4EFEA

Crystal structure of dna ligase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of DNA ligase
rcsb
molecule tags Ligase/ligase inhibitor
molecule keywords DNA ligase
total genus 103
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4efeA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4efeA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4efeA02
3GDEA 4JYAB 2VQFB 1X9NA 4X64B 5D1OA 3NC0B 3RR5A 4LH7A 1HNWB 3JSLA 1P8LA 2VQEB 2UXCB 3NBZB 5D1PA 4JI6B 4EFBA 4CC5A 3T1HB 2HIVA 1ZAUA 4DV7B 2UU9B 3GJXB 2Q2TA 4DR6B 1A0IA 4PZ7A 2E5LB 3PN1A 3T1YB 2UXDB 1IBLB 4E6NA 2HIXA 4NXMB 2UXBB 4JI4B 3BAAA 4JI3B 4JI0B 3BA8A 4X66B 4PZ8A 1DGSA 4TOIA 2F4VB 2HVQA 2OWOA 4CC6A 4UCSA 1XMQB 4JV5B 3TY5A 4B3SB 2Q2UA 1N33B 4GKKB 4LF5B 2VUGA 2UUCB 4LF6B 4UCOA 4LFAB 1N32B 4DR1B 4UCTA 4DV6B 4DR4B 3TY9A 3VNNA 4EFEA 5FPOA 5IWAB 4LF7B 1VS0A 4DV5B 4LFBB 4DR2B 4UCUA 4DV2B 1B04A 1HNXB 2CFMA 4EQ5A 2HVRA 4UCVA 4YHHB 5BR8B 4UFZA 4B3RB 1J5EB 3W5OA 4LH6A 1CKOA 3NBYB 1IBMB 4JI2B 4B3TB 2UUAB 4JI7B 4NXNB 3TY8A 4UCRA 1CKMA 3JSNA 4EEQA 4LF9B 3W1GA 1TA8A 1XNQB 1FVIA 4LFCB 1S68A 4DV4B 4LF4B 4OX9B 4DR3B 4DRFA 1CKNB 1V9PA 4B3MB 4JI5B 3UQ8A 4DUZB 5FPRA 4LF8B 4DR5B 1XMOB 1HR0B 1P16A 1XDNA 2ZM6B 5D1OB 1FJGB 5LMNB 3SGIA 4DV0B 1XK5A 3BA9A 3L2PA 4DV3B 4GKJB 4K0KB 4GLXA 4X65B 1IBKB 5LMUB 1HNZB 4DV1B 2HHHB 4JI8B 4PZ6A 4AQYB 3W1BA 3S24A 5DISC 3BABA 3GB8B 4X62B 1I94B 3RTXA 3QWUA 1N36B 4JI1B 4KHPB 4DR7B 2HVSA 4DUYB 1N34B 1XNRB 1TAEA 3KYHC 2UUBB 3OTOB 4YY3B 1CKNA
chains in the Genus database with same CATH superfamily
5FLXN 3CX5F 3PVXA 5CA1B 4XDKA 4QWEA 5LYJB 2HVJC 3F5TA 4E4EA 3ZHUA 4XX0B 4D6TH 1RSOA 3LSUA 2UXCH 2ZDHA 4K8XA 4DV4O 2IH3C 4JAUA 4O3NA 5FJ8G 2J6UA 1I7LA 2IU0A 3LQSA 4HNVA 2XNDG 2RCVA 5EOYA 4NYEA 4FFLA 3UYYA 2WSSG 5C4XG 3SNOA 4QIWE 4JAVA 3TXSA 3CJHB 3LNNA 2PZSA 2YIBA 3RVZA 2P67A 4C5BA 4IRKA 1W96A 4FGRA 4MA0A 3QG5A 2Y4TA 4E6NA 1Y74B 5D5PA 3TEKA 4ECRA 2B5UA 3MHHC 4HNAB 4DUZH 1M1KW 2AGAA 3KAKA 3QFFA 4F50A 2YI9A 3CQZA 1EKPA 2V4DA 2ZXWB 2YXYA 4A3EG 4LF5B 1ZTEA 1VQMV 1K92A 2P5OA 2UXDO 3ZEDA 2X6BA 4QWBA 1TWAA 2OCCB 2QKSA 1FKAH 5KFUA 4B7KA 1QLNA 1WH2A 2P90A 2QM8A 4MVRA 4DV2B 4LF4O 4HR7A 4FK5C 1GRJA 4GX1A 5H5NA 2OCCC 2R8HA 1Q8IA 4MVUA 4TQFA 4R6ZA 2A7WA 4RZRA 2XCLA 3DSQA 4B3TB 1VQ6V 1S03G 2VWJA 4NXNB 4AI8A 2E5LO 2CGOA 3L4JA 4I9QA 2QF7A 3RFCA 4B3MB 3QO7A 2EINB 2FTKA 4JI5B 3RBEA 4JV1A 2V4QA 4M0JA 4ZHQF 3P3NA 3OUUA 3E83A 3E8FA 5KFAA 1JDBB 5B1AB 1JXLA 1JPXA 2XT9A 3RB3A 2EINC 1Y76B 3V6HA 1YJNV 1HNZB 4U6PA 1JA8A 3GTMA 2QWNB 3CCJV 2OIGA 1R3IC 4IHJA 4I5SA 2K9PA 2VQEO 2OTJV 4GLWA 1NZ6A 2UXNA 3DGEA 3JCZA 4KHPO 1QU7A 1PV0A 4J9RA 4ZOLB 2AGQA 4A2AA 3D3IA 2DLNA 5KT3A 3T1YH 3FKIA 1M5IA 4H44B 1FKAO 2HGSA 2F1MA 4XDLA 3DXRB 1YJWV 4JYAB 5I5UA 4X89A 1N32H 3CSXA 3WB1A 4G3IA 3RIZA 1MG1A 2EIKC 3OW2U 1M90W 4I4TF 3UM7A 1FXHA 2FE3A 1C30A 2WLJA 3B8NA 2R85A 3KHGA 4E4TA 3OMNB 1Q3EA 1ET0A 1NTKH 3W7UA 1IBLB 4IHJF 4LFCO 1DAAA 1KEEA 3RT3C 3N2KA 1TVKB 3CCMV 5JUMA 4A93G 2UUBH 3N6RA 3RB4A 3D36C 1VQOV 4Y8VB 2X0LA 2ZNIA 2R8JA 2KB1A 4O3SA 5KT6A 3T5JA 4O4HB 4RAYA 2UUCH 3SJQC 4GKKB 1SEIA 4IRDA 1H2MA 2NUAB 2NNUA 4O7VA 4QW8A 2B9ZA 4NZOA 2XAFA 3D36A 2YZGA 4DV5O 5IYCG 3HOZG 3OGCC 2ZINA 2YZLA 3GIQA 3CCRV 3TIIA 1DLBA 1NVPB 2YEVB 4IYHA 3PW4A 4DR6H 3CCLV 4YHHO 4JYAH 2BTQA 1YHQV 4TQSA 1IOWA 3FB5C 2Q68A 5L3BA 1GN2A 4LH6A 4O2AB 4JTDB 2KQXA 4I7HA 1M0TA 1WJZA 4GC6A 2V7QG 5LXTB 1AI5A 4LF9B 1TA8A 2W70A 2Y48A 4DV4B 1GLVA 5LL6Y 3W7SA 5KMGB 2QWPB 2YRWA 2BQUA 3UQ8A 1XNQO 1Z2GA 5C3EG 2R72A 3U10A 2XAGA 3FB7C 2JEIA 2ZDIC 3RUPA 1XDNA 3CCQV 3G6YA 3LUTB 3G8DA 4C5AA 2GUZB 2E5LH 3KTMA 1AR5A 3UZOA 5DM6V 1COWG 2HVKC 1I0HA 2HG5C 4UXNA 2M05A 4DV3O 3AG3B 4JI8B 4CS4A 1KJJA 2HHFA 4HZ3A 2Q7EA 4J80A 1IBKO 4ECUA 4ZHQA 4LSAA 2NLJC 4Q45A 3QWUA 4KHPB 2E3CA 5DAAA 5KFLA 4DK1A 5JWPA 2Z3YA 4FPPA 3UZBA 4ASUG 1US6A 4RB2C 3AG7A 1AB3A 1KD1W 5KAFZ 5CAEB 2EIKB 4EB6B 1Q7YW 1S0VA 1HNZO 1S77D 4X64B 1NQTA 1OJHA 1GN4A 3OSPA 2MK3A 1SQQH 2BE3A 4ETSA 4WHXA 4B7EA 4OX9H 2FB5A 5KFVA 1P8LA 5BY1A 2D3OW 2VQEB 2GQSA 5D1PA 1HP8A 2W9BA 5BXZA 3RBZA 5LA6B 1OCCC 4EFBA 5EWEA 3THOA 3FKSG 2E5LB 5J2TF 4F6RA 2HIXA 4A3CG 2AQ4A 1KQSU 4FFPA 1BMFG 3SPIA 4JI3B 2YL2A 2ZQMA 2JEUA 4M9UA 5KX5A 2AHZA 4DV4H 4RB0A 4HNUA 3D3QA 1H8EG 3WG7C 5EZYB 4I7ZB 4HN2A 4A3DG 4LF6B 1SQXH 3K3WA 2EILB 3DC5A 4RZQA 3CRRA 2GLTA 4DV2H 3KCXA 1JIHA 4LF7B 3ZHQA 3WNZA 1GH6A 4GCZA 4YXWG 4LFBB 5FD5A 1D2DA 4JI0O 2J9GA 4X8AA 1KJ8A 3JZIA 3N2KB 1OZ0A 2AXTZ 2UXXA 5LA6F 2F66C 1SQPH 3CS5A 2Y69C 5BZBA 3OHAA 4PI0A 3L71H 1J5EB 5IYZF 1Q6HA 2BSKA 5LYJA 3VQVA 3ABUA 1GMGA 2GSMB 4KL1A 2JGDB 1Q5OA 1K8AW 2FLNA 4WBNA 5KFKA 4O4IA 2RF4A 1XNQB 4DR3B 5KUMA 4FIPC 5KA5A 2YICA 3V4ZA 4DUZB 2ILMA 2P6JA 2GV9A 2C2RA 1Y14B 2A9HA 3F5WC 4PWQA 3T99A 4RB1A 5C8YF 3HKBB 2FKXA 1MMMA 2NN4A 4DV3B 4GKJB 2FK1A 2W9BB 1VARA 2IBKA 2R93G 2X5RA 3PW2A 2YC0A 5B1BC 1SESA 3ZN1A 4O7WA 1EZVH 1JDEA 2I8CA 3OEEG 4PDVA 1H38A 2A06H 4O82A 4DL2A 2WLLA 4GX2A 4MVQA 2R7ZG 3LP8A 5EWFA 5KFZA 5F9LA 4DUYB 5LP6B 3TXQA 1P7BA 1Q43A 1A32A 3ABKB 2HR3A 4K35A 3KYHC 2R8IA 1WB7A 2HG8A 4LFBH 1NH2B 2ZD9A 1I1KA 1FYJA 2OIEA 2HGWA 3OR6C 1OCCB 4MV7A 4EG0A 1NTZH 1T5EA 5FLMG 4GX0A 1SQGA 4L87A 2GPSA 5GONA 3WWHA 2HFEC 4UB8Z 3JALA 4JV5O 3OUSA 2CW8A 3BQ0A 5BYBA 2AU0A 4LBEC 5IY5C 1VF6A 1BQ0A 5LYJF 4YY3H 4LF9O 4O2AF 2DABA 4KFMA 4FLZA 2Q0OC 1XREA 2PUSA 1Y1WA 1NH2D 2LFRA 3BFRA 2AZ2A 5KFGA 4DV1H 5KFIA 3RFRA 3T1CA 4JASA 1VP7A 5EWGA 3ZHSA 3TY5A 1H8HG 4B3MH 1VF5B 3EYYA 2RMKB 1OBDA 3PFFA 4DXWA 5KT7A 4ZIBA 1SF9A 1AR4A 3BHPA 2Z5UA 1VS0A 1JVMA 3ZCCA 4DV5B 2E76B 4YJ3F 4F4ZA 2DPJA 4UCUA 3CRCA 2W9CB 2EIJC 4O4JB 2F4VO 2SCUB 5I5SA 3V4SA 4PA9A 2CFMA 4TVIA 5DG9A 5H6RA 1S5JA 4IZOA 3M9NB 4PA4A 4K3AA 3SDLA 5DN6G 2WLLB 5A2QN 4KHPH 3CCSV 1YDXA 1L8DA 4MVMA 4M7EA 4U7OA 1ZUQA 2CTRA 4X64O 4A3KG 3WB2A 2ALZA 2IW5A 2YIAA 2CTPA 1WR2A 1YEWA 2W6MA 4DRFA 1BXRA 1XMQH 1OCOB 4CZZA 5FPRA 2XAJA 1Z2PX 3QZ8A 5LMNH 1BNCA 4RQEA 2Q6AA 4X62H 2ZDIA 1PP9H 4X20B 5ITZA 1FJGB 4Q8EA 4ED6A 4L1KA 3MAQA 1HR0H 2UVRA 3K03A 2JEGA 4P9PA 4IL6Z 1RPOA 1K4CC 1O9GA 5JVDF 1NR1A 5LGTA 2FPGB 1K7DA 3RYCA 4DV1B 3T54A 4PZ6A 1H2LA 4NB5A 4JI2H 2VUMA 3HB9A 2E74B 4DUYO 3OUFA 4FFMA 1VQ9V 4QSHA 1E4GT 2IMWP 1G8MA 5LMNO 4J7KA 2WLIB 4O2BA 3O65A 4F6RB 5KFHA 2HJWA 2QE7G 3FB6C 4DR4H 3G4SV 2VOBA 1B33N 1XDCA 3H4DA 4I50F 2ATKC 4O7SA 3M7MX 3ASOB 2FB9A 1EYZA 4BW9A 5IYBO 2H3OA 1GTOA 3AYHB 4U7NA 5EZYA 1HNWB 2QYZA 2L35A 1WP8A 2R70A 5B66Z 5KFRA 1NVPD 3QTCA 1G2WA 2FYUH 2ZIOA 3RYFA 1A0IA 2XTAA 5KMGA 2YW2A 4DW1A 4JI3H 2YSUB 2QWOB 3UT5A 4LSXA 4DV6O 4NXMB 4FLXA 4H13B 4JTAB 3BAAA 3A8TA 2COIA 2Z02A 3GB7C 4I4TB 4YR2A 3BVOA 2YS7A 4EEYA 2R93A 1KB9F 5C1PA 2CE4A 5J2UF 4AQYH 4ZI7A 5IYDO 4GYCB 4O4JF 3QF7A 4FM1A 3F7VC 3GIMA 4AHCA 1I5XA 2PMZE 1NJIW 3BJYA 1OCZC 2WLIA 4UCTA 5EC2C 1VQ4V 4PDMA 3WO1A 3GIDA 1VQKV 4FVMA 2C2DA 2R7MA 2A0LA 3K0DA 3OSNA 3J7AK 1O75A 4A3JG 3E2EA 1KMIZ 1B04A 1I94H 3TIGA 4A2BA 3PW7A 1TWGA 2VPSA 4YHHB 2Q0AA 3KHRA 4EB6A 5K1PA 2RQ6A 1F23A 4DR4O 4P2ZA 1S5LZ 1SQBH 2R82A 4OX9O 2Y0SE 4J0MA 3JSNA 2KG7B 2OT5A 2ZT9B 3CEIA 1JR9A 3IFXA 5GTHZ 5KX5B 4JI2O 5CR5A 5H80A 4CKEA 5IYZA 3F7YC 1HNZH 5I60A 4DR5B 3B40A 4FM2A 2FK2A 5LA6A 4WFAV 2FLLA 2F4VH 1SA0A 2ZM6B 1IURA 3FYEB 1KBLA 3SJCC 1XK5A 1KKDA 3MDSA 2UUBO 1SFOA 4JV0A 4NXNH 4O4LF 4EGQA 5T14A 1K5QA 3JAWA 2FMAA 4ECVA 4AQYO 5GONB 1IBMH 2BR0A 4PA6A 3MWMA 3HOVG 3W1BA 4FFKA 1G6UA 1BHAA 3OFNG 4YR0A 4Q4DA 3OE7G 4C2MA 3DTGA 1XHXA 3OTOO 1AP5A 3H1KH 4RWUA 3X2QC 4DV7O 1GGOA 1IX9A 1JJ2U 3GTQA 5BWRA 4LF4H 3SYOA 4BY1G 4FLYA 3RAXA 2EZPA 4YAKB 1XNRH 5KFXA 1SERA 3P32A 1AP6A 5IYCO 1KU9A 1KUTA 2QEXV 2DWCA 1V55B 3M9OB 5KG5A 1EZJA 5CN0A 3SYQA 3JD3A 3JSLA 3EPGA 1IBKH 4LF8O 2JGDA 1OCRC 5KFQA 1N56A 3PR5B 1A3GA 2XAQA 3ETEA 5JH7B 1FPOA 3M99B 2VRZA 3W7TA 4PZ7A 2GDSA 3RN4A 2WLKA 4O4JA 4YHHH 3APQA 4ECSA 3E35A 3RVYA 1IBLH 4J7JA 3T4ZA 2HVQA 4DIMA 2NVYA 3N40P 4B3SO 1V54C 4Q43A 5EBWC 4A3IG 4TQDA 2JA5A 5BYAA 4ZOLF 3T1HO 2WA3A 3MHSC 4B3RO 1A0GA 1C3OA 2CKZB 3GIIA 4BXXG 4L8JA 5CA0F 2IP4A 3G6EV 2IJKA 3S3XA 4X65H 1I2KA 4C5CA 3HO8A 3TY9A 1WCMA 2JIZG 5J9PC 2W6PA 3DTUB 4JTCB 4WFFA 4QNHB 2R7NA 1L2ZA 1URFA 1YVWA 2PY5A 4LF7O 2VQDA 1XL6A 3JASB 4LFBO 5L1KA 3O9OA 3JCUZ 2C35B 4J9NA 1XMQO 1IXBA 1RJRA 3K58A 1AILA 5LP6A 1WNSA 3ABLB 3KALA 1ZL8A 1NTMH 4JI6H 4PDRA 4MTOA 1NR7A 1M7JA 3Q8RB 4CKBA 1GO3E 4G2KA 1S68A 2HHHO 3H1LH 3MD0A 3AX6A 3CMEV 3ABLC 1D5AA 5CBGA 1WCMG 4IT5A 3ASOC 4HQ6A 4FBUA 1HR0B 4DR3O 2YEVA 4EKWA 3CRAA 1TUBA 4QIWF 3OTOH 4MTDA 3CCUV 1SETA 4R50A 5D1OB 4FM9A 3E86A 3WWIA 4I55A 1G4YB 2JK5C 2R9AA 4BWSC 3U9SA 4X65B 5LP6F 2IU3A 2QDOA 2C00A 5K2MA 2XC9A 4DUZO 5F2VO 3HXLA 4DL7A 4NZMA 1I7FA 1OCOC 1VEWA 2B1GA 5JQGF 4O3OA 3GTLA 1GKFA 1R9TA 2HVSA 4LR3A 4J9ZB 4JXUA 1PNLA 4DAAA 5J2UB 3MWDA 3VPDA 4N21A 3ZHTA 1DV2A 4H33A 4TV8A 4B3RH 3HBLA 2XIGA 4PI2A 3NUAA 4O2AA 4DL6A 2EULA 1N34O 3JZFA 4E2LA 3T5KA 1GN3A 3OGIB 1E4EA 3BRCA 2ZIMA 2FPIB 3ZS8C 1OCRB 3VQYA 3N2GB 4JI8O 2A79B 3CHXA 4I55F 1WLEA 2ZR2A 4X20A 5EIBC 5ITZB 1JKJB 3G6VA 4JGSA 5TISZ 5L3DA 2Q8VA 3K57A 2HHFB 1K4DC 3T5LA 2UXCB 1U96A 1JX4A 5DLGA 3P30A 4IR1A 1W59A 3QNEA 1YXBA 3PN1A 4J41A 4X66O 3CD6V 2R86A 1RYSA 1N34H 3AG1C 4J9KA 4BY7G 1YF2A 2V58A 3BA8A 3RB6A 2YS6A 1IXMA 3RGBA 3ETGA 5JQGA 3WG7B 4UCSA 3L73H 2W6IG 2QWRB 1ORQC 3EVKA 3HKCA 5BR8O 1B06A 1Y76A 2EILC 1XEQA 2F93B 1ZX3A 2VUGA 2RGVA 3RAQA 1FD9A 2J6SA 2JRIA 5BMVF 2M7WA 5FPOA 3HR0A 2JDIG 4FFOA 3H40A 2WLHA 3D8CA 2WLNA 5LOVB 5BR8H 2IJHA 4EBEA 4R8UA 2ASDA 3LDEA 1OBGA 4JZ2A 1MZFA 1VQ7V 1RK5A 2N05A 2VA3A 3W5OA 3LSQA 4FFNA 2V4RA 2C2AA 5LL6b 2R9RB 4A3LG 4MW8A 2EJ7A 5IP7G 4UCRA 1VQ8V 4EEQA 1SRYA 5JJEB 1OCZB 2QJ1A 5KFNA 2ADQB 4FS2A 4EGJA 2HKOA 2A3QA 5I5WA 4JI0H 3K5OA 4XYMB 4FBTA 3ZRXA 2YUAA 4CH4A 4DUYH 5H9CA 1MNGA 3UT5B 1XBLA 2JEFA 1S97A 5BMVA 4ICGA 3K06A 4RUFA 1XNQH 4LWSA 2UU9H 1KP3A 5LMUB 2HHHB 2WWWA 3SPJA 1Q6IA 3H9VA 4PDBA 1Y67A 2QKCA 5C93A 3S24A 2EZOA 1YCIA 1V4YA 5DISC 1BE3H 1MABG 1N33H 2ZM6H 3OMAB 1M0WA 5JH7A 4JPRA 5IY5B 3JAMW 5LOVA 1N34B 1IDSA 1TUBB 2P4VA 2NU9B 4WCEV 5DGAA 5KFEA 5KFDA 4YY3B 3ZMVA 4QIWA 2RJZA 5DQIA 4FZ0A 1SKVA 4PA3A 3A0RA 3STLC 3H20A 2CTWA 5H6QA 5FNVF 2Y69B 4WBNB 2OTLV 3T5HA 2O03A 2GBOA 4NZNA 1S10A 3I4NG 3T9DA 1S5HC 5C8YB 2Q5ZA 2PTMA 4O3RA 4Q4CA 5BPFA 3HKEA 5EK0A 3E22A 2CZGA 1ZAUA 2Q7GA 3ABMC 5CA1F 3GJXB 2E2HA 4FE2A 2Q2TA 1QVGU 1YI2V 1I08A 1F4MA 2OYQA 1JCHA 3WFVA 1SZXA 1ULZA 2HEPA 4J9SA 4ZQIA 3E8GA 4U3FH 3HKZE 2UXDH 5IT9W 3JD1A 5L9XA 3SYAA 2BTOA 4H37A 2R6FA 3VMMA 3VOUA 4IRCA 1R3KC 1RM1B 1RYRA 2GUZA 4B3SB 1N33B 2AHYA 1GYFA 5B1BB 1IBMO 2R7KA 4AILC 3VOTA 4DR1B 5FNVB 2W9AA 3KKYA 3W7XA 4DW0A 5IWAB 2E2IA 4MVSA 4DR2B 3AG2B 4IR9A 1HNXB 2LGQA 4RNOA 2HP8A 1P4RA 3RGZA 2BOCC 4CH5A 3RYCB 4UCVA 3CB2A 3KCYA 2PI4A 3HOYG 5CB4F 2QSAA 1WPBA 2VWKA 5JQGB 2UXCO 3CVZA 4ZBMA 3BCCH 4F4WA 4IHJB 3F8NA 1N36H 4ECZA 4G27B 4Q20A 3U11A 3JYCA 4KXRA 4CHIA 4UVAA 1AI7A 3E22B 3HT5A 3JARB 2RDCA 4DV2O 1QR9A 1UFIA 5EC1C 4LF4B 1BZKA 1K1QA 4LMYA 2XGPA 2O57A 4TSFG 3ZIAG 4LF8B 5J2UA 4B08A 4LF7H 4LCUC 5LGNA 4DLKA 1I2LA 1W93A 3N8DA 4FFBB 4FFRA 3ZRWB 5H2FZ 4NTYA 5KKNB 1TWCA 4B3TO 2ZM6O 1GAXA 3TW6A 3FB8C 1Q90D 1VQPV 3CP1A 3GWOA 3VQWA 2XHBA 4NVPA 1XI1A 5IJ0B 5L1LA 2GTSA 2VQFO 2WAQE 1N48A 3GTGA 2BQ3A 3K3VA 3GB8B 4X62B 5FD6A 3BG5A 1UPGA 3FD9A 1JX9A 1Z5WA 1SCUB 2G38A 2VS0A 2FP4B 4JI5H 1XOUA 3CPWU 4X1KB 3U54A 2ADPA 4A5UB 5BMVB 5L1JA 4JYCA 5D1OA 1EN6A 3TW7A 5JVLA 3NC0B 2KSDA 4O83A 2XASA 4OGQB 5EBMC 3ORRA 3APOA 2DQ3A 1VBHA 3G67A 3T1YO 4B3TH 3K04A 3UFXB 2P0AA 4HAMA 5I5XA 4BIUA 5JVDA 4HBNA 3K5LA 1GO3F 4O7RA 2CDYA 2KKWA 2ZE7A 4WFGA 2WDTA 5CBHA 4GX5A 3K9SA 4NKGB 2R8GA 4UVCA 3ICXA 4YJ3B 4CC6A 3PW5A 4PD4F 2W6NA 1OV9A 3K3PA 4O2BB 2UUCB 3AG2C 4KP4A 1PM9A 4NXNO 1GSOA 2ODMA 4QE9A 2R7LA 3JAKA 1XQ8A 2FPPB 3GLKA 2DYRB 1RJPA 1AJNA 4ZOLA 3K08A 3Q8QB 2VA2A 1YJ9V 3JAWB 2Z0AA 5DLFA 5L3CA 1ZWIC 4TV8B 5IJ0A 1J95A 1WP7A 5KUKA 3MJFA 2FKLA 2LGWA 2X6AA 4XDJA 4ME6A 1KT8A 3UO3A 2ZE5A 2LJ2A 5L3EA 5IT9N 2COJA 4AYBE 2A1HA 3TY8A 1J5EH 3RYHA 2CNUA 1AN7A 2JS5A 2Z04A 1VIBA 4Z1MG 2UXBH 1RPRA 4X1KA 2R84A 5I47A 1P84F 1P16A 1I94O 4TUYA 4MTFA 1S3JA 3G6XA 3SPHA 3B8MA 1VAJA 5KAIZ 3GVMA 1OWTA 2ITDC 1BGWA 3N43B 2KSWA 3GV8B 1PK8A 3H3VH 3I55V 4R8UB 4GKJH 2CW7A 1HWYA 4UV8A 4BR6A 1H2GA 3TETA 3EPIA 3PW0A 2JEXA 2DZDA 5DGIA 4RUAA 4XBFA 4MTXA 1E79G 3CC2V 1QHTA 1K3EA 2W6JG 1TAEA 1P7GA 2W9CA 3SPGA 2ZDQA 1FJGH 3BQ2A 4BBSG 4FMTA 2YXLA 2HHHH 3R65A 1WB8A 4YY3O 2VQFB 1MSDA 3AG4C 4D7SA 5KFTA 2WTFA 1CEZA 3ZMUA 1UC9A 3NBZB 3J80N 4CC5A 3B4SA 4DV7B 1B6SA 1I7NA 3CSWA 4O4LA 1QQCA 5HBRB 1S9FA 4BBRG 2LW1A 3ZBHA 4J9MA 2I80A 1GSHA 1Y66A 2JA7A 3NGDA 4DV5H 2FL4A 3W7WA 3FDSA 1CXZB 4CE5A 4QWDA 1AROP 4JI8H 2OWOA 3FKIG 3N44B 2DWEC 5DEDA 1AJPA 2WAMA 3J7AU 2EIJB 1GM9A 2JJ2G 4BAYA 3RWRD 1R3LC 4H0LB 3JARA 5DG7A 2W71A 1F7YA 3VNNA 4CKCA 4WBNF 2Q9LA 2N74A 4P30A 1RK6A 2LFSA 3QO5A 3VA7A 5JVDB 1FFTB 5IJ9B 4DRXA 1MA1A 4JI5O 2W7OA 3BACA 2W6ZA 3C0FB 3IN5A 1ZQ7A 3KZIZ 4P9OA 1NS1A 5DGBA 5KT4A 4YJ3A 2P4KA 3M8AA 3MWEA 4JI7H 1KJ9A 3DXRA 1FS0G 3Q4HA 1CS0A 3NXSA 2QKAA 4HNAA 4MV3A 2JEJA 1ZHQA 1FVIA 1I1MA 3JATA 5EBLC 4IWXA 1QLEB 4DQNA 5B3SC 5IE9A 4HNTA 5KFSA 4O4LB 1CKNB 5CBFA 4Z2WA 5C1OA 4JI6O 5AG2A 4ED3A 2PI5A 3JZ6A 1DF5A 3MR5A 3OHBA 4DV7H 2Q69A 4X1IA 5LMNB 3I4MG 3IC7A 3CWBH 3GTPA 4IGGA 4FJCC 2DOSA 5KG1A 4X9QA 2ZNJA 2I87A 3ZN0A 1YTFB 4IYIA 4JYAO 4KUMA 4NYKA 5LHIA 3GILA 2PMZA 2C22A 1ROPA 4MV8A 1JQ0A 3KAJA 3RGXA 4ZI7B 1ZHSA 2EIYA 1TWHA 3RTXA 4DO2A 1HNXH 2QB5A 4DR7B 4UB6Z 2IJIA 3K9AA 3GTJA 4UV9A 3AG4B 2UUBB 1H2KA 1ZL8B 2CNVA 2PN1A 3R66A 2ABJA 5KFMA 3B2EE 1M56C 4RU9A 3L74H 1EN5A 1IBLO 1WPXA 1HNXO 3JD0A 3T9FA 4A3FG 3SI8A 4B3SH 3CC7V 3IAYA 2P22C 2N04A 3SJBC 3LMLA 1T94A 3ABTA 4O4IB 4FFBA 5EYPB 1IOVA 3ZJZA 5D8DA 5IJ9A 4ECXA 2FMLA 4JAAA 2YCHA 5KLVH 2XCPA 1SQFA 3HKBA 1U97A 2RNBA 4DR6B 5IYZB 4MV1A 3BQ1A 4W4LA 2XGQA 2UXDB 4WFHA 1K97A 2COGA 3V6JA 4K0KO 5CA0B 3MR2A 4A3MG 1SA0B 2EIMC 4MS2A 3T7AA 1E4EB 2OH2A 1DGSA 1FXVA 4LP8A 4J10A 4GKKH 2RDIA 4YJ2B 1D5NA 2K1EA 4JV5B 3MFIA 1KTAA 2Q2UA 4O3QA 2QR4A 3P3PA 3HPLC 1AI4A 1PX2A 2GHYA 1SQVH 2EIMB 5GTIZ 3SPCA 4DV6B 2YIDA 4NXMO 2UUAH 3V6KA 1NI8A 4MVZA 2B63A 1UJWB 2ZKOA 3R5XA 3T9BA 4BW5A 2W0XA 2QTSA 4ED2A 2RGRA 5KT5A 4QW9A 2IBZH 2HVRA 4DR5H 5D5QA 2NU7B 2WB1A 1N33O 2RDJA 4UFZA 1RSOB 5LP6C 1KJQA 3CEBA 4AYBA 1NU1H 4NR1A 3R9RA 1CE8A 1LUVA 4A3BG 4LF9H 5CE8A 2AZ0A 5J2TA 4D7TA 4FM0A 3FFQA 3ASNC 4X66H 3BPZA 1MZBA 4OX9B 1JLLB 5LMUH 3OT7A 3UCSC 2ODTX 4GT1A 2V1DA 5BWXA 5EDWA 2J6TA 3A0HZ 4O2BF 1M56B 1S0OA 2P7TC 4DV0B 1TWFA 4YJ2A 3DAAA 2PVPA 5L3GA 4ABMA 1Y4MA 2QM4A 3ORQA 1WSCA 2LO1A 4F6EA 3PO3G 1SS3A 2VPQA 1PKXA 5HFMA 1KC8W 4TV8F 1PNMA 2YIBD 3TCUA 2JGUA 4AQYB 4DR7O 3WWJA 5K3WA 4I4TA 3AEIA 4GUNA 3H01A 4F4LA 4CBCA 4JI1H 4UVBA 2PGGA 4R7RA 4OXSA 3OTOB 5DG8A 4HYKA 1PL4A 2DW4A 1K73W 4ZI7F 3JAMN 4DR1H 3NR7A 1QR8A 1Y1WG 5J2TB 2WYOA 5LGUA 5I5TA 3RBDA 2YXHA 2R9IA 4O7NA 5KG0A 4YQWA 3N6XA 4CS2A 1PD3A 2DN9A 1BHBA 4JI6B 4J7ZA 5IP9G 4GKKO 4NTXA 4YJ2F 2X6CA 1B3QA 3FYIB 4QGPA 1VKZA 1N32O 3T1YB 4MT8A 2PBZA 2YZNA 1TGOA 4F4YA 3L4KA 5LXTF 1KBHA 5KFWA 5BPHA 2NU6B 4TOIA 2F4VB 3E8BA 1FFXB 2WAQA 3ZRSA 3PZPA 3UO2A 3MR3A 5KHGA 1Y6XA 2Q7HA 5EYPA 2VR1A 1HDJA 4DV3H 4YIPA 3JD2A 1JFFB 1J5EO 3TGUH 3QO8A 1S76D 4UCOA 3HKEB 5B1NA 4O84A 1QBZA 2BOBC 4EFEA 3GV7B 4ECTA 1AI6A 1M57B 4JYYA 4XZ3B 5BWVA 1VQNV 3T1HH 5KX5F 1XMOH 1R6TA 1HR0O 5K1XA 3N41B 1JJOA 1K5SA 1FJGO 4B3RB 1XHZA 2F23A 3HKDA 2YWVA 4J9YB 3DF7A 3H0GG 4O86A 4QWCA 2WPDG 3VPBA 4ECQA 1CKMA 1EKFA 2C2EA 2QK4A 4TT3G 2ASJA 4LFCB 1GM7A 1OHHG 4FLVA 4O7LA 1UNNC 1Z2NX 1TVKA 3EXAA 4O4HF 2Q4PA 1PPJH 4J9QA 2CUGA 3JALB 2Y0PA 1QCEA 4NLGA 5GW7A 4TV9A 3OAAG 1BQZA 4J9OA 1AUVA 1IZ3A 3Q2OA 2CTQA 1DTOA 2ZE6A 3PR4A 1I50A 1Y1VG 1W0JG 4O3PA 3CYOA 4O7ZA 2JA7G 3RF2A 1EFRG 4QE7A 2W6QA 3G80A 4MAMA 5LBQA 3ETJA 1XL4A 1VMGA 3I12A 4MSWC 3VQXA 5IYBG 3L9DA 5HNEA 4JI1B 1LNQA 4QPKA 1ZLZA 2JA8G 1W2BU 2EJRA 1WA8B 2BTQB 3RV4A 1BCCH 4GZRB 4PDLA 3JD4A 4YP3A 1SYXB 3K79A 4A3GG 2FK3A 1CKNA 1BS3A 3HB3B 3G6BA 1N0NA 2E75B 3PJSK 3GDEA 4TM5A 3J81W 1Q82W 5LMUO 3CCEV 1X9NA 3Q1KA 4DV1O 3MR6A 3I56V 5KFFA 1LUWA 4PBCA 4LH7A 3R5HA 3IC9A 2JA6A 2YDEA 1CP9A 3JATB 1Q81W 5EIBD 4OPHA 3E89A 3TQTA 5JJJB 2CH7A 3RYIA 1MOFA 2X0SA 4FLTA 3GIKA 5FLXW 4R8CA 2Q7DA 5KFBA 1H2SB 4DL5A 2D2CB 1WN7A 2CNQA 2C28A 4X66B 1X59A 4CS3A 3RYHB 4DK0A 4LF5H 3T2MA 3AW8A 4ZHQB 5E79Z 1Q6UA 3CE2A 2M6YA 4UUGA 1W0KG 4YAJB 4TUYB 4LWSB 3GIPA 2DYRC 1TUEB 3WU2Z 4ED0A 2P06A 4I50A 1XNRO 3GV5B 4I55B 3Q8PB 3A2FA 2JJ1G 5DECA 1X4TA 1B6RA 2VUMG 1THZA 5IWAH 3OTFA 3TK1A 1EUCB 5L1IA 5KHIA 2V9WA 4EQ5A 3AK1A 2DJVA 3ZHVA 2GQRA 2XOKG 4K8ZA 2BQRA 4FZ1A 1S0MA 5JCOA 2DE0X 1CKOA 4LF6H 4CMDA 2OCHA 2ASLA 1KJIA 1MSWD 5KA6A 2UUAB 4MV4A 1EZ1A 4GKJO 2YU9A 3STZC 4IIJB 5C8YA 2WB1E 3SYCA 1CQIB 1BSMA 4J9PA 2ZGIA 3CC4V 3T9EA 4JYBA 4J9LA 1V55C 3OEHG 3KXYT 3E5NA 3RV3A 3DC6A 2ZDGA 4N23A 4PA7A 5KHJA 3A0BZ 4MVOA 2VQFH 1R3JC 5EZYF 3ZMTA 2QWQB 1Z5VA 5JJNB 1EUDB 1YSCA 3M4IA 3BA9A 1E4FT 2F95B 3L2PA 4WFEA 2UVWA 2EX3A 5B1AC 4BWAA 2L6LA 2UXBO 4GLXA 2LW7A 1I1LA 5LOVF 3U55A 4QWAA 4CH6A 2CH7B 3RYIB 1K34A 5KT2A 1DK1A 4I50B 1RFYA 3HOXG 3CRMA 4O4HA 4JUZA 1KKCA 5JQWA 3ABKC 5FNVA 4DV0H 3QQMA 3SE7A 1N36O 1XUQA 2CQYA 4TV9B 2MCTA 4X65O 3LNMB 4F4XA 2YRXA 3ABMB 2BSKB 3ASNB 4FLWA 4MV9A 1EN4A 1WRVA 3H4BA 5C44G 2LQTA 2CAZC 3OM3B 1DIKA 4RB3C 2R92G 3K59A 5CMUA 2DIKA 4RAIA 3RR5A 1M57C 1F4NA 2LP7A 4X62O 3J81N 3OUZA 4LC1A 3T1HB 4DL3A 4Q8FA 5KFYA 5LHGA 1L0NH 3GTKA 2UU9B 1AJQA 5HV6A 1K83A 4EBCA 1RP3B 3OMIB 3H1JH 4DR6O 2R92A 3FX7A 4JI0B 4NTWA 4X1YB 4LF8H 3QVNA 3QZ7A 1KYOF 1KUQA 5I5YA 2W7PA 1XMQB 1B6QA 1YTFD 4DYLA 2PF4E 5KHHA 4Q0YA 3CMAV 1EHIA 4FU0A 3GQCA 1HW7A 4PELA 4ZKIA 3AK2A 3EFFK 2WLMA 1RJQA 4K0KH 1YZBA 1BGYH 4LFAB 2R87A 2WA4A 4RQFA 4APMA 1EM1A 4LNUB 5CB4A 4PHZA 3U9TA 4UUJC 2ATLA 4DR1O 1YITV 2NVXA 4JV2A 1I6UA 1FXKB 2IM9A 4DR2O 3K0GA 1GSAA 4R7CA 5BR8B 4BIZA 1BJTA 3L72H 2CGNA 2HLDG 4U3JB 2NR5A 4RCNA 3B77A 1Z2OX 4FLUA 4JI7B 2DPIA 3ETQA 5IWAO 1AUXA 3C90A 3SYPA 1FXKC 3W1GA 2Y0SA 1JMKC 1XMOO 5KFCA 1UC8A 1F51A 2IJJA 4RUCA 1V9PA 3WO0A 1T36A 1O9HA 3ZMZA 4DL4A 3K5HA 3T9CA 2YZMA 4O4IF 1GN6A 4RNNA 4IIJF 3ETDA 2XAHA 3ZX6A 5DQHA 2VQEH 4LF5O 3SJAC 1M4UA 2CK3G 4DV0O 2UUAO 5L3FA 2W6OA 1V51A 3R23A 4LFAH 4QPJA 1M9NA 2W8LA 3KG2A 2Y0IA 4FS1A 5HFLA 4TV9F 2IH1C 4RUEA 3CXCU 3HKDB 2JVDA 3GIJA 4QJFB 3J80W 3EHBB 1I94B 1K1SA 1N36B 1I5YA 1JFFA 2UVUA 5LXTA 2UUCO 2XD4A 2B1IA 1R1BA 2KG7A 3BY6A 3T4DA 1XNRB 3LSSA 5KG7A 2MW2B 5B3SB 4TUYF 1SC5B 4IAJA 1ZSPA 4U3JA 5JH7F 5FL7G 3JASA 1HNWO 1BL8A 4LFCH 1G1XB 5B5EZ 5KFOA 5DGHA 1PNKA 3IGAC 4B3MO 3L75H 3M9MB 1BT8A 1N4CA 3FMAA 5JCOC 2R7ZA 5KG2A 4MW3A 2HIVA 2DQ0A 4I9WA 4LF6O 4NXMH 1Q86W 4Q6GA 1NBMG 2JA6G 4I0XB 5IDJA 3FAVA 4K6NA 3LDDA 2W57A 3DTFA 1M93A 3K5MA 4JI4B 1RM1C 2UXBB 4EBDA 4TWKA 1E1QG 4EYHB 2PYLA 2QTOA 4DR7H 4PZ8A 2Q73A 2DYSB 5BWWA 3G71V 3TJTA 5E25A 4RAZA 4ED7A 1R6KA 5KG6A 5KHKA 5A2QW 1M6VA 2OLSA 4Q44A 3LDCA 3ETHA 4JV5H 4MA5A 3RJ0A 2UVVA 3MFHA 3CJHA 3H1IH 4DR4B 3ZRWA 5KS8A 3AK3A 3PO2G 1LR1A 4WF9V 2QA4V 4O7TA 1P49A 3GTOA 3TQ1A 1WA8A 2JS3A 2ITCC 3TINA 3IG0A 5GONF 3JRWA 1A9XA 1MZEA 3BEHA 3WB0A 1K33A 1K9MW 3E8HA 1PL0A 3IJ4A 2DAAA 2PYJA 2X7RB 4XYLB 2NU8B 1N8RW 5E1AC 2V59A 1R6NA 3NBYB 4QJFA 3N27A 1EKVA 4YR3A 4JI2B 5CA3A 5DQGA 1DF4A 3N2GA 3SR2C 4EYIB 2ZJTA 2AGPA 2R8KA 4DR5O 4X88A 4ED1A 3RYFB 2IA6A 4LNUA 5CA0A 5CB4B 3R5FA 2ZR3A 1S72V 3CRQA 2DWDC 3VBBA 1YIJV 4DR2H 3T9AA 3SGIA 5LHHA 5KFPA 4HYOA 5BWUA 1H2NA 1WAZA 1ENVA 2QM7A 2FLPA 2DMXA 3HOUG 4W4KA 3KHLA 1I3QA 1HNWH 4O81A 4DR3H 1S0NA 4TQRA 4I0XA 4RNMA 1ZETA 3K5NA 1L0LH 2YI8A 5F9NA 2F43G 3BABA 1QLEC 3I5DA 4OPAA 2GPWA 1IYEA 4GC7A 4JI4H 1Y74A 4IIJA 2JA5G 1E1RG 4J42A 3S3WA 3UKMA 4DRXB 2RN9A 2XCAA 3K5IA 2AGOA 3C3TA 4JI7O 3CXHF 2DYSC 3N42B 4BIOA 3ZHRA 4WD3A 2HDKA 3HKCB 4U7CA 4JI1O 3OD4A 2AW9A 3GWKC 4J11A 2YS8A 3Q4HB 5BWTA 4PJ0Z 1IVSA 2EJ0A 5DMXA 2UU9O 2QGNA 1NT2B 3Q8SB 1N0JA 1FXKA 2HJDA 4YBZB 2H94A 1Y1VA 3LULA 4C7UA 1NKDA 1A48A 3KHHA 4PV1B 2BCCH 4X1IB 3U0GA 3AG1B 2YYAA 1JOYA 3JRXA 1L1FA 1QVFU 1IYDA 2Y4UA 3G8CA 4X64H 4YIOA 4JF3A 1XILA 1N32B 5A9GA 4Z1VA 2V5AA 4JI4O 1V54B 3FAVB 2ZE8A 1EBOA 2ZCEA 1DV1A 2ARHA 4MV6A 3H0GA 5KG3A 5IYDG 2ETNA 2W8KA 4MTGA 3U0ZA 4IWYA 1FFXA 5CA1A 4WFBV 1VF7A 3OR7C 1IBMB 2ZXWC 4YB8B 1VQ5V 3ZMSA 1CQJB 3ML0A 3AG3C 4O7YA 4MTEA 1T3NA 3CCVV 1R73A 2FJZA 2WE6A 4ECYA 5B1OA 1VF6C 4CH3A 4RO2A 3JAKB 3L70H 2Y4RA 4ED8A 4JI3O 1FAFA 3X2QB 2EJ3A 1XMOB 3RB0A 1QNMA 3H1HH 3RW0A 1KP2A 2XUMA 4DV6H 1KC7A 5I5VA 3B09A 1CPYA 1AVMA 1GK9A 1GM8A 3LWBA 3VPCA 4CMFA 1AR1B 5KFJA 2Q67A 4K0KB 2HJFC 2H8PC 2W0FC 4X1YA 1IBKB 5FR9A 2HGXA 3ZRVA 2B63G 1KECA 4G28B 3KREA 3HKZA 1VBGA 5CM0A 4ECWA 2GTAA 4JZGA 4LFAO 3C3SA 1SZTA 2EJ2A 5KG4A 5C5JA 3HOWG 1VQLV 2EBOA
chains in the Genus database with same CATH topology
4JI5H 3GDEA 3J81W 4X1KB 5CA1B 3M7MX 5LYJB 5BMVB 1X9NA 4BW9A 1RSOA 2UXCH 5D1OA 4K8XA 3NC0B 5EOYA 4LH7A 5EZYA 1HNWB 2R70A 2PZSA 3LNNA 2YIBA 4B3TH 3JATB 3QTCA 5EIBD 2ZIOA 3RYFA 1A0IA 5KMGA 5JJJB 3QG5A 3RYIA 4E6NA 4JI3H 3UT5A 4LSXA 5JVDA 5D5PA 4HBNA 3K5LA 4FLTA 5FLXW 4NXMB 4FLXA 2KKWA 1H2SB 3BAAA 4I4TB 1WN7A 4HNAB 2WDTA 4DUZH 3KAKA 4X66B 2YI9A 4CS3A 3RYHB 4DK0A 4LF5H 3ICXA 4YJ3B 4CC6A 2V4DA 4AQYH 4ZHQB 4ZI7A 4GYCB 4LF5B 3QF7A 4FM1A 4AHCA 4O2BB 2UUCB 4TUYB 2P5OA 3ZEDA 4UCTA 4I50A 1FKAH 4I55B 3A2FA 3JAKA 1XQ8A 4FVMA 1X4TA 3J7AK 4ZOLA 1WH2A 1O75A 1KMIZ 5IWAH 4DV2B 1B04A 3JAWB 3OTFA 1I94H 5KHIA 4A2BA 4TV8B 5IJ0A 4EQ5A 2VPSA 4YHHB 2Q0AA 4K8ZA 4EB6A 5JCOA 5K1PA 2RQ6A 1Q8IA 1CKOA 4TQFA 4LF6H 3DSQA 4B3TB 1S03G 2UUAB 2VWJA 1J5EH 4NXNB 3TY8A 4J0MA 3JSNA 4IIJB 5C8YA 3RYHA 5KX5B 3L4JA 4I9QA 1AN7A 2JS5A 5IYZA 1HNZH 2UXBH 3KXYT 4B3MB 4JI5B 4X1KA 4DR5B 5KHJA 4FM2A 5LA6A 1P16A 2VQFH 4TUYA 2F4VH 1SA0A 2ZM6B 5JJNB 1Z5VA 3M4IA 3SJCC 1XK5A 3BA9A 1E4FT 2F95B 3L2PA 4NXNH 1BGWA 2EX3A 4BWAA 3N43B 4GLXA 3JAWA 2KSWA 1HNZB 4GKJH 4CH6A 2CW7A 3RYIB 5GONB 1IBMH 3MWMA 4I50B 3W1BA 1G6UA 4O4HA 4IHJA 5FNVA 4DV0H 1XHXA 1QHTA 4ZOLB 4TV9B 1TAEA 2MCTA 4LF4H 4A2AA 4FLYA 3T1YH 1FJGH 1M5IA 1XNRH 2HGSA 2F1MA 4FLWA 2YXLA 4JYAB 4MV9A 2HHHH 1N32H 2VQFB 3CSXA 3WB1A 2CAZC 4D7SA 4RB3C 1KU9A 3K59A 3RIZA 3RR5A 3JSLA 1IBKH 3NBZB 2FE3A 4CC5A 3T1HB 4DV7B 5JH7B 2UU9B 4O4LA 4PZ7A 1Q3EA 1QQCA 1IBLB 4O4JA 4YHHH 3N2KA 1TVKB 1IBLH 4JI0B 4DV5H 4X1YB 4LF8H 2UUBH 2HVQA 3N40P 4JI8H 2OWOA 3N44B 1XMQB 2ZNIA 5KHHA 4O4HB 4TQDA 4Q0YA 4RAYA 2UUCH 1SEIA 4GKKB 3RWRD 1HW7A 4L8JA 4K0KH 4LFAB 4X65H 3JARA 3VNNA 3TY9A 2ZINA 4APMA 4LNUB 5CB4A 4PHZA 5JVDB 1L2ZA 4DR6H 5IJ9B 4JYAH 2PY5A 1I6UA 4DRXA 2BTQA 2IM9A 3JASB 3K58A 5LP6A 5BR8B 1WNSA 1BJTA 3C0FB 3KALA 4JI7H 4YJ3A 4LH6A 4O2AB 4U3JB 4JI6H 4I7HA 1M0TA 4HNAA 4FLUA 4JI7B 5LXTB 1Z2OX 3ETQA 4LF9B 3W1GA 1TA8A 1ZHQA 1FVIA 1JMKC 3JATA 1S68A 4DV4B 4O4LB 5KMGB 1CKNB 1V9PA 1D5AA 3UQ8A 1O9HA 2R72A 3U10A 1HR0B 3OTOH 1TUBA 1XDNA 4MTDA 4DV7H 5D1OB 4X1IA 5LMNB 4FM9A 4I55A 2E5LH 2VQEH 3SJAC 1M4UA 2R9AA 2ZNJA 4BWSC 4X65B 4LFAH 4JI8B 4CS4A 3HXLA 2Q7EA 3HKDB 1I7FA 2JVDA 3KAJA 4ZHQA 4ZI7B 3RGXA 1ZHSA 4LSAA 1HNXH 3RTXA 3J80W 1I94B 3QWUA 1N36B 4KHPB 1JFFA 4LR3A 2E3CA 4DR7B 2HVSA 5LXTA 4DK1A 5J2UB 4B3RH 4TV8A 2XIGA 1XNRB 4PI2A 2UUBB 4O2AA 4RB2C 3B2EE 4EB6B 4IAJA 4U3JA 3BRCA 2ZIMA 4X64B 3JASA 3N2GB 3VQYA 3ZS8C 4B3SH 3CHXA 3IAYA 4LFCH 2P22C 4X20A 5EIBC 5ITZB 4ETSA 3SJBC 3LMLA 5EYPB 4O4IB 4FFBA 4OX9H 3K57A 1P8LA 2VQEB 2UXCB 5D1PA 5IJ9A 5LA6B 4EFBA 3FMAA 5JCOC 2YCHA 2HIVA 4NXMH 1SQFA 3HKBA 4Q6GA 3THOA 4DR6B 5IYZB 2E5LB 3PN1A 2UXDB 4F6RA 2HIXA 2W57A 1M93A 3K5MA 4JI4B 2UXBB 1N34H 5CA0B 1SA0B 4JI3B 2PYLA 3BA8A 4DR7H 4PZ8A 1DGSA 3RGBA 5KX5A 4GKKH 5JQGA 4UCSA 4YJ2B 4DV4H 4RB0A 4JV5B 4RAZA 2Q2UA 3HKCA 2F93B 5KHKA 5A2QW 5EZYB 2VUGA 2RGVA 4JV5H 4LF6B 3RJ0A 4DV6B 2UUAH 4DR4B 4RZQA 4DV2H 5FPOA 4LF7B 4LFBB 5FD5A 1P49A 2RGRA 5LOVB 5BR8H 3N2KB 3IG0A 2F66C 2HVRA 4DR5H 5D5QA 3WB0A 4PI0A 4UFZA 2PYJA 5LP6C 1J5EB 3W5OA 5LYJA 3VQVA 3NBYB 5LL6b 4LF9H 4JI2B 4KL1A 5J2TA 4D7TA 1Q5OA 4FM0A 3FFQA 4UCRA 4WBNA 4EEQA 4O4IA 3N2GA 3SR2C 4X66H 5JJEB 2ZJTA 1XNQB 3BPZA 1MZBA 3RYFB 2QJ1A 4DR3B 4OX9B 5LMUH 4LNUA 5CA0A 5CB4B 4DUZB 4JI0H 2GV9A 3K5OA 4RB1A 4DR2H 3HKBB 3SGIA 4DV0B 4DUYH 4CH4A 3UT5B 4YJ2A 4DV3B 4GKJB 5BMVA 2QM4A 1XNQH 2UU9H 1HNWH 5LMUB 4DR3H 2HHHB 3K5NA 4PDBA 2YI8A 2YIBD 2JGUA 4AQYB 3S24A 5DISC 3BABA 1N33H 4I4TA 2ZM6H 1M0WA 5JH7A 3JAMW 4DUYB 5LOVA 5LP6B 1N34B 4JI4H 1Q43A 1TUBB 4IIJA 2PGGA 4JI1H 4R7RA 3KYHC 3OTOB 4DRXB 4YY3B 4LFBH 2RJZA 1SKVA 3H20A 3N42B 4WBNB 4DR1H 2O03A 5J2TB 4MV7A 2WYOA 1T5EA 3HKCB 1SQGA 5C8YB 5GONA 3N6XA 2PTMA 4CS2A 3JALA 4JI6B 2CW8A 3HKEA 3E22A 1ZAUA 2Q7GA 3GJXB 2Q2TA 2OYQA 4YY3H 3T1YB 1TGOA 2HEPA 4FLZA 1NT2B 3L4KA 2PUSA 2UXDH 5IT9W 2BTOA 4TOIA 2F4VB 4DV1H 1FFXB 3RFRA 4X1IB 5KHGA 3TY5A 4B3MH 4B3SB 2Q7HA 5EYPA 1N33B 4DV3H 3EYYA 1JFFB 1GYFA 4UCOA 4X64H 4AILC 1N32B 3HKEB 4DR1B 5FNVB 4ZIBA 4EFEA 5IWAB 3BHPA 1VS0A 4DV5B 4DR2B 4UCUA 4O4JB 1HNXB 2ZCEA 3T1HH 2CFMA 3RGZA 3RYCB 4CH5A 1XMOH 4UCVA 5K1XA 3N41B 3CB2A 1JJOA 3U0ZA 1S5JA 4B3RB 1XHZA 1FFXA 3HKDA 1WPBA 2VWKA 5JQGB 3CVZA 5CA1A 4IHJB 3F8NA 1VF7A 1N36H 1IBMB 3DF7A 4KHPH 3U11A 1L8DA 4M7EA 1CKMA 3E22B 3WB2A 4LFCB 4MTEA 4FLVA 2YIAA 3JARB 1YEWA 4LF4B 4DRFA 1Z2NX 2WE6A 4CH3A 4LMYA 1XMQH 3JAKB 1TVKA 5FPRA 4LF8B 1XMOB 1Z2PX 5LMNH 3JALB 5J2UA 4B08A 4LF7H 4X62H 4X20B 4TV9A 5ITZA 1FJGB 4DV6H 3MAQA 4FFBB 1HR0H 4K0KB 1O9GA 4X1YA 3VQWA 2XHBA 1XI1A 4NVPA 1IBKB 5IJ0B 3RF2A 3RYCA 4DV1B 4PZ6A 4JI2H 3K3VA 3VQXA 4X62B 3GB8B 1E4GT 4JI1B 5FD6A 4O2BA 1Z5WA 2BTQB 4F6RB 4DR4H 1SYXB 2VOBA 1CKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GDE A;  4JYA B;  2VQF B;  1X9N A;  4X64 B;  5D1O A;  3NC0 B;  3RR5 A;  4LH7 A;  1HNW B;  3JSL A;  1P8L A;  2VQE B;  2UXC B;  3NBZ B;  5D1P A;  4JI6 B;  4EFB A;  4CC5 A;  3T1H B;  2HIV A;  1ZAU A;  4DV7 B;  2UU9 B;  3GJX B;  2Q2T A;  4DR6 B;  1A0I A;  4PZ7 A;  2E5L B;  3PN1 A;  3T1Y B;  2UXD B;  1IBL B;  4E6N A;  2HIX A;  4NXM B;  2UXB B;  4JI4 B;  3BAA A;  4JI3 B;  4JI0 B;  3BA8 A;  4X66 B;  4PZ8 A;  1DGS A;  4TOI A;  2F4V B;  2HVQ A;  2OWO A;  4CC6 A;  4UCS A;  1XMQ B;  4JV5 B;  3TY5 A;  4B3S B;  2Q2U A;  1N33 B;  4GKK B;  4LF5 B;  2VUG A;  2UUC B;  4LF6 B;  4UCO A;  4LFA B;  1N32 B;  4DR1 B;  4UCT A;  4DV6 B;  4DR4 B;  3TY9 A;  3VNN A;  4EFE A;  5FPO A;  5IWA B;  4LF7 B;  1VS0 A;  4DV5 B;  4LFB B;  4DR2 B;  4UCU A;  4DV2 B;  1B04 A;  1HNX B;  2CFM A;  4EQ5 A;  2HVR A;  4UCV A;  4YHH B;  5BR8 B;  4UFZ A;  4B3R B;  1J5E B;  3W5O A;  4LH6 A;  1CKO A;  3NBY B;  1IBM B;  4JI2 B;  4B3T B;  2UUA B;  4JI7 B;  4NXN B;  3TY8 A;  4UCR A;  1CKM A;  3JSN A;  4EEQ A;  4LF9 B;  3W1G A;  1TA8 A;  1XNQ B;  1FVI A;  4LFC B;  1S68 A;  4DV4 B;  4LF4 B;  4OX9 B;  4DR3 B;  4DRF A;  1CKN B;  1V9P A;  4B3M B;  4JI5 B;  3UQ8 A;  4DUZ B;  5FPR A;  4LF8 B;  4DR5 B;  1XMO B;  1HR0 B;  1P16 A;  1XDN A;  2ZM6 B;  5D1O B;  1FJG B;  5LMN B;  3SGI A;  4DV0 B;  1XK5 A;  3BA9 A;  3L2P A;  4DV3 B;  4GKJ B;  4K0K B;  4GLX A;  4X65 B;  1IBK B;  5LMU B;  1HNZ B;  4DV1 B;  2HHH B;  4JI8 B;  4PZ6 A;  4AQY B;  3W1B A;  3S24 A;  5DIS C;  3BAB A;  3GB8 B;  4X62 B;  1I94 B;  3RTX A;  3QWU A;  1N36 B;  4JI1 B;  4KHP B;  4DR7 B;  2HVS A;  4DUY B;  1N34 B;  1XNR B;  1TAE A;  3KYH C;  2UUB B;  3OTO B;  4YY3 B;  1CKN A; 
#chains in the Genus database with same CATH topology
 5FLX N;  3CX5 F;  3PVX A;  5CA1 B;  4XDK A;  4QWE A;  5LYJ B;  2HVJ C;  3F5T A;  4E4E A;  3ZHU A;  4XX0 B;  4D6T H;  1RSO A;  3LSU A;  2UXC H;  2ZDH A;  4K8X A;  4DV4 O;  2IH3 C;  4JAU A;  4O3N A;  5FJ8 G;  2J6U A;  1I7L A;  2IU0 A;  3LQS A;  4HNV A;  2XND G;  2RCV A;  5EOY A;  4NYE A;  4FFL A;  3UYY A;  2WSS G;  5C4X G;  3SNO A;  4QIW E;  4JAV A;  3TXS A;  3CJH B;  3LNN A;  2PZS A;  2YIB A;  3RVZ A;  2P67 A;  4C5B A;  4IRK A;  1W96 A;  4FGR A;  4MA0 A;  3QG5 A;  2Y4T A;  4E6N A;  1Y74 B;  5D5P A;  3TEK A;  4ECR A;  2B5U A;  3MHH C;  4HNA B;  4DUZ H;  1M1K W;  2AGA A;  3KAK A;  3QFF A;  4F50 A;  2YI9 A;  3CQZ A;  1EKP A;  2V4D A;  2ZXW B;  2YXY A;  4A3E G;  4LF5 B;  1ZTE A;  1VQM V;  1K92 A;  2P5O A;  2UXD O;  3ZED A;  2X6B A;  4QWB A;  1TWA A;  2OCC B;  2QKS A;  1FKA H;  5KFU A;  4B7K A;  1QLN A;  1WH2 A;  2P90 A;  2QM8 A;  4MVR A;  4DV2 B;  4LF4 O;  4HR7 A;  4FK5 C;  1GRJ A;  4GX1 A;  5H5N A;  2OCC C;  2R8H A;  1Q8I A;  4MVU A;  4TQF A;  4R6Z A;  2A7W A;  4RZR A;  2XCL A;  3DSQ A;  4B3T B;  1VQ6 V;  1S03 G;  2VWJ A;  4NXN B;  4AI8 A;  2E5L O;  2CGO A;  3L4J A;  4I9Q A;  2QF7 A;  3RFC A;  4B3M B;  3QO7 A;  2EIN B;  2FTK A;  4JI5 B;  3RBE A;  4JV1 A;  2V4Q A;  4M0J A;  4ZHQ F;  3P3N A;  3OUU A;  3E83 A;  3E8F A;  5KFA A;  1JDB B;  5B1A B;  1JXL A;  1JPX A;  2XT9 A;  3RB3 A;  2EIN C;  1Y76 B;  3V6H A;  1YJN V;  1HNZ B;  4U6P A;  1JA8 A;  3GTM A;  2QWN B;  3CCJ V;  2OIG A;  1R3I C;  4IHJ A;  4I5S A;  2K9P A;  2VQE O;  2OTJ V;  4GLW A;  1NZ6 A;  2UXN A;  3DGE A;  3JCZ A;  4KHP O;  1QU7 A;  1PV0 A;  4J9R A;  4ZOL B;  2AGQ A;  4A2A A;  3D3I A;  2DLN A;  5KT3 A;  3T1Y H;  3FKI A;  1M5I A;  4H44 B;  1FKA O;  2HGS A;  2F1M A;  4XDL A;  3DXR B;  1YJW V;  4JYA B;  5I5U A;  4X89 A;  1N32 H;  3CSX A;  3WB1 A;  4G3I A;  3RIZ A;  1MG1 A;  2EIK C;  3OW2 U;  1M90 W;  4I4T F;  3UM7 A;  1FXH A;  2FE3 A;  1C30 A;  2WLJ A;  3B8N A;  2R85 A;  3KHG A;  4E4T A;  3OMN B;  1Q3E A;  1ET0 A;  1NTK H;  3W7U A;  1IBL B;  4IHJ F;  4LFC O;  1DAA A;  1KEE A;  3RT3 C;  3N2K A;  1TVK B;  3CCM V;  5JUM A;  4A93 G;  2UUB H;  3N6R A;  3RB4 A;  3D36 C;  1VQO V;  4Y8V B;  2X0L A;  2ZNI A;  2R8J A;  2KB1 A;  4O3S A;  5KT6 A;  3T5J A;  4O4H B;  4RAY A;  2UUC H;  3SJQ C;  4GKK B;  1SEI A;  4IRD A;  1H2M A;  2NUA B;  2NNU A;  4O7V A;  4QW8 A;  2B9Z A;  4NZO A;  2XAF A;  3D36 A;  2YZG A;  4DV5 O;  5IYC G;  3HOZ G;  3OGC C;  2ZIN A;  2YZL A;  3GIQ A;  3CCR V;  3TII A;  1DLB A;  1NVP B;  2YEV B;  4IYH A;  3PW4 A;  4DR6 H;  3CCL V;  4YHH O;  4JYA H;  2BTQ A;  1YHQ V;  4TQS A;  1IOW A;  3FB5 C;  2Q68 A;  5L3B A;  1GN2 A;  4LH6 A;  4O2A B;  4JTD B;  2KQX A;  4I7H A;  1M0T A;  1WJZ A;  4GC6 A;  2V7Q G;  5LXT B;  1AI5 A;  4LF9 B;  1TA8 A;  2W70 A;  2Y48 A;  4DV4 B;  1GLV A;  5LL6 Y;  3W7S A;  5KMG B;  2QWP B;  2YRW A;  2BQU A;  3UQ8 A;  1XNQ O;  1Z2G A;  5C3E G;  2R72 A;  3U10 A;  2XAG A;  3FB7 C;  2JEI A;  2ZDI C;  3RUP A;  1XDN A;  3CCQ V;  3G6Y A;  3LUT B;  3G8D A;  4C5A A;  2GUZ B;  2E5L H;  3KTM A;  1AR5 A;  3UZO A;  5DM6 V;  1COW G;  2HVK C;  1I0H A;  2HG5 C;  4UXN A;  2M05 A;  4DV3 O;  3AG3 B;  4JI8 B;  4CS4 A;  1KJJ A;  2HHF A;  4HZ3 A;  2Q7E A;  4J80 A;  1IBK O;  4ECU A;  4ZHQ A;  4LSA A;  2NLJ C;  4Q45 A;  3QWU A;  4KHP B;  2E3C A;  5DAA A;  5KFL A;  4DK1 A;  5JWP A;  2Z3Y A;  4FPP A;  3UZB A;  4ASU G;  1US6 A;  4RB2 C;  3AG7 A;  1AB3 A;  1KD1 W;  5KAF Z;  5CAE B;  2EIK B;  4EB6 B;  1Q7Y W;  1S0V A;  1HNZ O;  1S77 D;  4X64 B;  1NQT A;  1OJH A;  1GN4 A;  3OSP A;  2MK3 A;  1SQQ H;  2BE3 A;  4ETS A;  4WHX A;  4B7E A;  4OX9 H;  2FB5 A;  5KFV A;  1P8L A;  5BY1 A;  2D3O W;  2VQE B;  2GQS A;  5D1P A;  1HP8 A;  2W9B A;  5BXZ A;  3RBZ A;  5LA6 B;  1OCC C;  4EFB A;  5EWE A;  3THO A;  3FKS G;  2E5L B;  5J2T F;  4F6R A;  2HIX A;  4A3C G;  2AQ4 A;  1KQS U;  4FFP A;  1BMF G;  3SPI A;  4JI3 B;  2YL2 A;  2ZQM A;  2JEU A;  4M9U A;  5KX5 A;  2AHZ A;  4DV4 H;  4RB0 A;  4HNU A;  3D3Q A;  1H8E G;  3WG7 C;  5EZY B;  4I7Z B;  4HN2 A;  4A3D G;  4LF6 B;  1SQX H;  3K3W A;  2EIL B;  3DC5 A;  4RZQ A;  3CRR A;  2GLT A;  4DV2 H;  3KCX A;  1JIH A;  4LF7 B;  3ZHQ A;  3WNZ A;  1GH6 A;  4GCZ A;  4YXW G;  4LFB B;  5FD5 A;  1D2D A;  4JI0 O;  2J9G A;  4X8A A;  1KJ8 A;  3JZI A;  3N2K B;  1OZ0 A;  2AXT Z;  2UXX A;  5LA6 F;  2F66 C;  1SQP H;  3CS5 A;  2Y69 C;  5BZB A;  3OHA A;  4PI0 A;  3L71 H;  1J5E B;  5IYZ F;  1Q6H A;  2BSK A;  5LYJ A;  3VQV A;  3ABU A;  1GMG A;  2GSM B;  4KL1 A;  2JGD B;  1Q5O A;  1K8A W;  2FLN A;  4WBN A;  5KFK A;  4O4I A;  2RF4 A;  1XNQ B;  4DR3 B;  5KUM A;  4FIP C;  5KA5 A;  2YIC A;  3V4Z A;  4DUZ B;  2ILM A;  2P6J A;  2GV9 A;  2C2R A;  1Y14 B;  2A9H A;  3F5W C;  4PWQ A;  3T99 A;  4RB1 A;  5C8Y F;  3HKB B;  2FKX A;  1MMM A;  2NN4 A;  4DV3 B;  4GKJ B;  2FK1 A;  2W9B B;  1VAR A;  2IBK A;  2R93 G;  2X5R A;  3PW2 A;  2YC0 A;  5B1B C;  1SES A;  3ZN1 A;  4O7W A;  1EZV H;  1JDE A;  2I8C A;  3OEE G;  4PDV A;  1H38 A;  2A06 H;  4O82 A;  4DL2 A;  2WLL A;  4GX2 A;  4MVQ A;  2R7Z G;  3LP8 A;  5EWF A;  5KFZ A;  5F9L A;  4DUY B;  5LP6 B;  3TXQ A;  1P7B A;  1Q43 A;  1A32 A;  3ABK B;  2HR3 A;  4K35 A;  3KYH C;  2R8I A;  1WB7 A;  2HG8 A;  4LFB H;  1NH2 B;  2ZD9 A;  1I1K A;  1FYJ A;  2OIE A;  2HGW A;  3OR6 C;  1OCC B;  4MV7 A;  4EG0 A;  1NTZ H;  1T5E A;  5FLM G;  4GX0 A;  1SQG A;  4L87 A;  2GPS A;  5GON A;  3WWH A;  2HFE C;  4UB8 Z;  3JAL A;  4JV5 O;  3OUS A;  2CW8 A;  3BQ0 A;  5BYB A;  2AU0 A;  4LBE C;  5IY5 C;  1VF6 A;  1BQ0 A;  5LYJ F;  4YY3 H;  4LF9 O;  4O2A F;  2DAB A;  4KFM A;  4FLZ A;  2Q0O C;  1XRE A;  2PUS A;  1Y1W A;  1NH2 D;  2LFR A;  3BFR A;  2AZ2 A;  5KFG A;  4DV1 H;  5KFI A;  3RFR A;  3T1C A;  4JAS A;  1VP7 A;  5EWG A;  3ZHS A;  3TY5 A;  1H8H G;  4B3M H;  1VF5 B;  3EYY A;  2RMK B;  1OBD A;  3PFF A;  4DXW A;  5KT7 A;  4ZIB A;  1SF9 A;  1AR4 A;  3BHP A;  2Z5U A;  1VS0 A;  1JVM A;  3ZCC A;  4DV5 B;  2E76 B;  4YJ3 F;  4F4Z A;  2DPJ A;  4UCU A;  3CRC A;  2W9C B;  2EIJ C;  4O4J B;  2F4V O;  2SCU B;  5I5S A;  3V4S A;  4PA9 A;  2CFM A;  4TVI A;  5DG9 A;  5H6R A;  1S5J A;  4IZO A;  3M9N B;  4PA4 A;  4K3A A;  3SDL A;  5DN6 G;  2WLL B;  5A2Q N;  4KHP H;  3CCS V;  1YDX A;  1L8D A;  4MVM A;  4M7E A;  4U7O A;  1ZUQ A;  2CTR A;  4X64 O;  4A3K G;  3WB2 A;  2ALZ A;  2IW5 A;  2YIA A;  2CTP A;  1WR2 A;  1YEW A;  2W6M A;  4DRF A;  1BXR A;  1XMQ H;  1OCO B;  4CZZ A;  5FPR A;  2XAJ A;  1Z2P X;  3QZ8 A;  5LMN H;  1BNC A;  4RQE A;  2Q6A A;  4X62 H;  2ZDI A;  1PP9 H;  4X20 B;  5ITZ A;  1FJG B;  4Q8E A;  4ED6 A;  4L1K A;  3MAQ A;  1HR0 H;  2UVR A;  3K03 A;  2JEG A;  4P9P A;  4IL6 Z;  1RPO A;  1K4C C;  1O9G A;  5JVD F;  1NR1 A;  5LGT A;  2FPG B;  1K7D A;  3RYC A;  4DV1 B;  3T54 A;  4PZ6 A;  1H2L A;  4NB5 A;  4JI2 H;  2VUM A;  3HB9 A;  2E74 B;  4DUY O;  3OUF A;  4FFM A;  1VQ9 V;  4QSH A;  1E4G T;  2IMW P;  1G8M A;  5LMN O;  4J7K A;  2WLI B;  4O2B A;  3O65 A;  4F6R B;  5KFH A;  2HJW A;  2QE7 G;  3FB6 C;  4DR4 H;  3G4S V;  2VOB A;  1B33 N;  1XDC A;  3H4D A;  4I50 F;  2ATK C;  4O7S A;  3M7M X;  3ASO B;  2FB9 A;  1EYZ A;  4BW9 A;  5IYB O;  2H3O A;  1GTO A;  3AYH B;  4U7N A;  5EZY A;  1HNW B;  2QYZ A;  2L35 A;  1WP8 A;  2R70 A;  5B66 Z;  5KFR A;  1NVP D;  3QTC A;  1G2W A;  2FYU H;  2ZIO A;  3RYF A;  1A0I A;  2XTA A;  5KMG A;  2YW2 A;  4DW1 A;  4JI3 H;  2YSU B;  2QWO B;  3UT5 A;  4LSX A;  4DV6 O;  4NXM B;  4FLX A;  4H13 B;  4JTA B;  3BAA A;  3A8T A;  2COI A;  2Z02 A;  3GB7 C;  4I4T B;  4YR2 A;  3BVO A;  2YS7 A;  4EEY A;  2R93 A;  1KB9 F;  5C1P A;  2CE4 A;  5J2U F;  4AQY H;  4ZI7 A;  5IYD O;  4GYC B;  4O4J F;  3QF7 A;  4FM1 A;  3F7V C;  3GIM A;  4AHC A;  1I5X A;  2PMZ E;  1NJI W;  3BJY A;  1OCZ C;  2WLI A;  4UCT A;  5EC2 C;  1VQ4 V;  4PDM A;  3WO1 A;  3GID A;  1VQK V;  4FVM A;  2C2D A;  2R7M A;  2A0L A;  3K0D A;  3OSN A;  3J7A K;  1O75 A;  4A3J G;  3E2E A;  1KMI Z;  1B04 A;  1I94 H;  3TIG A;  4A2B A;  3PW7 A;  1TWG A;  2VPS A;  4YHH B;  2Q0A A;  3KHR A;  4EB6 A;  5K1P A;  2RQ6 A;  1F23 A;  4DR4 O;  4P2Z A;  1S5L Z;  1SQB H;  2R82 A;  4OX9 O;  2Y0S E;  4J0M A;  3JSN A;  2KG7 B;  2OT5 A;  2ZT9 B;  3CEI A;  1JR9 A;  3IFX A;  5GTH Z;  5KX5 B;  4JI2 O;  5CR5 A;  5H80 A;  4CKE A;  5IYZ A;  3F7Y C;  1HNZ H;  5I60 A;  4DR5 B;  3B40 A;  4FM2 A;  2FK2 A;  5LA6 A;  4WFA V;  2FLL A;  2F4V H;  1SA0 A;  2ZM6 B;  1IUR A;  3FYE B;  1KBL A;  3SJC C;  1XK5 A;  1KKD A;  3MDS A;  2UUB O;  1SFO A;  4JV0 A;  4NXN H;  4O4L F;  4EGQ A;  5T14 A;  1K5Q A;  3JAW A;  2FMA A;  4ECV A;  4AQY O;  5GON B;  1IBM H;  2BR0 A;  4PA6 A;  3MWM A;  3HOV G;  3W1B A;  4FFK A;  1G6U A;  1BHA A;  3OFN G;  4YR0 A;  4Q4D A;  3OE7 G;  4C2M A;  3DTG A;  1XHX A;  3OTO O;  1AP5 A;  3H1K H;  4RWU A;  3X2Q C;  4DV7 O;  1GGO A;  1IX9 A;  1JJ2 U;  3GTQ A;  5BWR A;  4LF4 H;  3SYO A;  4BY1 G;  4FLY A;  3RAX A;  2EZP A;  4YAK B;  1XNR H;  5KFX A;  1SER A;  3P32 A;  1AP6 A;  5IYC O;  1KU9 A;  1KUT A;  2QEX V;  2DWC A;  1V55 B;  3M9O B;  5KG5 A;  1EZJ A;  5CN0 A;  3SYQ A;  3JD3 A;  3JSL A;  3EPG A;  1IBK H;  4LF8 O;  2JGD A;  1OCR C;  5KFQ A;  1N56 A;  3PR5 B;  1A3G A;  2XAQ A;  3ETE A;  5JH7 B;  1FPO A;  3M99 B;  2VRZ A;  3W7T A;  4PZ7 A;  2GDS A;  3RN4 A;  2WLK A;  4O4J A;  4YHH H;  3APQ A;  4ECS A;  3E35 A;  3RVY A;  1IBL H;  4J7J A;  3T4Z A;  2HVQ A;  4DIM A;  2NVY A;  3N40 P;  4B3S O;  1V54 C;  4Q43 A;  5EBW C;  4A3I G;  4TQD A;  2JA5 A;  5BYA A;  4ZOL F;  3T1H O;  2WA3 A;  3MHS C;  4B3R O;  1A0G A;  1C3O A;  2CKZ B;  3GII A;  4BXX G;  4L8J A;  5CA0 F;  2IP4 A;  3G6E V;  2IJK A;  3S3X A;  4X65 H;  1I2K A;  4C5C A;  3HO8 A;  3TY9 A;  1WCM A;  2JIZ G;  5J9P C;  2W6P A;  3DTU B;  4JTC B;  4WFF A;  4QNH B;  2R7N A;  1L2Z A;  1URF A;  1YVW A;  2PY5 A;  4LF7 O;  2VQD A;  1XL6 A;  3JAS B;  4LFB O;  5L1K A;  3O9O A;  3JCU Z;  2C35 B;  4J9N A;  1XMQ O;  1IXB A;  1RJR A;  3K58 A;  1AIL A;  5LP6 A;  1WNS A;  3ABL B;  3KAL A;  1ZL8 A;  1NTM H;  4JI6 H;  4PDR A;  4MTO A;  1NR7 A;  1M7J A;  3Q8R B;  4CKB A;  1GO3 E;  4G2K A;  1S68 A;  2HHH O;  3H1L H;  3MD0 A;  3AX6 A;  3CME V;  3ABL C;  1D5A A;  5CBG A;  1WCM G;  4IT5 A;  3ASO C;  4HQ6 A;  4FBU A;  1HR0 B;  4DR3 O;  2YEV A;  4EKW A;  3CRA A;  1TUB A;  4QIW F;  3OTO H;  4MTD A;  3CCU V;  1SET A;  4R50 A;  5D1O B;  4FM9 A;  3E86 A;  3WWI A;  4I55 A;  1G4Y B;  2JK5 C;  2R9A A;  4BWS C;  3U9S A;  4X65 B;  5LP6 F;  2IU3 A;  2QDO A;  2C00 A;  5K2M A;  2XC9 A;  4DUZ O;  5F2V O;  3HXL A;  4DL7 A;  4NZM A;  1I7F A;  1OCO C;  1VEW A;  2B1G A;  5JQG F;  4O3O A;  3GTL A;  1GKF A;  1R9T A;  2HVS A;  4LR3 A;  4J9Z B;  4JXU A;  1PNL A;  4DAA A;  5J2U B;  3MWD A;  3VPD A;  4N21 A;  3ZHT A;  1DV2 A;  4H33 A;  4TV8 A;  4B3R H;  3HBL A;  2XIG A;  4PI2 A;  3NUA A;  4O2A A;  4DL6 A;  2EUL A;  1N34 O;  3JZF A;  4E2L A;  3T5K A;  1GN3 A;  3OGI B;  1E4E A;  3BRC A;  2ZIM A;  2FPI B;  3ZS8 C;  1OCR B;  3VQY A;  3N2G B;  4JI8 O;  2A79 B;  3CHX A;  4I55 F;  1WLE A;  2ZR2 A;  4X20 A;  5EIB C;  5ITZ B;  1JKJ B;  3G6V A;  4JGS A;  5TIS Z;  5L3D A;  2Q8V A;  3K57 A;  2HHF B;  1K4D C;  3T5L A;  2UXC B;  1U96 A;  1JX4 A;  5DLG A;  3P30 A;  4IR1 A;  1W59 A;  3QNE A;  1YXB A;  3PN1 A;  4J41 A;  4X66 O;  3CD6 V;  2R86 A;  1RYS A;  1N34 H;  3AG1 C;  4J9K A;  4BY7 G;  1YF2 A;  2V58 A;  3BA8 A;  3RB6 A;  2YS6 A;  1IXM A;  3RGB A;  3ETG A;  5JQG A;  3WG7 B;  4UCS A;  3L73 H;  2W6I G;  2QWR B;  1ORQ C;  3EVK A;  3HKC A;  5BR8 O;  1B06 A;  1Y76 A;  2EIL C;  1XEQ A;  2F93 B;  1ZX3 A;  2VUG A;  2RGV A;  3RAQ A;  1FD9 A;  2J6S A;  2JRI A;  5BMV F;  2M7W A;  5FPO A;  3HR0 A;  2JDI G;  4FFO A;  3H40 A;  2WLH A;  3D8C A;  2WLN A;  5LOV B;  5BR8 H;  2IJH A;  4EBE A;  4R8U A;  2ASD A;  3LDE A;  1OBG A;  4JZ2 A;  1MZF A;  1VQ7 V;  1RK5 A;  2N05 A;  2VA3 A;  3W5O A;  3LSQ A;  4FFN A;  2V4R A;  2C2A A;  5LL6 b;  2R9R B;  4A3L G;  4MW8 A;  2EJ7 A;  5IP7 G;  4UCR A;  1VQ8 V;  4EEQ A;  1SRY A;  5JJE B;  1OCZ B;  2QJ1 A;  5KFN A;  2ADQ B;  4FS2 A;  4EGJ A;  2HKO A;  2A3Q A;  5I5W A;  4JI0 H;  3K5O A;  4XYM B;  4FBT A;  3ZRX A;  2YUA A;  4CH4 A;  4DUY H;  5H9C A;  1MNG A;  3UT5 B;  1XBL A;  2JEF A;  1S97 A;  5BMV A;  4ICG A;  3K06 A;  4RUF A;  1XNQ H;  4LWS A;  2UU9 H;  1KP3 A;  5LMU B;  2HHH B;  2WWW A;  3SPJ A;  1Q6I A;  3H9V A;  4PDB A;  1Y67 A;  2QKC A;  5C93 A;  3S24 A;  2EZO A;  1YCI A;  1V4Y A;  5DIS C;  1BE3 H;  1MAB G;  1N33 H;  2ZM6 H;  3OMA B;  1M0W A;  5JH7 A;  4JPR A;  5IY5 B;  3JAM W;  5LOV A;  1N34 B;  1IDS A;  1TUB B;  2P4V A;  2NU9 B;  4WCE V;  5DGA A;  5KFE A;  5KFD A;  4YY3 B;  3ZMV A;  4QIW A;  2RJZ A;  5DQI A;  4FZ0 A;  1SKV A;  4PA3 A;  3A0R A;  3STL C;  3H20 A;  2CTW A;  5H6Q A;  5FNV F;  2Y69 B;  4WBN B;  2OTL V;  3T5H A;  2O03 A;  2GBO A;  4NZN A;  1S10 A;  3I4N G;  3T9D A;  1S5H C;  5C8Y B;  2Q5Z A;  2PTM A;  4O3R A;  4Q4C A;  5BPF A;  3HKE A;  5EK0 A;  3E22 A;  2CZG A;  1ZAU A;  2Q7G A;  3ABM C;  5CA1 F;  3GJX B;  2E2H A;  4FE2 A;  2Q2T A;  1QVG U;  1YI2 V;  1I08 A;  1F4M A;  2OYQ A;  1JCH A;  3WFV A;  1SZX A;  1ULZ A;  2HEP A;  4J9S A;  4ZQI A;  3E8G A;  4U3F H;  3HKZ E;  2UXD H;  5IT9 W;  3JD1 A;  5L9X A;  3SYA A;  2BTO A;  4H37 A;  2R6F A;  3VMM A;  3VOU A;  4IRC A;  1R3K C;  1RM1 B;  1RYR A;  2GUZ A;  4B3S B;  1N33 B;  2AHY A;  1GYF A;  5B1B B;  1IBM O;  2R7K A;  4AIL C;  3VOT A;  4DR1 B;  5FNV B;  2W9A A;  3KKY A;  3W7X A;  4DW0 A;  5IWA B;  2E2I A;  4MVS A;  4DR2 B;  3AG2 B;  4IR9 A;  1HNX B;  2LGQ A;  4RNO A;  2HP8 A;  1P4R A;  3RGZ A;  2BOC C;  4CH5 A;  3RYC B;  4UCV A;  3CB2 A;  3KCY A;  2PI4 A;  3HOY G;  5CB4 F;  2QSA A;  1WPB A;  2VWK A;  5JQG B;  2UXC O;  3CVZ A;  4ZBM A;  3BCC H;  4F4W A;  4IHJ B;  3F8N A;  1N36 H;  4ECZ A;  4G27 B;  4Q20 A;  3U11 A;  3JYC A;  4KXR A;  4CHI A;  4UVA A;  1AI7 A;  3E22 B;  3HT5 A;  3JAR B;  2RDC A;  4DV2 O;  1QR9 A;  1UFI A;  5EC1 C;  4LF4 B;  1BZK A;  1K1Q A;  4LMY A;  2XGP A;  2O57 A;  4TSF G;  3ZIA G;  4LF8 B;  5J2U A;  4B08 A;  4LF7 H;  4LCU C;  5LGN A;  4DLK A;  1I2L A;  1W93 A;  3N8D A;  4FFB B;  4FFR A;  3ZRW B;  5H2F Z;  4NTY A;  5KKN B;  1TWC A;  4B3T O;  2ZM6 O;  1GAX A;  3TW6 A;  3FB8 C;  1Q90 D;  1VQP V;  3CP1 A;  3GWO A;  3VQW A;  2XHB A;  4NVP A;  1XI1 A;  5IJ0 B;  5L1L A;  2GTS A;  2VQF O;  2WAQ E;  1N48 A;  3GTG A;  2BQ3 A;  3K3V A;  3GB8 B;  4X62 B;  5FD6 A;  3BG5 A;  1UPG A;  3FD9 A;  1JX9 A;  1Z5W A;  1SCU B;  2G38 A;  2VS0 A;  2FP4 B;  4JI5 H;  1XOU A;  3CPW U;  4X1K B;  3U54 A;  2ADP A;  4A5U B;  5BMV B;  5L1J A;  4JYC A;  5D1O A;  1EN6 A;  3TW7 A;  5JVL A;  3NC0 B;  2KSD A;  4O83 A;  2XAS A;  4OGQ B;  5EBM C;  3ORR A;  3APO A;  2DQ3 A;  1VBH A;  3G67 A;  3T1Y O;  4B3T H;  3K04 A;  3UFX B;  2P0A A;  4HAM A;  5I5X A;  4BIU A;  5JVD A;  4HBN A;  3K5L A;  1GO3 F;  4O7R A;  2CDY A;  2KKW A;  2ZE7 A;  4WFG A;  2WDT A;  5CBH A;  4GX5 A;  3K9S A;  4NKG B;  2R8G A;  4UVC A;  3ICX A;  4YJ3 B;  4CC6 A;  3PW5 A;  4PD4 F;  2W6N A;  1OV9 A;  3K3P A;  4O2B B;  2UUC B;  3AG2 C;  4KP4 A;  1PM9 A;  4NXN O;  1GSO A;  2ODM A;  4QE9 A;  2R7L A;  3JAK A;  1XQ8 A;  2FPP B;  3GLK A;  2DYR B;  1RJP A;  1AJN A;  4ZOL A;  3K08 A;  3Q8Q B;  2VA2 A;  1YJ9 V;  3JAW B;  2Z0A A;  5DLF A;  5L3C A;  1ZWI C;  4TV8 B;  5IJ0 A;  1J95 A;  1WP7 A;  5KUK A;  3MJF A;  2FKL A;  2LGW A;  2X6A A;  4XDJ A;  4ME6 A;  1KT8 A;  3UO3 A;  2ZE5 A;  2LJ2 A;  5L3E A;  5IT9 N;  2COJ A;  4AYB E;  2A1H A;  3TY8 A;  1J5E H;  3RYH A;  2CNU A;  1AN7 A;  2JS5 A;  2Z04 A;  1VIB A;  4Z1M G;  2UXB H;  1RPR A;  4X1K A;  2R84 A;  5I47 A;  1P84 F;  1P16 A;  1I94 O;  4TUY A;  4MTF A;  1S3J A;  3G6X A;  3SPH A;  3B8M A;  1VAJ A;  5KAI Z;  3GVM A;  1OWT A;  2ITD C;  1BGW A;  3N43 B;  2KSW A;  3GV8 B;  1PK8 A;  3H3V H;  3I55 V;  4R8U B;  4GKJ H;  2CW7 A;  1HWY A;  4UV8 A;  4BR6 A;  1H2G A;  3TET A;  3EPI A;  3PW0 A;  2JEX A;  2DZD A;  5DGI A;  4RUA A;  4XBF A;  4MTX A;  1E79 G;  3CC2 V;  1QHT A;  1K3E A;  2W6J G;  1TAE A;  1P7G A;  2W9C A;  3SPG A;  2ZDQ A;  1FJG H;  3BQ2 A;  4BBS G;  4FMT A;  2YXL A;  2HHH H;  3R65 A;  1WB8 A;  4YY3 O;  2VQF B;  1MSD A;  3AG4 C;  4D7S A;  5KFT A;  2WTF A;  1CEZ A;  3ZMU A;  1UC9 A;  3NBZ B;  3J80 N;  4CC5 A;  3B4S A;  4DV7 B;  1B6S A;  1I7N A;  3CSW A;  4O4L A;  1QQC A;  5HBR B;  1S9F A;  4BBR G;  2LW1 A;  3ZBH A;  4J9M A;  2I80 A;  1GSH A;  1Y66 A;  2JA7 A;  3NGD A;  4DV5 H;  2FL4 A;  3W7W A;  3FDS A;  1CXZ B;  4CE5 A;  4QWD A;  1ARO P;  4JI8 H;  2OWO A;  3FKI G;  3N44 B;  2DWE C;  5DED A;  1AJP A;  2WAM A;  3J7A U;  2EIJ B;  1GM9 A;  2JJ2 G;  4BAY A;  3RWR D;  1R3L C;  4H0L B;  3JAR A;  5DG7 A;  2W71 A;  1F7Y A;  3VNN A;  4CKC A;  4WBN F;  2Q9L A;  2N74 A;  4P30 A;  1RK6 A;  2LFS A;  3QO5 A;  3VA7 A;  5JVD B;  1FFT B;  5IJ9 B;  4DRX A;  1MA1 A;  4JI5 O;  2W7O A;  3BAC A;  2W6Z A;  3C0F B;  3IN5 A;  1ZQ7 A;  3KZI Z;  4P9O A;  1NS1 A;  5DGB A;  5KT4 A;  4YJ3 A;  2P4K A;  3M8A A;  3MWE A;  4JI7 H;  1KJ9 A;  3DXR A;  1FS0 G;  3Q4H A;  1CS0 A;  3NXS A;  2QKA A;  4HNA A;  4MV3 A;  2JEJ A;  1ZHQ A;  1FVI A;  1I1M A;  3JAT A;  5EBL C;  4IWX A;  1QLE B;  4DQN A;  5B3S C;  5IE9 A;  4HNT A;  5KFS A;  4O4L B;  1CKN B;  5CBF A;  4Z2W A;  5C1O A;  4JI6 O;  5AG2 A;  4ED3 A;  2PI5 A;  3JZ6 A;  1DF5 A;  3MR5 A;  3OHB A;  4DV7 H;  2Q69 A;  4X1I A;  5LMN B;  3I4M G;  3IC7 A;  3CWB H;  3GTP A;  4IGG A;  4FJC C;  2DOS A;  5KG1 A;  4X9Q A;  2ZNJ A;  2I87 A;  3ZN0 A;  1YTF B;  4IYI A;  4JYA O;  4KUM A;  4NYK A;  5LHI A;  3GIL A;  2PMZ A;  2C22 A;  1ROP A;  4MV8 A;  1JQ0 A;  3KAJ A;  3RGX A;  4ZI7 B;  1ZHS A;  2EIY A;  1TWH A;  3RTX A;  4DO2 A;  1HNX H;  2QB5 A;  4DR7 B;  4UB6 Z;  2IJI A;  3K9A A;  3GTJ A;  4UV9 A;  3AG4 B;  2UUB B;  1H2K A;  1ZL8 B;  2CNV A;  2PN1 A;  3R66 A;  2ABJ A;  5KFM A;  3B2E E;  1M56 C;  4RU9 A;  3L74 H;  1EN5 A;  1IBL O;  1WPX A;  1HNX O;  3JD0 A;  3T9F A;  4A3F G;  3SI8 A;  4B3S H;  3CC7 V;  3IAY A;  2P22 C;  2N04 A;  3SJB C;  3LML A;  1T94 A;  3ABT A;  4O4I B;  4FFB A;  5EYP B;  1IOV A;  3ZJZ A;  5D8D A;  5IJ9 A;  4ECX A;  2FML A;  4JAA A;  2YCH A;  5KLV H;  2XCP A;  1SQF A;  3HKB A;  1U97 A;  2RNB A;  4DR6 B;  5IYZ B;  4MV1 A;  3BQ1 A;  4W4L A;  2XGQ A;  2UXD B;  4WFH A;  1K97 A;  2COG A;  3V6J A;  4K0K O;  5CA0 B;  3MR2 A;  4A3M G;  1SA0 B;  2EIM C;  4MS2 A;  3T7A A;  1E4E B;  2OH2 A;  1DGS A;  1FXV A;  4LP8 A;  4J10 A;  4GKK H;  2RDI A;  4YJ2 B;  1D5N A;  2K1E A;  4JV5 B;  3MFI A;  1KTA A;  2Q2U A;  4O3Q A;  2QR4 A;  3P3P A;  3HPL C;  1AI4 A;  1PX2 A;  2GHY A;  1SQV H;  2EIM B;  5GTI Z;  3SPC A;  4DV6 B;  2YID A;  4NXM O;  2UUA H;  3V6K A;  1NI8 A;  4MVZ A;  2B63 A;  1UJW B;  2ZKO A;  3R5X A;  3T9B A;  4BW5 A;  2W0X A;  2QTS A;  4ED2 A;  2RGR A;  5KT5 A;  4QW9 A;  2IBZ H;  2HVR A;  4DR5 H;  5D5Q A;  2NU7 B;  2WB1 A;  1N33 O;  2RDJ A;  4UFZ A;  1RSO B;  5LP6 C;  1KJQ A;  3CEB A;  4AYB A;  1NU1 H;  4NR1 A;  3R9R A;  1CE8 A;  1LUV A;  4A3B G;  4LF9 H;  5CE8 A;  2AZ0 A;  5J2T A;  4D7T A;  4FM0 A;  3FFQ A;  3ASN C;  4X66 H;  3BPZ A;  1MZB A;  4OX9 B;  1JLL B;  5LMU H;  3OT7 A;  3UCS C;  2ODT X;  4GT1 A;  2V1D A;  5BWX A;  5EDW A;  2J6T A;  3A0H Z;  4O2B F;  1M56 B;  1S0O A;  2P7T C;  4DV0 B;  1TWF A;  4YJ2 A;  3DAA A;  2PVP A;  5L3G A;  4ABM A;  1Y4M A;  2QM4 A;  3ORQ A;  1WSC A;  2LO1 A;  4F6E A;  3PO3 G;  1SS3 A;  2VPQ A;  1PKX A;  5HFM A;  1KC8 W;  4TV8 F;  1PNM A;  2YIB D;  3TCU A;  2JGU A;  4AQY B;  4DR7 O;  3WWJ A;  5K3W A;  4I4T A;  3AEI A;  4GUN A;  3H01 A;  4F4L A;  4CBC A;  4JI1 H;  4UVB A;  2PGG A;  4R7R A;  4OXS A;  3OTO B;  5DG8 A;  4HYK A;  1PL4 A;  2DW4 A;  1K73 W;  4ZI7 F;  3JAM N;  4DR1 H;  3NR7 A;  1QR8 A;  1Y1W G;  5J2T B;  2WYO A;  5LGU A;  5I5T A;  3RBD A;  2YXH A;  2R9I A;  4O7N A;  5KG0 A;  4YQW A;  3N6X A;  4CS2 A;  1PD3 A;  2DN9 A;  1BHB A;  4JI6 B;  4J7Z A;  5IP9 G;  4GKK O;  4NTX A;  4YJ2 F;  2X6C A;  1B3Q A;  3FYI B;  4QGP A;  1VKZ A;  1N32 O;  3T1Y B;  4MT8 A;  2PBZ A;  2YZN A;  1TGO A;  4F4Y A;  3L4K A;  5LXT F;  1KBH A;  5KFW A;  5BPH A;  2NU6 B;  4TOI A;  2F4V B;  3E8B A;  1FFX B;  2WAQ A;  3ZRS A;  3PZP A;  3UO2 A;  3MR3 A;  5KHG A;  1Y6X A;  2Q7H A;  5EYP A;  2VR1 A;  1HDJ A;  4DV3 H;  4YIP A;  3JD2 A;  1JFF B;  1J5E O;  3TGU H;  3QO8 A;  1S76 D;  4UCO A;  3HKE B;  5B1N A;  4O84 A;  1QBZ A;  2BOB C;  4EFE A;  3GV7 B;  4ECT A;  1AI6 A;  1M57 B;  4JYY A;  4XZ3 B;  5BWV A;  1VQN V;  3T1H H;  5KX5 F;  1XMO H;  1R6T A;  1HR0 O;  5K1X A;  3N41 B;  1JJO A;  1K5S A;  1FJG O;  4B3R B;  1XHZ A;  2F23 A;  3HKD A;  2YWV A;  4J9Y B;  3DF7 A;  3H0G G;  4O86 A;  4QWC A;  2WPD G;  3VPB A;  4ECQ A;  1CKM A;  1EKF A;  2C2E A;  2QK4 A;  4TT3 G;  2ASJ A;  4LFC B;  1GM7 A;  1OHH G;  4FLV A;  4O7L A;  1UNN C;  1Z2N X;  1TVK A;  3EXA A;  4O4H F;  2Q4P A;  1PPJ H;  4J9Q A;  2CUG A;  3JAL B;  2Y0P A;  1QCE A;  4NLG A;  5GW7 A;  4TV9 A;  3OAA G;  1BQZ A;  4J9O A;  1AUV A;  1IZ3 A;  3Q2O A;  2CTQ A;  1DTO A;  2ZE6 A;  3PR4 A;  1I50 A;  1Y1V G;  1W0J G;  4O3P A;  3CYO A;  4O7Z A;  2JA7 G;  3RF2 A;  1EFR G;  4QE7 A;  2W6Q A;  3G80 A;  4MAM A;  5LBQ A;  3ETJ A;  1XL4 A;  1VMG A;  3I12 A;  4MSW C;  3VQX A;  5IYB G;  3L9D A;  5HNE A;  4JI1 B;  1LNQ A;  4QPK A;  1ZLZ A;  2JA8 G;  1W2B U;  2EJR A;  1WA8 B;  2BTQ B;  3RV4 A;  1BCC H;  4GZR B;  4PDL A;  3JD4 A;  4YP3 A;  1SYX B;  3K79 A;  4A3G G;  2FK3 A;  1CKN A;  1BS3 A;  3HB3 B;  3G6B A;  1N0N A;  2E75 B;  3PJS K;  3GDE A;  4TM5 A;  3J81 W;  1Q82 W;  5LMU O;  3CCE V;  1X9N A;  3Q1K A;  4DV1 O;  3MR6 A;  3I56 V;  5KFF A;  1LUW A;  4PBC A;  4LH7 A;  3R5H A;  3IC9 A;  2JA6 A;  2YDE A;  1CP9 A;  3JAT B;  1Q81 W;  5EIB D;  4OPH A;  3E89 A;  3TQT A;  5JJJ B;  2CH7 A;  3RYI A;  1MOF A;  2X0S A;  4FLT A;  3GIK A;  5FLX W;  4R8C A;  2Q7D A;  5KFB A;  1H2S B;  4DL5 A;  2D2C B;  1WN7 A;  2CNQ A;  2C28 A;  4X66 B;  1X59 A;  4CS3 A;  3RYH B;  4DK0 A;  4LF5 H;  3T2M A;  3AW8 A;  4ZHQ B;  5E79 Z;  1Q6U A;  3CE2 A;  2M6Y A;  4UUG A;  1W0K G;  4YAJ B;  4TUY B;  4LWS B;  3GIP A;  2DYR C;  1TUE B;  3WU2 Z;  4ED0 A;  2P06 A;  4I50 A;  1XNR O;  3GV5 B;  4I55 B;  3Q8P B;  3A2F A;  2JJ1 G;  5DEC A;  1X4T A;  1B6R A;  2VUM G;  1THZ A;  5IWA H;  3OTF A;  3TK1 A;  1EUC B;  5L1I A;  5KHI A;  2V9W A;  4EQ5 A;  3AK1 A;  2DJV A;  3ZHV A;  2GQR A;  2XOK G;  4K8Z A;  2BQR A;  4FZ1 A;  1S0M A;  5JCO A;  2DE0 X;  1CKO A;  4LF6 H;  4CMD A;  2OCH A;  2ASL A;  1KJI A;  1MSW D;  5KA6 A;  2UUA B;  4MV4 A;  1EZ1 A;  4GKJ O;  2YU9 A;  3STZ C;  4IIJ B;  5C8Y A;  2WB1 E;  3SYC A;  1CQI B;  1BSM A;  4J9P A;  2ZGI A;  3CC4 V;  3T9E A;  4JYB A;  4J9L A;  1V55 C;  3OEH G;  3KXY T;  3E5N A;  3RV3 A;  3DC6 A;  2ZDG A;  4N23 A;  4PA7 A;  5KHJ A;  3A0B Z;  4MVO A;  2VQF H;  1R3J C;  5EZY F;  3ZMT A;  2QWQ B;  1Z5V A;  5JJN B;  1EUD B;  1YSC A;  3M4I A;  3BA9 A;  1E4F T;  2F95 B;  3L2P A;  4WFE A;  2UVW A;  2EX3 A;  5B1A C;  4BWA A;  2L6L A;  2UXB O;  4GLX A;  2LW7 A;  1I1L A;  5LOV F;  3U55 A;  4QWA A;  4CH6 A;  2CH7 B;  3RYI B;  1K34 A;  5KT2 A;  1DK1 A;  4I50 B;  1RFY A;  3HOX G;  3CRM A;  4O4H A;  4JUZ A;  1KKC A;  5JQW A;  3ABK C;  5FNV A;  4DV0 H;  3QQM A;  3SE7 A;  1N36 O;  1XUQ A;  2CQY A;  4TV9 B;  2MCT A;  4X65 O;  3LNM B;  4F4X A;  2YRX A;  3ABM B;  2BSK B;  3ASN B;  4FLW A;  4MV9 A;  1EN4 A;  1WRV A;  3H4B A;  5C44 G;  2LQT A;  2CAZ C;  3OM3 B;  1DIK A;  4RB3 C;  2R92 G;  3K59 A;  5CMU A;  2DIK A;  4RAI A;  3RR5 A;  1M57 C;  1F4N A;  2LP7 A;  4X62 O;  3J81 N;  3OUZ A;  4LC1 A;  3T1H B;  4DL3 A;  4Q8F A;  5KFY A;  5LHG A;  1L0N H;  3GTK A;  2UU9 B;  1AJQ A;  5HV6 A;  1K83 A;  4EBC A;  1RP3 B;  3OMI B;  3H1J H;  4DR6 O;  2R92 A;  3FX7 A;  4JI0 B;  4NTW A;  4X1Y B;  4LF8 H;  3QVN A;  3QZ7 A;  1KYO F;  1KUQ A;  5I5Y A;  2W7P A;  1XMQ B;  1B6Q A;  1YTF D;  4DYL A;  2PF4 E;  5KHH A;  4Q0Y A;  3CMA V;  1EHI A;  4FU0 A;  3GQC A;  1HW7 A;  4PEL A;  4ZKI A;  3AK2 A;  3EFF K;  2WLM A;  1RJQ A;  4K0K H;  1YZB A;  1BGY H;  4LFA B;  2R87 A;  2WA4 A;  4RQF A;  4APM A;  1EM1 A;  4LNU B;  5CB4 A;  4PHZ A;  3U9T A;  4UUJ C;  2ATL A;  4DR1 O;  1YIT V;  2NVX A;  4JV2 A;  1I6U A;  1FXK B;  2IM9 A;  4DR2 O;  3K0G A;  1GSA A;  4R7C A;  5BR8 B;  4BIZ A;  1BJT A;  3L72 H;  2CGN A;  2HLD G;  4U3J B;  2NR5 A;  4RCN A;  3B77 A;  1Z2O X;  4FLU A;  4JI7 B;  2DPI A;  3ETQ A;  5IWA O;  1AUX A;  3C90 A;  3SYP A;  1FXK C;  3W1G A;  2Y0S A;  1JMK C;  1XMO O;  5KFC A;  1UC8 A;  1F51 A;  2IJJ A;  4RUC A;  1V9P A;  3WO0 A;  1T36 A;  1O9H A;  3ZMZ A;  4DL4 A;  3K5H A;  3T9C A;  2YZM A;  4O4I F;  1GN6 A;  4RNN A;  4IIJ F;  3ETD A;  2XAH A;  3ZX6 A;  5DQH A;  2VQE H;  4LF5 O;  3SJA C;  1M4U A;  2CK3 G;  4DV0 O;  2UUA O;  5L3F A;  2W6O A;  1V51 A;  3R23 A;  4LFA H;  4QPJ A;  1M9N A;  2W8L A;  3KG2 A;  2Y0I A;  4FS1 A;  5HFL A;  4TV9 F;  2IH1 C;  4RUE A;  3CXC U;  3HKD B;  2JVD A;  3GIJ A;  4QJF B;  3J80 W;  3EHB B;  1I94 B;  1K1S A;  1N36 B;  1I5Y A;  1JFF A;  2UVU A;  5LXT A;  2UUC O;  2XD4 A;  2B1I A;  1R1B A;  2KG7 A;  3BY6 A;  3T4D A;  1XNR B;  3LSS A;  5KG7 A;  2MW2 B;  5B3S B;  4TUY F;  1SC5 B;  4IAJ A;  1ZSP A;  4U3J A;  5JH7 F;  5FL7 G;  3JAS A;  1HNW O;  1BL8 A;  4LFC H;  1G1X B;  5B5E Z;  5KFO A;  5DGH A;  1PNK A;  3IGA C;  4B3M O;  3L75 H;  3M9M B;  1BT8 A;  1N4C A;  3FMA A;  5JCO C;  2R7Z A;  5KG2 A;  4MW3 A;  2HIV A;  2DQ0 A;  4I9W A;  4LF6 O;  4NXM H;  1Q86 W;  4Q6G A;  1NBM G;  2JA6 G;  4I0X B;  5IDJ A;  3FAV A;  4K6N A;  3LDD A;  2W57 A;  3DTF A;  1M93 A;  3K5M A;  4JI4 B;  1RM1 C;  2UXB B;  4EBD A;  4TWK A;  1E1Q G;  4EYH B;  2PYL A;  2QTO A;  4DR7 H;  4PZ8 A;  2Q73 A;  2DYS B;  5BWW A;  3G71 V;  3TJT A;  5E25 A;  4RAZ A;  4ED7 A;  1R6K A;  5KG6 A;  5KHK A;  5A2Q W;  1M6V A;  2OLS A;  4Q44 A;  3LDC A;  3ETH A;  4JV5 H;  4MA5 A;  3RJ0 A;  2UVV A;  3MFH A;  3CJH A;  3H1I H;  4DR4 B;  3ZRW A;  5KS8 A;  3AK3 A;  3PO2 G;  1LR1 A;  4WF9 V;  2QA4 V;  4O7T A;  1P49 A;  3GTO A;  3TQ1 A;  1WA8 A;  2JS3 A;  2ITC C;  3TIN A;  3IG0 A;  5GON F;  3JRW A;  1A9X A;  1MZE A;  3BEH A;  3WB0 A;  1K33 A;  1K9M W;  3E8H A;  1PL0 A;  3IJ4 A;  2DAA A;  2PYJ A;  2X7R B;  4XYL B;  2NU8 B;  1N8R W;  5E1A C;  2V59 A;  1R6N A;  3NBY B;  4QJF A;  3N27 A;  1EKV A;  4YR3 A;  4JI2 B;  5CA3 A;  5DQG A;  1DF4 A;  3N2G A;  3SR2 C;  4EYI B;  2ZJT A;  2AGP A;  2R8K A;  4DR5 O;  4X88 A;  4ED1 A;  3RYF B;  2IA6 A;  4LNU A;  5CA0 A;  5CB4 B;  3R5F A;  2ZR3 A;  1S72 V;  3CRQ A;  2DWD C;  3VBB A;  1YIJ V;  4DR2 H;  3T9A A;  3SGI A;  5LHH A;  5KFP A;  4HYO A;  5BWU A;  1H2N A;  1WAZ A;  1ENV A;  2QM7 A;  2FLP A;  2DMX A;  3HOU G;  4W4K A;  3KHL A;  1I3Q A;  1HNW H;  4O81 A;  4DR3 H;  1S0N A;  4TQR A;  4I0X A;  4RNM A;  1ZET A;  3K5N A;  1L0L H;  2YI8 A;  5F9N A;  2F43 G;  3BAB A;  1QLE C;  3I5D A;  4OPA A;  2GPW A;  1IYE A;  4GC7 A;  4JI4 H;  1Y74 A;  4IIJ A;  2JA5 G;  1E1R G;  4J42 A;  3S3W A;  3UKM A;  4DRX B;  2RN9 A;  2XCA A;  3K5I A;  2AGO A;  3C3T A;  4JI7 O;  3CXH F;  2DYS C;  3N42 B;  4BIO A;  3ZHR A;  4WD3 A;  2HDK A;  3HKC B;  4U7C A;  4JI1 O;  3OD4 A;  2AW9 A;  3GWK C;  4J11 A;  2YS8 A;  3Q4H B;  5BWT A;  4PJ0 Z;  1IVS A;  2EJ0 A;  5DMX A;  2UU9 O;  2QGN A;  1NT2 B;  3Q8S B;  1N0J A;  1FXK A;  2HJD A;  4YBZ B;  2H94 A;  1Y1V A;  3LUL A;  4C7U A;  1NKD A;  1A48 A;  3KHH A;  4PV1 B;  2BCC H;  4X1I B;  3U0G A;  3AG1 B;  2YYA A;  1JOY A;  3JRX A;  1L1F A;  1QVF U;  1IYD A;  2Y4U A;  3G8C A;  4X64 H;  4YIO A;  4JF3 A;  1XIL A;  1N32 B;  5A9G A;  4Z1V A;  2V5A A;  4JI4 O;  1V54 B;  3FAV B;  2ZE8 A;  1EBO A;  2ZCE A;  1DV1 A;  2ARH A;  4MV6 A;  3H0G A;  5KG3 A;  5IYD G;  2ETN A;  2W8K A;  4MTG A;  3U0Z A;  4IWY A;  1FFX A;  5CA1 A;  4WFB V;  1VF7 A;  3OR7 C;  1IBM B;  2ZXW C;  4YB8 B;  1VQ5 V;  3ZMS A;  1CQJ B;  3ML0 A;  3AG3 C;  4O7Y A;  4MTE A;  1T3N A;  3CCV V;  1R73 A;  2FJZ A;  2WE6 A;  4ECY A;  5B1O A;  1VF6 C;  4CH3 A;  4RO2 A;  3JAK B;  3L70 H;  2Y4R A;  4ED8 A;  4JI3 O;  1FAF A;  3X2Q B;  2EJ3 A;  1XMO B;  3RB0 A;  1QNM A;  3H1H H;  3RW0 A;  1KP2 A;  2XUM A;  4DV6 H;  1KC7 A;  5I5V A;  3B09 A;  1CPY A;  1AVM A;  1GK9 A;  1GM8 A;  3LWB A;  3VPC A;  4CMF A;  1AR1 B;  5KFJ A;  2Q67 A;  4K0K B;  2HJF C;  2H8P C;  2W0F C;  4X1Y A;  1IBK B;  5FR9 A;  2HGX A;  3ZRV A;  2B63 G;  1KEC A;  4G28 B;  3KRE A;  3HKZ A;  1VBG A;  5CM0 A;  4ECW A;  2GTA A;  4JZG A;  4LFA O;  3C3S A;  1SZT A;  2EJ2 A;  5KG4 A;  5C5J A;  3HOW G;  1VQL V;  2EBO A; 
#chains in the Genus database with same CATH homology
 4JI5 H;  3GDE A;  3J81 W;  4X1K B;  5CA1 B;  3M7M X;  5LYJ B;  5BMV B;  1X9N A;  4BW9 A;  1RSO A;  2UXC H;  5D1O A;  4K8X A;  3NC0 B;  5EOY A;  4LH7 A;  5EZY A;  1HNW B;  2R70 A;  2PZS A;  3LNN A;  2YIB A;  4B3T H;  3JAT B;  3QTC A;  5EIB D;  2ZIO A;  3RYF A;  1A0I A;  5KMG A;  5JJJ B;  3QG5 A;  3RYI A;  4E6N A;  4JI3 H;  3UT5 A;  4LSX A;  5JVD A;  5D5P A;  4HBN A;  3K5L A;  4FLT A;  5FLX W;  4NXM B;  4FLX A;  2KKW A;  1H2S B;  3BAA A;  4I4T B;  1WN7 A;  4HNA B;  2WDT A;  4DUZ H;  3KAK A;  4X66 B;  2YI9 A;  4CS3 A;  3RYH B;  4DK0 A;  4LF5 H;  3ICX A;  4YJ3 B;  4CC6 A;  2V4D A;  4AQY H;  4ZHQ B;  4ZI7 A;  4GYC B;  4LF5 B;  3QF7 A;  4FM1 A;  4AHC A;  4O2B B;  2UUC B;  4TUY B;  2P5O A;  3ZED A;  4UCT A;  4I50 A;  1FKA H;  4I55 B;  3A2F A;  3JAK A;  1XQ8 A;  4FVM A;  1X4T A;  3J7A K;  4ZOL A;  1WH2 A;  1O75 A;  1KMI Z;  5IWA H;  4DV2 B;  1B04 A;  3JAW B;  3OTF A;  1I94 H;  5KHI A;  4A2B A;  4TV8 B;  5IJ0 A;  4EQ5 A;  2VPS A;  4YHH B;  2Q0A A;  4K8Z A;  4EB6 A;  5JCO A;  5K1P A;  2RQ6 A;  1Q8I A;  1CKO A;  4TQF A;  4LF6 H;  3DSQ A;  4B3T B;  1S03 G;  2UUA B;  2VWJ A;  1J5E H;  4NXN B;  3TY8 A;  4J0M A;  3JSN A;  4IIJ B;  5C8Y A;  3RYH A;  5KX5 B;  3L4J A;  4I9Q A;  1AN7 A;  2JS5 A;  5IYZ A;  1HNZ H;  2UXB H;  3KXY T;  4B3M B;  4JI5 B;  4X1K A;  4DR5 B;  5KHJ A;  4FM2 A;  5LA6 A;  1P16 A;  2VQF H;  4TUY A;  2F4V H;  1SA0 A;  2ZM6 B;  5JJN B;  1Z5V A;  3M4I A;  3SJC C;  1XK5 A;  3BA9 A;  1E4F T;  2F95 B;  3L2P A;  4NXN H;  1BGW A;  2EX3 A;  4BWA A;  3N43 B;  4GLX A;  3JAW A;  2KSW A;  1HNZ B;  4GKJ H;  4CH6 A;  2CW7 A;  3RYI B;  5GON B;  1IBM H;  3MWM A;  4I50 B;  3W1B A;  1G6U A;  4O4H A;  4IHJ A;  5FNV A;  4DV0 H;  1XHX A;  1QHT A;  4ZOL B;  4TV9 B;  1TAE A;  2MCT A;  4LF4 H;  4A2A A;  4FLY A;  3T1Y H;  1FJG H;  1M5I A;  1XNR H;  2HGS A;  2F1M A;  4FLW A;  2YXL A;  4JYA B;  4MV9 A;  2HHH H;  1N32 H;  2VQF B;  3CSX A;  3WB1 A;  2CAZ C;  4D7S A;  4RB3 C;  1KU9 A;  3K59 A;  3RIZ A;  3RR5 A;  3JSL A;  1IBK H;  3NBZ B;  2FE3 A;  4CC5 A;  3T1H B;  4DV7 B;  5JH7 B;  2UU9 B;  4O4L A;  4PZ7 A;  1Q3E A;  1QQC A;  1IBL B;  4O4J A;  4YHH H;  3N2K A;  1TVK B;  1IBL H;  4JI0 B;  4DV5 H;  4X1Y B;  4LF8 H;  2UUB H;  2HVQ A;  3N40 P;  4JI8 H;  2OWO A;  3N44 B;  1XMQ B;  2ZNI A;  5KHH A;  4O4H B;  4TQD A;  4Q0Y A;  4RAY A;  2UUC H;  1SEI A;  4GKK B;  3RWR D;  1HW7 A;  4L8J A;  4K0K H;  4LFA B;  4X65 H;  3JAR A;  3VNN A;  3TY9 A;  2ZIN A;  4APM A;  4LNU B;  5CB4 A;  4PHZ A;  5JVD B;  1L2Z A;  4DR6 H;  5IJ9 B;  4JYA H;  2PY5 A;  1I6U A;  4DRX A;  2BTQ A;  2IM9 A;  3JAS B;  3K58 A;  5LP6 A;  5BR8 B;  1WNS A;  1BJT A;  3C0F B;  3KAL A;  4JI7 H;  4YJ3 A;  4LH6 A;  4O2A B;  4U3J B;  4JI6 H;  4I7H A;  1M0T A;  4HNA A;  4FLU A;  4JI7 B;  5LXT B;  1Z2O X;  3ETQ A;  4LF9 B;  3W1G A;  1TA8 A;  1ZHQ A;  1FVI A;  1JMK C;  3JAT A;  1S68 A;  4DV4 B;  4O4L B;  5KMG B;  1CKN B;  1V9P A;  1D5A A;  3UQ8 A;  1O9H A;  2R72 A;  3U10 A;  1HR0 B;  3OTO H;  1TUB A;  1XDN A;  4MTD A;  4DV7 H;  5D1O B;  4X1I A;  5LMN B;  4FM9 A;  4I55 A;  2E5L H;  2VQE H;  3SJA C;  1M4U A;  2R9A A;  2ZNJ A;  4BWS C;  4X65 B;  4LFA H;  4JI8 B;  4CS4 A;  3HXL A;  2Q7E A;  3HKD B;  1I7F A;  2JVD A;  3KAJ A;  4ZHQ A;  4ZI7 B;  3RGX A;  1ZHS A;  4LSA A;  1HNX H;  3RTX A;  3J80 W;  1I94 B;  3QWU A;  1N36 B;  4KHP B;  1JFF A;  4LR3 A;  2E3C A;  4DR7 B;  2HVS A;  5LXT A;  4DK1 A;  5J2U B;  4B3R H;  4TV8 A;  2XIG A;  1XNR B;  4PI2 A;  2UUB B;  4O2A A;  4RB2 C;  3B2E E;  4EB6 B;  4IAJ A;  4U3J A;  3BRC A;  2ZIM A;  4X64 B;  3JAS A;  3N2G B;  3VQY A;  3ZS8 C;  4B3S H;  3CHX A;  3IAY A;  4LFC H;  2P22 C;  4X20 A;  5EIB C;  5ITZ B;  4ETS A;  3SJB C;  3LML A;  5EYP B;  4O4I B;  4FFB A;  4OX9 H;  3K57 A;  1P8L A;  2VQE B;  2UXC B;  5D1P A;  5IJ9 A;  5LA6 B;  4EFB A;  3FMA A;  5JCO C;  2YCH A;  2HIV A;  4NXM H;  1SQF A;  3HKB A;  4Q6G A;  3THO A;  4DR6 B;  5IYZ B;  2E5L B;  3PN1 A;  2UXD B;  4F6R A;  2HIX A;  2W57 A;  1M93 A;  3K5M A;  4JI4 B;  2UXB B;  1N34 H;  5CA0 B;  1SA0 B;  4JI3 B;  2PYL A;  3BA8 A;  4DR7 H;  4PZ8 A;  1DGS A;  3RGB A;  5KX5 A;  4GKK H;  5JQG A;  4UCS A;  4YJ2 B;  4DV4 H;  4RB0 A;  4JV5 B;  4RAZ A;  2Q2U A;  3HKC A;  2F93 B;  5KHK A;  5A2Q W;  5EZY B;  2VUG A;  2RGV A;  4JV5 H;  4LF6 B;  3RJ0 A;  4DV6 B;  2UUA H;  4DR4 B;  4RZQ A;  4DV2 H;  5FPO A;  4LF7 B;  4LFB B;  5FD5 A;  1P49 A;  2RGR A;  5LOV B;  5BR8 H;  3N2K B;  3IG0 A;  2F66 C;  2HVR A;  4DR5 H;  5D5Q A;  3WB0 A;  4PI0 A;  4UFZ A;  2PYJ A;  5LP6 C;  1J5E B;  3W5O A;  5LYJ A;  3VQV A;  3NBY B;  5LL6 b;  4LF9 H;  4JI2 B;  4KL1 A;  5J2T A;  4D7T A;  1Q5O A;  4FM0 A;  3FFQ A;  4UCR A;  4WBN A;  4EEQ A;  4O4I A;  3N2G A;  3SR2 C;  4X66 H;  5JJE B;  2ZJT A;  1XNQ B;  3BPZ A;  1MZB A;  3RYF B;  2QJ1 A;  4DR3 B;  4OX9 B;  5LMU H;  4LNU A;  5CA0 A;  5CB4 B;  4DUZ B;  4JI0 H;  2GV9 A;  3K5O A;  4RB1 A;  4DR2 H;  3HKB B;  3SGI A;  4DV0 B;  4DUY H;  4CH4 A;  3UT5 B;  4YJ2 A;  4DV3 B;  4GKJ B;  5BMV A;  2QM4 A;  1XNQ H;  2UU9 H;  1HNW H;  5LMU B;  4DR3 H;  2HHH B;  3K5N A;  4PDB A;  2YI8 A;  2YIB D;  2JGU A;  4AQY B;  3S24 A;  5DIS C;  3BAB A;  1N33 H;  4I4T A;  2ZM6 H;  1M0W A;  5JH7 A;  3JAM W;  4DUY B;  5LOV A;  5LP6 B;  1N34 B;  4JI4 H;  1Q43 A;  1TUB B;  4IIJ A;  2PGG A;  4JI1 H;  4R7R A;  3KYH C;  3OTO B;  4DRX B;  4YY3 B;  4LFB H;  2RJZ A;  1SKV A;  3H20 A;  3N42 B;  4WBN B;  4DR1 H;  2O03 A;  5J2T B;  4MV7 A;  2WYO A;  1T5E A;  3HKC B;  1SQG A;  5C8Y B;  5GON A;  3N6X A;  2PTM A;  4CS2 A;  3JAL A;  4JI6 B;  2CW8 A;  3HKE A;  3E22 A;  1ZAU A;  2Q7G A;  3GJX B;  2Q2T A;  2OYQ A;  4YY3 H;  3T1Y B;  1TGO A;  2HEP A;  4FLZ A;  1NT2 B;  3L4K A;  2PUS A;  2UXD H;  5IT9 W;  2BTO A;  4TOI A;  2F4V B;  4DV1 H;  1FFX B;  3RFR A;  4X1I B;  5KHG A;  3TY5 A;  4B3M H;  4B3S B;  2Q7H A;  5EYP A;  1N33 B;  4DV3 H;  3EYY A;  1JFF B;  1GYF A;  4UCO A;  4X64 H;  4AIL C;  1N32 B;  3HKE B;  4DR1 B;  5FNV B;  4ZIB A;  4EFE A;  5IWA B;  3BHP A;  1VS0 A;  4DV5 B;  4DR2 B;  4UCU A;  4O4J B;  1HNX B;  2ZCE A;  3T1H H;  2CFM A;  3RGZ A;  3RYC B;  4CH5 A;  1XMO H;  4UCV A;  5K1X A;  3N41 B;  3CB2 A;  1JJO A;  3U0Z A;  1S5J A;  4B3R B;  1XHZ A;  1FFX A;  3HKD A;  1WPB A;  2VWK A;  5JQG B;  3CVZ A;  5CA1 A;  4IHJ B;  3F8N A;  1VF7 A;  1N36 H;  1IBM B;  3DF7 A;  4KHP H;  3U11 A;  1L8D A;  4M7E A;  1CKM A;  3E22 B;  3WB2 A;  4LFC B;  4MTE A;  4FLV A;  2YIA A;  3JAR B;  1YEW A;  4LF4 B;  4DRF A;  1Z2N X;  2WE6 A;  4CH3 A;  4LMY A;  1XMQ H;  3JAK B;  1TVK A;  5FPR A;  4LF8 B;  1XMO B;  1Z2P X;  5LMN H;  3JAL B;  5J2U A;  4B08 A;  4LF7 H;  4X62 H;  4X20 B;  4TV9 A;  5ITZ A;  1FJG B;  4DV6 H;  3MAQ A;  4FFB B;  1HR0 H;  4K0K B;  1O9G A;  4X1Y A;  3VQW A;  2XHB A;  1XI1 A;  4NVP A;  1IBK B;  5IJ0 B;  3RF2 A;  3RYC A;  4DV1 B;  4PZ6 A;  4JI2 H;  3K3V A;  3VQX A;  4X62 B;  3GB8 B;  1E4G T;  4JI1 B;  5FD6 A;  4O2B A;  1Z5W A;  2BTQ B;  4F6R B;  4DR4 H;  1SYX B;  2VOB A;  1CKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...