4EFEA

Crystal structure of dna ligase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title crystal structure of DNA ligase
rcsb
molecule tags Ligase/ligase inhibitor
total genus 103
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4efeA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4efeA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4efeA02
4JI3B 4DV2B 3GB8B 4EEQA 3TY8A 2Q2TA 3W5OA 3OTOB 4DV4B 4UCRA 1A0IA 5D1PA 1XNQB 4LFCB 1HNXB 4JI0B 3JSNA 1CKNA 4B3SB 4LF9B 1IBMB 3BA8A 3TY9A 4JV5B 4X62B 1J5EB 1HNZB 4UCVA 4X66B 3NBYB 2HVSA 4LH7A 2OWOA 2VUGA 4JYAB 4JI7B 3KYHC 4TOIA 4DV6B 4DV5B 4B3TB 4CC5A 3TY5A 4OX9B 3RR5A 3VNNA 1HR0B 4KHPB 4DV1B 3NC0B 2HIXA 4DR6B 4LFAB 4GLXA 2VQEB 4GKKB 4PZ6A 4EQ5A 4JI5B 4NXNB 4DV7B 1DGSA 2HVRA 4JI2B 3GJXB 4LF8B 1ZAUA 1TA8A 4LF6B 2HVQA 4DR5B 3T1HB 4PZ7A 1I94B 4LF4B 4UCTA 3UQ8A 2UUAB 1XDNA 1XMQB 1V9PA 3L2PA 1IBKB 2UUBB 1IBLB 2F4VB 4EFEA 2Q2UA 5D1OB 4X64B 2UUCB 4DUYB 4DR1B 4JI8B 4DR4B 4UFZA 4AQYB 4PZ8A 5BR8B 4DV0B 1CKOA 4YY3B 4DV3B 5D1OA 4UCUA 1N34B 5LMUB 5LMNB 1XNRB 5DISC 1B04A 4LF5B 3T1YB 3BAAA 3RTXA 3SGIA 4DR2B 4JI4B 4JI6B 4B3RB 4K0KB 3PN1A 1TAEA 1P16A 3W1BA 1X9NA 1FVIA 1CKMA 4DUZB 5FPOA 2HHHB 3NBZB 3BA9A 2ZM6B 3S24A 2UU9B 4UCSA 4EFBA 4LFBB 3QWUA 1N33B 5IWAB 1VS0A 4CC6A 2VQFB 3BABA 1XMOB 3GDEA 2CFMA 1FJGB 3W1GA 4DR3B 4NXMB 3JSLA 1N36B 4B3MB 4DR7B 2UXCB 1P8LA 4LF7B 4YHHB 1N32B 1XK5A 4LH6A 4GKJB 4UCOA 1S68A 2UXBB 4X65B 2HIVA 2E5LB 4E6NA 5FPRA 2UXDB 1CKNB 1HNWB 4JI1B 4DRFA
chains in the Genus database with same CATH superfamily
2AGQA 1NTZH 1X4TA 1B6RA 1AR1B 3UFXB 2V5AA 5B3SC 2YUAA 4DV4B 5EOYA 3GTJA 4X1KB 2R82A 3GTGA 3F7VC 1M93A 4QIWE 1EKVA 1NS1A 1M57B 4IR1A 5KT6A 4JXUA 5KG7A 5EIBC 1J5EH 2AU0A 4JASA 2QKAA 5AG2A 2UUCO 4LBEC 1AR4A 3CE2A 4EGQA 2W57A 3JZ6A 5KFJA 1VMGA 5CBGA 3KXYT 2Q7EA 1QNMA 1N0JA 4MVRA 4Q0YA 5CA0B 2R7ZA 5LL6b 2DWEC 5H2FZ 2XAJA 2N05A 5BR8O 3D8CA 4J0MA 3WO1A 4B3TB 3HKCA 4CC5A 2DW4A 2HIXA 1ZSPA 3JRWA 3HOXG 4WBNF 1I5YA 3T1YO 3UO2A 1RK5A 1Q81W 4DV7H 4P2ZA 2VA3A 4JI6O 1JMKC 3VPCA 5FLXN 3UZOA 1S5LZ 4LNUA 3JARB 5B3SB 4HNTA 1Q6HA 4ED0A 4QIWF 1I5XA 1IBKH 4R7RA 3R5HA 2PMZA 4ECXA 2JEJA 2KG7A 1BHAA 2XHBA 1XNQO 2YXHA 2Z5UA 5J9PC 1OWTA 2YYAA 3CEBA 4WBNA 3PR4A 3RGXA 1B6QA 1CQIB 3WG7C 1OCRB 2ZE8A 3MWDA 1PNKA 4DV3B 2UXCO 5LMUH 4GT1A 4YB8B 5BWVA 2V9WA 1K1QA 4JI7O 2QDOA 4BWSC 4JI4B 3HKZE 2QK4A 2GPWA 4OX9O 1ZETA 2R92G 4KHPO 5LOVF 3TIGA 5LYJB 1TVKB 3GWOA 2Q7HA 1I2LA 3ETEA 3HKBB 3HB3B 3CMAV 3FYIB 3R9RA 3JASA 3RYIA 2PYLA 4ZOLF 4IZOA 4QPJA 1JQ0A 2Z04A 4H0LB 2W0XA 3OM3B 3ZBHA 1SEIA 3SDLA 1XMOB 4NXMH 2CFMA 3ASNC 4DK1A 3CVZA 1YHQV 3WG7B 4QWAA 5DN6G 4PHZA 1XK5A 3ORQA 5A9GA 2KKWA 4RUEA 1WN7A 1US6A 4JGSA 1Z2NX 3APOA 4L1KA 3DTFA 3ZS8C 1I7LA 2ITCC 3TXQA 4I4TF 1KTAA 2QWRB 1A0IA 4G28B 2R7MA 2P22C 2Q7GA 1J95A 4FPPA 4QNHB 1F7YA 2RN9A 1M0WA 2V7QG 3JSNA 2YDEA 1BSMA 5B1OA 4U7CA 1RK6A 3T1HH 3GV8B 1EKFA 3PW5A 2JS3A 4IIJF 1YZBA 3SYOA 1HNZB 4A3EG 3AG2C 4ZHQA 3HKZA 2WLIB 4LFBO 1KKCA 2Q0AA 3ASNB 2YC0A 3N2GA 2HVKC 3T2MA 3P32A 2OTJV 3J80W 2W9CB 3AK1A 3TY5A 5EZYB 3ZHUA 1PL0A 4X1YA 3KAKA 2XGQA 2L35A 3NC0B 3GVMA 3DC6A 2WB1E 3JCZA 4IHJA 5D5QA 4NXNH 2JIZG 1IOVA 3CSWA 1JX4A 2N74A 4LCUC 4B3RO 4MV4A 4ECQA 4HZ3A 3N42B 4OGQB 1D5NA 2R9IA 5JJEB 4CH4A 3K03A 4FVMA 3TW7A 1K3EA 4O2AB 4LF4B 3OUFA 1Y6XA 4UCTA 3K0GA 4X1KA 1D2DA 3UT5B 5EDWA 2HVJC 4EFEA 2JVDA 3W7TA 4DUYH 2RGRA 2IJIA 2JA5A 4WD3A 4DR4H 5KFZA 3LSSA 2BTQB 3ZJZA 4B08A 1G4YB 2DN9A 3WNZA 3AG2B 2Z0AA 2WAMA 4TT3G 1JFFA 4PZ8A 1FJGO 2GTSA 5BWTA 3X2QC 1R6TA 2NLJC 3LDDA 3ZRWA 5D1OA 5KMGB 5CA0A 2UXXA 1N34B 4FMTA 1YCIA 2EULA 4GKJO 3EXAA 2IU3A 1SQGA 1TWHA 4GX5A 4P9OA 3OUUA 4DYLA 3HO8A 1VBHA 4R8CA 5CA1B 4TWKA 1X9NA 5KX5F 4UVBA 2HHHH 3OTOO 1JJOA 4CS2A 4DUZB 5JCOC 1BS3A 2DYRB 4TQSA 1EHIA 2MCTA 3JARA 4RU9A 2X6AA 1IYDA 1SZTA 4CBCA 2CTWA 5F9NA 4PWQA 4ZKIA 5IJ0B 4I9QA 4LF9O 3CHXA 1SCUB 2Q68A 4U3FH 3BABA 5L3GA 4F4XA 1P7GA 2VRZA 3J81W 3EPGA 4MTFA 5LYJF 1I2KA 4B3MH 3JATB 1M0TA 3H3VH 3ETDA 2P7TC 3GILA 4JYAO 4DR7B 3X2QB 2FL4A 3TQ1A 2Y0PA 3T1CA 4MS2A 2KSWA 1QBZA 3B8MA 3K5MA 4XX0B 4DR6O 4JI3H 4LFAO 2HJWA 3OD4A 2DAAA 1B33N 1BE3H 3SPHA 3AW8A 2BE3A 2JJ1G 4C5AA 2RDIA 3TY8A 1G6UA 1PM9A 4NYKA 2R9AA 2R7NA 3TXSA 1WRVA 3MR5A 1C30A 3M8AA 1GRJA 2GQRA 4ED1A 4LF6H 1IBMH 1IBLO 1E4FT 4YJ3A 5BWUA 1WB8A 4M0JA 4UB6Z 4X64O 4X66B 4JI8O 2A0LA 3B2EE 5BMVF 4MSWC 3RFRA 2VUGA 5FR9A 4JTCB 1ZX3A 5I5TA 2WLJA 4EYHB 4MTOA 4JAUA 3GIKA 1OCOC 2GSMB 5B1BB 3HKDB 1GTOA 1LUWA 4PA9A 3L9DA 5DG7A 2VQEB 4LF5O 4O2BF 2WLLB 4QE7A 4GUNA 3JAWB 4R7CA 3K9SA 3SI8A 1R9TA 1VF5B 1RJPA 1A48A 2LQTA 1S3JA 1P7BA 3HR0A 5EZYF 3E8GA 2UUAB 3TEKA 3O65A 3CRQA 1XMQB 4C5BA 1IVSA 2ZM6H 4UUGA 4MA0A 5BYBA 2YI8A 3OMAB 5LA6B 3DXRB 2M6YA 1WNSA 4O2AF 1NU1H 2A7WA 1OCOB 1N36H 2E2IA 5EBWC 1AI5A 5I5UA 5EZYA 1Q7YW 5FL7G 2RDCA 2E5LO 1R3IC 4WFAV 4JI1O 1P16A 3QQMA 3HOUG 4DV2O 2UXDH 1PP9H 4YXWG 3BEHA 4QWEA 3OSPA 2EJ0A 3LP8A 2UU9H 3S24A 2KB1A 4IR9A 4O4LA 3V4ZA 2NUAB 5I5YA 3G67A 2VQFH 4A3BG 2W6MA 2ZDHA 4OXSA 3Q2OA 2E74B 1EYZA 2QKSA 2W6NA 5IE9A 1NTMH 3W1GA 2BTQA 3LUTB 4DV6O 4RNMA 1OJHA 1F51A 4DV5O 4BW5A 3MFHA 4I50B 1EZJA 3L70H 4D7TA 2CNVA 1WCMA 4FM2A 5KMGA 4DV1O 3QZ7A 4FU0A 3GV7B 2Q6AA 1R1BA 4ABMA 4FLXA 1Y1VA 5KT3A 3JD0A 4DV4H 1Z5WA 4EBCA 2XAQA 3VQVA 1Q6IA 5E25A 3JAKA 3S3WA 5CA1A 4LFCB 3PJSK 2UVRA 1I94O 3CSXA 4X1IB 2DQ0A 3ETHA 5EWEA 3G6EV 1Y76B 1I1LA 3VPBA 1IXMA 1L1FA 1NR1A 1BL8A 4G27B 5EBMC 5I47A 1GKFA 4DR1O 1ZQ7A 1CEZA 2XCPA 3M9MB 1IDSA 2W8KA 4JV0A 3HPLC 4ECYA 1XI1A 4AQYO 2DE0X 4B3TH 4AYBE 2ZGIA 3JATA 3WB0A 1FAFA 3KHGA 2EZPA 4MVSA 5H6RA 1AR5A 5EIBD 4FLVA 4GZRB 3CMEV 1XNRO 5CAEB 1E1QG 2GHYA 2FLNA 5BPFA 3E8BA 1R73A 5A2QW 2W9AA 1SF9A 2QWPB 3WB1A 1FXVA 2DWDC 5KFGA 1AJQA 2Y69B 5F9LA 2WTFA 2UVWA 3RYHA 3FB8C 4TV9B 3T1HB 4CKEA 3CRMA 2GPSA 3RB6A 3GV5B 5L1JA 1BNCA 4BAYA 1B06A 2UUBB 2F4VB 1SQXH 1GH6A 4NZNA 5KA6A 2JA6A 3RJ0A 3BHPA 3L4JA 5B66Z 1OBGA 4DK0A 3LDCA 1Q82W 4TQFA 1OBDA 2Q73A 2BTOA 2YIDA 2ASJA 2QTSA 4DV3H 5J2TB 5B1AC 4DV0B 1VQ8V 4DXWA 4Z1VA 3T9FA 3L72H 3LNMB 5KS8A 3HKDA 1RJRA 2BCCH 4JI4H 2B63G 5C8YB 5KFEA 4DR2B 2BR0A 1BT8A 1PKXA 2R8GA 2WLLA 4FM9A 2PGGA 3OMIB 2PY5A 2HEPA 4WCEV 1GGOA 1UC9A 4NTYA 4UV9A 3CYOA 4ED6A 1N33B 3EFFK 2ALZA 1TUEB 1AP6A 2I8CA 1XMOH 4M7EA 1YEWA 3JZIA 3OHBA 2FK2A 1AILA 2WPDG 3H20A 5LA6A 4G3IA 2K1EA 2ZE6A 3DXRA 4JAVA 1PK8A 5B1AB 2G38A 1KECA 2P6JA 1HR0O 4BBRG 4X65B 4LP8A 1AB3A 2LFRA 3SJBC 5LP6F 3AK2A 3U0GA 1WJZA 4EEQA 4JI5O 1FD9A 3EVKA 3W5OA 4B7EA 3J7AK 5D1PA 1AUXA 1IXBA 4LF8O 5JJJB 1HNXB 1CPYA 3CX5F 3CQZA 3GTKA 4K6NA 3OR6C 3IC7A 3TK1A 4DL4A 4MW3A 2R8IA 4B3SB 3JAMW 4ZI7F 5KFMA 1HNZH 3W7WA 3HKCB 4KL1A 3CC4V 2HHHO 1ET0A 2UVUA 2B9ZA 3AYHB 2XIGA 2OWOA 2GBOA 3KG2A 2L6LA 3RF2A 2HG5C 1CQJB 5TISZ 3WFVA 5I5XA 3W7UA 4E4TA 5JVDF 4LNUB 4MTGA 1WAZA 1PD3A 3F7YC 3K3WA 4IT5A 4I50A 3K58A 3M9OB 3C90A 3ML0A 4O86A 1XHZA 2KG7B 1DGSA 4ECRA 3RWRD 3MAQA 1EN5A 2FYUH 4LF4H 4MVUA 4LF6B 1Z2OX 3A0BZ 5C4XG 3Q8RB 1NTKH 4J9QA 3T5HA 1EZVH 2R8JA 3FB7C 1FXKC 5FLMG 1ORQC 4O7TA 3BQ1A 4DQNA 4CZZA 1E79G 4X1IA 1KJIA 1K4DC 4JAAA 4O4HF 1MABG 2V58A 3ZRSA 3KREA 1UPGA 1QVGU 2FPIB 3OE7G 3OTFA 4A3FG 3P3NA 1N34H 4W4KA 1GN3A 4P30A 4PJ0Z 4LF7O 3LWBA 1N4CA 1Q6UA 3K3PA 3K04A 4O3PA 1I1MA 5KT7A 2W6PA 1CP9A 2N04A 2UXBO 3RW0A 3G6BA 3JASB 3RYIB 2OIEA 1I0HA 5FNVB 1S9FA 1H2GA 4IWXA 4DUZH 2EZOA 4NKGB 4QGPA 3NGDA 2XCAA 5J2TF 1KJ9A 5FD6A 2ZXWB 1JPXA 2C2RA 2ZM6B 3V6HA 3MHSC 4TV9A 1FXKB 3CCJV 2RQ6A 3HT5A 1VS0A 5C8YF 2CQYA 3QVNA 4DL2A 4JV5O 4RZRA 2PVPA 1M90W 4KFMA 3RYFA 4DR7H 3H1KH 5DG9A 1FXHA 1KP2A 1N36B 5C1PA 4YHHB 4FZ0A 4LH6A 5CB4A 4I0XA 4FK5C 5KFPA 4E6NA 5FPRA 5IDJA 2UXDB 1R3JC 1H8HG 2EIYA 3QTCA 4I5SA 2AXTZ 4RUCA 2A3QA 2E3CA 3GB8B 3L4KA 4GLWA 2H3OA 1BHBA 5JH7B 2Y4TA 3Q8PB 4ZIBA 2VWKA 2ZDGA 4JI0B 4DR5O 1FPOA 2VOBA 3VQWA 3ZN1A 3N2GB 5KFOA 1OHHG 1GAXA 4X66H 1NR7A 3ZMSA 4X1YB 4F6RA 4J9NA 1F4NA 2R93G 2OIGA 1K4CC 1PX2A 4YY3O 2QGNA 3RR5A 1JJ2U 4E4EA 5HFLA 2ADQB 4WFEA 4O7SA 2VQEH 2VUMG 4DR3O 3CEIA 2YIBA 1XBLA 3CCUV 5LMNH 3V6JA 1N8RW 1KJ8A 1JXLA 3L74H 1FKAO 4K0KO 5L3FA 2YIAA 3J80N 1M7JA 1EN4A 4D7SA 3DTUB 1ZAUA 2FTKA 2DMXA 4NTWA 2UUAH 3R65A 2W6JG 1XMQH 2V4DA 3L75H 3KZIZ 1JFFB 3RAQA 2JEFA 1OCRC 5KAIZ 3ZRWB 5D1OB 4FFLA 4LSXA 4FFRA 2UUCB 3O9OA 1KT8A 2VWJA 3BG5A 4PDRA 5BXZA 3TCUA 3BJYA 4LR3A 4I7HA 3F5TA 5BR8B 1XEQA 2EIMC 4CH3A 1NVPD 1KKDA 1N32O 2NVYA 2Y0IA 2FP4B 1DLBA 1EM1A 3SJQC 4ETSA 1B04A 3T1YB 4FM0A 4TV8A 4JI6B 2GLTA 4O4IA 2PI4A 5KT5A 1JDEA 3P30A 2YL2A 1HW7A 2QB5A 3JZFA 1S97A 1P84F 4N23A 2V59A 1DV2A 4A2AA 3KALA 3N6RA 5DM6V 1SQPH 1VQ7V 5FNVF 1EFRG 2J9GA 2YXYA 3ZHTA 4X62H 3QG5A 3JSLA 5GW7A 2E76B 2UXCB 3H01A 2D3OW 1BXRA 2EIMB 5DGIA 5DAAA 2JGDB 4UCOA 3OGCC 2W7PA 3L73H 2V1DA 4R50A 5EC2C 3N6XA 4L8JA 3J81N 2NVXA 2BOCC 1EKPA 4DW0A 2M05A 2EIJC 1KU9A 4LFCH 2H94A 3E89A 4YJ3B 5FNVA 1JDBB 2R6FA 2LFSA 2ETNA 5DGBA 3BRCA 2QJ1A 3ZMZA 5CM0A 4I9WA 4B7KA 3TY9A 1FXKA 3N41B 3A0RA 4QWDA 4O3SA 2LO1A 1QVFU 4UCVA 3RB3A 1COWG 4CS4A 4MV8A 4H37A 5DLFA 3RN4A 2RDJA 3I4MG 3H1HH 1BMFG 2FPPB 2P5OA 4ZHQF 4BY1G 3DSQA 3RBDA 1TWAA 1G1XB 1YF2A 1QQCA 5KFSA 4Q44A 4JYBA 1NQTA 2MW2B 4IHJF 4BIUA 3GJXB 2EIJB 4YAKB 1O9HA 5LL6Y 5JH7A 3H1IH 5KFLA 4DL7A 2UUBH 2F4VH 3TJTA 2XC9A 3E86A 3L2PA 3N43B 1V51A 3W7XA 4DL3A 4FFKA 3THOA 3MR6A 2ABJA 3PZPA 4UUJC 4DV0H 1WA8B 3JYCA 1WP7A 1QU7A 2WLNA 1WH2A 4A3GG 3BFRA 3CJHB 2B63A 3SYAA 4DR2H 4FBUA 2NU8B 3L71H 3I4NG 4OPHA 2DYRC 3SGIA 2YZGA 5CA0F 1VQ4V 4O4LB 4B3RB 2YU9A 5H9CA 4CKBA 3SE7A 1DK1A 3IC9A 5H5NA 4QJFA 1ROPA 4BIOA 5C93A 2ZR2A 2CNUA 3IGAC 2CNQA 2C35B 1N33H 4QW9A 4FS1A 3GTLA 1LNQA 1VEWA 3ZN0A 3RUPA 2XT9A 2YICA 4HYKA 1EUCB 1AN7A 2XAFA 1FJGB 2GDSA 3ZMUA 3B09A 1YJ9V 4J9LA 4MTDA 4AI8A 2QM4A 2IJKA 4X65H 4GKJB 1V55C 2XUMA 3MWMA 3ABUA 3JAKB 2ZDQA 4FLTA 1LUVA 3FKIG 1MZEA 4J7ZA 1VF6A 5K2MA 2R7KA 1TWFA 2PI5A 3ZCCA 4GKKO 5L1IA 3ETQA 2A79B 4TUYA 5KFTA 2AW9A 4EEYA 1TWGA 1Y66A 2C2DA 4JV1A 3OTOB 1HNXH 4JI2O 2YCHA 2JA8G 4DO2A 3MFIA 3E22A 5E1AC 2M7WA 4YIOA 2VQDA 2Q8VA 4B3SH 2FLPA 4XDJA 1YITV 4CS3A 4LF9B 1MA1A 3AG3B 2HDKA 3T5KA 1S76D 3T9EA 1L2ZA 2XAGA 2JDIG 5B1BC 2Y4UA 2WSSG 1RPRA 3CCMV 4YJ3F 4JYAB 2EJ7A 3T4DA 5JUMA 4FIPC 3M7MX 4RAYA 1VQLV 1V54C 3MDSA 3RV4A 1V55B 4DW1A 3RYHB 4DR6B 2Q69A 4BWAA 4LFAB 1XUQA 2JGDA 3B40A 4O3NA 1AI4A 4EQ5A 5JQWA 3EPIA 2YS7A 3ABKC 4TQRA 3CRAA 1W59A 5IT9W 3ICXA 4JTAB 3H40A 4WHXA 3SPIA 4EKWA 2EILC 3K57A 3SJCC 1T5EA 3WWIA 1MMMA 1IBLB 2V4RA 2GTAA 5KFIA 4IAJA 3TETA 5EK0A 3U55A 2ZR3A 5A2QN 4X64B 5IWAO 4FFMA 4JI8B 4KXRA 2WA4A 3IFXA 1YSCA 3ZMTA 5DEDA 4IGGA 2R85A 3CD6V 1CE8A 3VBBA 5DISC 5LMNB 1S0NA 1SERA 4KP4A 1V54B 1S0OA 5LXTB 4LF5B 3ABMC 4O7VA 4FFBA 1HNWO 3T5LA 5IYDO 3W1BA 3TINA 5EBLC 5C3EG 1S10A 4IL6Z 3ZHQA 3ABKB 5KHJA 5B5EZ 4RQEA 1PPJH 3NBZB 1H2SB 5C44G 3D36A 2YW2A 2EILB 1TUBA 2OCHA 4FE2A 2QYZA 3Q4HB 3GWKC 4A5UB 1GN2A 2ZIMA 1JKJB 5LHHA 4O4LF 3OFNG 1J5EO 3GDEA 5KUKA 4FLZA 1EN6A 4MAMA 4YHHH 5EYPB 5KG4A 3DF7A 1WA8A 1VAJA 2A06H 2YI9A 3S3XA 1UNNC 3CPWU 1W0KG 2E5LB 1KYOF 4PD4F 3CJHA 4JI1B 2ZIOA 3ABMB 4DV2B 2X6CA 3HB9A 4ECWA 2RF4A 4ED3A 3AG1C 3CC7V 1GMGA 4DV7O 4JI0H 3TGUH 2JA7A 4CE5A 3N44B 2IBZH 1VQ5V 3PR5B 1PL4A 1FS0G 2AHYA 1KQSU 4O4JB 5CA1F 1IBKO 2Q9LA 1KD1W 4X62B 1SQFA 2R93A 3K3VA 2HG8A 4LH7A 1TWCA 4FM1A 5DQGA 1RSOB 2Q67A 4DV6B 5LGUA 1N56A 4DV5B 1MSDA 3RB0A 3C0FB 4RB3C 3JAMN 1GSAA 4F6EA 4DV1B 5LMUO 2VUMA 1N0NA 2Y69C 4J9MA 2VPSA 3QO5A 1ULZA 4GLXA 5KUMA 2PF4E 1NJIW 4PZ6A 1ENVA 3TW6A 1L0NH 2HP8A 2QM8A 2NU9B 4NYEA 3AG1B 3FAVB 3K5IA 2AQ4A 4PELA 3HOYG 4FFPA 3LMLA 2ASDA 4U7OA 2BQRA 1I94B 3A2FA 2XOKG 3UM7A 5E79Z 4NVPA 3KCXA 2UUCH 4TQDA 5DQHA 4C5CA 4FGRA 4MV1A 4DR1B 1ZUQA 5KAFZ 2COIA 2FK1A 5BR8H 4AQYB 2PBZA 1F4MA 2XNDG 3IG0A 3K5HA 4NXMO 5KFWA 5KFCA 3PW2A 1G2WA 3E35A 4HAMA 4UCUA 3ZMVA 4IYHA 1XNRB 4NZOA 3T1YH 4ME6A 3K79A 4JI6H 2YZLA 2V4QA 1AROP 2YS6A 4FZ1A 4I55B 3RVZA 3VQXA 5KKNB 5JVLA 3FX7A 1ZL8B 1VQNV 5C5JA 5L1LA 1GSHA 5KFYA 5FPOA 4E2LA 4NR1A 4DAAA 1B3QA 4ED2A 3RYFB 1VP7A 4HQ6A 4GX1A 3V6KA 1XNQH 1URFA 2H8PC 3BACA 4LC1A 2C28A 2IH3C 4AILC 4Q4DA 5LXTF 5KFRA 4MV6A 2CGNA 3T1HO 3T4ZA 4CC6A 5CB4B 4M9UA 4I0XB 2A1HA 1V4YA 1H2LA 1JR9A 3E83A 1VBGA 2UXCH 2C22A 2FPGB 5DG8A 2J6SA 4A2BA 1FFTB 1GM7A 4Y8VB 1BZKA 4PDMA 4TVIA 4JI7H 2Y0SA 2R92A 2R9RB 5LA6F 2QWNB 4XDLA 4MVOA 5KG1A 4A3LG 2J6TA 4OX9H 1Q3EA 1AI6A 1M1KW 4KHPH 1VKZA 2EX3A 5FJ8G 5LXTA 1T3NA 5KHGA 4NXNO 1T94A 2RCVA 4UCRA 2ODMA 2R7LA 3IN5A 2I80A 5IJ9B 4F6RB 1Z2PX 5LHGA 4U7NA 1ZTEA 5F2VO 4R8UB 4ECTA 5L1KA 4A93G 3CC2V 3MJFA 3OUSA 1JLLB 3RBEA 1WPXA 2ZE5A 3Q4HA 5EC1C 3NXSA 2ZNJA 4YJ2A 4DUYO 3GIMA 1BCCH 4DR4O 2R87A 2JA5G 3RYCA 2ZNIA 2P0AA 2IBKA 2KSDA 3FB6C 5EYPA 3UKMA 1HR0B 2YEVA 2CK3G 3QNEA 1H38A 1YJNV 3A0HZ 3MD0A 4A3MG 1Q90D 4XDKA 1QLNA 5CN0A 2QM7A 1O9GA 4PA3A 4JI5B 5IYZA 5KFDA 3BVOA 3CXCU 4I50F 5KFQA 4LF8B 1KMIZ 2HVQA 4J9YB 3H4DA 4UB8Z 4IYIA 2W9BA 2EIKC 5KFAA 2Z02A 3C3SA 2CE4A 1WP8A 4O4JA 4QPKA 2QWOB 3H9VA 4LFBH 5BPHA 2AHZA 5JWPA 1OCCC 1JVMA 2LP7A 3E8HA 3OUZA 4TV8B 4O4IB 4B3MO 5IP7G 1XL4A 4RQFA 1DIKA 1W93A 1RSOA 3I5DA 1PNLA 1Z5VA 4BW9A 3CCVV 3UO3A 4B3RH 3SPGA 5DECA 3AK3A 3E8FA 2ZXWC 2I87A 1SETA 1JOYA 4JI3O 4J41A 3PO2G 1Q43A 4OPAA 2YRXA 2CH7B 3FAVA 3GIQA 2JS5A 1YVWA 3U0ZA 2K9PA 2F95B 5ITZA 2RJZA 4LF6O 1IBMO 2EIKB 3R5FA 4TV9F 4J9PA 2YS8A 1FJGH 1Z2GA 1K34A 4BXXG 2DWCA 1OCCB 4D6TH 4LF7B 1ZHSA 2EJ2A 4GKJH 3QZ8A 2MK3A 4BBSG 4PDBA 1KP3A 2R84A 2AZ2A 4YAJB 2FMAA 2UXBB 2DYSC 4MT8A 3T9CA 2R70A 5CB4F 2EBOA 3STLC 3KHHA 3VQYA 3OTOH 2P06A 1VQ6V 4I55A 2PTMA 3NUAA 2ITDC 4F4WA 1ZL8A 5K3WA 1GM8A 4LMYA 1CKNA 2P90A 4LF9H 1NI8A 2AGAA 4F4YA 2W7OA 2HKOA 5KFHA 4JV5B 4A3KG 4JUZA 2ZM6O 3HKEB 1DAAA 4JYAH 2FB9A 5DMXA 3NBYB 2HVSA 1OZ0A 2ADPA 1Y14B 4YR0A 4LSAA 3KYHC 3GIJA 2XD4A 1AUVA 2DLNA 2Q5ZA 2HGXA 4WFGA 3OEHG 5LOVB 5I60A 4EBEA 4LFAH 1H2KA 4DR6H 1BGYH 1E4EB 4ED7A 1YJWV 1NH2B 3ETJA 2WA3A 1N36O 2DYSB 2WLMA 4J9RA 3D3IA 1QR8A 4ZOLB 2HGWA 2ZD9A 5L3BA 2ODTX 3T99A 5CE8A 1U97A 2QSAA 2FE3A 4ECVA 3QO8A 2ZE7A 2GUZB 3SYPA 5KHIA 4DR5B 2UXDO 3CWBH 5L9XA 1IBLH 5IJ9A 5L3CA 2UU9O 4X64H 4C2MA 4JI8H 1R6KA 3STZC 4R8UA 2FB5A 3FKSG 1FFXA 1NT2B 1WLEA 3JCUZ 2VQFO 2COJA 1VF6C 4EB6A 1KB9F 1MSWD 5KFNA 4MV3A 4YR2A 2QF7A 5IYBG 2AZ0A 4YY3B 1X59A 1AP5A 4CHIA 3ZHSA 1MG1A 3R5XA 2C2EA 4QJFB 4LF5H 3F8NA 1THZA 3ZRXA 3GIPA 3WU2Z 2LW1A 1Y1WG 4K0KB 1L0LH 1TAEA 2ZKOA 3B8NA 2WE6A 5KFXA 5HV6A 3SR2C 2JRIA 5KG6A 4DV4O 1GN6A 2ATKC 3B4SA 3R23A 3CXHF 4O4IF 4TV8F 5I5SA 1Q5OA 1Y1VG 3BA9A 3AG4C 1Y74A 5CBHA 3VMMA 4NB5A 1EUDB 2ZCEA 4XYMB 3T54A 4ECZA 2FMLA 4EG0A 3T7AA 4EYIB 4A3JG 5BWRA 1SYXB 4APMA 3K0DA 1SS3A 2RNBA 4RWUA 3K5OA 3KHLA 2YSUB 5BY1A 3LDEA 2CW7A 4J9OA 3GIDA 1N32B 4TUYB 1BQ0A 2KQXA 2Y48A 4B3TO 3BQ2A 1YTFB 2E5LH 4J7KA 4FJCC 3SPCA 4JI1H 3E22B 4JZ2A 4NTXA 1AI7A 3BPZA 3AX6A 4DV2H 5KHKA 2D2CB 2SCUB 1MOFA 4DLKA 4R6ZA 4Q8EA 1XNQB 2BOBC 1SZXA 3N8DA 4ED8A 5KFVA 4RB0A 1QR9A 3CB2A 3OSNA 2CH7A 3AG4B 1CS0A 4YBZB 3K9AA 3LNNA 2CAZC 1QHTA 3BA8A 4GX2A 2Q7DA 3R66A 2HHFA 2DABA 5GTIZ 1Y4MA 4X9QA 4XYLB 5KFBA 1K7DA 2JEUA 1K5SA 4FFOA 4DV6H 1RP3B 4JI7B 4DV5H 2PN1A 3T9DA 1HWYA 1OV9A 2JA6G 3VPDA 4DV1H 4DV3O 4OX9B 3VNNA 4KHPB 3MHHC 5KX5B 2F23A 4QWCA 3D36C 4PBCA 1O75A 1DF4A 4JI4O 3G71V 2IP4A 4QIWA 3ABLC 1JCHA 5CMUA 4MTEA 5IYDG 1I94H 4BR6A 1TA8A 3G6VA 1P4RA 4K8ZA 4JYCA 5BZBA 3SYCA 3JRXA 4PDVA 1F23A 1MNGA 2LJ2A 4RCNA 4DR1H 5JH7F 3K08A 1SC5B 3VA7A 1D5AA 2OH2A 3K5NA 5IT9N 3GTQA 4TSFG 4AQYH 1VQPV 1I7NA 2XAHA 4HBNA 1XMOO 3HKEA 5GTHZ 3ZHRA 4FFBB 5KLVH 1CKOA 1XNRH 3GTPA 5HBRB 4IRCA 4QE9A 1K92A 3ZHVA 3T9BA 5LOVA 4I7ZB 2W6QA 2Y4RA 3BAAA 3ZIAG 1E4EA 3UZBA 5DLGA 4RUAA 5IYCG 3JD2A 2Z3YA 1TUBB 4RB1A 3OMNB 4DRXA 1FVIA 1H2MA 3ABLB 4ZOLA 2QEXV 2CKZB 2BQUA 1IX9A 4O3OA 2VR1A 2GQSA 3RGZA 2GUZA 1VQ9V 5BMVB 4JYYA 2WLKA 4MVMA 4UXNA 4NLGA 2J6UA 1XREA 5LGNA 4LFBB 1BQZA 1KBHA 1M56C 1XHXA 3H0GG 1SQVH 1HNZO 3I55V 4MVZA 1KBLA 2YRWA 2JEXA 2DPJA 1S0MA 4O2BB 2ILMA 1DV1A 3PO3G 5CR5A 4J10A 3ASOC 3OEEG 2DQ3A 5B1NA 3BY6A 3PFFA 5D8DA 3M4IA 2ZDIA 2OCCC 3M9NB 5HFMA 2EINC 4I4TA 5FD5A 1T36A 1KC8W 2YIBD 4DRFA 2XGPA 4MV9A 3DTGA 5DGAA 2WWWA 3OGIB 1VQKV 3AG3C 4UVCA 4K8XA 3DGEA 1E4GT 3FMAA 1YIJV 2BSKB 4TUYF 4IIJA 4U3JB 1VQMV 4A3IG 4LF4O 1GSOA 3JD1A 3CRCA 4UVAA 3ZRVA 5IYBO 4JPRA 3MWEA 4Q6GA 3H4BA 1XDCA 1M56B 1U96A 4JF3A 2B1GA 2R86A 3T9AA 5FLXW 4H44B 4P9PA 1HR0H 1AJPA 1H8EG 3ASOB 3MR3A 3HOVG 1N34O 3LSQA 2OCCB 2NU7B 2EINB 4NZMA 4GKKB 4JI5H 3B77A 3N27A 4RB2C 4LF8H 4O7WA 4JI2B 5CA3A 4O7LA 4Q4CA 2HLDG 1E1RG 3VOUA 4DUZO 3UCSC 3K5LA 3WO0A 1XDNA 1GLVA 2DIKA 3JD4A 1V9PA 3RAXA 5D5PA 1SKVA 5KFFA 2YZNA 3KAJA 5KFUA 4J80A 3AG7A 5K1PA 2O03A 3G8CA 1DF5A 2WAQE 1JA8A 3GLKA 3HOWG 2WYOA 2WB1A 2W70A 2CUGA 3OAAG 4DR7O 1FYJA 3PW4A 4UV8A 2ZT9B 2C2AA 4WFFA 4H13B 4Z2WA 1IZ3A 5KX5A 3CCEV 2PUSA 4QSHA 1BJTA 5EWGA 3FD9A 1IOWA 2XCLA 1K1SA 4YR3A 1W96A 3HOZG 1AVMA 2QTOA 4PDLA 5JJNB 1M9NA 3FYEB 5BWXA 1UFIA 4FLYA 3U11A 2PZSA 1PV0A 3VOTA 4O3QA 2ATLA 1N48A 2HJFC 1AJNA 2IA6A 3RGBA 2FKXA 4TM5A 4Q45A 3MR2A 3LULA 3C3TA 5LYJA 1TVKA 1I1KA 5IWAB 4WFHA 3RT3C 3U54A 3HKBA 3BCCH 4X66O 4LF7H 1GK9A 2PYJA 4PI2A 3ABTA 2RGVA 1Y67A 5LHIA 3G8DA 2F1MA 2X0LA 4L87A 2UXBH 2COGA 1S68A 3UYYA 4HNAB 1K83A 4MVQA 4PI0A 3GTMA 1HNWB 2VQEO 2W6IG 2O57A 4RZQA 1VIBA 5LMNO 1SQQH 4A3DG 3U9TA 3ZEDA 2WAQA 5I5WA 4YJ2B 4WF9V 2F93B 1NH2D 2X5RA 5BYAA 4X8AA 5KG0A 2UUAO 4JV5H 3RYCB 1XMQO 1KJJA 1Q86W 5BMVA 2CDYA 1J5EB 2YEVB 2Q4PA 2Q0OC 2W71A 4HYOA 3SPJA 5LP6C 3JALB 4HR7A 5GONB 3RBZA 4GX0A 3WWHA 3E5NA 5IYCO 5IYZB 2R7ZG 1YXBA 1A0GA 4X20B 4O2BA 1HDJA 2C00A 2IM9A 1BGWA 3RB4A 4LWSB 4A3CG 1QLEC 2QWQB 4RO2A 1YDXA 2NN4A 2LGWA 2WLIA 3J7AU 2R72A 2W9CA 3CCSV 5KG3A 1PNMA 5K1XA 2P67A 4DV7B 2HGSA 2W9BB 2CGOA 4DR5H 1I08A 5H80A 4F4ZA 1NKDA 4IRDA 3KCYA 1IYEA 2CZGA 2HJDA 4HN2A 4GC6A 3APQA 1A9XA 4Q43A 2A9HA 1GO3E 3N40P 2BSKA 4U3JA 1IBKB 3V4SA 1VF7A 2Q2UA 4GC7A 2X0SA 3QFFA 3DAAA 3PW7A 4YP3A 4O2AA 1KUTA 1NZ6A 1NVPB 3UT5A 4YY3H 4CKCA 3N2KB 5LP6B 4EBDA 4X62O 3WB2A 3Q8SB 4DR3H 2F43G 1RM1C 5LMUB 1FKAH 1QLEB 2IJHA 4JV2A 4K0KH 1Y1WA 5JQGB 4QW8A 1UJWB 5KG5A 1WB7A 3Q1KA 2Y0SE 2R8HA 2QR4A 3IJ4A 5ITZB 4ZI7B 2R8KA 2NNUA 4MTXA 4RUFA 1CKMA 1SRYA 1ZLZA 1YTFD 4LFCO 1B6SA 1GO3F 2ASLA 2NR5A 4CH5A 2FK3A 4O3RA 4C7UA 1GM9A 4UCSA 2ZQMA 4YIPA 3QWUA 1I7FA 2JEIA 1Q8IA 4O81A 5I5VA 5JVDB 3P3PA 4EGJA 1NBMG 5H6QA 2UXNA 3EYYA 2VA2A 4NXMB 1N32H 5IJ0A 2VPQA 1SA0B 4RNNA 2BQ3A 1L8DA 2RMKB 4XZ3B 1K8AW 4K3AA 1RM1B 2W8LA 4G2KA 2HIVA 3W7SA 2DOSA 1CXZB 3KKYA 4XBFA 1CKNB 2QKCA 2IW5A 2IH1C 4ICGA 4JTDB 5KHHA 3I12A 1I6UA 3CCLV 5HNEA 2Q2TA 2FJZA 1QCEA 2ZJTA 4O4HB 2JGUA 3CCRV 4F4LA 3PW0A 1S5JA 2UUBO 1GN4A 2F4VO 3RV3A 4J9SA 4GCZA 2YZMA 3K06A 3OHAA 5KT2A 1R3LC 5JCOA 1YI2V 3HBLA 2XASA 1XQ8A 3G80A 4TOIA 2GV9A 2P4KA 3LQSA 2FLLA 4YJ2F 4J42A 4DV0O 1VQOV 4J7JA 1RYSA 2JK5C 3PVXA 3D3QA 3OR7C 4HNAA 4W4LA 4DR2O 1DTOA 1S5HC 3K59A 4NXNB 4O7NA 4BY7G 1I3QA 2IU0A 5GONF 1FFXB 1VARA 2QE7G 5IYZF 1HP8A 3H1JH 4EB6B 4O83A 4PA4A 4DL6A 1K73W 3BQ0A 4WFBV 3U9SA 2WLHA 3OT7A 3JAWA 3CCQV 1A3GA 1N33O 4AYBA 1K33A 5J2UB 3EHBB 4DUYB 4JZGA 2VS0A 4J9ZB 3GTOA 4DR4B 1RPOA 4ZBMA 4UFZA 1S72V 1WSCA 1P49A 1RYRA 4O4JF 1S0VA 4ASUG 1W0JG 4HNUA 3SJAC 4QWBA 3JALA 4IRKA 5GONA 4MV7A 1R6NA 1ZWIC 1XILA 4GYCB 4X20A 3WWJA 5KT4A 4X65O 1M6VA 4LWSA 4HNVA 3U10A 2OTLV 3RTXA 1Y74B 2ARHA 2XTAA 3TQTA 3RIZA 1KUQA 1XOUA 4RAIA 3CP1A 1C3OA 2HHHB 1HNXO 3ORRA 3NR7A 5T14A 2F66C 3QO7A 4DL5A 4B3SO 3G6XA 5JQGF 3H0GA 4RAZA 3I56V 2FKLA 3IAYA 1EBOA 2LGQA 3GB7C 1SFOA 3RFCA 5DGHA 4B3MB 3SYQA 3SNOA 1LR1A 4FBTA 3N2KA 5LP6A 2DPIA 3OW2U 2IJJA 5CBFA 5KA5A 2UVVA 4KUMA 2W6ZA 4J9KA 4O82A 3E2EA 1S03G 4IWYA 1M5IA 4JI3B 5JQGA 4FLUA 2OYQA 4AHCA 2HHFB 4CMFA 4ZI7A 4O84A 2CTPA 2DJVA 3CRRA 4I55F 1ZHQA 1K9MW 2AGPA 1IBMB 5KFKA 1W2BU 4RNOA 3ZX6A 4MW8A 4WBNB 2B1IA 4O7YA 3H1LH 1TGOA 5L3EA 2OT5A 5KG2A 3G6YA 5JVDA 1SQBH 3ETGA 5L3DA 1Y76A 1KC7A 3FKIA 3CS5A 1R3KC 1SA0A 4FLWA 4GKKH 2EJ3A 4PA6A 4YQWA 3GIIA 4JI2H 2YXLA 2HVRA 3AEIA 3KTMA 3QF7A 3G4SV 1OCZC 2CW8A 2HR3A 4PZ7A 4CMDA 1KJQA 4K35A 1IURA 3UQ8A 1UC8A 4ZQIA 4H33A 2JEGA 4O4HA 4O7ZA 4N21A 2QA4V 3HXLA 1I50A 4ECUA 1SESA 1K5QA 3LSUA 4PA7A 2WDTA 4X88A 3TIIA 2ZDIC 4U6PA 2B5UA 4FFNA 2W6OA 4O7RA 1H2NA 2DZDA 1GYFA 1S77D 4DIMA 4Z1MG 5EWFA 2CTRA 1M4UA 3T5JA 5IY5C 2ZINA 4YHHO 1K97A 4DRXB 4ECSA 4Q20A 3RVYA 3F5WC 1MZBA 2LW7A 3FB5C 3JD3A 4X89A 5J2UF 2JJ2G 5J2TA 1EZ1A 4J11A 3PN1A 1RFYA 4FS2A 5LBQA 2OLSA 3Q8QB 1XL6A 1WR2A 1MZFA 4Q8FA 3FFQA 5BWWA 2IMWP 1OCZB 4F50A 1M57C 5C8YA 4JI0O 2UU9B 1JIHA 4EFBA 2CTQA 5IWAH 2X7RB 2JA7G 4CH6A 3DC5A 3GQCA 4ZHQB 2VQFB 2AGOA 4PV1B 4MA5A 4I4TB 5J2UA 5C1OA 2X6BA 5DQIA 4DR3B 2E75B 2YWVA 1P8LA 1WPBA 1KEEA 5IP9G 5LGTA 2E2HA 1JX9A 3A8TA 5IY5B 2PMZE 3KHRA 2EJRA 3M99B 4IHJB 2P4VA 1G8MA 2NU6B 1WCMG 3FDSA 1HNWH 4IIJB 1A32A 2HFEC 1RJQA 4BIZA 2W0FC
chains in the Genus database with same CATH topology
2ZIOA 4DV2B 4MV9A 4EEQA 1X4TA 3W5OA 4DV4B 3J7AK 5EOYA 4X1KB 5D1PA 4JI0H 4K8XA 1E4GT 5JJJB 3FMAA 1HNXB 3N44B 4IIJA 1M93A 4U3JB 4O4JB 4B3SB 3JAMW 5EIBC 1J5EH 4Q6GA 1HNZH 3HKCB 4KL1A 4X62B 1SQFA 2W57A 2XIGA 3K3VA 4LH7A 2OWOA 3KXYT 2Q7EA 4FM1A 4Q0YA 3RF2A 5CA0B 4DV6B 5FLXW 5LL6b 4J0MA 1HR0H 4DV5B 4B3TB 3HKCA 4CC5A 3C0FB 4RB3C 4LNUB 4DV1B 2HIXA 4I50A 2VPSA 3K58A 4GLXA 4GKKB 4JI5H 4PZ6A 4DV7H 1JMKC 4RB2C 1XHZA 4LF8H 1DGSA 4JI2B 3RWRD 4LNUA 3MAQA 3JARB 4LF4H 4LF6B 1Z2OX 3LMLA 1I94B 3A2FA 3K5LA 1IBKH 4R7RA 1XDNA 1V9PA 4NVPA 2UUCH 4X1IA 5D5PA 2XHBA 4TQDA 1SKVA 3KAJA 4DR1B 5K1PA 2O03A 4WBNA 5BR8H 3RGXA 4AQYB 2WYOA 3OTFA 3IG0A 1N34H 4DV3B 5LMUH 4UCUA 1XNRB 3T1YH 4JI6H 4BWSC 5KX5A 4JI4B 3JASB 3RYIB 2PUSA 4I55B 3VQXA 1BJTA 5FNVB 5LYJB 4DUZH 1TVKB 5JJNB 2Q7HA 5FD6A 5FPOA 3HKBB 2ZM6B 4FLYA 3U11A 2PZSA 3RYFB 3JASA 3RYIA 2PYLA 4TV9A 1XNQH 3RGBA 2RQ6A 4AILC 5LYJA 1TVKA 5IWAB 1VS0A 4CC6A 5CB4B 1SEIA 3HKBA 4NXMH 1XMOB 2CFMA 3RYFA 4DK1A 4DR7H 2UXCH 3CVZA 4LF7H 2PYJA 4PI2A 1N36B 2RGVA 4A2BA 4PHZA 4YHHB 1XK5A 2F1MA 2KKWA 4LH6A 4JI7H 2UXBH 1WN7A 5CB4A 1Z2NX 1S68A 4HNAB 4OX9H 3ZS8C 1Q3EA 4KHPH 4E6NA 5FPRA 4PI0A 2UXDB 1HNWB 3QTCA 2EX3A 4RZQA 5LXTA 2E3CA 3GB8B 3L4KA 5KHGA 5JH7B 4UCRA 3ZEDA 1A0IA 4ZIBA 5IJ9B 2VWKA 2P22C 2Q7GA 4YJ2B 4F6RB 1Z2PX 4JI0B 1M0WA 2VOBA 2F93B 3JSNA 3VQWA 3T1HH 4JV5H 3N2GB 3RYCB 5BMVA 4X66H 1J5EB 4X1YB 1HNZB 4F6RA 4YJ2A 2ZNJA 4ZHQA 3JALB 2Q0AA 5LP6C 5GONB 3N2GA 3RYCA 2ZNIA 5IYZB 3J80W 4X20B 5EYPA 3RR5A 4O2BA 3TY5A 5EZYB 2IM9A 1HR0B 1BGWA 4X1YA 3KAKA 3NC0B 2VQEH 2YIBA 4IHJA 5D5QA 5LMNH 4NXNH 1O9GA 2R72A 4JI5B 5IYZA 2YIAA 5K1XA 2HGSA 4DV7B 3N42B 5JJEB 4CH4A 4DR5H 4LF8B 4FVMA 4D7SA 1ZAUA 1KMIZ 2HVQA 4O2AB 2UUAH 4LF4B 1XMQH 4UCTA 4X1KA 2V4DA 3N40P 3UT5B 1JFFB 4U3JA 1IBKB 1VF7A 2Q2UA 4EFEA 2JVDA 4DUYH 2RGRA 5D1OB 4LSXA 4O4JA 2UUCB 2VWJA 4DR4H 4LFBH 4O2AA 2BTQB 4B08A 4LR3A 4I7HA 3UT5A 4YY3H 1JFFA 4PZ8A 4TV8B 5BR8B 3N2KB 4O4IB 5LP6B 3WB2A 5D1OA 4CH3A 5KMGB 1RSOA 5CA0A 4DR3H 1N34B 5LMUB 1Z5VA 4BW9A 1FKAH 4ETSA 1B04A 1SQGA 4B3RH 5JQGB 3T1YB 4K0KH 4FM0A 4TV8A 4JI6B 4O4IA 5CA1B 5ITZB 4ZI7B 1X9NA 1Q43A 2HHHH 1JJOA 1HW7A 4CS2A 4DUZB 1CKMA 5JCOC 2MCTA 3JARA 2JS5A 4CH5A 3U0ZA 4UCSA 5IJ0B 4I9QA 2F95B 4A2AA 3QWUA 5ITZA 2RJZA 1I7FA 3CHXA 3KALA 1Q8IA 3BABA 5JVDB 1FJGH 3J81W 4X62H 4B3MH 3JATB 1M0TA 3EYYA 1N32H 3QG5A 3JSLA 4NXMB 5IJ0A 1SA0B 4DR7B 2UXCB 4LF7B 1ZHSA 4GKJH 1L8DA 4PDBA 2KSWA 4UCOA 3K5MA 2UXBB 2HIVA 4JI3H 3N6XA 4L8JA 2R70A 1CKNB 5KHHA 3VQYA 3OTOH 1I6UA 3TY8A 2Q2TA 1G6UA 2R9AA 1KU9A 2PTMA 4I55A 4YJ3B 4LFCH 5FNVA 3BRCA 2QJ1A 2ZJTA 4O4HB 2JGUA 4LMYA 1CKNA 4LF9H 4LF6H 1IBMH 1S5JA 1E4FT 3TY9A 4JV5B 4YJ3A 3N41B 4UCVA 3HKEB 4X66B 4JYAH 5JCOA 4CS4A 3B2EE 3NBYB 2HVSA 3RFRA 2VUGA 1XQ8A 3KYHC 4LSAA 4TOIA 2GV9A 2P5OA 3HKDB 5LOVB 4DR6H 4LFAH 3DSQA 2VQEB 4HNAA 1QQCA 4ZOLB 3K59A 4NXNB 2FE3A 3JAWB 3GJXB 1FFXB 1O9HA 5KHIA 4DR5B 4EB6B 5JH7A 2UUBH 2F4VH 1IBLH 5IJ9A 2UUAB 1XMQB 3L2PA 3N43B 4X64H 2ZM6H 3JAWA 4JI8H 2YI8A 5J2UB 1FFXA 4DUYB 1NT2B 5LA6B 3THOA 4EB6A 4DR4B 4UFZA 1P49A 4DV0H 1WNSA 3SJAC 4YY3B 3JALA 5GONA 4MV7A 1WH2A 1N36H 4LF5H 3F8NA 4GYCB 4X20A 4DR2H 5EZYA 3U10A 3RTXA 3SGIA 4O4LB 4B3RB 4K0KB 1P16A 1TAEA 3RIZA 2WE6A 2UXDH 3SR2C 2UU9H 2HHHB 1Q5OA 3BA9A 3S24A 4O4LA 1N33H 2F66C 2ZCEA 2VQFH 1SYXB 4RAZA 4APMA 3IAYA 3K5OA 1AN7A 1FJGB 2CW7A 3W1GA 2BTQA 4B3MB 4MTDA 1N32B 4TUYB 2QM4A 3N2KA 5LP6A 4I50B 4GKJB 3MWMA 4X65H 4D7TA 2E5LH 3JAKB 4FM2A 5KMGA 4FLTA 4JI1H 3E22B 3BPZA 4DV2H 1S03G 4FLXA 1M5IA 4JI3B 3ETQA 5KHKA 5JQGA 4DV4H 1Z5WA 4TUYA 4FLUA 3VQVA 2OYQA 3OTOB 1HNXH 4AHCA 2YCHA 3JAKA 5CA1A 1XNQB 4LFCB 4ZI7A 3E22A 3CSXA 4X1IB 4RB0A 1ZHQA 3CB2A 4B3SH 3LNNA 4CS3A 2CAZC 1QHTA 1IBMB 3BA8A 4LF9B 1L2ZA 4WBNB 1TGOA 4DV6H 5JVDA 1XI1A 4JI7B 4JYAB 4DV5H 4B3TH 3JATA 3WB0A 4DV1H 3M7MX 3VNNA 4OX9B 4RAYA 1SA0A 4KHPB 5EIBD 4FLWA 4FLVA 5KX5B 4GKKH 3RYHB 4DR6B 4LFAB 4BWAA 1O75A 4EQ5A 4JI2H 5A2QW 2YIBD 3WB1A 2YXLA 2HVRA 5IT9W 4MTEA 3ICXA 3QF7A 1I94H 2CW8A 1TA8A 3RYHA 4TV9B 3T1HB 4PZ7A 4K8ZA 3UQ8A 3K57A 3SJCC 4O4HA 1T5EA 2UUBB 2F4VB 1IBLB 3HXLA 4IAJA 4DR1H 2WDTA 4X64B 1D5AA 3RJ0A 3BHPA 3K5NA 3L4JA 4JI8B 4DK0A 4AQYH 4TQFA 1GYFA 2BTOA 4HBNA 3HKEA 4DV3H 4FFBB 1M4UA 5J2TB 4DV0B 1CKOA 1XNRH 2ZINA 4DRXB 5DISC 5LMNB 3HKDA 5LOVA 1MZBA 4JI4H 5LXTB 4LF5B 3BAAA 5C8YB 4FFBA 4DR2B 5J2TA 3PN1A 3W1BA 1TUBB 4RB1A 4DRXA 1FVIA 4ZOLA 4FM9A 5KHJA 2PGGA 3FFQA 2PY5A 2HEPA 3NBZB 1H2SB 5C8YA 2UU9B 3RGZA 5BMVB 4EFBA 5IWAH 1TUBA 4LFBB 1N33B 4CH6A 4ZHQB 2ZIMA 2VQFB 1XHXA 1XMOH 4M7EA 1YEWA 4I4TB 3GDEA 5J2UA 4FLZA 3H20A 5LA6A 4DR3B 4YHHH 5EYPB 4O2BB 1P8LA 1WPBA 3DF7A 2YI9A 4IHJB 3M4IA 4X65B 4I4TA 1HNWH 5FD5A 2E5LB 4IIJB 3SJBC 4JI1B 4DRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 B;  4DV2 B;  3GB8 B;  4EEQ A;  3TY8 A;  2Q2T A;  3W5O A;  3OTO B;  4DV4 B;  4UCR A;  1A0I A;  5D1P A;  1XNQ B;  4LFC B;  1HNX B;  4JI0 B;  3JSN A;  1CKN A;  4B3S B;  4LF9 B;  1IBM B;  3BA8 A;  3TY9 A;  4JV5 B;  4X62 B;  1J5E B;  1HNZ B;  4UCV A;  4X66 B;  3NBY B;  2HVS A;  4LH7 A;  2OWO A;  2VUG A;  4JYA B;  4JI7 B;  3KYH C;  4TOI A;  4DV6 B;  4DV5 B;  4B3T B;  4CC5 A;  3TY5 A;  4OX9 B;  3RR5 A;  3VNN A;  1HR0 B;  4KHP B;  4DV1 B;  3NC0 B;  2HIX A;  4DR6 B;  4LFA B;  4GLX A;  2VQE B;  4GKK B;  4PZ6 A;  4EQ5 A;  4JI5 B;  4NXN B;  4DV7 B;  1DGS A;  2HVR A;  4JI2 B;  3GJX B;  4LF8 B;  1ZAU A;  1TA8 A;  4LF6 B;  2HVQ A;  4DR5 B;  3T1H B;  4PZ7 A;  1I94 B;  4LF4 B;  4UCT A;  3UQ8 A;  2UUA B;  1XDN A;  1XMQ B;  1V9P A;  3L2P A;  1IBK B;  2UUB B;  1IBL B;  2F4V B;  4EFE A;  2Q2U A;  5D1O B;  4X64 B;  2UUC B;  4DUY B;  4DR1 B;  4JI8 B;  4DR4 B;  4UFZ A;  4AQY B;  4PZ8 A;  5BR8 B;  4DV0 B;  1CKO A;  4YY3 B;  4DV3 B;  5D1O A;  4UCU A;  1N34 B;  5LMU B;  5LMN B;  1XNR B;  5DIS C;  1B04 A;  4LF5 B;  3T1Y B;  3BAA A;  3RTX A;  3SGI A;  4DR2 B;  4JI4 B;  4JI6 B;  4B3R B;  4K0K B;  3PN1 A;  1TAE A;  1P16 A;  3W1B A;  1X9N A;  1FVI A;  1CKM A;  4DUZ B;  5FPO A;  2HHH B;  3NBZ B;  3BA9 A;  2ZM6 B;  3S24 A;  2UU9 B;  4UCS A;  4EFB A;  4LFB B;  3QWU A;  1N33 B;  5IWA B;  1VS0 A;  4CC6 A;  2VQF B;  3BAB A;  1XMO B;  3GDE A;  2CFM A;  1FJG B;  3W1G A;  4DR3 B;  4NXM B;  3JSL A;  1N36 B;  4B3M B;  4DR7 B;  2UXC B;  1P8L A;  4LF7 B;  4YHH B;  1N32 B;  1XK5 A;  4LH6 A;  4GKJ B;  4UCO A;  1S68 A;  2UXB B;  4X65 B;  2HIV A;  2E5L B;  4E6N A;  5FPR A;  2UXD B;  1CKN B;  1HNW B;  4JI1 B;  4DRF A; 
#chains in the Genus database with same CATH topology
 2AGQ A;  1NTZ H;  1X4T A;  1B6R A;  1AR1 B;  3UFX B;  2V5A A;  5B3S C;  2YUA A;  4DV4 B;  5EOY A;  3GTJ A;  4X1K B;  2R82 A;  3GTG A;  3F7V C;  1M93 A;  4QIW E;  1EKV A;  1NS1 A;  1M57 B;  4IR1 A;  5KT6 A;  4JXU A;  5KG7 A;  5EIB C;  1J5E H;  2AU0 A;  4JAS A;  2QKA A;  5AG2 A;  2UUC O;  4LBE C;  1AR4 A;  3CE2 A;  4EGQ A;  2W57 A;  3JZ6 A;  5KFJ A;  1VMG A;  5CBG A;  3KXY T;  2Q7E A;  1QNM A;  1N0J A;  4MVR A;  4Q0Y A;  5CA0 B;  2R7Z A;  5LL6 b;  2DWE C;  5H2F Z;  2XAJ A;  2N05 A;  5BR8 O;  3D8C A;  4J0M A;  3WO1 A;  4B3T B;  3HKC A;  4CC5 A;  2DW4 A;  2HIX A;  1ZSP A;  3JRW A;  3HOX G;  4WBN F;  1I5Y A;  3T1Y O;  3UO2 A;  1RK5 A;  1Q81 W;  4DV7 H;  4P2Z A;  2VA3 A;  4JI6 O;  1JMK C;  3VPC A;  5FLX N;  3UZO A;  1S5L Z;  4LNU A;  3JAR B;  5B3S B;  4HNT A;  1Q6H A;  4ED0 A;  4QIW F;  1I5X A;  1IBK H;  4R7R A;  3R5H A;  2PMZ A;  4ECX A;  2JEJ A;  2KG7 A;  1BHA A;  2XHB A;  1XNQ O;  2YXH A;  2Z5U A;  5J9P C;  1OWT A;  2YYA A;  3CEB A;  4WBN A;  3PR4 A;  3RGX A;  1B6Q A;  1CQI B;  3WG7 C;  1OCR B;  2ZE8 A;  3MWD A;  1PNK A;  4DV3 B;  2UXC O;  5LMU H;  4GT1 A;  4YB8 B;  5BWV A;  2V9W A;  1K1Q A;  4JI7 O;  2QDO A;  4BWS C;  4JI4 B;  3HKZ E;  2QK4 A;  2GPW A;  4OX9 O;  1ZET A;  2R92 G;  4KHP O;  5LOV F;  3TIG A;  5LYJ B;  1TVK B;  3GWO A;  2Q7H A;  1I2L A;  3ETE A;  3HKB B;  3HB3 B;  3CMA V;  3FYI B;  3R9R A;  3JAS A;  3RYI A;  2PYL A;  4ZOL F;  4IZO A;  4QPJ A;  1JQ0 A;  2Z04 A;  4H0L B;  2W0X A;  3OM3 B;  3ZBH A;  1SEI A;  3SDL A;  1XMO B;  4NXM H;  2CFM A;  3ASN C;  4DK1 A;  3CVZ A;  1YHQ V;  3WG7 B;  4QWA A;  5DN6 G;  4PHZ A;  1XK5 A;  3ORQ A;  5A9G A;  2KKW A;  4RUE A;  1WN7 A;  1US6 A;  4JGS A;  1Z2N X;  3APO A;  4L1K A;  3DTF A;  3ZS8 C;  1I7L A;  2ITC C;  3TXQ A;  4I4T F;  1KTA A;  2QWR B;  1A0I A;  4G28 B;  2R7M A;  2P22 C;  2Q7G A;  1J95 A;  4FPP A;  4QNH B;  1F7Y A;  2RN9 A;  1M0W A;  2V7Q G;  3JSN A;  2YDE A;  1BSM A;  5B1O A;  4U7C A;  1RK6 A;  3T1H H;  3GV8 B;  1EKF A;  3PW5 A;  2JS3 A;  4IIJ F;  1YZB A;  3SYO A;  1HNZ B;  4A3E G;  3AG2 C;  4ZHQ A;  3HKZ A;  2WLI B;  4LFB O;  1KKC A;  2Q0A A;  3ASN B;  2YC0 A;  3N2G A;  2HVK C;  3T2M A;  3P32 A;  2OTJ V;  3J80 W;  2W9C B;  3AK1 A;  3TY5 A;  5EZY B;  3ZHU A;  1PL0 A;  4X1Y A;  3KAK A;  2XGQ A;  2L35 A;  3NC0 B;  3GVM A;  3DC6 A;  2WB1 E;  3JCZ A;  4IHJ A;  5D5Q A;  4NXN H;  2JIZ G;  1IOV A;  3CSW A;  1JX4 A;  2N74 A;  4LCU C;  4B3R O;  4MV4 A;  4ECQ A;  4HZ3 A;  3N42 B;  4OGQ B;  1D5N A;  2R9I A;  5JJE B;  4CH4 A;  3K03 A;  4FVM A;  3TW7 A;  1K3E A;  4O2A B;  4LF4 B;  3OUF A;  1Y6X A;  4UCT A;  3K0G A;  4X1K A;  1D2D A;  3UT5 B;  5EDW A;  2HVJ C;  4EFE A;  2JVD A;  3W7T A;  4DUY H;  2RGR A;  2IJI A;  2JA5 A;  4WD3 A;  4DR4 H;  5KFZ A;  3LSS A;  2BTQ B;  3ZJZ A;  4B08 A;  1G4Y B;  2DN9 A;  3WNZ A;  3AG2 B;  2Z0A A;  2WAM A;  4TT3 G;  1JFF A;  4PZ8 A;  1FJG O;  2GTS A;  5BWT A;  3X2Q C;  1R6T A;  2NLJ C;  3LDD A;  3ZRW A;  5D1O A;  5KMG B;  5CA0 A;  2UXX A;  1N34 B;  4FMT A;  1YCI A;  2EUL A;  4GKJ O;  3EXA A;  2IU3 A;  1SQG A;  1TWH A;  4GX5 A;  4P9O A;  3OUU A;  4DYL A;  3HO8 A;  1VBH A;  4R8C A;  5CA1 B;  4TWK A;  1X9N A;  5KX5 F;  4UVB A;  2HHH H;  3OTO O;  1JJO A;  4CS2 A;  4DUZ B;  5JCO C;  1BS3 A;  2DYR B;  4TQS A;  1EHI A;  2MCT A;  3JAR A;  4RU9 A;  2X6A A;  1IYD A;  1SZT A;  4CBC A;  2CTW A;  5F9N A;  4PWQ A;  4ZKI A;  5IJ0 B;  4I9Q A;  4LF9 O;  3CHX A;  1SCU B;  2Q68 A;  4U3F H;  3BAB A;  5L3G A;  4F4X A;  1P7G A;  2VRZ A;  3J81 W;  3EPG A;  4MTF A;  5LYJ F;  1I2K A;  4B3M H;  3JAT B;  1M0T A;  3H3V H;  3ETD A;  2P7T C;  3GIL A;  4JYA O;  4DR7 B;  3X2Q B;  2FL4 A;  3TQ1 A;  2Y0P A;  3T1C A;  4MS2 A;  2KSW A;  1QBZ A;  3B8M A;  3K5M A;  4XX0 B;  4DR6 O;  4JI3 H;  4LFA O;  2HJW A;  3OD4 A;  2DAA A;  1B33 N;  1BE3 H;  3SPH A;  3AW8 A;  2BE3 A;  2JJ1 G;  4C5A A;  2RDI A;  3TY8 A;  1G6U A;  1PM9 A;  4NYK A;  2R9A A;  2R7N A;  3TXS A;  1WRV A;  3MR5 A;  1C30 A;  3M8A A;  1GRJ A;  2GQR A;  4ED1 A;  4LF6 H;  1IBM H;  1IBL O;  1E4F T;  4YJ3 A;  5BWU A;  1WB8 A;  4M0J A;  4UB6 Z;  4X64 O;  4X66 B;  4JI8 O;  2A0L A;  3B2E E;  5BMV F;  4MSW C;  3RFR A;  2VUG A;  5FR9 A;  4JTC B;  1ZX3 A;  5I5T A;  2WLJ A;  4EYH B;  4MTO A;  4JAU A;  3GIK A;  1OCO C;  2GSM B;  5B1B B;  3HKD B;  1GTO A;  1LUW A;  4PA9 A;  3L9D A;  5DG7 A;  2VQE B;  4LF5 O;  4O2B F;  2WLL B;  4QE7 A;  4GUN A;  3JAW B;  4R7C A;  3K9S A;  3SI8 A;  1R9T A;  1VF5 B;  1RJP A;  1A48 A;  2LQT A;  1S3J A;  1P7B A;  3HR0 A;  5EZY F;  3E8G A;  2UUA B;  3TEK A;  3O65 A;  3CRQ A;  1XMQ B;  4C5B A;  1IVS A;  2ZM6 H;  4UUG A;  4MA0 A;  5BYB A;  2YI8 A;  3OMA B;  5LA6 B;  3DXR B;  2M6Y A;  1WNS A;  4O2A F;  1NU1 H;  2A7W A;  1OCO B;  1N36 H;  2E2I A;  5EBW C;  1AI5 A;  5I5U A;  5EZY A;  1Q7Y W;  5FL7 G;  2RDC A;  2E5L O;  1R3I C;  4WFA V;  4JI1 O;  1P16 A;  3QQM A;  3HOU G;  4DV2 O;  2UXD H;  1PP9 H;  4YXW G;  3BEH A;  4QWE A;  3OSP A;  2EJ0 A;  3LP8 A;  2UU9 H;  3S24 A;  2KB1 A;  4IR9 A;  4O4L A;  3V4Z A;  2NUA B;  5I5Y A;  3G67 A;  2VQF H;  4A3B G;  2W6M A;  2ZDH A;  4OXS A;  3Q2O A;  2E74 B;  1EYZ A;  2QKS A;  2W6N A;  5IE9 A;  1NTM H;  3W1G A;  2BTQ A;  3LUT B;  4DV6 O;  4RNM A;  1OJH A;  1F51 A;  4DV5 O;  4BW5 A;  3MFH A;  4I50 B;  1EZJ A;  3L70 H;  4D7T A;  2CNV A;  1WCM A;  4FM2 A;  5KMG A;  4DV1 O;  3QZ7 A;  4FU0 A;  3GV7 B;  2Q6A A;  1R1B A;  4ABM A;  4FLX A;  1Y1V A;  5KT3 A;  3JD0 A;  4DV4 H;  1Z5W A;  4EBC A;  2XAQ A;  3VQV A;  1Q6I A;  5E25 A;  3JAK A;  3S3W A;  5CA1 A;  4LFC B;  3PJS K;  2UVR A;  1I94 O;  3CSX A;  4X1I B;  2DQ0 A;  3ETH A;  5EWE A;  3G6E V;  1Y76 B;  1I1L A;  3VPB A;  1IXM A;  1L1F A;  1NR1 A;  1BL8 A;  4G27 B;  5EBM C;  5I47 A;  1GKF A;  4DR1 O;  1ZQ7 A;  1CEZ A;  2XCP A;  3M9M B;  1IDS A;  2W8K A;  4JV0 A;  3HPL C;  4ECY A;  1XI1 A;  4AQY O;  2DE0 X;  4B3T H;  4AYB E;  2ZGI A;  3JAT A;  3WB0 A;  1FAF A;  3KHG A;  2EZP A;  4MVS A;  5H6R A;  1AR5 A;  5EIB D;  4FLV A;  4GZR B;  3CME V;  1XNR O;  5CAE B;  1E1Q G;  2GHY A;  2FLN A;  5BPF A;  3E8B A;  1R73 A;  5A2Q W;  2W9A A;  1SF9 A;  2QWP B;  3WB1 A;  1FXV A;  2DWD C;  5KFG A;  1AJQ A;  2Y69 B;  5F9L A;  2WTF A;  2UVW A;  3RYH A;  3FB8 C;  4TV9 B;  3T1H B;  4CKE A;  3CRM A;  2GPS A;  3RB6 A;  3GV5 B;  5L1J A;  1BNC A;  4BAY A;  1B06 A;  2UUB B;  2F4V B;  1SQX H;  1GH6 A;  4NZN A;  5KA6 A;  2JA6 A;  3RJ0 A;  3BHP A;  3L4J A;  5B66 Z;  1OBG A;  4DK0 A;  3LDC A;  1Q82 W;  4TQF A;  1OBD A;  2Q73 A;  2BTO A;  2YID A;  2ASJ A;  2QTS A;  4DV3 H;  5J2T B;  5B1A C;  4DV0 B;  1VQ8 V;  4DXW A;  4Z1V A;  3T9F A;  3L72 H;  3LNM B;  5KS8 A;  3HKD A;  1RJR A;  2BCC H;  4JI4 H;  2B63 G;  5C8Y B;  5KFE A;  4DR2 B;  2BR0 A;  1BT8 A;  1PKX A;  2R8G A;  2WLL A;  4FM9 A;  2PGG A;  3OMI B;  2PY5 A;  2HEP A;  4WCE V;  1GGO A;  1UC9 A;  4NTY A;  4UV9 A;  3CYO A;  4ED6 A;  1N33 B;  3EFF K;  2ALZ A;  1TUE B;  1AP6 A;  2I8C A;  1XMO H;  4M7E A;  1YEW A;  3JZI A;  3OHB A;  2FK2 A;  1AIL A;  2WPD G;  3H20 A;  5LA6 A;  4G3I A;  2K1E A;  2ZE6 A;  3DXR A;  4JAV A;  1PK8 A;  5B1A B;  2G38 A;  1KEC A;  2P6J A;  1HR0 O;  4BBR G;  4X65 B;  4LP8 A;  1AB3 A;  2LFR A;  3SJB C;  5LP6 F;  3AK2 A;  3U0G A;  1WJZ A;  4EEQ A;  4JI5 O;  1FD9 A;  3EVK A;  3W5O A;  4B7E A;  3J7A K;  5D1P A;  1AUX A;  1IXB A;  4LF8 O;  5JJJ B;  1HNX B;  1CPY A;  3CX5 F;  3CQZ A;  3GTK A;  4K6N A;  3OR6 C;  3IC7 A;  3TK1 A;  4DL4 A;  4MW3 A;  2R8I A;  4B3S B;  3JAM W;  4ZI7 F;  5KFM A;  1HNZ H;  3W7W A;  3HKC B;  4KL1 A;  3CC4 V;  2HHH O;  1ET0 A;  2UVU A;  2B9Z A;  3AYH B;  2XIG A;  2OWO A;  2GBO A;  3KG2 A;  2L6L A;  3RF2 A;  2HG5 C;  1CQJ B;  5TIS Z;  3WFV A;  5I5X A;  3W7U A;  4E4T A;  5JVD F;  4LNU B;  4MTG A;  1WAZ A;  1PD3 A;  3F7Y C;  3K3W A;  4IT5 A;  4I50 A;  3K58 A;  3M9O B;  3C90 A;  3ML0 A;  4O86 A;  1XHZ A;  2KG7 B;  1DGS A;  4ECR A;  3RWR D;  3MAQ A;  1EN5 A;  2FYU H;  4LF4 H;  4MVU A;  4LF6 B;  1Z2O X;  3A0B Z;  5C4X G;  3Q8R B;  1NTK H;  4J9Q A;  3T5H A;  1EZV H;  2R8J A;  3FB7 C;  1FXK C;  5FLM G;  1ORQ C;  4O7T A;  3BQ1 A;  4DQN A;  4CZZ A;  1E79 G;  4X1I A;  1KJI A;  1K4D C;  4JAA A;  4O4H F;  1MAB G;  2V58 A;  3ZRS A;  3KRE A;  1UPG A;  1QVG U;  2FPI B;  3OE7 G;  3OTF A;  4A3F G;  3P3N A;  1N34 H;  4W4K A;  1GN3 A;  4P30 A;  4PJ0 Z;  4LF7 O;  3LWB A;  1N4C A;  1Q6U A;  3K3P A;  3K04 A;  4O3P A;  1I1M A;  5KT7 A;  2W6P A;  1CP9 A;  2N04 A;  2UXB O;  3RW0 A;  3G6B A;  3JAS B;  3RYI B;  2OIE A;  1I0H A;  5FNV B;  1S9F A;  1H2G A;  4IWX A;  4DUZ H;  2EZO A;  4NKG B;  4QGP A;  3NGD A;  2XCA A;  5J2T F;  1KJ9 A;  5FD6 A;  2ZXW B;  1JPX A;  2C2R A;  2ZM6 B;  3V6H A;  3MHS C;  4TV9 A;  1FXK B;  3CCJ V;  2RQ6 A;  3HT5 A;  1VS0 A;  5C8Y F;  2CQY A;  3QVN A;  4DL2 A;  4JV5 O;  4RZR A;  2PVP A;  1M90 W;  4KFM A;  3RYF A;  4DR7 H;  3H1K H;  5DG9 A;  1FXH A;  1KP2 A;  1N36 B;  5C1P A;  4YHH B;  4FZ0 A;  4LH6 A;  5CB4 A;  4I0X A;  4FK5 C;  5KFP A;  4E6N A;  5FPR A;  5IDJ A;  2UXD B;  1R3J C;  1H8H G;  2EIY A;  3QTC A;  4I5S A;  2AXT Z;  4RUC A;  2A3Q A;  2E3C A;  3GB8 B;  3L4K A;  4GLW A;  2H3O A;  1BHB A;  5JH7 B;  2Y4T A;  3Q8P B;  4ZIB A;  2VWK A;  2ZDG A;  4JI0 B;  4DR5 O;  1FPO A;  2VOB A;  3VQW A;  3ZN1 A;  3N2G B;  5KFO A;  1OHH G;  1GAX A;  4X66 H;  1NR7 A;  3ZMS A;  4X1Y B;  4F6R A;  4J9N A;  1F4N A;  2R93 G;  2OIG A;  1K4C C;  1PX2 A;  4YY3 O;  2QGN A;  3RR5 A;  1JJ2 U;  4E4E A;  5HFL A;  2ADQ B;  4WFE A;  4O7S A;  2VQE H;  2VUM G;  4DR3 O;  3CEI A;  2YIB A;  1XBL A;  3CCU V;  5LMN H;  3V6J A;  1N8R W;  1KJ8 A;  1JXL A;  3L74 H;  1FKA O;  4K0K O;  5L3F A;  2YIA A;  3J80 N;  1M7J A;  1EN4 A;  4D7S A;  3DTU B;  1ZAU A;  2FTK A;  2DMX A;  4NTW A;  2UUA H;  3R65 A;  2W6J G;  1XMQ H;  2V4D A;  3L75 H;  3KZI Z;  1JFF B;  3RAQ A;  2JEF A;  1OCR C;  5KAI Z;  3ZRW B;  5D1O B;  4FFL A;  4LSX A;  4FFR A;  2UUC B;  3O9O A;  1KT8 A;  2VWJ A;  3BG5 A;  4PDR A;  5BXZ A;  3TCU A;  3BJY A;  4LR3 A;  4I7H A;  3F5T A;  5BR8 B;  1XEQ A;  2EIM C;  4CH3 A;  1NVP D;  1KKD A;  1N32 O;  2NVY A;  2Y0I A;  2FP4 B;  1DLB A;  1EM1 A;  3SJQ C;  4ETS A;  1B04 A;  3T1Y B;  4FM0 A;  4TV8 A;  4JI6 B;  2GLT A;  4O4I A;  2PI4 A;  5KT5 A;  1JDE A;  3P30 A;  2YL2 A;  1HW7 A;  2QB5 A;  3JZF A;  1S97 A;  1P84 F;  4N23 A;  2V59 A;  1DV2 A;  4A2A A;  3KAL A;  3N6R A;  5DM6 V;  1SQP H;  1VQ7 V;  5FNV F;  1EFR G;  2J9G A;  2YXY A;  3ZHT A;  4X62 H;  3QG5 A;  3JSL A;  5GW7 A;  2E76 B;  2UXC B;  3H01 A;  2D3O W;  1BXR A;  2EIM B;  5DGI A;  5DAA A;  2JGD B;  4UCO A;  3OGC C;  2W7P A;  3L73 H;  2V1D A;  4R50 A;  5EC2 C;  3N6X A;  4L8J A;  3J81 N;  2NVX A;  2BOC C;  1EKP A;  4DW0 A;  2M05 A;  2EIJ C;  1KU9 A;  4LFC H;  2H94 A;  3E89 A;  4YJ3 B;  5FNV A;  1JDB B;  2R6F A;  2LFS A;  2ETN A;  5DGB A;  3BRC A;  2QJ1 A;  3ZMZ A;  5CM0 A;  4I9W A;  4B7K A;  3TY9 A;  1FXK A;  3N41 B;  3A0R A;  4QWD A;  4O3S A;  2LO1 A;  1QVF U;  4UCV A;  3RB3 A;  1COW G;  4CS4 A;  4MV8 A;  4H37 A;  5DLF A;  3RN4 A;  2RDJ A;  3I4M G;  3H1H H;  1BMF G;  2FPP B;  2P5O A;  4ZHQ F;  4BY1 G;  3DSQ A;  3RBD A;  1TWA A;  1G1X B;  1YF2 A;  1QQC A;  5KFS A;  4Q44 A;  4JYB A;  1NQT A;  2MW2 B;  4IHJ F;  4BIU A;  3GJX B;  2EIJ B;  4YAK B;  1O9H A;  5LL6 Y;  5JH7 A;  3H1I H;  5KFL A;  4DL7 A;  2UUB H;  2F4V H;  3TJT A;  2XC9 A;  3E86 A;  3L2P A;  3N43 B;  1V51 A;  3W7X A;  4DL3 A;  4FFK A;  3THO A;  3MR6 A;  2ABJ A;  3PZP A;  4UUJ C;  4DV0 H;  1WA8 B;  3JYC A;  1WP7 A;  1QU7 A;  2WLN A;  1WH2 A;  4A3G G;  3BFR A;  3CJH B;  2B63 A;  3SYA A;  4DR2 H;  4FBU A;  2NU8 B;  3L71 H;  3I4N G;  4OPH A;  2DYR C;  3SGI A;  2YZG A;  5CA0 F;  1VQ4 V;  4O4L B;  4B3R B;  2YU9 A;  5H9C A;  4CKB A;  3SE7 A;  1DK1 A;  3IC9 A;  5H5N A;  4QJF A;  1ROP A;  4BIO A;  5C93 A;  2ZR2 A;  2CNU A;  3IGA C;  2CNQ A;  2C35 B;  1N33 H;  4QW9 A;  4FS1 A;  3GTL A;  1LNQ A;  1VEW A;  3ZN0 A;  3RUP A;  2XT9 A;  2YIC A;  4HYK A;  1EUC B;  1AN7 A;  2XAF A;  1FJG B;  2GDS A;  3ZMU A;  3B09 A;  1YJ9 V;  4J9L A;  4MTD A;  4AI8 A;  2QM4 A;  2IJK A;  4X65 H;  4GKJ B;  1V55 C;  2XUM A;  3MWM A;  3ABU A;  3JAK B;  2ZDQ A;  4FLT A;  1LUV A;  3FKI G;  1MZE A;  4J7Z A;  1VF6 A;  5K2M A;  2R7K A;  1TWF A;  2PI5 A;  3ZCC A;  4GKK O;  5L1I A;  3ETQ A;  2A79 B;  4TUY A;  5KFT A;  2AW9 A;  4EEY A;  1TWG A;  1Y66 A;  2C2D A;  4JV1 A;  3OTO B;  1HNX H;  4JI2 O;  2YCH A;  2JA8 G;  4DO2 A;  3MFI A;  3E22 A;  5E1A C;  2M7W A;  4YIO A;  2VQD A;  2Q8V A;  4B3S H;  2FLP A;  4XDJ A;  1YIT V;  4CS3 A;  4LF9 B;  1MA1 A;  3AG3 B;  2HDK A;  3T5K A;  1S76 D;  3T9E A;  1L2Z A;  2XAG A;  2JDI G;  5B1B C;  2Y4U A;  2WSS G;  1RPR A;  3CCM V;  4YJ3 F;  4JYA B;  2EJ7 A;  3T4D A;  5JUM A;  4FIP C;  3M7M X;  4RAY A;  1VQL V;  1V54 C;  3MDS A;  3RV4 A;  1V55 B;  4DW1 A;  3RYH B;  4DR6 B;  2Q69 A;  4BWA A;  4LFA B;  1XUQ A;  2JGD A;  3B40 A;  4O3N A;  1AI4 A;  4EQ5 A;  5JQW A;  3EPI A;  2YS7 A;  3ABK C;  4TQR A;  3CRA A;  1W59 A;  5IT9 W;  3ICX A;  4JTA B;  3H40 A;  4WHX A;  3SPI A;  4EKW A;  2EIL C;  3K57 A;  3SJC C;  1T5E A;  3WWI A;  1MMM A;  1IBL B;  2V4R A;  2GTA A;  5KFI A;  4IAJ A;  3TET A;  5EK0 A;  3U55 A;  2ZR3 A;  5A2Q N;  4X64 B;  5IWA O;  4FFM A;  4JI8 B;  4KXR A;  2WA4 A;  3IFX A;  1YSC A;  3ZMT A;  5DED A;  4IGG A;  2R85 A;  3CD6 V;  1CE8 A;  3VBB A;  5DIS C;  5LMN B;  1S0N A;  1SER A;  4KP4 A;  1V54 B;  1S0O A;  5LXT B;  4LF5 B;  3ABM C;  4O7V A;  4FFB A;  1HNW O;  3T5L A;  5IYD O;  3W1B A;  3TIN A;  5EBL C;  5C3E G;  1S10 A;  4IL6 Z;  3ZHQ A;  3ABK B;  5KHJ A;  5B5E Z;  4RQE A;  1PPJ H;  3NBZ B;  1H2S B;  5C44 G;  3D36 A;  2YW2 A;  2EIL B;  1TUB A;  2OCH A;  4FE2 A;  2QYZ A;  3Q4H B;  3GWK C;  4A5U B;  1GN2 A;  2ZIM A;  1JKJ B;  5LHH A;  4O4L F;  3OFN G;  1J5E O;  3GDE A;  5KUK A;  4FLZ A;  1EN6 A;  4MAM A;  4YHH H;  5EYP B;  5KG4 A;  3DF7 A;  1WA8 A;  1VAJ A;  2A06 H;  2YI9 A;  3S3X A;  1UNN C;  3CPW U;  1W0K G;  2E5L B;  1KYO F;  4PD4 F;  3CJH A;  4JI1 B;  2ZIO A;  3ABM B;  4DV2 B;  2X6C A;  3HB9 A;  4ECW A;  2RF4 A;  4ED3 A;  3AG1 C;  3CC7 V;  1GMG A;  4DV7 O;  4JI0 H;  3TGU H;  2JA7 A;  4CE5 A;  3N44 B;  2IBZ H;  1VQ5 V;  3PR5 B;  1PL4 A;  1FS0 G;  2AHY A;  1KQS U;  4O4J B;  5CA1 F;  1IBK O;  2Q9L A;  1KD1 W;  4X62 B;  1SQF A;  2R93 A;  3K3V A;  2HG8 A;  4LH7 A;  1TWC A;  4FM1 A;  5DQG A;  1RSO B;  2Q67 A;  4DV6 B;  5LGU A;  1N56 A;  4DV5 B;  1MSD A;  3RB0 A;  3C0F B;  4RB3 C;  3JAM N;  1GSA A;  4F6E A;  4DV1 B;  5LMU O;  2VUM A;  1N0N A;  2Y69 C;  4J9M A;  2VPS A;  3QO5 A;  1ULZ A;  4GLX A;  5KUM A;  2PF4 E;  1NJI W;  4PZ6 A;  1ENV A;  3TW6 A;  1L0N H;  2HP8 A;  2QM8 A;  2NU9 B;  4NYE A;  3AG1 B;  3FAV B;  3K5I A;  2AQ4 A;  4PEL A;  3HOY G;  4FFP A;  3LML A;  2ASD A;  4U7O A;  2BQR A;  1I94 B;  3A2F A;  2XOK G;  3UM7 A;  5E79 Z;  4NVP A;  3KCX A;  2UUC H;  4TQD A;  5DQH A;  4C5C A;  4FGR A;  4MV1 A;  4DR1 B;  1ZUQ A;  5KAF Z;  2COI A;  2FK1 A;  5BR8 H;  4AQY B;  2PBZ A;  1F4M A;  2XND G;  3IG0 A;  3K5H A;  4NXM O;  5KFW A;  5KFC A;  3PW2 A;  1G2W A;  3E35 A;  4HAM A;  4UCU A;  3ZMV A;  4IYH A;  1XNR B;  4NZO A;  3T1Y H;  4ME6 A;  3K79 A;  4JI6 H;  2YZL A;  2V4Q A;  1ARO P;  2YS6 A;  4FZ1 A;  4I55 B;  3RVZ A;  3VQX A;  5KKN B;  5JVL A;  3FX7 A;  1ZL8 B;  1VQN V;  5C5J A;  5L1L A;  1GSH A;  5KFY A;  5FPO A;  4E2L A;  4NR1 A;  4DAA A;  1B3Q A;  4ED2 A;  3RYF B;  1VP7 A;  4HQ6 A;  4GX1 A;  3V6K A;  1XNQ H;  1URF A;  2H8P C;  3BAC A;  4LC1 A;  2C28 A;  2IH3 C;  4AIL C;  4Q4D A;  5LXT F;  5KFR A;  4MV6 A;  2CGN A;  3T1H O;  3T4Z A;  4CC6 A;  5CB4 B;  4M9U A;  4I0X B;  2A1H A;  1V4Y A;  1H2L A;  1JR9 A;  3E83 A;  1VBG A;  2UXC H;  2C22 A;  2FPG B;  5DG8 A;  2J6S A;  4A2B A;  1FFT B;  1GM7 A;  4Y8V B;  1BZK A;  4PDM A;  4TVI A;  4JI7 H;  2Y0S A;  2R92 A;  2R9R B;  5LA6 F;  2QWN B;  4XDL A;  4MVO A;  5KG1 A;  4A3L G;  2J6T A;  4OX9 H;  1Q3E A;  1AI6 A;  1M1K W;  4KHP H;  1VKZ A;  2EX3 A;  5FJ8 G;  5LXT A;  1T3N A;  5KHG A;  4NXN O;  1T94 A;  2RCV A;  4UCR A;  2ODM A;  2R7L A;  3IN5 A;  2I80 A;  5IJ9 B;  4F6R B;  1Z2P X;  5LHG A;  4U7N A;  1ZTE A;  5F2V O;  4R8U B;  4ECT A;  5L1K A;  4A93 G;  3CC2 V;  3MJF A;  3OUS A;  1JLL B;  3RBE A;  1WPX A;  2ZE5 A;  3Q4H A;  5EC1 C;  3NXS A;  2ZNJ A;  4YJ2 A;  4DUY O;  3GIM A;  1BCC H;  4DR4 O;  2R87 A;  2JA5 G;  3RYC A;  2ZNI A;  2P0A A;  2IBK A;  2KSD A;  3FB6 C;  5EYP A;  3UKM A;  1HR0 B;  2YEV A;  2CK3 G;  3QNE A;  1H38 A;  1YJN V;  3A0H Z;  3MD0 A;  4A3M G;  1Q90 D;  4XDK A;  1QLN A;  5CN0 A;  2QM7 A;  1O9G A;  4PA3 A;  4JI5 B;  5IYZ A;  5KFD A;  3BVO A;  3CXC U;  4I50 F;  5KFQ A;  4LF8 B;  1KMI Z;  2HVQ A;  4J9Y B;  3H4D A;  4UB8 Z;  4IYI A;  2W9B A;  2EIK C;  5KFA A;  2Z02 A;  3C3S A;  2CE4 A;  1WP8 A;  4O4J A;  4QPK A;  2QWO B;  3H9V A;  4LFB H;  5BPH A;  2AHZ A;  5JWP A;  1OCC C;  1JVM A;  2LP7 A;  3E8H A;  3OUZ A;  4TV8 B;  4O4I B;  4B3M O;  5IP7 G;  1XL4 A;  4RQF A;  1DIK A;  1W93 A;  1RSO A;  3I5D A;  1PNL A;  1Z5V A;  4BW9 A;  3CCV V;  3UO3 A;  4B3R H;  3SPG A;  5DEC A;  3AK3 A;  3E8F A;  2ZXW C;  2I87 A;  1SET A;  1JOY A;  4JI3 O;  4J41 A;  3PO2 G;  1Q43 A;  4OPA A;  2YRX A;  2CH7 B;  3FAV A;  3GIQ A;  2JS5 A;  1YVW A;  3U0Z A;  2K9P A;  2F95 B;  5ITZ A;  2RJZ A;  4LF6 O;  1IBM O;  2EIK B;  3R5F A;  4TV9 F;  4J9P A;  2YS8 A;  1FJG H;  1Z2G A;  1K34 A;  4BXX G;  2DWC A;  1OCC B;  4D6T H;  4LF7 B;  1ZHS A;  2EJ2 A;  4GKJ H;  3QZ8 A;  2MK3 A;  4BBS G;  4PDB A;  1KP3 A;  2R84 A;  2AZ2 A;  4YAJ B;  2FMA A;  2UXB B;  2DYS C;  4MT8 A;  3T9C A;  2R70 A;  5CB4 F;  2EBO A;  3STL C;  3KHH A;  3VQY A;  3OTO H;  2P06 A;  1VQ6 V;  4I55 A;  2PTM A;  3NUA A;  2ITD C;  4F4W A;  1ZL8 A;  5K3W A;  1GM8 A;  4LMY A;  1CKN A;  2P90 A;  4LF9 H;  1NI8 A;  2AGA A;  4F4Y A;  2W7O A;  2HKO A;  5KFH A;  4JV5 B;  4A3K G;  4JUZ A;  2ZM6 O;  3HKE B;  1DAA A;  4JYA H;  2FB9 A;  5DMX A;  3NBY B;  2HVS A;  1OZ0 A;  2ADP A;  1Y14 B;  4YR0 A;  4LSA A;  3KYH C;  3GIJ A;  2XD4 A;  1AUV A;  2DLN A;  2Q5Z A;  2HGX A;  4WFG A;  3OEH G;  5LOV B;  5I60 A;  4EBE A;  4LFA H;  1H2K A;  4DR6 H;  1BGY H;  1E4E B;  4ED7 A;  1YJW V;  1NH2 B;  3ETJ A;  2WA3 A;  1N36 O;  2DYS B;  2WLM A;  4J9R A;  3D3I A;  1QR8 A;  4ZOL B;  2HGW A;  2ZD9 A;  5L3B A;  2ODT X;  3T99 A;  5CE8 A;  1U97 A;  2QSA A;  2FE3 A;  4ECV A;  3QO8 A;  2ZE7 A;  2GUZ B;  3SYP A;  5KHI A;  4DR5 B;  2UXD O;  3CWB H;  5L9X A;  1IBL H;  5IJ9 A;  5L3C A;  2UU9 O;  4X64 H;  4C2M A;  4JI8 H;  1R6K A;  3STZ C;  4R8U A;  2FB5 A;  3FKS G;  1FFX A;  1NT2 B;  1WLE A;  3JCU Z;  2VQF O;  2COJ A;  1VF6 C;  4EB6 A;  1KB9 F;  1MSW D;  5KFN A;  4MV3 A;  4YR2 A;  2QF7 A;  5IYB G;  2AZ0 A;  4YY3 B;  1X59 A;  1AP5 A;  4CHI A;  3ZHS A;  1MG1 A;  3R5X A;  2C2E A;  4QJF B;  4LF5 H;  3F8N A;  1THZ A;  3ZRX A;  3GIP A;  3WU2 Z;  2LW1 A;  1Y1W G;  4K0K B;  1L0L H;  1TAE A;  2ZKO A;  3B8N A;  2WE6 A;  5KFX A;  5HV6 A;  3SR2 C;  2JRI A;  5KG6 A;  4DV4 O;  1GN6 A;  2ATK C;  3B4S A;  3R23 A;  3CXH F;  4O4I F;  4TV8 F;  5I5S A;  1Q5O A;  1Y1V G;  3BA9 A;  3AG4 C;  1Y74 A;  5CBH A;  3VMM A;  4NB5 A;  1EUD B;  2ZCE A;  4XYM B;  3T54 A;  4ECZ A;  2FML A;  4EG0 A;  3T7A A;  4EYI B;  4A3J G;  5BWR A;  1SYX B;  4APM A;  3K0D A;  1SS3 A;  2RNB A;  4RWU A;  3K5O A;  3KHL A;  2YSU B;  5BY1 A;  3LDE A;  2CW7 A;  4J9O A;  3GID A;  1N32 B;  4TUY B;  1BQ0 A;  2KQX A;  2Y48 A;  4B3T O;  3BQ2 A;  1YTF B;  2E5L H;  4J7K A;  4FJC C;  3SPC A;  4JI1 H;  3E22 B;  4JZ2 A;  4NTX A;  1AI7 A;  3BPZ A;  3AX6 A;  4DV2 H;  5KHK A;  2D2C B;  2SCU B;  1MOF A;  4DLK A;  4R6Z A;  4Q8E A;  1XNQ B;  2BOB C;  1SZX A;  3N8D A;  4ED8 A;  5KFV A;  4RB0 A;  1QR9 A;  3CB2 A;  3OSN A;  2CH7 A;  3AG4 B;  1CS0 A;  4YBZ B;  3K9A A;  3LNN A;  2CAZ C;  1QHT A;  3BA8 A;  4GX2 A;  2Q7D A;  3R66 A;  2HHF A;  2DAB A;  5GTI Z;  1Y4M A;  4X9Q A;  4XYL B;  5KFB A;  1K7D A;  2JEU A;  1K5S A;  4FFO A;  4DV6 H;  1RP3 B;  4JI7 B;  4DV5 H;  2PN1 A;  3T9D A;  1HWY A;  1OV9 A;  2JA6 G;  3VPD A;  4DV1 H;  4DV3 O;  4OX9 B;  3VNN A;  4KHP B;  3MHH C;  5KX5 B;  2F23 A;  4QWC A;  3D36 C;  4PBC A;  1O75 A;  1DF4 A;  4JI4 O;  3G71 V;  2IP4 A;  4QIW A;  3ABL C;  1JCH A;  5CMU A;  4MTE A;  5IYD G;  1I94 H;  4BR6 A;  1TA8 A;  3G6V A;  1P4R A;  4K8Z A;  4JYC A;  5BZB A;  3SYC A;  3JRX A;  4PDV A;  1F23 A;  1MNG A;  2LJ2 A;  4RCN A;  4DR1 H;  5JH7 F;  3K08 A;  1SC5 B;  3VA7 A;  1D5A A;  2OH2 A;  3K5N A;  5IT9 N;  3GTQ A;  4TSF G;  4AQY H;  1VQP V;  1I7N A;  2XAH A;  4HBN A;  1XMO O;  3HKE A;  5GTH Z;  3ZHR A;  4FFB B;  5KLV H;  1CKO A;  1XNR H;  3GTP A;  5HBR B;  4IRC A;  4QE9 A;  1K92 A;  3ZHV A;  3T9B A;  5LOV A;  4I7Z B;  2W6Q A;  2Y4R A;  3BAA A;  3ZIA G;  1E4E A;  3UZB A;  5DLG A;  4RUA A;  5IYC G;  3JD2 A;  2Z3Y A;  1TUB B;  4RB1 A;  3OMN B;  4DRX A;  1FVI A;  1H2M A;  3ABL B;  4ZOL A;  2QEX V;  2CKZ B;  2BQU A;  1IX9 A;  4O3O A;  2VR1 A;  2GQS A;  3RGZ A;  2GUZ A;  1VQ9 V;  5BMV B;  4JYY A;  2WLK A;  4MVM A;  4UXN A;  4NLG A;  2J6U A;  1XRE A;  5LGN A;  4LFB B;  1BQZ A;  1KBH A;  1M56 C;  1XHX A;  3H0G G;  1SQV H;  1HNZ O;  3I55 V;  4MVZ A;  1KBL A;  2YRW A;  2JEX A;  2DPJ A;  1S0M A;  4O2B B;  2ILM A;  1DV1 A;  3PO3 G;  5CR5 A;  4J10 A;  3ASO C;  3OEE G;  2DQ3 A;  5B1N A;  3BY6 A;  3PFF A;  5D8D A;  3M4I A;  2ZDI A;  2OCC C;  3M9N B;  5HFM A;  2EIN C;  4I4T A;  5FD5 A;  1T36 A;  1KC8 W;  2YIB D;  4DRF A;  2XGP A;  4MV9 A;  3DTG A;  5DGA A;  2WWW A;  3OGI B;  1VQK V;  3AG3 C;  4UVC A;  4K8X A;  3DGE A;  1E4G T;  3FMA A;  1YIJ V;  2BSK B;  4TUY F;  4IIJ A;  4U3J B;  1VQM V;  4A3I G;  4LF4 O;  1GSO A;  3JD1 A;  3CRC A;  4UVA A;  3ZRV A;  5IYB O;  4JPR A;  3MWE A;  4Q6G A;  3H4B A;  1XDC A;  1M56 B;  1U96 A;  4JF3 A;  2B1G A;  2R86 A;  3T9A A;  5FLX W;  4H44 B;  4P9P A;  1HR0 H;  1AJP A;  1H8E G;  3ASO B;  3MR3 A;  3HOV G;  1N34 O;  3LSQ A;  2OCC B;  2NU7 B;  2EIN B;  4NZM A;  4GKK B;  4JI5 H;  3B77 A;  3N27 A;  4RB2 C;  4LF8 H;  4O7W A;  4JI2 B;  5CA3 A;  4O7L A;  4Q4C A;  2HLD G;  1E1R G;  3VOU A;  4DUZ O;  3UCS C;  3K5L A;  3WO0 A;  1XDN A;  1GLV A;  2DIK A;  3JD4 A;  1V9P A;  3RAX A;  5D5P A;  1SKV A;  5KFF A;  2YZN A;  3KAJ A;  5KFU A;  4J80 A;  3AG7 A;  5K1P A;  2O03 A;  3G8C A;  1DF5 A;  2WAQ E;  1JA8 A;  3GLK A;  3HOW G;  2WYO A;  2WB1 A;  2W70 A;  2CUG A;  3OAA G;  4DR7 O;  1FYJ A;  3PW4 A;  4UV8 A;  2ZT9 B;  2C2A A;  4WFF A;  4H13 B;  4Z2W A;  1IZ3 A;  5KX5 A;  3CCE V;  2PUS A;  4QSH A;  1BJT A;  5EWG A;  3FD9 A;  1IOW A;  2XCL A;  1K1S A;  4YR3 A;  1W96 A;  3HOZ G;  1AVM A;  2QTO A;  4PDL A;  5JJN B;  1M9N A;  3FYE B;  5BWX A;  1UFI A;  4FLY A;  3U11 A;  2PZS A;  1PV0 A;  3VOT A;  4O3Q A;  2ATL A;  1N48 A;  2HJF C;  1AJN A;  2IA6 A;  3RGB A;  2FKX A;  4TM5 A;  4Q45 A;  3MR2 A;  3LUL A;  3C3T A;  5LYJ A;  1TVK A;  1I1K A;  5IWA B;  4WFH A;  3RT3 C;  3U54 A;  3HKB A;  3BCC H;  4X66 O;  4LF7 H;  1GK9 A;  2PYJ A;  4PI2 A;  3ABT A;  2RGV A;  1Y67 A;  5LHI A;  3G8D A;  2F1M A;  2X0L A;  4L87 A;  2UXB H;  2COG A;  1S68 A;  3UYY A;  4HNA B;  1K83 A;  4MVQ A;  4PI0 A;  3GTM A;  1HNW B;  2VQE O;  2W6I G;  2O57 A;  4RZQ A;  1VIB A;  5LMN O;  1SQQ H;  4A3D G;  3U9T A;  3ZED A;  2WAQ A;  5I5W A;  4YJ2 B;  4WF9 V;  2F93 B;  1NH2 D;  2X5R A;  5BYA A;  4X8A A;  5KG0 A;  2UUA O;  4JV5 H;  3RYC B;  1XMQ O;  1KJJ A;  1Q86 W;  5BMV A;  2CDY A;  1J5E B;  2YEV B;  2Q4P A;  2Q0O C;  2W71 A;  4HYO A;  3SPJ A;  5LP6 C;  3JAL B;  4HR7 A;  5GON B;  3RBZ A;  4GX0 A;  3WWH A;  3E5N A;  5IYC O;  5IYZ B;  2R7Z G;  1YXB A;  1A0G A;  4X20 B;  4O2B A;  1HDJ A;  2C00 A;  2IM9 A;  1BGW A;  3RB4 A;  4LWS B;  4A3C G;  1QLE C;  2QWQ B;  4RO2 A;  1YDX A;  2NN4 A;  2LGW A;  2WLI A;  3J7A U;  2R72 A;  2W9C A;  3CCS V;  5KG3 A;  1PNM A;  5K1X A;  2P67 A;  4DV7 B;  2HGS A;  2W9B B;  2CGO A;  4DR5 H;  1I08 A;  5H80 A;  4F4Z A;  1NKD A;  4IRD A;  3KCY A;  1IYE A;  2CZG A;  2HJD A;  4HN2 A;  4GC6 A;  3APQ A;  1A9X A;  4Q43 A;  2A9H A;  1GO3 E;  3N40 P;  2BSK A;  4U3J A;  1IBK B;  3V4S A;  1VF7 A;  2Q2U A;  4GC7 A;  2X0S A;  3QFF A;  3DAA A;  3PW7 A;  4YP3 A;  4O2A A;  1KUT A;  1NZ6 A;  1NVP B;  3UT5 A;  4YY3 H;  4CKC A;  3N2K B;  5LP6 B;  4EBD A;  4X62 O;  3WB2 A;  3Q8S B;  4DR3 H;  2F43 G;  1RM1 C;  5LMU B;  1FKA H;  1QLE B;  2IJH A;  4JV2 A;  4K0K H;  1Y1W A;  5JQG B;  4QW8 A;  1UJW B;  5KG5 A;  1WB7 A;  3Q1K A;  2Y0S E;  2R8H A;  2QR4 A;  3IJ4 A;  5ITZ B;  4ZI7 B;  2R8K A;  2NNU A;  4MTX A;  4RUF A;  1CKM A;  1SRY A;  1ZLZ A;  1YTF D;  4LFC O;  1B6S A;  1GO3 F;  2ASL A;  2NR5 A;  4CH5 A;  2FK3 A;  4O3R A;  4C7U A;  1GM9 A;  4UCS A;  2ZQM A;  4YIP A;  3QWU A;  1I7F A;  2JEI A;  1Q8I A;  4O81 A;  5I5V A;  5JVD B;  3P3P A;  4EGJ A;  1NBM G;  5H6Q A;  2UXN A;  3EYY A;  2VA2 A;  4NXM B;  1N32 H;  5IJ0 A;  2VPQ A;  1SA0 B;  4RNN A;  2BQ3 A;  1L8D A;  2RMK B;  4XZ3 B;  1K8A W;  4K3A A;  1RM1 B;  2W8L A;  4G2K A;  2HIV A;  3W7S A;  2DOS A;  1CXZ B;  3KKY A;  4XBF A;  1CKN B;  2QKC A;  2IW5 A;  2IH1 C;  4ICG A;  4JTD B;  5KHH A;  3I12 A;  1I6U A;  3CCL V;  5HNE A;  2Q2T A;  2FJZ A;  1QCE A;  2ZJT A;  4O4H B;  2JGU A;  3CCR V;  4F4L A;  3PW0 A;  1S5J A;  2UUB O;  1GN4 A;  2F4V O;  3RV3 A;  4J9S A;  4GCZ A;  2YZM A;  3K06 A;  3OHA A;  5KT2 A;  1R3L C;  5JCO A;  1YI2 V;  3HBL A;  2XAS A;  1XQ8 A;  3G80 A;  4TOI A;  2GV9 A;  2P4K A;  3LQS A;  2FLL A;  4YJ2 F;  4J42 A;  4DV0 O;  1VQO V;  4J7J A;  1RYS A;  2JK5 C;  3PVX A;  3D3Q A;  3OR7 C;  4HNA A;  4W4L A;  4DR2 O;  1DTO A;  1S5H C;  3K59 A;  4NXN B;  4O7N A;  4BY7 G;  1I3Q A;  2IU0 A;  5GON F;  1FFX B;  1VAR A;  2QE7 G;  5IYZ F;  1HP8 A;  3H1J H;  4EB6 B;  4O83 A;  4PA4 A;  4DL6 A;  1K73 W;  3BQ0 A;  4WFB V;  3U9S A;  2WLH A;  3OT7 A;  3JAW A;  3CCQ V;  1A3G A;  1N33 O;  4AYB A;  1K33 A;  5J2U B;  3EHB B;  4DUY B;  4JZG A;  2VS0 A;  4J9Z B;  3GTO A;  4DR4 B;  1RPO A;  4ZBM A;  4UFZ A;  1S72 V;  1WSC A;  1P49 A;  1RYR A;  4O4J F;  1S0V A;  4ASU G;  1W0J G;  4HNU A;  3SJA C;  4QWB A;  3JAL A;  4IRK A;  5GON A;  4MV7 A;  1R6N A;  1ZWI C;  1XIL A;  4GYC B;  4X20 A;  3WWJ A;  5KT4 A;  4X65 O;  1M6V A;  4LWS A;  4HNV A;  3U10 A;  2OTL V;  3RTX A;  1Y74 B;  2ARH A;  2XTA A;  3TQT A;  3RIZ A;  1KUQ A;  1XOU A;  4RAI A;  3CP1 A;  1C3O A;  2HHH B;  1HNX O;  3ORR A;  3NR7 A;  5T14 A;  2F66 C;  3QO7 A;  4DL5 A;  4B3S O;  3G6X A;  5JQG F;  3H0G A;  4RAZ A;  3I56 V;  2FKL A;  3IAY A;  1EBO A;  2LGQ A;  3GB7 C;  1SFO A;  3RFC A;  5DGH A;  4B3M B;  3SYQ A;  3SNO A;  1LR1 A;  4FBT A;  3N2K A;  5LP6 A;  2DPI A;  3OW2 U;  2IJJ A;  5CBF A;  5KA5 A;  2UVV A;  4KUM A;  2W6Z A;  4J9K A;  4O82 A;  3E2E A;  1S03 G;  4IWY A;  1M5I A;  4JI3 B;  5JQG A;  4FLU A;  2OYQ A;  4AHC A;  2HHF B;  4CMF A;  4ZI7 A;  4O84 A;  2CTP A;  2DJV A;  3CRR A;  4I55 F;  1ZHQ A;  1K9M W;  2AGP A;  1IBM B;  5KFK A;  1W2B U;  4RNO A;  3ZX6 A;  4MW8 A;  4WBN B;  2B1I A;  4O7Y A;  3H1L H;  1TGO A;  5L3E A;  2OT5 A;  5KG2 A;  3G6Y A;  5JVD A;  1SQB H;  3ETG A;  5L3D A;  1Y76 A;  1KC7 A;  3FKI A;  3CS5 A;  1R3K C;  1SA0 A;  4FLW A;  4GKK H;  2EJ3 A;  4PA6 A;  4YQW A;  3GII A;  4JI2 H;  2YXL A;  2HVR A;  3AEI A;  3KTM A;  3QF7 A;  3G4S V;  1OCZ C;  2CW8 A;  2HR3 A;  4PZ7 A;  4CMD A;  1KJQ A;  4K35 A;  1IUR A;  3UQ8 A;  1UC8 A;  4ZQI A;  4H33 A;  2JEG A;  4O4H A;  4O7Z A;  4N21 A;  2QA4 V;  3HXL A;  1I50 A;  4ECU A;  1SES A;  1K5Q A;  3LSU A;  4PA7 A;  2WDT A;  4X88 A;  3TII A;  2ZDI C;  4U6P A;  2B5U A;  4FFN A;  2W6O A;  4O7R A;  1H2N A;  2DZD A;  1GYF A;  1S77 D;  4DIM A;  4Z1M G;  5EWF A;  2CTR A;  1M4U A;  3T5J A;  5IY5 C;  2ZIN A;  4YHH O;  1K97 A;  4DRX B;  4ECS A;  4Q20 A;  3RVY A;  3F5W C;  1MZB A;  2LW7 A;  3FB5 C;  3JD3 A;  4X89 A;  5J2U F;  2JJ2 G;  5J2T A;  1EZ1 A;  4J11 A;  3PN1 A;  1RFY A;  4FS2 A;  5LBQ A;  2OLS A;  3Q8Q B;  1XL6 A;  1WR2 A;  1MZF A;  4Q8F A;  3FFQ A;  5BWW A;  2IMW P;  1OCZ B;  4F50 A;  1M57 C;  5C8Y A;  4JI0 O;  2UU9 B;  1JIH A;  4EFB A;  2CTQ A;  5IWA H;  2X7R B;  2JA7 G;  4CH6 A;  3DC5 A;  3GQC A;  4ZHQ B;  2VQF B;  2AGO A;  4PV1 B;  4MA5 A;  4I4T B;  5J2U A;  5C1O A;  2X6B A;  5DQI A;  4DR3 B;  2E75 B;  2YWV A;  1P8L A;  1WPB A;  1KEE A;  5IP9 G;  5LGT A;  2E2H A;  1JX9 A;  3A8T A;  5IY5 B;  2PMZ E;  3KHR A;  2EJR A;  3M99 B;  4IHJ B;  2P4V A;  1G8M A;  2NU6 B;  1WCM G;  3FDS A;  1HNW H;  4IIJ B;  1A32 A;  2HFE C;  1RJQ A;  4BIZ A;  2W0F C; 
#chains in the Genus database with same CATH homology
 2ZIO A;  4DV2 B;  4MV9 A;  4EEQ A;  1X4T A;  3W5O A;  4DV4 B;  3J7A K;  5EOY A;  4X1K B;  5D1P A;  4JI0 H;  4K8X A;  1E4G T;  5JJJ B;  3FMA A;  1HNX B;  3N44 B;  4IIJ A;  1M93 A;  4U3J B;  4O4J B;  4B3S B;  3JAM W;  5EIB C;  1J5E H;  4Q6G A;  1HNZ H;  3HKC B;  4KL1 A;  4X62 B;  1SQF A;  2W57 A;  2XIG A;  3K3V A;  4LH7 A;  2OWO A;  3KXY T;  2Q7E A;  4FM1 A;  4Q0Y A;  3RF2 A;  5CA0 B;  4DV6 B;  5FLX W;  5LL6 b;  4J0M A;  1HR0 H;  4DV5 B;  4B3T B;  3HKC A;  4CC5 A;  3C0F B;  4RB3 C;  4LNU B;  4DV1 B;  2HIX A;  4I50 A;  2VPS A;  3K58 A;  4GLX A;  4GKK B;  4JI5 H;  4PZ6 A;  4DV7 H;  1JMK C;  4RB2 C;  1XHZ A;  4LF8 H;  1DGS A;  4JI2 B;  3RWR D;  4LNU A;  3MAQ A;  3JAR B;  4LF4 H;  4LF6 B;  1Z2O X;  3LML A;  1I94 B;  3A2F A;  3K5L A;  1IBK H;  4R7R A;  1XDN A;  1V9P A;  4NVP A;  2UUC H;  4X1I A;  5D5P A;  2XHB A;  4TQD A;  1SKV A;  3KAJ A;  4DR1 B;  5K1P A;  2O03 A;  4WBN A;  5BR8 H;  3RGX A;  4AQY B;  2WYO A;  3OTF A;  3IG0 A;  1N34 H;  4DV3 B;  5LMU H;  4UCU A;  1XNR B;  3T1Y H;  4JI6 H;  4BWS C;  5KX5 A;  4JI4 B;  3JAS B;  3RYI B;  2PUS A;  4I55 B;  3VQX A;  1BJT A;  5FNV B;  5LYJ B;  4DUZ H;  1TVK B;  5JJN B;  2Q7H A;  5FD6 A;  5FPO A;  3HKB B;  2ZM6 B;  4FLY A;  3U11 A;  2PZS A;  3RYF B;  3JAS A;  3RYI A;  2PYL A;  4TV9 A;  1XNQ H;  3RGB A;  2RQ6 A;  4AIL C;  5LYJ A;  1TVK A;  5IWA B;  1VS0 A;  4CC6 A;  5CB4 B;  1SEI A;  3HKB A;  4NXM H;  1XMO B;  2CFM A;  3RYF A;  4DK1 A;  4DR7 H;  2UXC H;  3CVZ A;  4LF7 H;  2PYJ A;  4PI2 A;  1N36 B;  2RGV A;  4A2B A;  4PHZ A;  4YHH B;  1XK5 A;  2F1M A;  2KKW A;  4LH6 A;  4JI7 H;  2UXB H;  1WN7 A;  5CB4 A;  1Z2N X;  1S68 A;  4HNA B;  4OX9 H;  3ZS8 C;  1Q3E A;  4KHP H;  4E6N A;  5FPR A;  4PI0 A;  2UXD B;  1HNW B;  3QTC A;  2EX3 A;  4RZQ A;  5LXT A;  2E3C A;  3GB8 B;  3L4K A;  5KHG A;  5JH7 B;  4UCR A;  3ZED A;  1A0I A;  4ZIB A;  5IJ9 B;  2VWK A;  2P22 C;  2Q7G A;  4YJ2 B;  4F6R B;  1Z2P X;  4JI0 B;  1M0W A;  2VOB A;  2F93 B;  3JSN A;  3VQW A;  3T1H H;  4JV5 H;  3N2G B;  3RYC B;  5BMV A;  4X66 H;  1J5E B;  4X1Y B;  1HNZ B;  4F6R A;  4YJ2 A;  2ZNJ A;  4ZHQ A;  3JAL B;  2Q0A A;  5LP6 C;  5GON B;  3N2G A;  3RYC A;  2ZNI A;  5IYZ B;  3J80 W;  4X20 B;  5EYP A;  3RR5 A;  4O2B A;  3TY5 A;  5EZY B;  2IM9 A;  1HR0 B;  1BGW A;  4X1Y A;  3KAK A;  3NC0 B;  2VQE H;  2YIB A;  4IHJ A;  5D5Q A;  5LMN H;  4NXN H;  1O9G A;  2R72 A;  4JI5 B;  5IYZ A;  2YIA A;  5K1X A;  2HGS A;  4DV7 B;  3N42 B;  5JJE B;  4CH4 A;  4DR5 H;  4LF8 B;  4FVM A;  4D7S A;  1ZAU A;  1KMI Z;  2HVQ A;  4O2A B;  2UUA H;  4LF4 B;  1XMQ H;  4UCT A;  4X1K A;  2V4D A;  3N40 P;  3UT5 B;  1JFF B;  4U3J A;  1IBK B;  1VF7 A;  2Q2U A;  4EFE A;  2JVD A;  4DUY H;  2RGR A;  5D1O B;  4LSX A;  4O4J A;  2UUC B;  2VWJ A;  4DR4 H;  4LFB H;  4O2A A;  2BTQ B;  4B08 A;  4LR3 A;  4I7H A;  3UT5 A;  4YY3 H;  1JFF A;  4PZ8 A;  4TV8 B;  5BR8 B;  3N2K B;  4O4I B;  5LP6 B;  3WB2 A;  5D1O A;  4CH3 A;  5KMG B;  1RSO A;  5CA0 A;  4DR3 H;  1N34 B;  5LMU B;  1Z5V A;  4BW9 A;  1FKA H;  4ETS A;  1B04 A;  1SQG A;  4B3R H;  5JQG B;  3T1Y B;  4K0K H;  4FM0 A;  4TV8 A;  4JI6 B;  4O4I A;  5CA1 B;  5ITZ B;  4ZI7 B;  1X9N A;  1Q43 A;  2HHH H;  1JJO A;  1HW7 A;  4CS2 A;  4DUZ B;  1CKM A;  5JCO C;  2MCT A;  3JAR A;  2JS5 A;  4CH5 A;  3U0Z A;  4UCS A;  5IJ0 B;  4I9Q A;  2F95 B;  4A2A A;  3QWU A;  5ITZ A;  2RJZ A;  1I7F A;  3CHX A;  3KAL A;  1Q8I A;  3BAB A;  5JVD B;  1FJG H;  3J81 W;  4X62 H;  4B3M H;  3JAT B;  1M0T A;  3EYY A;  1N32 H;  3QG5 A;  3JSL A;  4NXM B;  5IJ0 A;  1SA0 B;  4DR7 B;  2UXC B;  4LF7 B;  1ZHS A;  4GKJ H;  1L8D A;  4PDB A;  2KSW A;  4UCO A;  3K5M A;  2UXB B;  2HIV A;  4JI3 H;  3N6X A;  4L8J A;  2R70 A;  1CKN B;  5KHH A;  3VQY A;  3OTO H;  1I6U A;  3TY8 A;  2Q2T A;  1G6U A;  2R9A A;  1KU9 A;  2PTM A;  4I55 A;  4YJ3 B;  4LFC H;  5FNV A;  3BRC A;  2QJ1 A;  2ZJT A;  4O4H B;  2JGU A;  4LMY A;  1CKN A;  4LF9 H;  4LF6 H;  1IBM H;  1S5J A;  1E4F T;  3TY9 A;  4JV5 B;  4YJ3 A;  3N41 B;  4UCV A;  3HKE B;  4X66 B;  4JYA H;  5JCO A;  4CS4 A;  3B2E E;  3NBY B;  2HVS A;  3RFR A;  2VUG A;  1XQ8 A;  3KYH C;  4LSA A;  4TOI A;  2GV9 A;  2P5O A;  3HKD B;  5LOV B;  4DR6 H;  4LFA H;  3DSQ A;  2VQE B;  4HNA A;  1QQC A;  4ZOL B;  3K59 A;  4NXN B;  2FE3 A;  3JAW B;  3GJX B;  1FFX B;  1O9H A;  5KHI A;  4DR5 B;  4EB6 B;  5JH7 A;  2UUB H;  2F4V H;  1IBL H;  5IJ9 A;  2UUA B;  1XMQ B;  3L2P A;  3N43 B;  4X64 H;  2ZM6 H;  3JAW A;  4JI8 H;  2YI8 A;  5J2U B;  1FFX A;  4DUY B;  1NT2 B;  5LA6 B;  3THO A;  4EB6 A;  4DR4 B;  4UFZ A;  1P49 A;  4DV0 H;  1WNS A;  3SJA C;  4YY3 B;  3JAL A;  5GON A;  4MV7 A;  1WH2 A;  1N36 H;  4LF5 H;  3F8N A;  4GYC B;  4X20 A;  4DR2 H;  5EZY A;  3U10 A;  3RTX A;  3SGI A;  4O4L B;  4B3R B;  4K0K B;  1P16 A;  1TAE A;  3RIZ A;  2WE6 A;  2UXD H;  3SR2 C;  2UU9 H;  2HHH B;  1Q5O A;  3BA9 A;  3S24 A;  4O4L A;  1N33 H;  2F66 C;  2ZCE A;  2VQF H;  1SYX B;  4RAZ A;  4APM A;  3IAY A;  3K5O A;  1AN7 A;  1FJG B;  2CW7 A;  3W1G A;  2BTQ A;  4B3M B;  4MTD A;  1N32 B;  4TUY B;  2QM4 A;  3N2K A;  5LP6 A;  4I50 B;  4GKJ B;  3MWM A;  4X65 H;  4D7T A;  2E5L H;  3JAK B;  4FM2 A;  5KMG A;  4FLT A;  4JI1 H;  3E22 B;  3BPZ A;  4DV2 H;  1S03 G;  4FLX A;  1M5I A;  4JI3 B;  3ETQ A;  5KHK A;  5JQG A;  4DV4 H;  1Z5W A;  4TUY A;  4FLU A;  3VQV A;  2OYQ A;  3OTO B;  1HNX H;  4AHC A;  2YCH A;  3JAK A;  5CA1 A;  1XNQ B;  4LFC B;  4ZI7 A;  3E22 A;  3CSX A;  4X1I B;  4RB0 A;  1ZHQ A;  3CB2 A;  4B3S H;  3LNN A;  4CS3 A;  2CAZ C;  1QHT A;  1IBM B;  3BA8 A;  4LF9 B;  1L2Z A;  4WBN B;  1TGO A;  4DV6 H;  5JVD A;  1XI1 A;  4JI7 B;  4JYA B;  4DV5 H;  4B3T H;  3JAT A;  3WB0 A;  4DV1 H;  3M7M X;  3VNN A;  4OX9 B;  4RAY A;  1SA0 A;  4KHP B;  5EIB D;  4FLW A;  4FLV A;  5KX5 B;  4GKK H;  3RYH B;  4DR6 B;  4LFA B;  4BWA A;  1O75 A;  4EQ5 A;  4JI2 H;  5A2Q W;  2YIB D;  3WB1 A;  2YXL A;  2HVR A;  5IT9 W;  4MTE A;  3ICX A;  3QF7 A;  1I94 H;  2CW8 A;  1TA8 A;  3RYH A;  4TV9 B;  3T1H B;  4PZ7 A;  4K8Z A;  3UQ8 A;  3K57 A;  3SJC C;  4O4H A;  1T5E A;  2UUB B;  2F4V B;  1IBL B;  3HXL A;  4IAJ A;  4DR1 H;  2WDT A;  4X64 B;  1D5A A;  3RJ0 A;  3BHP A;  3K5N A;  3L4J A;  4JI8 B;  4DK0 A;  4AQY H;  4TQF A;  1GYF A;  2BTO A;  4HBN A;  3HKE A;  4DV3 H;  4FFB B;  1M4U A;  5J2T B;  4DV0 B;  1CKO A;  1XNR H;  2ZIN A;  4DRX B;  5DIS C;  5LMN B;  3HKD A;  5LOV A;  1MZB A;  4JI4 H;  5LXT B;  4LF5 B;  3BAA A;  5C8Y B;  4FFB A;  4DR2 B;  5J2T A;  3PN1 A;  3W1B A;  1TUB B;  4RB1 A;  4DRX A;  1FVI A;  4ZOL A;  4FM9 A;  5KHJ A;  2PGG A;  3FFQ A;  2PY5 A;  2HEP A;  3NBZ B;  1H2S B;  5C8Y A;  2UU9 B;  3RGZ A;  5BMV B;  4EFB A;  5IWA H;  1TUB A;  4LFB B;  1N33 B;  4CH6 A;  4ZHQ B;  2ZIM A;  2VQF B;  1XHX A;  1XMO H;  4M7E A;  1YEW A;  4I4T B;  3GDE A;  5J2U A;  4FLZ A;  3H20 A;  5LA6 A;  4DR3 B;  4YHH H;  5EYP B;  4O2B B;  1P8L A;  1WPB A;  3DF7 A;  2YI9 A;  4IHJ B;  3M4I A;  4X65 B;  4I4T A;  1HNW H;  5FD5 A;  2E5L B;  4IIJ B;  3SJB C;  4JI1 B;  4DRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...