A 4OX9H 2UXNA 1JA8A 4OX9O 2W8KA 1ZETA 4NXNH 1VQNV 4DXWA 4O81A 2EJRA 5CR5A 1IZ3A 3H01A 4O7SA 3JATA 4B3MH 4JYBA 1CS0A 3FDSA 2JS5A 3AG4B 5L3EA 1G1XB 1YJNV 5LXTF 1GM7A 2JEJA 3JYCA 1GMGA 1F23A 2C2AA 2QWNB 3C90A 3E8GA 3LNMB 1G8MA 1JR9A 2HGSA 4MSWC 2W70A 4DV1H 4DR4B 2YS7A 4I9WA 5DGBA 2DIKA 3ZBHA 4O7RA 1DIKA 4PZ7A 5GONF 5IJ9A 5JH7F 3BJYA 4UV8A 5J9PC 3M9NB 5LL6b 4JYYA 2X7RB 2P7TC 5BWTA 3ABMB 1ENVA 2N04A 3AG2B 1I1KA 3FB8C 3VQVA 3U0GA 3D3IA 3ZS8C 1S10A 2QB5A 5C8YA 3Q4HA 2F93B 2UVVA 2W6PA 1WH2A 4YJ2B 5CE8A 3I4MG 1EN5A 2HHHO 3AX6A 5IYBG 4I55A 3FB6C 2IU3A 5CN0A 5KFYA 2IH3C 2Q9LA 3VBBA 3K5HA 2FP4B 2SCUB 3JATB 2CAZC 1KJJA 2V4DA 2UU9O 4A3CG 2OWOA 4UUJC 1I5XA 3BQ1A 4K3AA 3RYFB 2OCHA 2DOSA 1KT8A 2EJ3A 4O3OA 1I94H 1XNRB 5LHGA 1E4FT 3T9DA 3B8MA 3WO0A 2AU0A 4O3QA 4A3BG 4DV4B 2N74A 3QO8A 2UUBB 4KXRA 4ZOLB 2QEXV 4JV5H 3ABTA 5IY5B 2JJ2G 1CKNB 1E79G 4X1IA 2MW2B 5KT7A 4LH7A 3DF7A 2ZJTA 5BMVF 1S72V 4U7OA 1HNXO 3TJTA 3T1CA 4FM1A 4I0XB 1MMMA 1IBLO 4DUYO 4IRKA 3LSSA 2ITCC 4DV3H 5KFNA 1QNMA 1EBOA 2CTPA 3R5XA 1L0LH 1IYEA 4YR2A 5LYJB 2GHYA 1RFYA 1JCHA 1IBLB 2QWRB 1AI5A 5IT9N 1FFXA 5DGIA 3T4ZA 2GSMB 2UU9B 1ZQ7A 2Y0SE 1TWGA 1IDSA 4B3TO 3T9CA 1XBLA 3GV5B 4QIWF 3N2KB 3JSLA 4CS2A 1OCZB 2R9AA 2X6AA 4MTXA 1AR5A 3W7XA 1VQPV 1VQ8V 3UZOA 4NKGB 2R92G 3HKCA 1M5IA 5FNVF 3FKSG 1HR0O 3K08A 2HHHH 3K3PA 5JQWA 4IR9A 1WLEA 1TWFA 1NH2B 2GQSA 1OBGA 3WNZA 3PO2G 4AQYO 2VWKA 1QCEA 4EKWA 1D5AA 2VPSA 4I4TB 2HGXA 3D8CA 5KA6A 1Q81W 2XC9A 5KFSA 2CW8A 4Q44A 2XGPA 3TCUA 2HKOA 1N48A 1PM9A 3N2GA 5FLMG 4X1KA 3SGIA 3ASNB 4B3SO 3CS5A 1RM1C 4ED1A 4M9UA 3PW5A 2VQEO 2WLKA 4DL2A 1DGSA 2Q4PA 2ZGIA 4JI3O 3K57A 1RJQA 4JI5O 3N42B 4J9NA 4RAYA 3BHPA 5JJNB 3T5KA 2PTMA 3JD0A 4DV2H 2JA7G 1NTMH 4PJ0Z 4HNTA 1Q6IA 4R50A 4GX1A 4DR3B 4NZNA 3HR0A 1UFIA 3JALA 4A3KG 5C93A 3H4DA 2UXBO 1H2NA 1YTFD 4H37A 1XHXA 3G80A 5EC1C 4LF7O 3PFFA 3VNNA 3X2QB 2R9RB 4BY7G 5JVLA 1N32B 4UCSA 1Z2PX 4UCRA 3CCJV 1C3OA 3OSNA 4K0KH 5KHJA 3CSWA 4ECXA 2P90A 4B3RH 3CC7V 2FLLA 5B66Z 1I7NA 1SEIA 2UXCB 3QTCA 3LWBA 3U10A 4FM0A 2P0AA 4C5BA 2R8KA 4L87A 1K5QA 3VQWA 4O4HB 1XK5A 2CH7B 5EIBC 3ORRA 3EPGA 1B3QA 4I7HA 2OYQA 1SERA 4IIJA 3TY9A 4LWSB 3C3TA 2ASJA 3D36A 5CAEB 3RBDA 2Y48A 4FJCC 4WBNB 4K35A 4QWDA 1HNWB 4FFBB 2IBKA 4TT3G 2JEFA 4WBNA 4DV4H 4HNAB 5GTIZ 4YBZB 2ZM6O 3L2PA 4X62B 3PO3G 1AN7A 2EJ7A 5KFXA 2A06H 2P4KA 5IYZA 3C0FB 4DV6H 2GUZB 4LNUA 3DC6A 5LYJA 4RNNA 2J9GA 4ED7A 2ASLA 2E74B 3MJFA 3DXRA 1TWCA 4X1YA 4LFBH 2PF4E 3F5TA 1TVKB 1Y74A 3HKZE 5BR8O 5JWPA 2WAMA 2RQ6A 2EIMC 3Q8RB 3OMNB 4UXNA 1SESA 3JAMN 4WFHA 2R8HA 1VEWA 1I1MA 2HIVA 2Z04A 3TXQA 4KUMA 1RPRA 3H1JH 5JQGF 2F4VH 1S5HC 1B6SA 4JI3B 4DRFA 2UUBO 4EBDA 2E2IA 3APQA 4GX5A 3IC7A 4ECYA 2UU9H 1U96A 1EZ1A 5IYZF 1EUCB 2RNBA 2DN9A 3UZBA 2LGQA 2HHFB 2HJWA 3BABA 4KHPO 3Q4HB 3STZC 4U6PA 2YIDA 3KHLA 4AHCA 4PA7A 1H2MA 2DWEC 1V55C 2JRIA 2QM4A 3OT7A 4PI2A 3ZCCA 2HHHB 1EKPA 3LULA 3TW6A 5C5JA 1TA8A 3T1HB 4G27B 4LF7H 1Q8IA 3UQ8A 1JPXA 3ZHRA 1JLLB 4ECSA 1Q5OA 5C4XG 1XREA 3GIQA 3JCZA 4O7LA 1BGWA 3A0HZ 3JAWB 1IOWA 4JI0O 4DV2O 4QSHA 5LGNA 4MTDA 3MFIA 3BFRA 1SZTA 1LUVA 2Z0AA 3PW7A 2R9IA 2Z02A 2RDIA 3W7TA 4X20B 4O2BA 4JTDB 2YXHA 3LSUA 1S03G 2Y0IA 2Y4TA 4GUNA 2VOBA 4J9OA 2W6MA 3P3NA 4JI8H 2VUGA 2Q73A 3RWRD 3FYEB 4MVRA 2AGAA 2YZLA 2CE4A 5FNVA 2FMAA 1GTOA 1SC5B 2BOBC 2ZR3A 3SJCC 2V58A 1CP9A 2YZNA 2N05A 5LGTA 4IT5A 2KG7B 4Q6GA 4EGJA 4DR7O 1RSOA 5EC2C 4RUAA 3E8FA 3SE7A 1QHTA 3G67A 3TETA 5IWAB 3SPHA 5L3FA 3E89A 2BTOA 2J6TA 4UCTA 4TQSA 2ADQB 3E86A 4P30A 5J2UA 3EVKA 3KHRA 2B1GA 1T94A 4PHZA 3H4BA 4Q4DA 4OPAA 5CBHA 2YS6A 3N2GB 4YY3O 2YRWA 4DL6A 4XZ3B 1SQBH 5L9XA 2DPJA 3CQZA 5K1XA 2YU9A 3S3WA 5FLXN 4FK5C 4F6EA 4IYHA 3RAQA 2LFRA 3SYAA 4Z2WA 2LP7A 4O3SA 4F4LA 4UVAA 1V4YA 2ZDIA 2B1IA 5D5QA 4ED0A 1GSAA 3W7UA 4E2LA 3ZHSA 4NYKA 3JD3A 3RIZA 1XDCA 4LF5H 3OAAG 1GGOA 5DECA 4LF6H 4JYAO 2IA6A 1S0OA 2JEUA 5KX5B 1M0WA 5EBWC 3CC4V 3ASOC 2LO1A 2GPSA 2L6LA 2QTOA 1PD3A 1SF9A 4K0KO 4RAZA 4DV3B 1I2KA 4BY1G 4J11A 2JIZG 5EBLC 2YI8A 3J81N 1SRYA 4FFLA 3V6KA 3BEHA 4IHJB 1I7LA 5JH7A 4RUEA 3CMEV 5F2VO 3ETJA 1J95A 4YR3A 4IIJB 2YZGA 3GIPA 4JI4B 2NU7B 2H94A 5B1NA 4O4JF 2PYLA 2QKCA 2YEVA 5D1PA 1K9MW 3QNEA 1YVWA 5KFWA 3JARA 4NVPA 4O7WA 3S3XA 4U7NA 3BY6A 4WF9V 1IOVA 4Q43A 1E1RG 1JDBB 3JAMW 4IYIA 4O3PA 1Q86W 3HOXG 2AW9A 4Q8FA 1MSDA 4GYCB 2JA5G 2QWQB 5FLXW 3RTXA 3MR5A 4FPPA 4HN2A 2RGVA 1CXZB 2FMLA 4RB2C 1TWAA 4ZQIA 2X6CA 3E83A 2OCCC 4I50B 2IJKA 5JVDF 3QF7A 4MAMA 4CMDA 2C2DA 1R9TA 1S5JA 3N41B 1OJHA 2V4QA 3F5WC 4MV9A 3RGXA 3TINA 4JI1B 1TUBA 3RYIB 5JQGA 3GTKA 3ZMVA 2HG5C 5B1BB 1LUWA 4E4TA 2ZDIC 2C2RA 4JXUA 2Q2UA 4L8JA 3K5LA 3ETHA 3VPDA 3RB3A 4HYOA 1VQ4V 1M90W 4DR7H 3CCSV 4X64B 4B3TH 5HFMA 1SQVH 1CPYA 1AVMA 4QW9A 4X8AA 3RJ0A 3TY5A 4X62H 3WB2A 4QPKA 2YW2A 4J9YB 5IY5C 4GKJO 5J2TA 1FD9A 4JI2H 3KTMA 5LA6B 3GIJA 1N33H 2IJIA 2Q8VA 2GQRA 4AI8A 5CA0A 3O9OA 4DL3A 2V9WA 5KUKA 4O7TA 1DLBA 4MT8A 4IL6Z 1W2BU 1AI6A 3CP1A 3OE7G 2P67A 4FFKA 1MZBA 1XNQH 1CKMA 5JH7B 1NVPD 5GONB 3K06A 4JI0H 3B77A 3EHBB 1Q6HA 1HNXH 2ILMA 5CA1B 5L3GA 4RB3C 2IBZH 4B7KA 1OWTA 4MV8A 1WRVA 1XMQO 2AZ2A 5LXTB 3KG2A 4TV8F 3SYQA 1NI8A 1P84F 2RCVA 5KA5A 3T1HO 4LFBO 2GTSA 3G8CA 1PK8A 1SA0A 4H33A 4NTWA 2W8LA 1E4EA 3EYYA 3AG1C 2CQYA 3L72H 5L1KA 2WLJA 2GTAA 3SDLA 1IXMA 1QR9A 4QW8A 4FFBA 3DXRB 1NVPB 2PN1A 1XNRH 3HKEA 4OPHA 4FZ0A 4JV0A 4UCUA 3CCEV 4JASA 2UVWA 2ZCEA 3ZN0A 1QLEB 3T7AA 4JI7O 2YS8A 2UUCH 4X65O 4JZGA 5A9GA 2DWCA 4NZOA 4LFBB 1T3NA 4O4IF 3RUPA 1K3EA 3E2EA 2CNQA 2G38A 2JEIA 3I12A 5LHIA 4H44B 5IYDG 2R7LA 3CMAV 1NT2B 1FFXB 5LGUA 4JI8B 1I08A 1WPXA 4JI2B 2W6ZA 4EB6A 1S68A 1Y4MA 3TEKA 3N6RA 1H2GA 3QQMA 4MVQA 4DV7B 4X1KB 4DV1O 4YR0A 4I4TF 3ORQA 3A0RA 3SPJA 3R66A 2HLDG 4H0LB 3ZMZA 2Q67A 1FXKA 3GDEA 3CCRV 2DE0X 5KKNB 2RGRA 3QG5A 3OEEG 1YF2A 4JI0B 5KG7A 4G28B 2B9ZA 4J7JA 5KFIA 1FS0G 1BE3H 1V54C 5CBFA 3GIKA 1M56B 3GTQA 5KFTA 4JI6H 1YI2V 3IG0A 3ZJZA 1HNZB 1H2SB 2HVQA 2R86A 3CCVV 1B6RA 5EWEA 2FLNA 4LF6O 5KG3A 4YJ3B 4JI3H 1OCCC 5KG5A 5KFBA 2OCCB 1BL8A 5LL6Y 3ETEA 5KG0A 3UCSC 1KJ9A 2DJVA 5KFCA 3ZRWB 3RYFA 3VOTA 3M9OB 4GC6A 5IP9G 3JAWA 4ZBMA 3JD4A 4QPJA 3PW0A 2COGA 4GT1A 4NLGA 3R9RA 3GTJA 4DR1O 1GN4A 4TV9A 5KT6A 4O7NA 3G6EV 3K5OA 2PI5A 4LF4B 4LF9B 4U7CA 3JSNA 1OCZC 4ECZA 2RMKB 4J41A 1PL0A
chains in the Genus database with same CATH topology
1FJGB 3VQYA 3PN1A 3NBYB 2CW8A 4AQYH 1L2ZA 4FLTA 3ZEDA 4ZIBA 3N2GA 4X1KA 3SGIA 5CB4A 3U11A 5EYPA 1HR0H 1ZHSA 1IBMB 5GONA 1DGSA 1M4UA 4B3SH 3N42B 2ZIMA 3K57A 4OX9B 4RAYA 4TOIA 3BHPA 5JJNB 2PTMA 4DR3H 4DV2H 4CH3A 4GKJH 5FPRA 3HKCB 1P16A 1CKOA 4EEQA 5KHHA 4EFEA 4DR3B 4FLYA 2P22C 1HW7A 1N33B 3JALA 3KXYT 3OTOB 2YIBD 5BR8B 2XHBA 2RJZA 1XHXA 4LF8H 5FNVB 4JYAB 3VNNA 3RYHB 3BAAA 2YCHA 3OTOH 1N32B 2Q0AA 4UCSA 1Z2PX 4UCRA 1JMKC 2ZINA 4K0KH 2UXDB 5KHJA 4B3RH 5LP6B 2ZNIA 5IWAH 1SEIA 1Z2NX 4O4LA 3QTCA 2UXCB 3U10A 4FM0A 4A2BA 4I55B 3U0ZA 5J2TB 4GKKB 3J80W 1IBLH 4DR6B 2PY5A 2UUCB 3OTFA 3VQWA 3KALA 3BA8A 4O4HB 1XK5A 5EIBC 5EIBD 4I7HA 2OYQA 1O9GA 4IIJA 4FLXA 2PYJA 4LF6B 3TY9A 3JAKB 3KYHC 5KMGB 4ZHQA 1FKAH 4WBNB 3BA9A 1Z2OX 1HNWB 4LF7B 1Q3EA 4FFBB 1I94B 1TUBB 3SJAC 4WBNA 4DV4H 4HNAB 1B04A 1GYFA 5BMVB 3L2PA 3E22A 4R7RA 4X62B 1VF7A 4BW9A 5D1OB 4KL1A 4FLZA 4A2AA 4LR3A 3QWUA 1AN7A 3C0FB 5IYZA 2HVRA 4O4IB 4DV6H 4B3MB 4DUYH 4LNUA 5LYJA 4YY3B 4X20A 4TUYB 2W57A 3N43B 1CKNA 4X1YA 5CA0B 5JJJB 3RYIA 1JFFA 4LFBH 3RYCB 4ETSA 1TVKB 5JVDA 4B3SB 2ZNJA 2RQ6A 5EZYB 4EQ5A 2F66C 5IJ0B 1N32H 4PDBA 4CS4A 3UT5A 2HIVA 2VQFB 2JVDA 4CH5A 2F4VH 4JI3B 4DRFA 4YJ3A 1WN7A 3T1YH 4CH6A 5JJEB 1WNSA 2BTQA 4DR4H 4X1YB 3RYCA 3W1GA 4FLVA 3LMLA 2UU9H 3T1YB 5KHGA 4DV2B 4DR1B 1TAEA 2VQEH 5LXTA 1O9HA 1P49A 3IAYA 5J2UB 3KAJA 1TGOA 1P8LA 3BABA 3E22B 1M93A 4FVMA 4LF5B 4Q0YA 2E3CA 2XIGA 3RGZA 4NXMH 4AHCA 4ZOLA 2BTQB 2QM4A 2HHHB 4GLXA 4PI2A 1XI1A 4LF7H 4MV7A 3N40P 1TA8A 2R70A 3T1HB 5A2QW 1Q8IA 4JI7B 3UQ8A 1FJGH 4CC6A 1Q5OA 4EB6B 2CFMA 2F95B 3HKDB 4DV0H 5KHKA 3CSXA 2Q2TA 1BGWA 4K8ZA 1Z5VA 5KHIA 3JAWB 4DRXA 4GKKH 1KU9A 5LP6C 4MTDA 4DV0B 5EYPB 3RYHA 4DR6H 3L4KA 4JV5B 3JARB 2ZIOA 3N2KA 3VQXA 4X20B 3RF2A 4O2BA 1XHZA 4DR7B 2HIXA 1S03G 2VOBA 1O75A 4DK1A 2EX3A 4KHPB 4LF4H 4LF9H 5LOVB 4JI8H 2VUGA 3RGBA 3RWRD 5C8YB 4O2AB 3CVZA 3HKEB 3SR2C 1IBMH 4O2AA 5FNVA 2VQFH 3SJCC 3HXLA 3H20A 2PGGA 4RB0A 4Q6GA 1RSOA 3RFRA 2Q7GA 4LFCH 1QHTA 4DV5B 5EOYA 5IWAB 4DR1H 3GJXB 1Z5WA 5BR8H 2BTOA 4UCTA 1N34B 5J2UA 5BMVA 5EZYA 4PZ8A 1A0IA 2YI9A 4O4HA 4YHHB 3CB2A 4PHZA 2E5LB 5D5PA 3K3VA 1Q43A 1SKVA 3N2GB 1JJOA 4UFZA 3K58A 1BJTA 3FFQA 5KMGA 1VS0A 2MCTA 4LMYA 4YHHH 1XNQB 2QJ1A 4TV8A 5K1XA 3A2FA 5DISC 1X4TA 2UUAH 2ZM6B 4DRXB 4JI7H 4FM9A 1TVKA 1FVIA 5D5QA 4O4JB 4TV9B 1ZAUA 4I9QA 4RB1A 2Q7EA 3RIZA 1G6UA 4J0MA 4LF5H 3BRCA 3WB0A 3JAKA 2HEPA 2FE3A 4LF6H 4UCOA 3NBZB 5FD5A 5KX5B 1M0WA 5LMNB 2UUBH 1IBKH 3J7AK 2UXBB 3K5MA 4U3JB 4DV6B 5LMNH 1J5EH 4B08A 4RAZA 4O4LB 4DV3B 2WYOA 5JCOC 2YI8A 3F8NA 4IHJB 4LFCB 2PZSA 4DR5H 5LMUH 4GKJB 5JH7A 3HKBA 2KKWA 2P5OA 3CHXA 5KX5A 4IIJB 5LMUB 4JI4B 5ITZA 4TV8B 2PYLA 4I4TA 3JALB 4DK0A 5D1PA 5IT9W 1HNZH 4FLUA 4X66H 2JGUA 4K8XA 2HVSA 4NXMB 3JARA 4NVPA 2WDTA 2YXLA 4O4JA 4JI5B 1XDNA 3T1HH 3JAMW 4JI6B 2VQEB 4UCVA 2F1MA 1N36B 1X9NA 4GYCB 5FLXW 3RTXA 5CA1A 4K0KB 3M4IA 2RGVA 5FD6A 4RB2C 1XQ8A 4TQFA 4AILC 2UXCH 3ICXA 2VWJA 4I50B 3QF7A 4DR2B 1S5JA 3M7MX 5IJ0A 3N41B 4HBNA 3RR5A 1HNWH 4KHPH 4MV9A 4F6RA 3RGXA 3W1BA 4LFAB 1KMIZ 4JI1B 1TUBA 3RYIB 4X1IB 5JQGA 1SQGA 1XMOH 4HNAA 1L8DA 4LFAH 3BPZA 4EFBA 2Q2UA 3JASB 4L8JA 3K5LA 1HR0B 4M7EA 4DR5B 1IBKB 1XMQH 4APMA 4YJ2A 4NXNB 4DR7H 1V9PA 4X64B 3UT5B 4B3TH 4IAJA 4OX9H 3RJ0A 5K1PA 4PI0A 3TY5A 3WB2A 4X62H 4DV5H 4NXNH 3MWMA 1T5EA 5J2TA 4IHJA 3JATA 1JFFB 3W5OA 4DUYB 2R72A 1SYXB 4JI2H 4B3MH 5LA6B 5JVDB 1N33H 2JS5A 5CA0A 4BWSC 4ZHQB 4DV7H 4LF8B 4JI4H 3MAQA 3HKDA 1J5EB 5D1OA 2HGSA 4DV1H 4DR4B 1MZBA 1XNQH 1CKMA 5JH7B 4X66B 5GONB 4PZ7A 2KSWA 5IJ9A 4JI0H 5LA6A 1HNXH 5CA1B 2UUAB 1I6UA 4TUYA 5LL6b 3N44B 4CS3A 4DUZB 4RB3C 3S24A 2YIAA 3ETQA 3VQVA 3ZS8C 5IYZB 3B2EE 2WE6A 5LXTB 5C8YA 4DR2H 4PZ6A 2F93B 4LH6A 4X65H 4MTEA 1WH2A 3GB8B 5CB4B 4YJ2B 3K59A 1QQCA 1SA0A 5IJ9B 3EYYA 4I55A 5JQGB 5ITZB 4FFBA 1ZHQA 4AQYB 3JATB 2CAZC 1N36H 3TY8A 2V4DA 4U3JA 3THOA 1XNRH 2OWOA 3HKEA 4CC5A 4UCUA 3RYFB 2ZM6H 2ZCEA 1I94H 1XNRB 3K5NA 1E4FT 2UUCH 4DV4B 4RZQA 3JASA 4O2BB 2UUBB 1M0TA 4ZOLB 4LFBB 4LSXA 4JV5H 4B3TB 1SQFA 1CKNB 4X1IA 4D7TA 4LH7A 2Q7HA 3DF7A 4YY3H 3LNNA 2ZJTA 1NT2B 1FFXB 4O4IA 4ZI7B 1XMOB 4JI2B 4JI8B 4FM1A 4TQDA 4EB6A 1S68A 2PUSA 4D7SA 4DV7B 4X1KB 4CH4A 4DV3H 4FLWA 3SJBC 4X64H 2CW7A 4F6RB 5FPOA 5LYJB 3N6XA 3WB1A 3GDEA 4DV1B 4DUZH 5LP6A 2YIBA 2RGRA 1IBLB 3QG5A 1WPBA 1FFXA 1I7FA 4ZI7A 4JI0B 3DSQA 1HNXB 3KAKA 1YEWA 2UU9B 4I50A 3L4JA 1N34H 4JI6H 2GV9A 3IG0A 1HNZB 1H2SB 2HVQA 3J81W 3N2KB 3JSLA 4CS2A 4LSAA 2R9AA 2E5LH 2F4VB 2O03A 4JI5H 4YJ3B 4JI3H 4JYAH 4X65B 3HKCA 4BWAA 4E6NA 1M5IA 3FMAA 2UXDH 5LOVA 2HHHH 3RYFA 4B3RB 2IM9A 3JAWA 1XMQB 1E4GT 2VWKA 4TV9A 4JI1H 3K5OA 4FM2A 1SA0B 4LNUB 1D5AA 2VPSA 4LF4B 4LF9B 4I4TB 3HKBB 5JCOA 2UXBH 3JSNA 3NC0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y B;  2UXB B;  4DV2 B;  4DR1 B;  1FJG B;  3PN1 A;  3NBY B;  4DUZ B;  3S24 A;  1TAE A;  4DV6 B;  4DV3 B;  3SGI A;  1P8L A;  4PZ6 A;  3BAB A;  4LH6 A;  4LF5 B;  3GB8 B;  4LFC B;  1IBM B;  1DGS A;  4GKJ B;  2HHH B;  4GLX A;  4OX9 B;  1TA8 A;  3T1H B;  4TOI A;  4JI7 B;  3UQ8 A;  5LMU B;  4JI4 B;  4CC6 A;  2CFM A;  5FPR A;  4AQY B;  1P16 A;  3TY8 A;  1CKO A;  4EEQ A;  2Q2T A;  2OWO A;  4EFE A;  4DR3 B;  4CC5 A;  1N33 B;  5D1P A;  4UCU A;  3OTO B;  5BR8 B;  4DV0 B;  1XNR B;  2HVS A;  4NXM B;  4JYA B;  4DV4 B;  3VNN A;  4JV5 B;  4JI5 B;  3BAA A;  1XDN A;  1N32 B;  2UUB B;  4UCS A;  4UCR A;  4LFB B;  2UXD B;  4DR7 B;  2HIX A;  4JI6 B;  2VQE B;  4B3T B;  4UCV A;  1N36 B;  1CKN B;  1X9N A;  4KHP B;  2VUG A;  4LH7 A;  3RTX A;  2UXC B;  4K0K B;  4GKK B;  1XMO B;  4JI8 B;  4JI2 B;  4DR6 B;  2UUC B;  1S68 A;  3BA8 A;  1XK5 A;  4DV7 B;  4DR2 B;  3RR5 A;  4LF6 B;  3TY9 A;  3KYH C;  5FPO A;  4DV5 B;  5IWA B;  3GDE A;  3W1B A;  4DV1 B;  3GJX B;  3BA9 A;  4LFA B;  4JI1 B;  1HNW B;  4LF7 B;  1IBL B;  1I94 B;  4UCT A;  1N34 B;  4JI0 B;  4PZ8 A;  1HNX B;  1A0I A;  1B04 A;  4EFB A;  2Q2U A;  3L2P A;  1HR0 B;  4DR5 B;  1IBK B;  2UU9 B;  4X62 B;  4YHH B;  2E5L B;  4NXN B;  5D1O B;  1V9P A;  4X64 B;  3QWU A;  1HNZ B;  2HVR A;  2HVQ A;  4B3M B;  4UFZ A;  3TY5 A;  1VS0 A;  3JSL A;  4YY3 B;  2F4V B;  1XNQ B;  4X65 B;  3W5O A;  4DUY B;  4E6N A;  1CKN A;  5DIS C;  2ZM6 B;  4B3S B;  4B3R B;  1XMQ B;  4LF8 B;  4EQ5 A;  1FVI A;  1ZAU A;  1J5E B;  5D1O A;  2HIV A;  4DR4 B;  2VQF B;  4JI3 B;  1CKM A;  4DRF A;  4X66 B;  4LF4 B;  4LF9 B;  4PZ7 A;  3JSN A;  4UCO A;  2UUA B;  3NBZ B;  3NC0 B;  3W1G A;  5LMN B; 
#chains in the Genus database with same CATH topology
 1ZX3 A;  1US6 A;  3OW2 U;  4KFM A;  3L9D A;  4AQY H;  1N56 A;  4DR3 O;  4PA4 A;  4DUZ O;  4FU0 A;  2QTS A;  1EKF A;  3QVN A;  2DPI A;  3EFF K;  1IVS A;  4C2M A;  4IWY A;  1GK9 A;  1HR0 H;  3OGC C;  4TWK A;  1NZ6 A;  2WLI A;  1IBM B;  2CKZ B;  1M4U A;  3B8N A;  2EIY A;  5B3S C;  3AG2 C;  3CXC U;  3W7S A;  4NXN O;  3KHG A;  1DF5 A;  1SQQ H;  1IYD A;  2RDJ A;  4EFE A;  3TIG A;  5EWF A;  2W9B A;  2OLS A;  4MVO A;  5BR8 B;  2NNU A;  2QGN A;  5T14 A;  3G6X A;  2XHB A;  1THZ A;  5DMX A;  1GN6 A;  4O3N A;  3RYH B;  3BAA A;  1YJW V;  4J9P A;  4CKE A;  2LW1 A;  2UXD B;  4R7C A;  1OBD A;  2WSS G;  4YJ2 F;  2OIG A;  2FPG B;  3Q8Q B;  4J9Z B;  3CCM V;  1N4C A;  5IWA H;  2FJZ A;  1ZL8 B;  1I2L A;  1R6N A;  5KFA A;  2ATL A;  5J2T B;  4GKK B;  3AG3 C;  1WA8 B;  4DR6 O;  5EZY F;  3K9A A;  4DR6 B;  1I1L A;  3OTF A;  5CMU A;  3KAL A;  4UVB A;  2UXC O;  4QE7 A;  5C8Y F;  5CA0 F;  4O82 A;  5EIB D;  1AI7 A;  3T4D A;  4I0X A;  2ZE7 A;  5BPH A;  2F4V O;  4QIW A;  2C35 B;  2XGQ A;  3KYH C;  1X59 A;  4GZR B;  3A0B Z;  3BA9 A;  1GLV A;  3O65 A;  2W6O A;  1TUB B;  5KFF A;  4BIU A;  2DZD A;  2R93 A;  2NU6 B;  1GYF A;  3FB5 C;  1MNG A;  3UO2 A;  3E22 A;  2VRZ A;  2QF7 A;  4Q8E A;  5KT3 A;  1Y1V A;  3OFN G;  5KFL A;  4A2A A;  2FPI B;  3ML0 A;  2BCC H;  2HFE C;  1EM1 A;  3LDE A;  1XNQ O;  2FPP B;  2ALZ A;  4O4I B;  1FPO A;  4DUY H;  2ADP A;  4JYC A;  2D3O W;  4X20 A;  4PEL A;  3N43 B;  1DTO A;  3GTP A;  1CKN A;  5JJJ B;  3RYI A;  3RN4 A;  2AGP A;  3RYC B;  4ETS A;  4B3S B;  1ULZ A;  2ODT X;  2M05 A;  2ZNJ A;  2R7M A;  2F66 C;  3CJH A;  1FKA O;  1JX4 A;  1W59 A;  4RNM A;  2QSA A;  3T9A A;  3BQ2 A;  4YJ3 A;  2NLJ C;  5D8D A;  2JJ1 G;  1NQT A;  5JJE B;  5IYD O;  4QWA A;  1RJR A;  1Y1W A;  3LML A;  1XNR O;  2EZO A;  2Q5Z A;  3T1Y B;  2EJ2 A;  2YYA A;  3JRW A;  2WA3 A;  4DR1 B;  1XMO O;  1F7Y A;  1QLE C;  3IFX A;  4XYM B;  5J2U B;  3F7Y C;  2JA5 A;  3FAV B;  1KUT A;  4XBF A;  3E22 B;  4Q0Y A;  5CA1 F;  2XIG A;  3RGZ A;  4FBT A;  4JV2 A;  4MV7 A;  4F4Z A;  2R70 A;  4PDR A;  5F9N A;  4IRD A;  5A2Q W;  2W0F C;  5H6R A;  3TII A;  3APO A;  3UO3 A;  4CC6 A;  4QWB A;  4EB6 B;  4ECV A;  3HKD B;  4DV0 H;  3SYO A;  5KHI A;  2HHF A;  3IJ4 A;  1Y6X A;  3R23 A;  3OR6 C;  2B63 A;  4ED3 A;  4ME6 A;  5LP6 C;  3ABM C;  1XEQ A;  4O7V A;  2XND G;  5EYP B;  1SS3 A;  1PV0 A;  5LA6 F;  4DR6 H;  2E75 B;  5JUM A;  1Y67 A;  4JAU A;  3AYH B;  3N2K A;  3VQX A;  1MA1 A;  3HOY G;  2FKX A;  3RF2 A;  2YUA A;  4F50 A;  3BG5 A;  4PDM A;  2GUZ A;  2EX3 A;  4DV7 O;  3QO7 A;  1VQO V;  3U55 A;  4O2A B;  4MTO A;  4GX2 A;  4FFR A;  3HKE B;  4Q45 A;  4J9Q A;  2ODM A;  4MA0 A;  4R6Z A;  2QKA A;  4BW5 A;  3SNO A;  3P32 A;  1OCO C;  3MWD A;  2E76 B;  2ARH A;  3HXL A;  5LP6 F;  2PGG A;  1JXL A;  4WCE V;  1KJ8 A;  4NZM A;  1KBH A;  2NUA B;  4LFC H;  5EOY A;  4DR1 H;  2CNV A;  1V51 A;  3IGA C;  1Z5W A;  4I50 F;  5BR8 H;  1H8H G;  3K0D A;  3ZHQ A;  1NBM G;  4C5C A;  1MZF A;  2FK2 A;  3CB2 A;  1VQ5 V;  1HNW O;  2L35 A;  4MVM A;  5C1P A;  1N0J A;  1BJT A;  4UFZ A;  1AP6 A;  5KMG A;  3ABK B;  1E4E B;  4D6T H;  1VS0 A;  4LMY A;  5KFH A;  1YHQ V;  1XNQ B;  2QJ1 A;  1D2D A;  1RPO A;  4DV4 O;  3LDC A;  5I5T A;  3JRX A;  4DR5 O;  2AQ4 A;  2ZM6 B;  4DRX B;  4NB5 A;  2CTQ A;  4FFM A;  3H40 A;  1GN2 A;  1JKJ B;  5KLV H;  4O4J B;  1OZ0 A;  1KJQ A;  2W6J G;  4A3F G;  1ROP A;  5EBM C;  1G6U A;  2FB5 A;  2ITD C;  3BRC A;  3K9S A;  4LWS A;  5B5E Z;  2HEP A;  2JS3 A;  3M99 B;  4IHJ F;  2NU8 B;  2EJ0 A;  4LF5 O;  4DR4 O;  1W0K G;  5LMN B;  2Z5U A;  3J7A K;  2I87 A;  4PWQ A;  4HYK A;  1SQP H;  5E25 A;  1UNN C;  3TQ1 A;  1J5E H;  2QDO A;  4B08 A;  3WO1 A;  4O4L B;  2WYO A;  2KG7 A;  5KX5 F;  5JCO C;  4DR5 H;  1Q90 D;  1AI4 A;  4GKJ B;  4OGQ B;  4CZZ A;  2KKW A;  2VQF O;  5BWW A;  1JJ2 U;  1QLN A;  3V6H A;  1GO3 E;  3MR6 A;  1BGY H;  3T9B A;  4X64 O;  5ITZ A;  1IBK O;  1R3I C;  3JAL B;  2ZE6 A;  1S97 A;  3FKI A;  5IT9 W;  4X88 A;  1HNZ H;  2QR4 A;  1WSC A;  5DQI A;  2HVS A;  2D2C B;  2V59 A;  5DQH A;  2YXL A;  2Q6A A;  4NTY A;  3K79 A;  1XDN A;  4UUG A;  2DAA A;  3AK3 A;  2VQE B;  4O3R A;  4XDK A;  1DV1 A;  1Q82 W;  2HDK A;  3M4I A;  2YEV B;  3OEH G;  2AHY A;  4NTX A;  4P2Z A;  4UVC A;  4ZI7 F;  2ZDH A;  5BWV A;  2R93 G;  4TQF A;  4AIL C;  1FXK C;  3ICX A;  4CKC A;  4FS1 A;  3CJH B;  4HBN A;  3RR5 A;  1OHH G;  1CE8 A;  1WJZ A;  2YDE A;  4KHP H;  5KFG A;  2EUL A;  3CRA A;  4LFA B;  1BXR A;  3CRC A;  3L71 H;  1SQG A;  2VUM A;  3SYP A;  2WLL B;  3CCL V;  1XMO H;  1L8D A;  4J9K A;  1VBG A;  4EFB A;  3ZN1 A;  4GKK O;  2OTJ V;  1HR0 B;  4M7E A;  2XUM A;  4ABM A;  4DR5 B;  1XMQ H;  4APM A;  2NVX A;  1VKZ A;  2W9A A;  3CXH F;  3K04 A;  4JI6 O;  4DV5 O;  2CDY A;  4FFP A;  1RK6 A;  3GWO A;  5EWG A;  5K1P A;  4DV5 H;  2IJJ A;  2X0S A;  4HQ6 A;  1T5E A;  1IBM O;  4IHJ A;  3W5O A;  1Q6U A;  1U97 A;  4DUY B;  5CB4 F;  3N8D A;  5BWR A;  5KFZ A;  4EEY A;  1JVM A;  3J80 N;  2BSK A;  2ZR2 A;  2DWD C;  5L1I A;  2UXX A;  4JI8 O;  5EDW A;  2C2E A;  4LF8 B;  3MFH A;  5FR9 A;  2M6Y A;  4ECR A;  3H1I H;  1A48 A;  1JQ0 A;  3MAQ A;  3HKD A;  1J5E B;  2ATK C;  3GQC A;  3OHB A;  4YIO A;  2FTK A;  2KSW A;  2EIL C;  5LA6 A;  2GBO A;  1WCM A;  2UUA B;  1I6U A;  4TUY A;  4RQF A;  1BMF G;  3JCU Z;  4DV0 O;  1IXB A;  3ABL C;  3K3W A;  2BE3 A;  2QM7 A;  4DUZ B;  3N44 B;  4X89 A;  3ETQ A;  5IYZ B;  2WE6 A;  3H1L H;  4E4E A;  4PZ6 A;  2IP4 A;  4LC1 A;  3DTG A;  4MTE A;  4P9O A;  3GB8 B;  5BWU A;  1OCC B;  3K59 A;  1B06 A;  2RN9 A;  3MR2 A;  5GW7 A;  4Z1V A;  1NJI W;  1OV9 A;  4MVU A;  5JQG B;  4PD4 F;  5ITZ B;  2QM8 A;  2C28 A;  3ETD A;  4O4L F;  3TY8 A;  3FX7 A;  4U3J A;  4QJF A;  2WTF A;  1F4M A;  4A93 G;  4CC5 A;  4RU9 A;  1KP2 A;  3B4S A;  1EZV H;  2YIC A;  5KFE A;  3HT5 A;  3K5N A;  5C3E G;  4XDJ A;  1K4D C;  1YDX A;  4O2B B;  3GIM A;  1DV2 A;  3MD0 A;  1MOF A;  4LSX A;  5IYC O;  3M8A A;  5L1L A;  3PZP A;  1XIL A;  5TIS Z;  4YHH O;  3ZHT A;  4GCZ A;  3FKI G;  1KB9 F;  1YXB A;  3LNN A;  3MHH C;  4YY3 H;  3T5L A;  3RB6 A;  4CBC A;  3E8H A;  1MG1 A;  5DAA A;  2DQ0 A;  1XMO B;  2ZXW C;  4LCU C;  4MA5 A;  4HNU A;  1I0H A;  4TQD A;  4XYL B;  1M9N A;  1SQX H;  3HOW G;  3H3V H;  1BCC H;  4FLW A;  3SJB C;  2CW7 A;  3ZMU A;  4F6R B;  2QYZ A;  5DG8 A;  4DV1 B;  4DUZ H;  4JV5 O;  4O4H F;  4GC7 A;  1R6T A;  1S77 D;  5KFM A;  1JOY A;  1HP8 A;  4JZ2 A;  2W9C A;  4ZI7 A;  3E5N A;  1SZX A;  1GH6 A;  1AIL A;  2ZKO A;  3PVX A;  1I94 O;  2GPW A;  4MV6 A;  1N34 H;  2GV9 A;  2R92 A;  2Y4R A;  3J81 W;  2JDI G;  2JK5 C;  3ETG A;  2E2H A;  4JYA H;  2O03 A;  4JI5 H;  3H0G G;  2EIK C;  3WG7 C;  3WFV A;  4J10 A;  4GX0 A;  4WFG A;  3FMA A;  1F4N A;  1TUE B;  4B3R B;  3PR4 A;  2IU0 A;  4FS2 A;  5H80 A;  5H5N A;  4FFN A;  3L74 H;  4QWC A;  4Z1M G;  2P4V A;  1CQJ B;  5KFV A;  4FM2 A;  5CBG A;  4CE5 A;  2W7P A;  4LNU B;  2LGW A;  3I5D A;  2UXB H;  2YXY A;  4C7U A;  3I56 V;  5H6Q A;  3AEI A;  5AG2 A;  1SET A;  3QO5 A;  3NR7 A;  2ZDQ A;  4A3I G;  1FJG B;  3FD9 A;  3PN1 A;  3NBY B;  1L2Z A;  4ZIB A;  4F4W A;  3V4S A;  2P6J A;  1AUV A;  4EG0 A;  2V7Q G;  4JI4 O;  3U11 A;  1KEC A;  3G6B A;  4WHX A;  2EIJ C;  2M7W A;  2EIL B;  2R82 A;  4MS2 A;  3OM3 B;  2ZIM A;  4TOI A;  4B3M O;  2V5A A;  4CH3 A;  4GKJ H;  3GV7 B;  3HKC B;  4QIW E;  1P16 A;  1KYO F;  1L1F A;  5J2U F;  5IDJ A;  3H1H H;  4EEQ A;  1JDE A;  1N33 B;  4FLY A;  2P22 C;  3OHA A;  5H9C A;  3KXY T;  3E8B A;  4ED8 A;  1FJG O;  1AJP A;  3STL C;  5FNV B;  2XAG A;  4JYA B;  3LP8 A;  4JI1 O;  4LFA O;  2JGD A;  2YL2 A;  1K92 A;  3OTO H;  1VP7 A;  5DED A;  3OSP A;  1JMK C;  2ZIN A;  3QZ8 A;  3OUS A;  3K5I A;  1EN6 A;  1H2L A;  2XCL A;  1AJN A;  4DW1 A;  2W7O A;  3KZI Z;  3JZF A;  2FL4 A;  4JAV A;  2CZG A;  3RV4 A;  1KD1 W;  1Z2N X;  1QU7 A;  2HG8 A;  1VIB A;  4ED2 A;  4I55 B;  4RO2 A;  3U0Z A;  1IBL H;  2W9B B;  5C1O A;  4H13 B;  1GM8 A;  5B1A B;  2UUC B;  3ZRW A;  2C22 A;  5LOV F;  2AHZ A;  1MZE A;  1O9G A;  4J80 A;  1MSW D;  5LYJ F;  4O84 A;  1BNC A;  2OTL V;  1RSO B;  3W7W A;  1N32 O;  4ECT A;  1Z2O X;  4CMF A;  4LF7 B;  1I94 B;  2OH2 A;  4FZ1 A;  1BHB A;  2CGO A;  4RUC A;  2Q0O C;  2BQU A;  5BMV B;  1GRJ A;  4ICG A;  4JAA A;  2FK3 A;  4RNO A;  1VF7 A;  4BAY A;  5D1O B;  1R73 A;  1A9X A;  3QWU A;  1WR2 A;  1KC8 W;  2HVR A;  4YP3 A;  1KBL A;  4YY3 B;  3GTM A;  1VQ9 V;  2PMZ E;  4J9L A;  2DQ3 A;  3KKY A;  3UYY A;  1NR7 A;  5CA0 B;  1H2K A;  1K33 A;  1R1B A;  1VQM V;  3M9M B;  3ASN C;  5EZY B;  3HB9 A;  5BYA A;  4EQ5 A;  2CGN A;  3CRM A;  5J2T F;  3ASO B;  2ZE8 A;  1N32 H;  2PMZ A;  3R5F A;  2A79 B;  1NS1 A;  3FAV A;  3GWK C;  4LP8 A;  2RDC A;  5KAI Z;  4CS4 A;  3UT5 A;  5LMN O;  2VQF B;  4RWU A;  2JVD A;  4CH5 A;  1G4Y B;  1B33 N;  3K03 A;  1WN7 A;  1KJI A;  3T1Y H;  2EIJ B;  4CH6 A;  3EXA A;  4DR4 H;  2XCA A;  4A3D G;  1AB3 A;  3RYC A;  3W1G A;  4CKB A;  4FLV A;  1AJQ A;  1GM9 A;  2HJD A;  5KFQ A;  3L75 H;  5KHG A;  1KP3 A;  4DV2 B;  1TAE A;  5LXT A;  2QK4 A;  3IAY A;  3KCY A;  3GLK A;  2Y4U A;  1KC7 A;  1P8L A;  2BOC C;  3BCC H;  5KT4 A;  1M93 A;  4LF5 B;  3WWI A;  2E3C A;  1WP8 A;  2IMW P;  2BTQ B;  4GLX A;  1F51 A;  2CTW A;  1CEZ A;  2XT9 A;  3U54 A;  5B1A C;  1BSM A;  5KHK A;  3CSX A;  3HO8 A;  2Q2T A;  4K8Z A;  4QWE A;  3DGE A;  4DRX A;  3VMM A;  3RVZ A;  5I5X A;  4J42 A;  5KFO A;  2Q68 A;  4DV0 B;  5L3D A;  3CPW U;  3T9F A;  3L4K A;  4DW0 A;  3JAR B;  3T9E A;  4ECW A;  5IWA O;  2XD4 A;  5I60 A;  3ABK C;  4DR7 B;  1YJ9 V;  5KG6 A;  1V54 B;  4KHP B;  2VA2 A;  4LF4 H;  4LF9 H;  5LOV B;  2JA8 G;  2NN4 A;  3RGB A;  1NTK H;  4UB8 Z;  3CVZ A;  3MHS C;  4I55 F;  2VQF H;  1KEE A;  4J9R A;  5KFJ A;  3D36 C;  4BR6 A;  3H0G A;  1RJP A;  3RFR A;  1AR1 B;  2Q7G A;  2P06 A;  3T54 A;  2WLM A;  1M1K W;  4DV5 B;  5I5U A;  2FK1 A;  2LJ2 A;  1J5E O;  3JD2 A;  4TV9 F;  3N27 A;  5BMV A;  5EZY A;  4PZ8 A;  1A0I A;  1MAB G;  2EBO A;  4C5A A;  1ZWI C;  2YI9 A;  3TGU H;  3OR7 C;  4O4H A;  1UPG A;  4R8U B;  4F4Y A;  4MVS A;  2E5L B;  5D5P A;  3K3V A;  1TWH A;  1UC8 A;  1Q43 A;  2JEX A;  1SKV A;  2MCT A;  1JJO A;  4TQR A;  4YHH H;  3FFQ A;  2CUG A;  4IZO A;  4M0J A;  3PJS K;  4TV8 A;  1K83 A;  3A2F A;  2QKS A;  4Q4C A;  3R65 A;  2X5R A;  5DIS C;  1IUR A;  2UUA H;  1CQI B;  2C00 A;  3DC5 A;  4RQE A;  1M56 C;  5B1B C;  3ZIA G;  5L1J A;  4FM9 A;  4A5U B;  4TV9 B;  3P3P A;  3RFC A;  4P9P A;  3AG1 B;  1R3J C;  1K7D A;  3OUF A;  4RB1 A;  2XAS A;  1VQK V;  4J0M A;  3L73 H;  4WFB V;  4B7E A;  1S5L Z;  3JAK A;  4X66 O;  1R3L C;  2IH1 C;  2EIN C;  1ET0 A;  5FD5 A;  3G71 V;  1FXH A;  2UXB B;  4EBC A;  5DN6 G;  5IE9 A;  1M57 C;  2EIM B;  4DV6 B;  4O7Z A;  3GIL A;  5LMN H;  4DO2 A;  3HKZ A;  4MTG A;  4O83 A;  1H8E G;  3OGI B;  1VAR A;  2PZS A;  3LDD A;  1FAF A;  4G2K A;  3ZRV A;  3U9T A;  1ARO P;  3AW8 A;  4BIO A;  3CHX A;  3CWB H;  5LMU B;  4DAA A;  5LBQ A;  4TV8 B;  2ZXW B;  3L70 H;  2F43 G;  2ZQM A;  4U3F H;  1WA8 A;  1XL6 A;  3HOZ G;  4A3E G;  4X66 H;  4W4K A;  2OIE A;  3P30 A;  2QE7 G;  2JGU A;  3CCQ V;  4NXM B;  4PDL A;  4BBS G;  1WCM G;  4JI5 B;  4ECU A;  5A2Q N;  3AK1 A;  5B1O A;  4BIZ A;  2YZM A;  2IJH A;  3UKM A;  4DLK A;  5BWX A;  2OT5 A;  1VBH A;  4JI6 B;  1IX9 A;  2WWW A;  2KB1 A;  1N36 B;  1X9N A;  1N8R W;  2WB1 E;  5I5W A;  3SPI A;  4X62 O;  4K0K B;  1VQ7 V;  1S0M A;  5FD6 A;  2B63 G;  1S3J A;  1XQ8 A;  4HAM A;  2UXC H;  4PA3 A;  5KUM A;  1M6V A;  1Q7Y W;  2GDS A;  2FKL A;  2WAQ E;  4DR2 B;  4I7Z B;  3HB3 B;  5IYC G;  4IGG A;  5KFD A;  2WLN A;  4QJF B;  3VA7 A;  1KMI Z;  1GSH A;  1VF5 B;  2DYR B;  1FXK B;  1AP5 A;  2JA6 G;  3WU2 Z;  2VPQ A;  3ABL B;  3JZ6 A;  2V1D A;  4LFA H;  4MTF A;  2CNU A;  5C44 G;  1S76 D;  1ZLZ A;  1G2W A;  5DM6 V;  1Y76 A;  4NXN B;  1V9P A;  2CH7 A;  1Y1W G;  4IAJ A;  2A1H A;  4N21 A;  3K0G A;  1XOU A;  4PI0 A;  4PBC A;  4RZR A;  3MWM A;  3D3Q A;  1YIJ V;  1Y66 A;  1JIH A;  1NU1 H;  3UM7 A;  1JFF B;  3J7A U;  2COJ A;  2R72 A;  1SYX B;  4L1K A;  3EPI A;  5JVD B;  4NXM O;  1VAJ A;  3RB0 A;  4YAK B;  1WB7 A;  4BWS C;  2AXT Z;  5BYB A;  4ZHQ B;  4WD3 A;  4DV7 H;  2I80 A;  3B09 A;  4JI4 H;  5KG4 A;  2WPD G;  5DG9 A;  3G6Y A;  1RK5 A;  5D1O A;  3ABU A;  1I50 A;  5B3S B;  3ZHV A;  1P7B A;  3DTU B;  2VQD A;  4WFA V;  1NKD A;  4X66 B;  5F9L A;  3TQT A;  3C3S A;  2KSD A;  2AGQ A;  1GKF A;  1EUD B;  1OCR C;  2HGW A;  3Q1K A;  4CS3 A;  3V4Z A;  3S24 A;  3CD6 V;  2YIA A;  4JUZ A;  2W9C B;  3B2E E;  4MW3 A;  1D5N A;  1URF A;  4DR2 H;  2A3Q A;  2LW7 A;  5I5S A;  3MR3 A;  4LH6 A;  3VPB A;  4X65 H;  3G6V A;  4IIJ F;  1BQ0 A;  2ETN A;  5CB4 B;  1K8A W;  2YWV A;  2PI4 A;  1QQC A;  2DMX A;  5L3B A;  1KTA A;  5IJ9 B;  1B6Q A;  3WWH A;  2JEG A;  4W4L A;  1HNZ O;  2Y0S A;  1ZHQ A;  2KQX A;  3GID A;  4AQY B;  3CRR A;  3TW7 A;  2R7N A;  2E5L O;  3UFX B;  1N36 H;  3THO A;  1NR1 A;  1FFT B;  4FMT A;  4LBE C;  1GO3 F;  4XDL A;  2ZM6 H;  2W71 A;  2VS0 A;  4DL4 A;  1ORQ C;  3T1Y O;  1OCR B;  5LHH A;  1JX9 A;  3NUA A;  2JA6 A;  4TUY F;  3VOU A;  4RZQ A;  3JAS A;  1S9F A;  1M0T A;  1BT8 A;  3T5H A;  4TM5 A;  4B3T B;  1SQF A;  3V6J A;  4D7T A;  3IC9 A;  2Q7H A;  2XAF A;  4A3M G;  1RYR A;  4J7K A;  3OMI B;  1VQL V;  2UVR A;  4ZI7 B;  4O4I A;  2ABJ A;  3TXS A;  5FL7 G;  4G3I A;  4YQW A;  3SJQ C;  1QR8 A;  3HOU G;  2PUS A;  4D7S A;  4CH4 A;  5HBR B;  3CE2 A;  3SPC A;  4X64 H;  2Y69 C;  1HWY A;  2QWP B;  5FPO A;  1KQS U;  3N6X A;  3WB1 A;  4RUF A;  3I4N G;  5LP6 A;  4UB6 Z;  4PA6 A;  2YIB A;  3LUT B;  5DGH A;  1WPB A;  5EK0 A;  4BXX G;  3RBE A;  1I7F A;  4JI2 O;  4K6N A;  3DSQ A;  4YAJ B;  3Q8S B;  1HNX B;  4JV1 A;  3KAK A;  1S0V A;  4TVI A;  2JGD B;  2R8G A;  2VUM G;  1YEW A;  4I50 A;  4A3G G;  3CC2 V;  3L4J A;  2R7Z G;  2K1E A;  3G4S V;  2CTR A;  3HBL A;  2W0X A;  4EBE A;  1KKD A;  2E5L H;  4LSA A;  5KT2 A;  4J9M A;  2F4V B;  4FBU A;  3RV3 A;  4X65 B;  4BWA A;  4E6N A;  2R7Z A;  2UXD H;  3ZX6 A;  5LOV A;  1Y14 B;  2Y0P A;  3GTL A;  1PPJ H;  1BQZ A;  2IM9 A;  2H3O A;  1XMQ B;  2BSK B;  1E4G T;  2HR3 A;  2YSU B;  4CHI A;  4MV1 A;  3GB7 C;  4UV9 A;  3SYC A;  1V55 B;  4JI1 H;  5I47 A;  4NR1 A;  1SA0 B;  5JCO A;  3HKB B;  4MVZ A;  3T2M A;  1ZSP A;  1FYJ A;  2PBZ A;  1VQ6 V;  3NC0 B;  5BY1 A;  5BZB A;  3AG7 A;  1VF6 A;  2HVK C;  3VQY A;  3DTF A;  1YTF B;  1XL4 A;  3H1K H;  3ZED A;  4FLT A;  3RB4 A;  4YB8 B;  5CB4 A;  4Q20 A;  3T5J A;  4J9S A;  5EYP A;  2UXD O;  1ZHS A;  2LQT A;  5GON A;  4JTC B;  4B3S H;  3X2Q C;  4O2B F;  3AK2 A;  3G8D A;  4EYH B;  1AUX A;  4OX9 B;  4LFC O;  2WLI B;  1UC9 A;  4DR3 H;  1A3G A;  2R87 A;  5FPR A;  1CKO A;  5KG2 A;  3MDS A;  5KHH A;  1HW7 A;  2YRX A;  2W6Q A;  3OTO B;  2YIB D;  4HNV A;  2RJZ A;  4JTA B;  5LMU O;  4LF8 H;  3KHH A;  2UVU A;  4N23 A;  4O86 A;  2YCH A;  5KS8 A;  2Q0A A;  4LF4 O;  4LF9 O;  3RW0 A;  1K5S A;  1E1Q G;  2J6U A;  2J6S A;  5I5Y A;  5KFK A;  5LP6 B;  2ZNI A;  2A9H A;  1Z2G A;  2ZT9 B;  5IP7 G;  1W0J G;  4O4L A;  2X0L A;  4A2B A;  4ASU G;  4DV6 O;  1GSO A;  3J80 W;  1PP9 H;  5K2M A;  2NR5 A;  2PY5 A;  1N0N A;  3BA8 A;  1ZTE A;  3IN5 A;  2W6N A;  4XX0 B;  2BQR A;  2EIK B;  4I5S A;  5CM0 A;  4FLX A;  2PYJ A;  4LF6 B;  3JAK B;  5KMG B;  4ZHQ A;  2ASD A;  3KRE A;  1FKA H;  2VA3 A;  1SCU B;  5KAF Z;  4AYB E;  2O57 A;  3GTG A;  2LFS A;  1C30 A;  3CEI A;  1Q3E A;  3KCX A;  5CA3 A;  2UUC O;  3SJA C;  3PW4 A;  3LQS A;  5DG7 A;  1B04 A;  1OCO B;  3FB7 C;  4RAI A;  4R7R A;  4QNH B;  4DL5 A;  2WLH A;  4BW9 A;  1BHA A;  4KL1 A;  4FLZ A;  4LR3 A;  1Y76 B;  4WBN F;  1XUQ A;  2FB9 A;  4B3M B;  2VR1 A;  2H8P C;  1I5Y A;  4JPR A;  3TK1 A;  3Q2O A;  3RAX A;  3I55 V;  1K4C C;  4TUY B;  4DIM A;  2W57 A;  4YXW G;  2V4R A;  2Y69 B;  3ZMT A;  3MWE A;  1JFF A;  5GTH Z;  5JVD A;  5DQG A;  1N33 O;  1K1Q A;  4IWX A;  2R8J A;  1I3Q A;  5IJ0 B;  2WA4 A;  2PVP A;  2IW5 A;  4PDB A;  4NYE A;  3CEB A;  3B40 A;  1LNQ A;  1AR4 A;  4FGR A;  2XAJ A;  2WLL A;  3U9S A;  1WNS A;  2BTQ A;  4X1Y B;  4GLW A;  5KG1 A;  1KKC A;  3ZHU A;  2A0L A;  3Q8P B;  4R8U A;  2QWO B;  4IR1 A;  4FE2 A;  2VQE H;  1O9H A;  1P49 A;  4QE9 A;  1NH2 D;  1HDJ A;  3OUZ A;  2NVY A;  4AYB A;  3KAJ A;  4B3R O;  1TGO A;  4O7Y A;  5HV6 A;  4FVM A;  2XCP A;  3PW2 A;  5KFU A;  1UJW B;  3H9V A;  2ZDG A;  4NXM H;  4ZOL A;  3A8T A;  1YZB A;  2CK3 G;  1NTZ H;  1XI1 A;  3N40 P;  1RP3 B;  2ZE5 A;  5L3C A;  4JI7 B;  1FJG H;  1ZL8 A;  2CFM A;  4HZ3 A;  1PX2 A;  2F95 B;  3AG3 B;  4ECQ A;  1Z5V A;  1EZJ A;  2DYR C;  4ZHQ F;  4IRC A;  3JZI A;  1KU9 A;  4GKK H;  4A3J G;  1T36 A;  4FIP C;  3RYH A;  4MV3 A;  1SFO A;  3QZ7 A;  4ED6 A;  1YSC A;  2K9P A;  4JV5 B;  2HVJ C;  2ZIO A;  1XHZ A;  3FYI B;  2HIX A;  4WFF A;  1O75 A;  4DK1 A;  4ZKI A;  1W93 A;  5DLG A;  4WFE A;  3RVY A;  5C8Y B;  2R6F A;  1QVG U;  1RM1 B;  2R8I A;  3PR5 B;  4FFO A;  2XAH A;  4LF8 O;  3SR2 C;  1M7J A;  1K73 W;  1N34 O;  1IBM H;  4KP4 A;  4O2A A;  2JA7 A;  1DK1 A;  1A0G A;  2AZ0 A;  2Q69 A;  3H20 A;  2XAQ A;  3CCU V;  4RB0 A;  3GTO A;  3OMA B;  4X9Q A;  1GAX A;  1K97 A;  1QVF U;  3GJX B;  2FYU H;  3QFF A;  2Q7D A;  3HPL C;  3CRQ A;  1H38 A;  1BZK A;  1N34 B;  1QBZ A;  2WAQ A;  5E1A C;  3AG4 C;  1KUQ A;  4Y8V B;  2FLP A;  3ZRX A;  3VPC A;  2A7W A;  4QGP A;  4YHH B;  4PV1 B;  5DGA A;  4EYI B;  5BPF A;  2ZD9 A;  3OUU A;  4DQN A;  1L0N H;  3CYO A;  3GVM A;  3K58 A;  3JD1 A;  3F7V C;  1RYS A;  1VMG A;  3BQ0 A;  1K34 A;  2DYS B;  1FXV A;  1ZUQ A;  1M57 B;  1X4T A;  5FJ8 G;  2QA4 V;  4OXS A;  2GLT A;  1EN4 A;  1BS3 A;  4MV4 A;  4JI7 H;  1TVK A;  1Y74 B;  1FVI A;  2EIN B;  4JF3 A;  1ZAU A;  4I9Q A;  4JGS A;  2DLN A;  5DLF A;  2Q7E A;  2COI A;  1PNK A;  3WB0 A;  4ZOL F;  2F23 A;  1A32 A;  3RBZ A;  2R7K A;  2HJF C;  1EKV A;  2FE3 A;  4UCO A;  2MK3 A;  3NBZ B;  5HNE A;  3LSQ A;  2DW4 A;  2DAB A;  3BAC A;  1YIT V;  1YCI A;  1IBK H;  2UUB H;  3NGD A;  3K5M A;  2Z3Y A;  2R85 A;  1VF6 C;  1PNM A;  4U3J B;  2RF4 A;  4O2A F;  1EFR G;  4F4X A;  4EGQ A;  1EYZ A;  1LR1 A;  2R84 A;  2UUA O;  3F8N A;  4LFC B;  3OD4 A;  5LMU H;  3HOV G;  4YJ3 F;  5I5V A;  2W6I G;  5IYB O;  3E35 A;  3HKB A;  3ZMS A;  2P5O A;  1WAZ A;  5KX5 A;  2YC0 A;  4DV3 O;  3T99 A;  4I4T A;  4YIP A;  1PNL A;  2X6B A;  4DK0 A;  1W96 A;  3RT3 C;  3GII A;  2NU9 B;  1R3K C;  4FLU A;  4K8X A;  2WDT A;  4O4J A;  3BVO A;  2XTA A;  2EZP A;  5KT5 A;  3T1H H;  1S0N A;  1EHI A;  4RCN A;  4MW8 A;  4UCV A;  2F1M A;  4DR2 O;  4HR7 A;  4PA9 A;  5BXZ A;  5CA1 A;  1Y1V G;  5KFR A;  4DYL A;  4BBR G;  1K1S A;  4A3L G;  1DF4 A;  1WP7 A;  1R6K A;  3GV8 B;  2B5U A;  1P4R A;  4DL7 A;  1COW G;  1PKX A;  1GN3 A;  2VWJ A;  3WG7 B;  1DAA A;  3CX5 F;  2WB1 A;  3SI8 A;  1N36 O;  3M7M X;  5H2F Z;  5IJ0 A;  4PDV A;  5K3W A;  1HNW H;  2AGO A;  4R8C A;  4TSF G;  4F6R A;  3WWJ A;  5KFP A;  3W1B A;  5HFL A;  3NXS A;  1P7G A;  4X1I B;  3DAA A;  5E79 Z;  4HNA A;  3OTO O;  3BPZ A;  4J7Z A;  2HP8 A;  1WB8 A;  2I8C A;  3JAS B;  3R5H A;  1PL4 A;  2DYS C;  1IBK B;  2BQ3 A;  4YJ2 A;  2XOK G;  3ZRS A;  3UT5 B;  3SPG A;  2BR0 A;  4OX9 H;  2UXN A;  1JA8 A;  4OX9 O;  2W8K A;  1ZET A;  4NXN H;  1VQN V;  4DXW A;  4O81 A;  2EJR A;  5CR5 A;  1IZ3 A;  3H01 A;  4O7S A;  3JAT A;  4B3M H;  4JYB A;  1CS0 A;  3FDS A;  2JS5 A;  3AG4 B;  5L3E A;  1G1X B;  1YJN V;  5LXT F;  1GM7 A;  2JEJ A;  3JYC A;  1GMG A;  1F23 A;  2C2A A;  2QWN B;  3C90 A;  3E8G A;  3LNM B;  1G8M A;  1JR9 A;  2HGS A;  4MSW C;  2W70 A;  4DV1 H;  4DR4 B;  2YS7 A;  4I9W A;  5DGB A;  2DIK A;  3ZBH A;  4O7R A;  1DIK A;  4PZ7 A;  5GON F;  5IJ9 A;  5JH7 F;  3BJY A;  4UV8 A;  5J9P C;  3M9N B;  5LL6 b;  4JYY A;  2X7R B;  2P7T C;  5BWT A;  3ABM B;  1ENV A;  2N04 A;  3AG2 B;  1I1K A;  3FB8 C;  3VQV A;  3U0G A;  3D3I A;  3ZS8 C;  1S10 A;  2QB5 A;  5C8Y A;  3Q4H A;  2F93 B;  2UVV A;  2W6P A;  1WH2 A;  4YJ2 B;  5CE8 A;  3I4M G;  1EN5 A;  2HHH O;  3AX6 A;  5IYB G;  4I55 A;  3FB6 C;  2IU3 A;  5CN0 A;  5KFY A;  2IH3 C;  2Q9L A;  3VBB A;  3K5H A;  2FP4 B;  2SCU B;  3JAT B;  2CAZ C;  1KJJ A;  2V4D A;  2UU9 O;  4A3C G;  2OWO A;  4UUJ C;  1I5X A;  3BQ1 A;  4K3A A;  3RYF B;  2OCH A;  2DOS A;  1KT8 A;  2EJ3 A;  4O3O A;  1I94 H;  1XNR B;  5LHG A;  1E4F T;  3T9D A;  3B8M A;  3WO0 A;  2AU0 A;  4O3Q A;  4A3B G;  4DV4 B;  2N74 A;  3QO8 A;  2UUB B;  4KXR A;  4ZOL B;  2QEX V;  4JV5 H;  3ABT A;  5IY5 B;  2JJ2 G;  1CKN B;  1E79 G;  4X1I A;  2MW2 B;  5KT7 A;  4LH7 A;  3DF7 A;  2ZJT A;  5BMV F;  1S72 V;  4U7O A;  1HNX O;  3TJT A;  3T1C A;  4FM1 A;  4I0X B;  1MMM A;  1IBL O;  4DUY O;  4IRK A;  3LSS A;  2ITC C;  4DV3 H;  5KFN A;  1QNM A;  1EBO A;  2CTP A;  3R5X A;  1L0L H;  1IYE A;  4YR2 A;  5LYJ B;  2GHY A;  1RFY A;  1JCH A;  1IBL B;  2QWR B;  1AI5 A;  5IT9 N;  1FFX A;  5DGI A;  3T4Z A;  2GSM B;  2UU9 B;  1ZQ7 A;  2Y0S E;  1TWG A;  1IDS A;  4B3T O;  3T9C A;  1XBL A;  3GV5 B;  4QIW F;  3N2K B;  3JSL A;  4CS2 A;  1OCZ B;  2R9A A;  2X6A A;  4MTX A;  1AR5 A;  3W7X A;  1VQP V;  1VQ8 V;  3UZO A;  4NKG B;  2R92 G;  3HKC A;  1M5I A;  5FNV F;  3FKS G;  1HR0 O;  3K08 A;  2HHH H;  3K3P A;  5JQW A;  4IR9 A;  1WLE A;  1TWF A;  1NH2 B;  2GQS A;  1OBG A;  3WNZ A;  3PO2 G;  4AQY O;  2VWK A;  1QCE A;  4EKW A;  1D5A A;  2VPS A;  4I4T B;  2HGX A;  3D8C A;  5KA6 A;  1Q81 W;  2XC9 A;  5KFS A;  2CW8 A;  4Q44 A;  2XGP A;  3TCU A;  2HKO A;  1N48 A;  1PM9 A;  3N2G A;  5FLM G;  4X1K A;  3SGI A;  3ASN B;  4B3S O;  3CS5 A;  1RM1 C;  4ED1 A;  4M9U A;  3PW5 A;  2VQE O;  2WLK A;  4DL2 A;  1DGS A;  2Q4P A;  2ZGI A;  4JI3 O;  3K57 A;  1RJQ A;  4JI5 O;  3N42 B;  4J9N A;  4RAY A;  3BHP A;  5JJN B;  3T5K A;  2PTM A;  3JD0 A;  4DV2 H;  2JA7 G;  1NTM H;  4PJ0 Z;  4HNT A;  1Q6I A;  4R50 A;  4GX1 A;  4DR3 B;  4NZN A;  3HR0 A;  1UFI A;  3JAL A;  4A3K G;  5C93 A;  3H4D A;  2UXB O;  1H2N A;  1YTF D;  4H37 A;  1XHX A;  3G80 A;  5EC1 C;  4LF7 O;  3PFF A;  3VNN A;  3X2Q B;  2R9R B;  4BY7 G;  5JVL A;  1N32 B;  4UCS A;  1Z2P X;  4UCR A;  3CCJ V;  1C3O A;  3OSN A;  4K0K H;  5KHJ A;  3CSW A;  4ECX A;  2P90 A;  4B3R H;  3CC7 V;  2FLL A;  5B66 Z;  1I7N A;  1SEI A;  2UXC B;  3QTC A;  3LWB A;  3U10 A;  4FM0 A;  2P0A A;  4C5B A;  2R8K A;  4L87 A;  1K5Q A;  3VQW A;  4O4H B;  1XK5 A;  2CH7 B;  5EIB C;  3ORR A;  3EPG A;  1B3Q A;  4I7H A;  2OYQ A;  1SER A;  4IIJ A;  3TY9 A;  4LWS B;  3C3T A;  2ASJ A;  3D36 A;  5CAE B;  3RBD A;  2Y48 A;  4FJC C;  4WBN B;  4K35 A;  4QWD A;  1HNW B;  4FFB B;  2IBK A;  4TT3 G;  2JEF A;  4WBN A;  4DV4 H;  4HNA B;  5GTI Z;  4YBZ B;  2ZM6 O;  3L2P A;  4X62 B;  3PO3 G;  1AN7 A;  2EJ7 A;  5KFX A;  2A06 H;  2P4K A;  5IYZ A;  3C0F B;  4DV6 H;  2GUZ B;  4LNU A;  3DC6 A;  5LYJ A;  4RNN A;  2J9G A;  4ED7 A;  2ASL A;  2E74 B;  3MJF A;  3DXR A;  1TWC A;  4X1Y A;  4LFB H;  2PF4 E;  3F5T A;  1TVK B;  1Y74 A;  3HKZ E;  5BR8 O;  5JWP A;  2WAM A;  2RQ6 A;  2EIM C;  3Q8R B;  3OMN B;  4UXN A;  1SES A;  3JAM N;  4WFH A;  2R8H A;  1VEW A;  1I1M A;  2HIV A;  2Z04 A;  3TXQ A;  4KUM A;  1RPR A;  3H1J H;  5JQG F;  2F4V H;  1S5H C;  1B6S A;  4JI3 B;  4DRF A;  2UUB O;  4EBD A;  2E2I A;  3APQ A;  4GX5 A;  3IC7 A;  4ECY A;  2UU9 H;  1U96 A;  1EZ1 A;  5IYZ F;  1EUC B;  2RNB A;  2DN9 A;  3UZB A;  2LGQ A;  2HHF B;  2HJW A;  3BAB A;  4KHP O;  3Q4H B;  3STZ C;  4U6P A;  2YID A;  3KHL A;  4AHC A;  4PA7 A;  1H2M A;  2DWE C;  1V55 C;  2JRI A;  2QM4 A;  3OT7 A;  4PI2 A;  3ZCC A;  2HHH B;  1EKP A;  3LUL A;  3TW6 A;  5C5J A;  1TA8 A;  3T1H B;  4G27 B;  4LF7 H;  1Q8I A;  3UQ8 A;  1JPX A;  3ZHR A;  1JLL B;  4ECS A;  1Q5O A;  5C4X G;  1XRE A;  3GIQ A;  3JCZ A;  4O7L A;  1BGW A;  3A0H Z;  3JAW B;  1IOW A;  4JI0 O;  4DV2 O;  4QSH A;  5LGN A;  4MTD A;  3MFI A;  3BFR A;  1SZT A;  1LUV A;  2Z0A A;  3PW7 A;  2R9I A;  2Z02 A;  2RDI A;  3W7T A;  4X20 B;  4O2B A;  4JTD B;  2YXH A;  3LSU A;  1S03 G;  2Y0I A;  2Y4T A;  4GUN A;  2VOB A;  4J9O A;  2W6M A;  3P3N A;  4JI8 H;  2VUG A;  2Q73 A;  3RWR D;  3FYE B;  4MVR A;  2AGA A;  2YZL A;  2CE4 A;  5FNV A;  2FMA A;  1GTO A;  1SC5 B;  2BOB C;  2ZR3 A;  3SJC C;  2V58 A;  1CP9 A;  2YZN A;  2N05 A;  5LGT A;  4IT5 A;  2KG7 B;  4Q6G A;  4EGJ A;  4DR7 O;  1RSO A;  5EC2 C;  4RUA A;  3E8F A;  3SE7 A;  1QHT A;  3G67 A;  3TET A;  5IWA B;  3SPH A;  5L3F A;  3E89 A;  2BTO A;  2J6T A;  4UCT A;  4TQS A;  2ADQ B;  3E86 A;  4P30 A;  5J2U A;  3EVK A;  3KHR A;  2B1G A;  1T94 A;  4PHZ A;  3H4B A;  4Q4D A;  4OPA A;  5CBH A;  2YS6 A;  3N2G B;  4YY3 O;  2YRW A;  4DL6 A;  4XZ3 B;  1SQB H;  5L9X A;  2DPJ A;  3CQZ A;  5K1X A;  2YU9 A;  3S3W A;  5FLX N;  4FK5 C;  4F6E A;  4IYH A;  3RAQ A;  2LFR A;  3SYA A;  4Z2W A;  2LP7 A;  4O3S A;  4F4L A;  4UVA A;  1V4Y A;  2ZDI A;  2B1I A;  5D5Q A;  4ED0 A;  1GSA A;  3W7U A;  4E2L A;  3ZHS A;  4NYK A;  3JD3 A;  3RIZ A;  1XDC A;  4LF5 H;  3OAA G;  1GGO A;  5DEC A;  4LF6 H;  4JYA O;  2IA6 A;  1S0O A;  2JEU A;  5KX5 B;  1M0W A;  5EBW C;  3CC4 V;  3ASO C;  2LO1 A;  2GPS A;  2L6L A;  2QTO A;  1PD3 A;  1SF9 A;  4K0K O;  4RAZ A;  4DV3 B;  1I2K A;  4BY1 G;  4J11 A;  2JIZ G;  5EBL C;  2YI8 A;  3J81 N;  1SRY A;  4FFL A;  3V6K A;  3BEH A;  4IHJ B;  1I7L A;  5JH7 A;  4RUE A;  3CME V;  5F2V O;  3ETJ A;  1J95 A;  4YR3 A;  4IIJ B;  2YZG A;  3GIP A;  4JI4 B;  2NU7 B;  2H94 A;  5B1N A;  4O4J F;  2PYL A;  2QKC A;  2YEV A;  5D1P A;  1K9M W;  3QNE A;  1YVW A;  5KFW A;  3JAR A;  4NVP A;  4O7W A;  3S3X A;  4U7N A;  3BY6 A;  4WF9 V;  1IOV A;  4Q43 A;  1E1R G;  1JDB B;  3JAM W;  4IYI A;  4O3P A;  1Q86 W;  3HOX G;  2AW9 A;  4Q8F A;  1MSD A;  4GYC B;  2JA5 G;  2QWQ B;  5FLX W;  3RTX A;  3MR5 A;  4FPP A;  4HN2 A;  2RGV A;  1CXZ B;  2FML A;  4RB2 C;  1TWA A;  4ZQI A;  2X6C A;  3E83 A;  2OCC C;  4I50 B;  2IJK A;  5JVD F;  3QF7 A;  4MAM A;  4CMD A;  2C2D A;  1R9T A;  1S5J A;  3N41 B;  1OJH A;  2V4Q A;  3F5W C;  4MV9 A;  3RGX A;  3TIN A;  4JI1 B;  1TUB A;  3RYI B;  5JQG A;  3GTK A;  3ZMV A;  2HG5 C;  5B1B B;  1LUW A;  4E4T A;  2ZDI C;  2C2R A;  4JXU A;  2Q2U A;  4L8J A;  3K5L A;  3ETH A;  3VPD A;  3RB3 A;  4HYO A;  1VQ4 V;  1M90 W;  4DR7 H;  3CCS V;  4X64 B;  4B3T H;  5HFM A;  1SQV H;  1CPY A;  1AVM A;  4QW9 A;  4X8A A;  3RJ0 A;  3TY5 A;  4X62 H;  3WB2 A;  4QPK A;  2YW2 A;  4J9Y B;  5IY5 C;  4GKJ O;  5J2T A;  1FD9 A;  4JI2 H;  3KTM A;  5LA6 B;  3GIJ A;  1N33 H;  2IJI A;  2Q8V A;  2GQR A;  4AI8 A;  5CA0 A;  3O9O A;  4DL3 A;  2V9W A;  5KUK A;  4O7T A;  1DLB A;  4MT8 A;  4IL6 Z;  1W2B U;  1AI6 A;  3CP1 A;  3OE7 G;  2P67 A;  4FFK A;  1MZB A;  1XNQ H;  1CKM A;  5JH7 B;  1NVP D;  5GON B;  3K06 A;  4JI0 H;  3B77 A;  3EHB B;  1Q6H A;  1HNX H;  2ILM A;  5CA1 B;  5L3G A;  4RB3 C;  2IBZ H;  4B7K A;  1OWT A;  4MV8 A;  1WRV A;  1XMQ O;  2AZ2 A;  5LXT B;  3KG2 A;  4TV8 F;  3SYQ A;  1NI8 A;  1P84 F;  2RCV A;  5KA5 A;  3T1H O;  4LFB O;  2GTS A;  3G8C A;  1PK8 A;  1SA0 A;  4H33 A;  4NTW A;  2W8L A;  1E4E A;  3EYY A;  3AG1 C;  2CQY A;  3L72 H;  5L1K A;  2WLJ A;  2GTA A;  3SDL A;  1IXM A;  1QR9 A;  4QW8 A;  4FFB A;  3DXR B;  1NVP B;  2PN1 A;  1XNR H;  3HKE A;  4OPH A;  4FZ0 A;  4JV0 A;  4UCU A;  3CCE V;  4JAS A;  2UVW A;  2ZCE A;  3ZN0 A;  1QLE B;  3T7A A;  4JI7 O;  2YS8 A;  2UUC H;  4X65 O;  4JZG A;  5A9G A;  2DWC A;  4NZO A;  4LFB B;  1T3N A;  4O4I F;  3RUP A;  1K3E A;  3E2E A;  2CNQ A;  2G38 A;  2JEI A;  3I12 A;  5LHI A;  4H44 B;  5IYD G;  2R7L A;  3CMA V;  1NT2 B;  1FFX B;  5LGU A;  4JI8 B;  1I08 A;  1WPX A;  4JI2 B;  2W6Z A;  4EB6 A;  1S68 A;  1Y4M A;  3TEK A;  3N6R A;  1H2G A;  3QQM A;  4MVQ A;  4DV7 B;  4X1K B;  4DV1 O;  4YR0 A;  4I4T F;  3ORQ A;  3A0R A;  3SPJ A;  3R66 A;  2HLD G;  4H0L B;  3ZMZ A;  2Q67 A;  1FXK A;  3GDE A;  3CCR V;  2DE0 X;  5KKN B;  2RGR A;  3QG5 A;  3OEE G;  1YF2 A;  4JI0 B;  5KG7 A;  4G28 B;  2B9Z A;  4J7J A;  5KFI A;  1FS0 G;  1BE3 H;  1V54 C;  5CBF A;  3GIK A;  1M56 B;  3GTQ A;  5KFT A;  4JI6 H;  1YI2 V;  3IG0 A;  3ZJZ A;  1HNZ B;  1H2S B;  2HVQ A;  2R86 A;  3CCV V;  1B6R A;  5EWE A;  2FLN A;  4LF6 O;  5KG3 A;  4YJ3 B;  4JI3 H;  1OCC C;  5KG5 A;  5KFB A;  2OCC B;  1BL8 A;  5LL6 Y;  3ETE A;  5KG0 A;  3UCS C;  1KJ9 A;  2DJV A;  5KFC A;  3ZRW B;  3RYF A;  3VOT A;  3M9O B;  4GC6 A;  5IP9 G;  3JAW A;  4ZBM A;  3JD4 A;  4QPJ A;  3PW0 A;  2COG A;  4GT1 A;  4NLG A;  3R9R A;  3GTJ A;  4DR1 O;  1GN4 A;  4TV9 A;  5KT6 A;  4O7N A;  3G6E V;  3K5O A;  2PI5 A;  4LF4 B;  4LF9 B;  4U7C A;  3JSN A;  1OCZ C;  4ECZ A;  2RMK B;  4J41 A;  1PL0 A; 
#chains in the Genus database with same CATH homology
 1FJG B;  3VQY A;  3PN1 A;  3NBY B;  2CW8 A;  4AQY H;  1L2Z A;  4FLT A;  3ZED A;  4ZIB A;  3N2G A;  4X1K A;  3SGI A;  5CB4 A;  3U11 A;  5EYP A;  1HR0 H;  1ZHS A;  1IBM B;  5GON A;  1DGS A;  1M4U A;  4B3S H;  3N42 B;  2ZIM A;  3K57 A;  4OX9 B;  4RAY A;  4TOI A;  3BHP A;  5JJN B;  2PTM A;  4DR3 H;  4DV2 H;  4CH3 A;  4GKJ H;  5FPR A;  3HKC B;  1P16 A;  1CKO A;  4EEQ A;  5KHH A;  4EFE A;  4DR3 B;  4FLY A;  2P22 C;  1HW7 A;  1N33 B;  3JAL A;  3KXY T;  3OTO B;  2YIB D;  5BR8 B;  2XHB A;  2RJZ A;  1XHX A;  4LF8 H;  5FNV B;  4JYA B;  3VNN A;  3RYH B;  3BAA A;  2YCH A;  3OTO H;  1N32 B;  2Q0A A;  4UCS A;  1Z2P X;  4UCR A;  1JMK C;  2ZIN A;  4K0K H;  2UXD B;  5KHJ A;  4B3R H;  5LP6 B;  2ZNI A;  5IWA H;  1SEI A;  1Z2N X;  4O4L A;  3QTC A;  2UXC B;  3U10 A;  4FM0 A;  4A2B A;  4I55 B;  3U0Z A;  5J2T B;  4GKK B;  3J80 W;  1IBL H;  4DR6 B;  2PY5 A;  2UUC B;  3OTF A;  3VQW A;  3KAL A;  3BA8 A;  4O4H B;  1XK5 A;  5EIB C;  5EIB D;  4I7H A;  2OYQ A;  1O9G A;  4IIJ A;  4FLX A;  2PYJ A;  4LF6 B;  3TY9 A;  3JAK B;  3KYH C;  5KMG B;  4ZHQ A;  1FKA H;  4WBN B;  3BA9 A;  1Z2O X;  1HNW B;  4LF7 B;  1Q3E A;  4FFB B;  1I94 B;  1TUB B;  3SJA C;  4WBN A;  4DV4 H;  4HNA B;  1B04 A;  1GYF A;  5BMV B;  3L2P A;  3E22 A;  4R7R A;  4X62 B;  1VF7 A;  4BW9 A;  5D1O B;  4KL1 A;  4FLZ A;  4A2A A;  4LR3 A;  3QWU A;  1AN7 A;  3C0F B;  5IYZ A;  2HVR A;  4O4I B;  4DV6 H;  4B3M B;  4DUY H;  4LNU A;  5LYJ A;  4YY3 B;  4X20 A;  4TUY B;  2W57 A;  3N43 B;  1CKN A;  4X1Y A;  5CA0 B;  5JJJ B;  3RYI A;  1JFF A;  4LFB H;  3RYC B;  4ETS A;  1TVK B;  5JVD A;  4B3S B;  2ZNJ A;  2RQ6 A;  5EZY B;  4EQ5 A;  2F66 C;  5IJ0 B;  1N32 H;  4PDB A;  4CS4 A;  3UT5 A;  2HIV A;  2VQF B;  2JVD A;  4CH5 A;  2F4V H;  4JI3 B;  4DRF A;  4YJ3 A;  1WN7 A;  3T1Y H;  4CH6 A;  5JJE B;  1WNS A;  2BTQ A;  4DR4 H;  4X1Y B;  3RYC A;  3W1G A;  4FLV A;  3LML A;  2UU9 H;  3T1Y B;  5KHG A;  4DV2 B;  4DR1 B;  1TAE A;  2VQE H;  5LXT A;  1O9H A;  1P49 A;  3IAY A;  5J2U B;  3KAJ A;  1TGO A;  1P8L A;  3BAB A;  3E22 B;  1M93 A;  4FVM A;  4LF5 B;  4Q0Y A;  2E3C A;  2XIG A;  3RGZ A;  4NXM H;  4AHC A;  4ZOL A;  2BTQ B;  2QM4 A;  2HHH B;  4GLX A;  4PI2 A;  1XI1 A;  4LF7 H;  4MV7 A;  3N40 P;  1TA8 A;  2R70 A;  3T1H B;  5A2Q W;  1Q8I A;  4JI7 B;  3UQ8 A;  1FJG H;  4CC6 A;  1Q5O A;  4EB6 B;  2CFM A;  2F95 B;  3HKD B;  4DV0 H;  5KHK A;  3CSX A;  2Q2T A;  1BGW A;  4K8Z A;  1Z5V A;  5KHI A;  3JAW B;  4DRX A;  4GKK H;  1KU9 A;  5LP6 C;  4MTD A;  4DV0 B;  5EYP B;  3RYH A;  4DR6 H;  3L4K A;  4JV5 B;  3JAR B;  2ZIO A;  3N2K A;  3VQX A;  4X20 B;  3RF2 A;  4O2B A;  1XHZ A;  4DR7 B;  2HIX A;  1S03 G;  2VOB A;  1O75 A;  4DK1 A;  2EX3 A;  4KHP B;  4LF4 H;  4LF9 H;  5LOV B;  4JI8 H;  2VUG A;  3RGB A;  3RWR D;  5C8Y B;  4O2A B;  3CVZ A;  3HKE B;  3SR2 C;  1IBM H;  4O2A A;  5FNV A;  2VQF H;  3SJC C;  3HXL A;  3H20 A;  2PGG A;  4RB0 A;  4Q6G A;  1RSO A;  3RFR A;  2Q7G A;  4LFC H;  1QHT A;  4DV5 B;  5EOY A;  5IWA B;  4DR1 H;  3GJX B;  1Z5W A;  5BR8 H;  2BTO A;  4UCT A;  1N34 B;  5J2U A;  5BMV A;  5EZY A;  4PZ8 A;  1A0I A;  2YI9 A;  4O4H A;  4YHH B;  3CB2 A;  4PHZ A;  2E5L B;  5D5P A;  3K3V A;  1Q43 A;  1SKV A;  3N2G B;  1JJO A;  4UFZ A;  3K58 A;  1BJT A;  3FFQ A;  5KMG A;  1VS0 A;  2MCT A;  4LMY A;  4YHH H;  1XNQ B;  2QJ1 A;  4TV8 A;  5K1X A;  3A2F A;  5DIS C;  1X4T A;  2UUA H;  2ZM6 B;  4DRX B;  4JI7 H;  4FM9 A;  1TVK A;  1FVI A;  5D5Q A;  4O4J B;  4TV9 B;  1ZAU A;  4I9Q A;  4RB1 A;  2Q7E A;  3RIZ A;  1G6U A;  4J0M A;  4LF5 H;  3BRC A;  3WB0 A;  3JAK A;  2HEP A;  2FE3 A;  4LF6 H;  4UCO A;  3NBZ B;  5FD5 A;  5KX5 B;  1M0W A;  5LMN B;  2UUB H;  1IBK H;  3J7A K;  2UXB B;  3K5M A;  4U3J B;  4DV6 B;  5LMN H;  1J5E H;  4B08 A;  4RAZ A;  4O4L B;  4DV3 B;  2WYO A;  5JCO C;  2YI8 A;  3F8N A;  4IHJ B;  4LFC B;  2PZS A;  4DR5 H;  5LMU H;  4GKJ B;  5JH7 A;  3HKB A;  2KKW A;  2P5O A;  3CHX A;  5KX5 A;  4IIJ B;  5LMU B;  4JI4 B;  5ITZ A;  4TV8 B;  2PYL A;  4I4T A;  3JAL B;  4DK0 A;  5D1P A;  5IT9 W;  1HNZ H;  4FLU A;  4X66 H;  2JGU A;  4K8X A;  2HVS A;  4NXM B;  3JAR A;  4NVP A;  2WDT A;  2YXL A;  4O4J A;  4JI5 B;  1XDN A;  3T1H H;  3JAM W;  4JI6 B;  2VQE B;  4UCV A;  2F1M A;  1N36 B;  1X9N A;  4GYC B;  5FLX W;  3RTX A;  5CA1 A;  4K0K B;  3M4I A;  2RGV A;  5FD6 A;  4RB2 C;  1XQ8 A;  4TQF A;  4AIL C;  2UXC H;  3ICX A;  2VWJ A;  4I50 B;  3QF7 A;  4DR2 B;  1S5J A;  3M7M X;  5IJ0 A;  3N41 B;  4HBN A;  3RR5 A;  1HNW H;  4KHP H;  4MV9 A;  4F6R A;  3RGX A;  3W1B A;  4LFA B;  1KMI Z;  4JI1 B;  1TUB A;  3RYI B;  4X1I B;  5JQG A;  1SQG A;  1XMO H;  4HNA A;  1L8D A;  4LFA H;  3BPZ A;  4EFB A;  2Q2U A;  3JAS B;  4L8J A;  3K5L A;  1HR0 B;  4M7E A;  4DR5 B;  1IBK B;  1XMQ H;  4APM A;  4YJ2 A;  4NXN B;  4DR7 H;  1V9P A;  4X64 B;  3UT5 B;  4B3T H;  4IAJ A;  4OX9 H;  3RJ0 A;  5K1P A;  4PI0 A;  3TY5 A;  3WB2 A;  4X62 H;  4DV5 H;  4NXN H;  3MWM A;  1T5E A;  5J2T A;  4IHJ A;  3JAT A;  1JFF B;  3W5O A;  4DUY B;  2R72 A;  1SYX B;  4JI2 H;  4B3M H;  5LA6 B;  5JVD B;  1N33 H;  2JS5 A;  5CA0 A;  4BWS C;  4ZHQ B;  4DV7 H;  4LF8 B;  4JI4 H;  3MAQ A;  3HKD A;  1J5E B;  5D1O A;  2HGS A;  4DV1 H;  4DR4 B;  1MZB A;  1XNQ H;  1CKM A;  5JH7 B;  4X66 B;  5GON B;  4PZ7 A;  2KSW A;  5IJ9 A;  4JI0 H;  5LA6 A;  1HNX H;  5CA1 B;  2UUA B;  1I6U A;  4TUY A;  5LL6 b;  3N44 B;  4CS3 A;  4DUZ B;  4RB3 C;  3S24 A;  2YIA A;  3ETQ A;  3VQV A;  3ZS8 C;  5IYZ B;  3B2E E;  2WE6 A;  5LXT B;  5C8Y A;  4DR2 H;  4PZ6 A;  2F93 B;  4LH6 A;  4X65 H;  4MTE A;  1WH2 A;  3GB8 B;  5CB4 B;  4YJ2 B;  3K59 A;  1QQC A;  1SA0 A;  5IJ9 B;  3EYY A;  4I55 A;  5JQG B;  5ITZ B;  4FFB A;  1ZHQ A;  4AQY B;  3JAT B;  2CAZ C;  1N36 H;  3TY8 A;  2V4D A;  4U3J A;  3THO A;  1XNR H;  2OWO A;  3HKE A;  4CC5 A;  4UCU A;  3RYF B;  2ZM6 H;  2ZCE A;  1I94 H;  1XNR B;  3K5N A;  1E4F T;  2UUC H;  4DV4 B;  4RZQ A;  3JAS A;  4O2B B;  2UUB B;  1M0T A;  4ZOL B;  4LFB B;  4LSX A;  4JV5 H;  4B3T B;  1SQF A;  1CKN B;  4X1I A;  4D7T A;  4LH7 A;  2Q7H A;  3DF7 A;  4YY3 H;  3LNN A;  2ZJT A;  1NT2 B;  1FFX B;  4O4I A;  4ZI7 B;  1XMO B;  4JI2 B;  4JI8 B;  4FM1 A;  4TQD A;  4EB6 A;  1S68 A;  2PUS A;  4D7S A;  4DV7 B;  4X1K B;  4CH4 A;  4DV3 H;  4FLW A;  3SJB C;  4X64 H;  2CW7 A;  4F6R B;  5FPO A;  5LYJ B;  3N6X A;  3WB1 A;  3GDE A;  4DV1 B;  4DUZ H;  5LP6 A;  2YIB A;  2RGR A;  1IBL B;  3QG5 A;  1WPB A;  1FFX A;  1I7F A;  4ZI7 A;  4JI0 B;  3DSQ A;  1HNX B;  3KAK A;  1YEW A;  2UU9 B;  4I50 A;  3L4J A;  1N34 H;  4JI6 H;  2GV9 A;  3IG0 A;  1HNZ B;  1H2S B;  2HVQ A;  3J81 W;  3N2K B;  3JSL A;  4CS2 A;  4LSA A;  2R9A A;  2E5L H;  2F4V B;  2O03 A;  4JI5 H;  4YJ3 B;  4JI3 H;  4JYA H;  4X65 B;  3HKC A;  4BWA A;  4E6N A;  1M5I A;  3FMA A;  2UXD H;  5LOV A;  2HHH H;  3RYF A;  4B3R B;  2IM9 A;  3JAW A;  1XMQ B;  1E4G T;  2VWK A;  4TV9 A;  4JI1 H;  3K5O A;  4FM2 A;  1SA0 B;  4LNU B;  1D5A A;  2VPS A;  4LF4 B;  4LF9 B;  4I4T B;  3HKB B;  5JCO A;  2UXB H;  3JSN A;  3NC0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...