4EFGA

Crystal structure of the q108k:k40l:t51v:t53c:y19w:r58w:t29l mutant of cellular retinol binding protein type ii in complex with all-trans-retinal at 1.58 angstrom resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
133
structure length
133
Chain Sequence
TRDQNGTWEMESNENFEGWMKALDIDFALRKIAVRLTQTLVIDQDGDNFKVKCTSTFWNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKKWIEGDKLYLELTCGDQVCRQVFKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tuning the electronic absorption of protein-embedded all-trans-retinal.
pubmed doi rcsb
molecule keywords Retinol-binding protein 2
molecule tags Transport protein
source organism Homo sapiens
total genus 36
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4efgA00
1GKAA 4YBPA 4O9SA 1YIVA 2WR6A 5BVSA 3PH5A 3NR3A 4QYPA 3NQ3A 1QY0A 5HCDC 1CBRA 4KIIA 1A18A 3CR6A 4BVMA 4ZJ0A 3VG6A 4Y0QA 2OFMX 1IIUA 1VYFA 5DG4A 4TLJA 5LJBA 1X8UA 3I17A 3AKNA 1QABE 2HZQA 2KTDA 1SY0A 3TGAA 1OEJA 1GT5A 1EUOA 4GKCA 5D4AA 1L6MA 4IB9A 2CM9A 4Y0RA 1BRQA 4YKOA 1JJXA 2JOZA 1ZNKA 2POAA 4I3DA 4OMWA 1U18A 2CZUA 3TGCA 1IFCA 2AT0X 3APVA 2AT3X 4RUNA 4YMYA 1GX8A 3C76X 4YDAA 3WXQA 3C77X 4HPBA 3VG2A 5F58A 4M6SA 5HWZA 1DFVA 3VG7A 3FEKA 4MVKA 4A8ZA 1KZXA 3APWA 1X71A 3MBTA 4QYNA 1HMTA 5HBSA 5HCCC 2K23A 5F6BA 4MVLA 1I05A 5EDCA 2A2UA 3P6CA 3D96A 4AZPA 1EW3A 4R0BA 2RA6A 5D45A 1GX9A 4NLIA 2L5PA 1BM5A 1CRBA 1AVGI 4GETA 3MVFA 1DZPA 5EPQA 1EIOA 2FR3A 3U0DA 2O62A 3O2YA 1VYGA 4EEJA 1EPBA 3D97A 5EDBA 5LJGA 2DM5A 5HA0A 1ZNDA 5LJEA 1BRPA 3AKMA 4IAWA 1FTPA 3WVMA 1KOIA 4XMDA 3RZYA 1B8EA 2Q9SA 3B2IA 1DC9A 3RSWA 5IO6A 3CQRA 3BRNA 1LPJA 4I9RA 5JR8A 2OVAA 4XMCA 1KXOA 4AZRA 1QFTA 1SXYA 5HCEC 1YWCA 3FA7A 5KICA 1T8VA 3B2KA 2Q39A 4ZH9A 2W2AA 4NLJA 4ORXA 3ELZA 1AB0A 1LFOA 1B4MA 2A0AA 1D2UA 3UEUA 1SY1A 1EIIA 3PECA 3WJBA 3EYCA 1HBQA 4BOEA 1GT3A 2MJIA 3EBKA 5HZQA 1BSQA 3VG3A 1IKJA 1LIFA 4NYQA 1SY3A 5HA1A 2EU7X 5FAZA 3WJGA 1ZNEA 2HZRA 2OVEA 4ZR2A 2A2GA 2CBRA 4K19A 5D47A 1CBQA 2P8GA 2L67A 4N7DA 1AELA 3NP1A 1DZKA 4ARHA 1I04A 1KT4A 4ZHGA 3NQ9A 4YFPA 1EALA 1FENA 4WFVA 3BS2A 3HK1A 4ODDA 4YGGA 2AKQA 2MO5A 4D6AA 1PMPA 2LBAA 1SA8A 2NNQA 4XMFA 1CBIA 1HMRA 3Q6LA 5L8IA 1FELA 1KT5A 4AZMA 4IMOA 1HQPA 1ICMA 3NX1A 4ZH6A 1QY2A 1LIDA 4ZCBA 2ALLX 1ML7A 2Q2PA 1X89A 3PP6A 2WWPA 5B29A 1DZJA 1NGLA 1FEMA 2JU3A 2FR2A 3WJFA 4A60A 1O1VA 5H9NA 5HTDA 4ORSA 1G7NA 5DPQA 1E06A 2FT9A 1OBQA 3SAOA 1ERXA 2AT6X 1GKAB 3K3LA 3PEDA 4A1HA 1XKIA 1OBPA 3UEWA 1G85A 4QZTA 2CZTA 2KT4B 5F1EA 2WEXA 4ALOA 3FMZA 1GT4A 4AW8A 1CJ5A 1LIBA 1X8NA 3B2HA 1B0OA 2FS6A 2Q2MA 1MDCA 3BU1A 4NYRA 3T1DA 2OZQA 2AH7X 1N0SA 3UEXA 2ACOA 1DZMA 1RBPA 1MVGA 2LFOA 1E02A 4ZGUA 2JU7A 1GT1A 1QFVA 5KHPA 2FRSA 1UREA 3GAQA 1GGLA 3FA8A 1O1UA 2ASNX 1KT3A 3F8AA 3PPTA 1PM1X 4TJZA 4YDBA 1O8VA 1YUPA 4CK4A 3EMMA 1A3YA 3CBSA 4TKHA 4LZUA 4XMEA 3JSQA 4QAEA 3VG5A 4DQ3A 1H91A 3BDRA 1YWDA 2LB6A 1IW2A 2LKKA 1JV4A 3KFIA 2WEWA 2R56A 3D95A 3KQ0A 1U17A 1CBSA 4WBKA 4BQUA 1T0VA 2QO4A 2QM9A 1LF7A 3ZUIA 3FR4A 4HPCA 1OBUA 3DSZA 5HZ8A 2HNXA 4AZOA 5L8NA 1AQBA 3FIQA 5HZ5A 2F73A 4ORYA 1JYDA 2X46A 3TGBA 5H8TA 4ORUA 4TKJA 1D3SA 4XMHA 1PEEA 2K62A 3C78X 1IFBA 2GC9A 3NPOA 1BJ7A 4OMXA 1TW4A 1T68X 5FFHA 2WSJA 4GNYA 3L4RA 1XCAA 3KFHA 4NP1A 1KT6A 2RQ0A 2W2FA 3FR2A 2FLJA 3FLLA 4UU3A 1LIEA 4YGZA 3JS1A 2E4JA 5CE4A 5AQ6A 3TF6A 1LNMA 1TOUA 2RD7C 4QGVA 3TZSA 1QG5A 3FW4A 1P6PA 2QO6A 1ERBA 1PBOA 4RUUA 2W2BA 4YGHA 1OPAA 3IA8A 3CMPA 4OS8A 4M7MA 1G74A 3U03A 5LJKA 4YBUA 4Y0SA 1ICNA 1ZRYA 2L68A 4DQ4A 3EBWA 3F9DA 1MUPA 5F7GA 2ANSA 3BX7A 3FA6A 2HLVA 2WQ9A 4LKPA 3OJYC 3P6EA 4TKBA 2RCQA 5LKFA 3WJCA 1UZ2X 3FR5A 1I4UA 1BBPA 4ZHHA 3HWGA 1JJJA 2LBVA 4ZHDA 1EQDA 4QZUA 2RCTA 2CM4A 5FENA 1X8OA 1E00A 2CBSA 4ORRA 1FDQA 5EEEA 1YWBA 2FS7A 4YFQA 4D6BA 1GM6A 1U0XA 5L8OA 3P6HA 3U9PC 4NNTA 5HTEA 3ZQ3A 1A2DA 1FE3A 1ALBA 1MX8A 2G78A 3EM0A 5C0NA 4GE1A 3APXA 2GTFX 1E5PA 1I06A 1NP4A 3FEPA 4XMGA 3FA9A 2YG2A 4I3BA 3BX8A 5BVQA 4I3CA 5F6ZA 4YKMA 1YP6A 1KQXA 4I9SA 3WBGA 5HZ6A 5HZ9A 2WQAE 4NNSA 5EZ2A 1R0UA 1JZUA 2A13A 2Q4NA 1BEBA 1KGLA 4YCEA 5IO5A 1SXWA 1JYJA 1S2PA 3NADA 1SY2A 1ACDA 1BWYA 5B27A 1LICA 2WUTA 4UU2A 5H9LA 1GXAA 3HWDA 3QKGA 1BSOA 3DTQA 1EXSA 3B2LA 1DV9A 1Z24A 5H9AA 3HWFA 1SXXA 1KZWA 1QQSA 2AT5X 2QOSC 4IMNA 1G5WA 1ZNLA 2OFRX 1TVQA 3ZUOA 4YFRA 4A1YA 4AYHA 3CQNA 1ZNGA 2X45A 1SXUA 3O22A 3BY0A 1S7DA 3STNA 1ZNHA 1LKEA 4LZVA 2XSTA 3P6FA 2BLGA 5IO7A 4IAXA 4ZHCA 3STMX 4TQ2A 2JN3A 4QGXA 5HAEA 1KT7A 2N93A 1X8QA 4ZFXA 2MM3A 1BLRA 3P6DA 3KFFA 1S44A 3VG4A 2FWVA 3WJDA 1B56A 5H9KA 1QWDA 4EXZA 1VPRA 3WJEA 3PH6A 2R74A 4N7CA 2QO5A 3CWKA 4IB6A 2IFBA 3G7XA 1IKEA 1TOWA 2PY1A 3O19A 1EPAA 3P6GA 5BVTA 3KZAA 2ACPX 4LKTA 2GJ5A 3B2JA 3FELA 3FW5A 3HWEA 5LJHA 3S26A 4IB8A 4OS3A 2NNDA 3CBCA 4AZNA 1A57A 1DF3A 4HPAA 4OS0A 5LJDA 4ZHFA 4WFUA 1HMSA 2JU8A 1HBPA 3IFBA 2R73A 1JBHA 1TXLA 1ADLA 2HMBA 2XKLA 4TNNA 4YCHA 4ES7A 5LKEA 5LJCA 1YP7A 4YH0A 4IBAA 2G7BA 2NNEA 3APUA 3STKA 4EDEA 2L9CA 3UEVA 5EEDA 4IB7A 1X8PA 1OPBA 5D48A 4GNWA 4Y0PA 2G79A 1BSYA 4EFGA 2FTBA 4MVIA 3NX2A 2NP1A 5D8JA 1YWAA 4HPDA 1KQWA 4PSQA 4ALBA 2A3FX 2OVDA 1HN2A 1NP1A 4AZQA 3BU9A 1MX7A 3FENA 3BSZE 5K06A 5KIDA 1OEEA 2HYSA 1RLBE 4HFOA 3KFGA 2AL0X 1OEKA 1QY1A 3I0AA 3BLGA 4ORWA 4GH7A 4GRJA 3ELXA 4QGWA 2AMMX 2AT8X
chains in the Genus database with same CATH superfamily
1HQQA 4CV7A 3HOEA 1GKAA 4YBPA 4O9SA 3T6FA 1YIVA 3FIDA 4QRLA 2WR6A 5BVSA 3RDOA 1I78A 3PH5A 3NR3A 4QYPA 3NQ3A 4DCBA 1QY0A 3CKGA 4BJ8A 1CBRA 4ON1A 2OL6O 4KIIA 1A18A 3CR6A 4PJ2A 4BVMA 4ZJ0A 3VG6A 4Y0QA 2AF5A 1IIUA 1VYFA 2OFMX 1VWBB 4TLJA 5DG4A 5LJBA 1X8UA 3I17A 3AKNA 1QABE 2HZQA 2OFBA 2KTDA 1STRB 1SY0A 4U9CA 3TGAA 1OEJA 2IZLB 1NQMA 2JGSA 2OL7A 2A5CA 1HY2A 1GT5A 1EUOA 1SWTA 4GKCA 4MVEA 5D4AA 1L6MA 4IB9A 3MX7A 3T2XA 3UAQA 2CM9A 4JHQA 1BRQA 4Y0RA 4YKOA 1JJXA 2JOZA 4U3QA 1ZNKA 2POAA 4I3DA 4OMWA 1U18A 2CZUA 2KD2A 2X4MA 3TGCA 1IFCA 4GGTA 2AT0X 3APVA 2AT3X 4RUNA 4YMYA 1GX8A 3C76X 4YDAA 2JMBA 4QNIA 3HOLA 3AEHA 1NBXA 3WXQA 3OBLA 3C77X 4HPBA 3VG2A 5F58A 4M6SA 1SRGA 1DFVA 3VG7A 5HWZA 3FEKA 4MVKA 4A8ZA 1KZXA 3APWA 1X71A 3MBTA 3D4RA 1WBIA 4QYNA 1SWUA 1HMTA 2UZ2A 3FDCA 5HBSA 3RDXA 5HCCC 2K23A 2Y32A 1UYNX 5F6BA 4MVLA 4CDFA 1SWOA 1I05A 5EDCA 3SZIA 1LCZA 2A2UA 3FYFA 3P6CA 3D96A 4AZPA 1VWOB 1EW3A 4O4OA 1VWMB 2RA6A 4MISA 4R0BA 4KT5A 4NW4A 5D45A 1GX9A 4NLIA 2L5PA 1BM5A 1CRBA 3ZWEA 1SWQA 3H3IA 1AVGI 3LTWA 4Z28A 2IZBA 4GETA 3MVFA 2ZAIA 1DZPA 5EPQA 1EIOA 2C1SA 2FR3A 1Y52X 3U0DA 2O62A 3O2YA 1VYGA 4EEJA 1EPBA 3D97A 4O3WA 5EDBA 2I5VO 1LDOA 5F2BA 1SRHA 2DM5A 1SLFB 2Y3EA 5LJGA 5HA0A 3WYQA 1ZNDA 1VYOA 4FGIB 5CSEA 3VPJE 3VU1A 5LJEA 1BRPA 3AKMA 1LELA 1FTPA 4IAWA 1KOIA 4XMDA 3RZYA 3WVMA 2X55A 1B8EA 2Q9SA 3B2IA 1DC9A 3RSWA 1N4JA 5IO6A 3CQRA 1VWEB 3BRNA 3EW1A 1LPJA 1JQPA 4GDAA 1DF8A 4I9RA 5JR8A 2OVAA 4GZVA 3S5XA 4XMCA 1KXOA 4AZRA 1QFTA 1SXYA 1Y0GA 1YWCA 3FA7A 5HCEC 5KICA 1T8VA 3SZJA 5CYBA 3B2KA 2Q39A 4O3ZA 4ZH9A 2W2AA 4MIRA 2OY7A 4NLJA 1SWBA 3P24A 4ORXA 5BYPA 3ELZA 1AB0A 1LFOA 1B4MA 2A0AA 1D2UA 1W6FA 3UEUA 1SY1A 1EIIA 3PECA 3WJBA 3MG5A 2BC3A 1VWHB 1HBQA 3EYCA 1SWJA 4NV8A 2OFAA 5IRUA 3PDFA 1NDJA 1GT3A 3RDSA 4BOEA 2F09A 4CDEA 2MJIA 3EBKA 4GJSA 5HZQA 1BSQA 3VG3A 1IKJA 1LIFA 4GJVA 1SY3A 4NYQA 5HA1A 2EU7X 5FAZA 3VHMA 1ZNEA 3WJGA 2HZRA 4Z6JA 2OVEA 2RTDB 3N91A 2A2GA 2CBRA 2QMIA 4K19A 5D47A 4ZR2A 1CBQA 4BBOA 4I60A 2P8GA 2L67A 2IZKA 4BX5A 2A8GA 4GUZA 2FKGA 4N7DA 1AELA 3NP1A 1DZKA 3GE2A 4ARHA 4KC8A 2C1QA 1I04A 1KT4A 2MWHA 3NQ9A 1SWDA 2HKDA 4YFPA 4ZHGA 1EALA 1FENA 4WFVA 2OYBO 2RTLA 3BS2A 3HK1A 4GGRA 4BX6B 4I6SA 4BGFA 5B2AO 1MEPA 4ODDA 4YGGA 1LCWA 2AKQA 2MO5A 4BX5B 4D6AA 3SLOA 1PMPA 3VHIA 3VE1A 2LBAA 1SA8A 2NNQA 4O4XA 4XMFA 1CBIA 1HMRA 3Q6LA 5L8IA 1FELA 1K3BA 1KT5A 2BT9A 2VFBA 1HQPA 1ICMA 3NX1A 4IMOA 3D9WA 4ZH6A 1QY2A 3KVNA 1VWPB 2MF6A 1LIDA 4ZCBA 2FKJA 3PQSA 2ALLX 1ML7A 1N7YA 2Q2PA 1FJ1E 4COTA 1X89A 3PP6A 2WWPA 5B29A 4C5PA 1DZJA 1NGLA 1FEMA 2JU3A 1SLGB 2FR2A 3WJFA 4A60A 1VWCB 2GH7A 4U8UO 1O1VA 1VWJB 2RTOB 5H9NA 4U8UN 5HTDA 4ORSA 1G7NA 5DPQA 1E06A 2FT9A 1OBQA 3SAOA 4BCSA 2X8TA 1ERXA 4O4UA 2AT6X 1GKAB 2IZAA 3K3LA 2A5BA 2Z4HA 3OD9A 4KCAA 2G5LA 3PEDA 4A1HA 1XKIA 1OBPA 2X32A 3UEWA 3ZZVA 2RTKA 1G85A 4QZTA 3RE5A 2CZTA 2KT4B 3S60A 5F1EA 2BS6A 2WEXA 4ALOA 3FMZA 1SRIA 1GT4A 3RE6A 4AW8A 1LIBA 1X8NA 2GTLO 4Z2PA 3B2HA 1CJ5A 3ZW0A 1B0OA 2FS6A 2GTLN 2Q2MA 1MDCA 3BU1A 4NYRA 2BS5A 5CHKA 3T1DA 2OZQA 1HXLA 1RXHA 1STPA 2AH7X 1EI5A 2F01A 4AZMA 1N0SA 2IZIA 4JNJA 2X34A 3UEXA 2OY1O 2ACOA 2C4IA 1DZMA 1RBPA 1MVGA 2AVIA 3RDMA 2LFOA 1VWLB 1E02A 4ZGUA 2JU7A 1GT1A 1QFVA 2VFCA 3LV4A 5KHPA 2FRSA 1UREA 2WPUA 3SZHA 3ZW0B 3GAQA 1GGLA 3FA8A 4OKAA 1NQNA 1SWLA 1KL3A 3PK2A 1O1UA 2ASNX 2RTGB 1KT3A 1K24A 3F8AA 1SWPA 1PM1X 3PPTA 2KW1A 4TJZA 4YDBA 1O8VA 1VWDB 1YUPA 4CK4A 3EMMA 3X00A 1A3YA 3CBSA 4TKHA 4LZUA 4XMEA 3JSQA 4QAEA 4Y59A 3VG5A 2OF9A 4CPHA 1Y55X 4DQ3A 1H91A 3BDRA 1YWDA 2LB6A 1IW2A 1E2TA 2LKKA 4CDDA 1JV4A 4ID2A 3KFIA 4KC7A 2WEWA 4GU8A 4Z27A 1MOYA 2R56A 4BX7A 3RY2A 3D95A 1RSUB 3KQ0A 1U17A 4QQ1A 1CBSA 3WZNA 4IABA 4WBKA 4BQUA 1T0VA 2QO4A 2QM9A 1LF7A 1JIWI 3ZUIA 3FR4A 3P02A 4HPCA 1OBUA 2QCBA 3DSZA 2OY5O 3WZOA 2DJGA 5HZ8A 2HNXA 4U46A 4AZOA 5L8NA 1AQBA 2ZAGA 3FIQA 5HZ5A 1SWKA 2BHVA 4BX7B 2F73A 4ORYA 2IZDB 1JYDA 2X46A 3TGBA 1SWSA 5H8TA 4ORUA 4TKJA 1SWAA 1D3SA 4XMHA 1PEEA 5B5FA 2K62A 3C78X 1IFBA 2GC9A 3NPOA 1BJ7A 4OMXA 1TW4A 1VWFB 2CAMA 1SWGA 3F6ZB 4ZGFA 4MEEA 1T68X 5FFHA 1LDQA 2WSJA 3L4RA 1XCAA 4GNYA 3KFHA 4NP1A 1KT6A 1Y9TA 2RQ0A 2W2FA 3FR2A 2FLJA 3FLLA 1KL5A 1N43A 1LIEA 2RTEB 4UU3A 3JS1A 2E4JA 4YGZA 4CPEA 5CE4A 5AQ6A 3TF6A 1MK5A 1LNMA 1TOUA 2RD7C 5L3YA 1NC9A 4QGVA 3RY1A 3TZSA 1QG5A 3FW4A 4FBVA 2FHNX 4WHIA 1P6PA 1LUQA 2QO6A 1ERBA 1AVDA 1Y53X 4FBOA 1PBOA 1Y9LA 4RUUA 2W2BA 2RTRB 1OPAA 3IA8A 3CMPA 4YGHA 5K67A 1VWKB 5K68A 2FGSA 5IXGA 4OS8A 5AEOA 4M7MA 1G74A 2RTCB 3U03A 5LJKA 4YBUA 4Y0SA 3WZPA 2RTAA 3T6LA 2G8CO 3VHHA 4L1NA 1ICNA 3V8UA 1ZRYA 2L68A 4DQ4A 3ZW1A 3EBWA 2Z4IA 3F9DA 1MUPA 3E3CA 5AJCA 3VGWA 5F7GA 2ANSA 1STSB 4CSBA 3BX7A 3FA6A 4CDCA 2HLVA 2WQ9A 5B3MO 4LKPA 3OJYC 3P6EA 4TKBA 2RCQA 2IZGB 5LKFA 1PTSA 3WJCA 1UZ2X 3FR5A 1I4UA 1BBPA 4ZHHA 1JJUA 3HWGA 1JJJA 1LCVA 2LBVA 1GX3A 2OL8O 4ZHDA 1EQDA 4QZUA 2RCTA 2CM4A 1VWIB 2FHLA 5FENA 1X8OA 1E00A 3VE2A 2CBSA 4ORRA 1FDQA 2X8SA 3RBYA 2IZHB 1W4TA 5EEEA 1YWBA 2FS7A 4YFQA 4D6BA 4Y5DA 1GM6A 1U0XA 5L8OA 1RSTB 3P6HA 3Q34A 4GDZA 4OEMA 3U9PC 2OVSA 4CPFA 2RTMA 4NNTA 5HTEA 3ZQ3A 1A2DA 2ZSCA 5AJBA 1FE3A 4JO6A 1ALBA 1MX8A 2G78A 1SLDB 3EM0A 5C0NA 4GE1A 3APXA 2GTFX 3NQKA 1E5PA 1I06A 1NP4A 1JMXA 3FEPA 1SREA 3HTYA 1KFFA 4XMGA 3FA9A 2YG2A 4I3BA 2I5ZO 3BX8A 2OY8A 1VWGB 5BVQA 2YMSA 4I3CA 5F6ZA 4O4SA 4YKMA 1YP6A 1KQXA 4I9SA 3WBGA 5HZ6A 5HZ9A 1SRJA 2WQAE 4NNSA 4O3XB 5EZ2A 1R0UA 1JZUA 2A13A 3WYPA 2Q4NA 1BEBA 2IZEB 1KGLA 4YCEA 2X8FA 5IO5A 1SXWA 1N9MA 3RDQA 1JYJA 1S2PA 3NADA 3T2WA 1SY2A 1ACDA 1BWYA 1SWEA 5B27A 1LICA 2WUTA 4UU2A 5H9LA 1GXAA 4NV7A 3HWDA 4O49A 3QKGA 1BSOA 3DTQA 1EXSA 1RXJA 3B2LA 1DV9A 4O3YA 1Z24A 2Y3FA 2KTSA 5H9AA 3HWFA 1SXXA 3AUMO 5B11O 1QQSA 1HXZA 2DJFA 5HCDC 1KZWA 4GD9A 4EKVA 2AT5X 2QOSC 4IMNA 4U8UM 1VWRB 1G5WA 4FBRA 1ZNLA 2IZJA 2OFRX 1TVQA 3ZUOA 4YFRA 4A1YA 3RDUA 3CQNA 4AYHA 3JQOA 1ZNGA 2X45A 1SXUA 3O22A 3BY0A 1S7DA 1VWNB 3STNA 1ZNHA 1LKEA 3WZQA 4LZVA 2XSTA 1MM9A 3P6FA 2BLGA 5IO7A 2M4LA 2X56A 4IAXA 3STMX 4ZHCA 4TQ2A 2JN3A 4B55A 4QGXA 5HAEA 1KT7A 1SWHA 3EC5A 4CPHB 2N93A 4I95A 1X8QA 5FQ8E 1JMZA 4ZFXA 2MM3A 1BLRA 2GTLM 3ZI8A 3P6DA 3KFFA 1KL4A 1S44A 2BSZA 3MM0A 3VG4A 2FWVA 3WJDA 2RTJA 1B56A 4CPIA 4DNEA 5H9KA 1QWDA 4EXZA 1VPRA 3WJEA 1SWNA 2MHDA 3PH6A 2R74A 4N7CA 2QO5A 3CWKA 4GGZA 3OE3A 1W5RA 2RTBB 2IFBA 3G7XA 4IB6A 4YVBA 1IKEA 1TOWA 2PY1A 3O19A 1EPAA 3P6GA 1N9YA 3KZAA 5BVTA 2ACPX 4LKTA 2GJ5A 3B2JA 3ZW2A 4EQAC 3FELA 3FW5A 1SWRA 1SMPI 1SWCA 2RTFB 3HWEA 4OELA 5FQ6E 1AVEA 2RTQB 4GK9A 5LJHA 2RN4A 1RAVA 1VWQB 3S26A 4IB8A 4ML7B 4OS3A 1SRFA 4INNA 3EW2A 2NNDA 3CBCA 4AZNA 2PI3O 1A57A 1DF3A 1UYOX 4HPAA 2RTPB 1RXKA 4OS0A 5LJDA 4WFUA 1HMSA 2JU8A 1HBPA 4Z2OA 3IFBA 4ZHFA 2LA7A 2R73A 1JBHA 3SOTA 1TXLA 1ADLA 2HMBA 1PBYA 2XKLA 4TNNA 4YCHA 5JD2A 4ES7A 5LKEA 1YP7A 2RTIB 4YH0A 4IBAA 3RKGA 3S5VA 5LJCA 2G7BA 2NNEA 3APUA 2UYWA 3STKA 3WOVA 2L9CA 2RTHB 3UEVA 4EDEA 2OF8A 1VWAB 2QOMA 5EEDA 4IB7A 1X8PA 4BX6A 5IRAA 1OPBA 1WUBA 5D48A 4GNWA 4Y0PA 2G79A 1SLEB 4LQZA 5IRWA 3PQUA 1OSPO 1IJ8A 3NBXX 1BSYA 4EFGA 2FTBA 1SWFA 3NX2A 2NP1A 4MVIA 5D8JA 3HPEA 1YWAA 4HPDA 2VDFA 1KQWA 4PSQA 2IZFB 4ALBA 2A3FX 2OVDA 3CKFA 3ZW1B 1HN2A 1NP1A 4AZQA 3BU9A 1MX7A 4FQBB 3FENA 4HWMA 2RTNB 3BSZE 5K06A 1OEEA 5KIDA 2HYSA 1RLBE 4HFOA 3KFGA 4IRWA 2AL0X 3SLJA 1OEKA 2JW1A 1QY1A 4KH8A 1I9HA 3RWXA 3I0AA 3BLGA 4ORWA 3LHNA 3QQ2A 5B5GA 3SLTA 4GH7A 5FQ7E 4GRJA 4JGLA 3ELXA 4Z2VA 4QGWA 5B10O 2AMMX 4L3RA 2IZCB 2AT8X
chains in the Genus database with same CATH topology
4CV7A 3HOEA 1GKAA 4YBPA 4O9SA 1YIVA 4QRLA 2WR6A 5BVSA 3PH5A 3NR3A 4QYPA 3NQ3A 1QY0A 5HCDC 1CBRA 4ON1A 4KIIA 1A18A 3CR6A 4PJ2A 4BVMA 4ZJ0A 3VG6A 4Y0QA 2OFMX 1IIUA 1VYFA 5DG4A 4TLJA 5LJBA 1X8UA 3I17A 3AKNA 1QABE 2HZQA 2KTDA 1SY0A 4U9CA 3TGAA 1OEJA 1GT5A 1EUOA 4GKCA 4MVEA 5D4AA 1L6MA 4IB9A 3MX7A 3UAQA 2CM9A 4Y0RA 1BRQA 4YKOA 1JJXA 2JOZA 4U3QA 1ZNKA 2POAA 4I3DA 4OMWA 1U18A 2CZUA 2KD2A 3TGCA 1IFCA 2AT0X 3APVA 2AT3X 4RUNA 4YMYA 1GX8A 3C76X 4YDAA 2JMBA 4QNIA 3HOLA 3WXQA 3OBLA 3C77X 4HPBA 3VG2A 5F58A 4M6SA 5HWZA 1DFVA 3VG7A 3FEKA 4MVKA 4A8ZA 1KZXA 3APWA 1X71A 3MBTA 3D4RA 4QYNA 1HMTA 5HBSA 5HCCC 2K23A 5F6BA 4MVLA 1I05A 5EDCA 2A2UA 3FYFA 3P6CA 3D96A 4AZPA 4O4OA 1EW3A 4R0BA 2RA6A 4MISA 5D45A 4KT5A 4NW4A 1GX9A 4NLIA 2L5PA 1BM5A 1CRBA 3ZWEA 3H3IA 1AVGI 4GETA 3MVFA 2ZAIA 1DZPA 5EPQA 1EIOA 2FR3A 3U0DA 2O62A 3O2YA 1VYGA 4EEJA 1EPBA 3D97A 4O3WA 5EDBA 5LJGA 2DM5A 5HA0A 1ZNDA 4FGIB 3VPJE 3VU1A 5LJEA 1BRPA 3AKMA 4IAWA 1FTPA 3WVMA 1KOIA 4XMDA 3RZYA 1B8EA 2Q9SA 3B2IA 1DC9A 3RSWA 5IO6A 3CQRA 3BRNA 1LPJA 4I9RA 5JR8A 2OVAA 4GZVA 3S5XA 4XMCA 1KXOA 4AZRA 1QFTA 1SXYA 5HCEC 1YWCA 3FA7A 5KICA 1T8VA 5CYBA 3B2KA 2Q39A 4O3ZA 4ZH9A 2W2AA 4MIRA 4NLJA 3P24A 4ORXA 5BYPA 3ELZA 1AB0A 1LFOA 1B4MA 2A0AA 1D2UA 3UEUA 1SY1A 1EIIA 3PECA 3WJBA 3EYCA 1HBQA 4BOEA 1GT3A 2F09A 2MJIA 3EBKA 5HZQA 1BSQA 3VG3A 1IKJA 1LIFA 4NYQA 1SY3A 5HA1A 2EU7X 5FAZA 3WJGA 1ZNEA 2HZRA 2OVEA 3N91A 4ZR2A 2A2GA 2CBRA 2QMIA 4K19A 5D47A 1CBQA 2P8GA 2L67A 4N7DA 1AELA 3NP1A 1DZKA 3GE2A 4ARHA 4KC8A 1I04A 1KT4A 2MWHA 3NQ9A 4YFPA 4ZHGA 1EALA 1FENA 4WFVA 3BS2A 3HK1A 4I6SA 4ODDA 4YGGA 2AKQA 2MO5A 4D6AA 1PMPA 3VE1A 2LBAA 1SA8A 2NNQA 4O4XA 4XMFA 1CBIA 1HMRA 3Q6LA 5L8IA 1FELA 1KT5A 4AZMA 2BT9A 4IMOA 1HQPA 1ICMA 3NX1A 4ZH6A 1QY2A 1LIDA 4ZCBA 3PQSA 2ALLX 1ML7A 2Q2PA 4COTA 1X89A 3PP6A 2WWPA 5B29A 1DZJA 1NGLA 1FEMA 2JU3A 2FR2A 3WJFA 4A60A 4U8UO 1O1VA 5H9NA 4U8UN 5HTDA 4ORSA 1G7NA 5DPQA 1E06A 2FT9A 1OBQA 3SAOA 2X8TA 1ERXA 4O4UA 2AT6X 1GKAB 3K3LA 3OD9A 2Z4HA 4KCAA 3PEDA 4A1HA 1XKIA 1OBPA 3UEWA 3ZZVA 1G85A 4QZTA 2CZTA 2KT4B 3S60A 5F1EA 2BS6A 2WEXA 4ALOA 3FMZA 1GT4A 4AW8A 1CJ5A 1LIBA 1X8NA 2GTLO 3B2HA 3ZW0A 1B0OA 2FS6A 2GTLN 2Q2MA 1MDCA 3BU1A 4NYRA 2BS5A 3T1DA 2OZQA 2AH7X 1EI5A 1N0SA 3UEXA 2ACOA 1DZMA 1RBPA 1MVGA 2LFOA 1E02A 4ZGUA 2JU7A 1GT1A 1QFVA 3LV4A 5KHPA 2FRSA 1UREA 3ZW0B 3GAQA 1GGLA 3FA8A 1O1UA 2ASNX 1KT3A 3F8AA 3PPTA 1PM1X 4TJZA 2KW1A 4YDBA 1O8VA 1YUPA 4CK4A 3EMMA 1A3YA 3CBSA 4TKHA 4LZUA 4XMEA 3JSQA 4QAEA 3VG5A 4DQ3A 1H91A 3BDRA 1YWDA 2LB6A 1IW2A 2LKKA 1JV4A 4ID2A 3KFIA 4KC7A 2WEWA 4GU8A 2R56A 3D95A 3KQ0A 4QQ1A 1U17A 1CBSA 4IABA 4WBKA 4BQUA 1T0VA 2QO4A 2QM9A 1LF7A 1JIWI 3ZUIA 3FR4A 3P02A 4HPCA 1OBUA 3DSZA 5HZ8A 2HNXA 4AZOA 5L8NA 1AQBA 2ZAGA 3FIQA 5HZ5A 2BHVA 2F73A 4ORYA 1JYDA 2X46A 3TGBA 5H8TA 4ORUA 4TKJA 1D3SA 4XMHA 1PEEA 2K62A 3C78X 1IFBA 2GC9A 3NPOA 1BJ7A 4OMXA 1TW4A 3F6ZB 4ZGFA 1T68X 5FFHA 2WSJA 4GNYA 3L4RA 1XCAA 3KFHA 4NP1A 1KT6A 1Y9TA 2RQ0A 2W2FA 3FR2A 2FLJA 3FLLA 4UU3A 1LIEA 4YGZA 3JS1A 2E4JA 5CE4A 5AQ6A 3TF6A 1LNMA 1TOUA 2RD7C 4QGVA 3TZSA 1QG5A 3FW4A 4FBVA 4WHIA 1P6PA 2QO6A 1ERBA 4FBOA 1PBOA 1Y9LA 4RUUA 2W2BA 4YGHA 1OPAA 3IA8A 3CMPA 4OS8A 5AEOA 4M7MA 1G74A 3U03A 5LJKA 4YBUA 4Y0SA 4L1NA 1ICNA 3V8UA 1ZRYA 2L68A 4DQ4A 3ZW1A 3EBWA 2Z4IA 3F9DA 1MUPA 3E3CA 5AJCA 5F7GA 2ANSA 4CSBA 3BX7A 3FA6A 2HLVA 2WQ9A 4LKPA 3OJYC 3P6EA 4TKBA 2RCQA 5LKFA 3WJCA 1UZ2X 3FR5A 1I4UA 1BBPA 4ZHHA 3HWGA 1JJJA 2LBVA 4ZHDA 1EQDA 4QZUA 2RCTA 2CM4A 5FENA 1X8OA 1E00A 3VE2A 2CBSA 4ORRA 1FDQA 2X8SA 3RBYA 5EEEA 1YWBA 2FS7A 4YFQA 4D6BA 1GM6A 1U0XA 5L8OA 3P6HA 4GDZA 3U9PC 2OVSA 4NNTA 5HTEA 3ZQ3A 1A2DA 5AJBA 1FE3A 1ALBA 1MX8A 2G78A 3EM0A 5C0NA 4GE1A 3APXA 2GTFX 3NQKA 1E5PA 1I06A 1NP4A 3FEPA 3HTYA 4XMGA 3FA9A 2YG2A 4I3BA 3BX8A 5BVQA 2YMSA 4I3CA 5F6ZA 4O4SA 4YKMA 1YP6A 1KQXA 4I9SA 3WBGA 5HZ6A 5HZ9A 2WQAE 4NNSA 4O3XB 5EZ2A 1R0UA 1JZUA 2A13A 2Q4NA 1BEBA 1KGLA 4YCEA 2X8FA 5IO5A 1SXWA 1JYJA 1S2PA 3NADA 1SY2A 1ACDA 1BWYA 5B27A 1LICA 2WUTA 4UU2A 5H9LA 1GXAA 3HWDA 4O49A 3QKGA 1BSOA 3DTQA 1EXSA 3B2LA 1DV9A 4O3YA 1Z24A 2KTSA 5H9AA 3HWFA 1SXXA 1KZWA 1QQSA 2AT5X 2QOSC 4IMNA 4U8UM 1G5WA 4FBRA 1ZNLA 2OFRX 1TVQA 3ZUOA 4YFRA 4A1YA 4AYHA 3CQNA 3JQOA 1ZNGA 2X45A 1SXUA 3O22A 3BY0A 1S7DA 3STNA 1ZNHA 1LKEA 4LZVA 2XSTA 3P6FA 2BLGA 5IO7A 2M4LA 4IAXA 4ZHCA 3STMX 4TQ2A 2JN3A 4QGXA 5HAEA 1KT7A 2N93A 4I95A 1X8QA 5FQ8E 4ZFXA 2MM3A 1BLRA 2GTLM 3ZI8A 3P6DA 3KFFA 1S44A 3VG4A 2FWVA 3WJDA 1B56A 5H9KA 1QWDA 4EXZA 1VPRA 3WJEA 2MHDA 3PH6A 2R74A 4N7CA 2QO5A 3CWKA 3OE3A 4IB6A 2IFBA 3G7XA 1IKEA 1TOWA 2PY1A 3O19A 1EPAA 3P6GA 5BVTA 3KZAA 2ACPX 4LKTA 2GJ5A 3B2JA 3ZW2A 4EQAC 3FELA 3FW5A 3HWEA 1SMPI 5FQ6E 4GK9A 5LJHA 2RN4A 3S26A 4IB8A 4ML7B 4OS3A 4INNA 2NNDA 3CBCA 4AZNA 1A57A 1DF3A 4HPAA 4OS0A 5LJDA 4ZHFA 4WFUA 1HMSA 2JU8A 1HBPA 3IFBA 2LA7A 2R73A 1JBHA 3SOTA 1TXLA 1ADLA 2HMBA 2XKLA 4TNNA 4YCHA 4ES7A 5LKEA 5LJCA 1YP7A 4YH0A 4IBAA 3RKGA 3S5VA 2G7BA 2NNEA 3APUA 3STKA 3WOVA 4EDEA 2L9CA 3UEVA 5EEDA 4IB7A 1X8PA 1OPBA 5D48A 4GNWA 4Y0PA 2G79A 4LQZA 3PQUA 3NBXX 1BSYA 4EFGA 2FTBA 4MVIA 3NX2A 2NP1A 5D8JA 1YWAA 4HPDA 1KQWA 4PSQA 4ALBA 2A3FX 2OVDA 3ZW1B 1HN2A 1NP1A 4AZQA 3BU9A 1MX7A 4FQBB 3FENA 4HWMA 3BSZE 5K06A 5KIDA 1OEEA 2HYSA 1RLBE 4HFOA 3KFGA 2AL0X 1OEKA 2JW1A 1QY1A 4KH8A 3RWXA 3I0AA 3BLGA 4ORWA 3LHNA 4GH7A 5FQ7E 4GRJA 4JGLA 3ELXA 4QGWA 2AMMX 4L3RA 2AT8X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GKA A;  4YBP A;  4O9S A;  1YIV A;  2WR6 A;  5BVS A;  3PH5 A;  3NR3 A;  4QYP A;  3NQ3 A;  1QY0 A;  5HCD C;  1CBR A;  4KII A;  1A18 A;  3CR6 A;  4BVM A;  4ZJ0 A;  3VG6 A;  4Y0Q A;  2OFM X;  1IIU A;  1VYF A;  5DG4 A;  4TLJ A;  5LJB A;  1X8U A;  3I17 A;  3AKN A;  1QAB E;  2HZQ A;  2KTD A;  1SY0 A;  3TGA A;  1OEJ A;  1GT5 A;  1EUO A;  4GKC A;  5D4A A;  1L6M A;  4IB9 A;  2CM9 A;  4Y0R A;  1BRQ A;  4YKO A;  1JJX A;  2JOZ A;  1ZNK A;  2POA A;  4I3D A;  4OMW A;  1U18 A;  2CZU A;  3TGC A;  1IFC A;  2AT0 X;  3APV A;  2AT3 X;  4RUN A;  4YMY A;  1GX8 A;  3C76 X;  4YDA A;  3WXQ A;  3C77 X;  4HPB A;  3VG2 A;  5F58 A;  4M6S A;  5HWZ A;  1DFV A;  3VG7 A;  3FEK A;  4MVK A;  4A8Z A;  1KZX A;  3APW A;  1X71 A;  3MBT A;  4QYN A;  1HMT A;  5HBS A;  5HCC C;  2K23 A;  5F6B A;  4MVL A;  1I05 A;  5EDC A;  2A2U A;  3P6C A;  3D96 A;  4AZP A;  1EW3 A;  4R0B A;  2RA6 A;  5D45 A;  1GX9 A;  4NLI A;  2L5P A;  1BM5 A;  1CRB A;  1AVG I;  4GET A;  3MVF A;  1DZP A;  5EPQ A;  1EIO A;  2FR3 A;  3U0D A;  2O62 A;  3O2Y A;  1VYG A;  4EEJ A;  1EPB A;  3D97 A;  5EDB A;  5LJG A;  2DM5 A;  5HA0 A;  1ZND A;  5LJE A;  1BRP A;  3AKM A;  4IAW A;  1FTP A;  3WVM A;  1KOI A;  4XMD A;  3RZY A;  1B8E A;  2Q9S A;  3B2I A;  1DC9 A;  3RSW A;  5IO6 A;  3CQR A;  3BRN A;  1LPJ A;  4I9R A;  5JR8 A;  2OVA A;  4XMC A;  1KXO A;  4AZR A;  1QFT A;  1SXY A;  5HCE C;  1YWC A;  3FA7 A;  5KIC A;  1T8V A;  3B2K A;  2Q39 A;  4ZH9 A;  2W2A A;  4NLJ A;  4ORX A;  3ELZ A;  1AB0 A;  1LFO A;  1B4M A;  2A0A A;  1D2U A;  3UEU A;  1SY1 A;  1EII A;  3PEC A;  3WJB A;  3EYC A;  1HBQ A;  4BOE A;  1GT3 A;  2MJI A;  3EBK A;  5HZQ A;  1BSQ A;  3VG3 A;  1IKJ A;  1LIF A;  4NYQ A;  1SY3 A;  5HA1 A;  2EU7 X;  5FAZ A;  3WJG A;  1ZNE A;  2HZR A;  2OVE A;  4ZR2 A;  2A2G A;  2CBR A;  4K19 A;  5D47 A;  1CBQ A;  2P8G A;  2L67 A;  4N7D A;  1AEL A;  3NP1 A;  1DZK A;  4ARH A;  1I04 A;  1KT4 A;  4ZHG A;  3NQ9 A;  4YFP A;  1EAL A;  1FEN A;  4WFV A;  3BS2 A;  3HK1 A;  4ODD A;  4YGG A;  2AKQ A;  2MO5 A;  4D6A A;  1PMP A;  2LBA A;  1SA8 A;  2NNQ A;  4XMF A;  1CBI A;  1HMR A;  3Q6L A;  5L8I A;  1FEL A;  1KT5 A;  4AZM A;  4IMO A;  1HQP A;  1ICM A;  3NX1 A;  4ZH6 A;  1QY2 A;  1LID A;  4ZCB A;  2ALL X;  1ML7 A;  2Q2P A;  1X89 A;  3PP6 A;  2WWP A;  5B29 A;  1DZJ A;  1NGL A;  1FEM A;  2JU3 A;  2FR2 A;  3WJF A;  4A60 A;  1O1V A;  5H9N A;  5HTD A;  4ORS A;  1G7N A;  5DPQ A;  1E06 A;  2FT9 A;  1OBQ A;  3SAO A;  1ERX A;  2AT6 X;  1GKA B;  3K3L A;  3PED A;  4A1H A;  1XKI A;  1OBP A;  3UEW A;  1G85 A;  4QZT A;  2CZT A;  2KT4 B;  5F1E A;  2WEX A;  4ALO A;  3FMZ A;  1GT4 A;  4AW8 A;  1CJ5 A;  1LIB A;  1X8N A;  3B2H A;  1B0O A;  2FS6 A;  2Q2M A;  1MDC A;  3BU1 A;  4NYR A;  3T1D A;  2OZQ A;  2AH7 X;  1N0S A;  3UEX A;  2ACO A;  1DZM A;  1RBP A;  1MVG A;  2LFO A;  1E02 A;  4ZGU A;  2JU7 A;  1GT1 A;  1QFV A;  5KHP A;  2FRS A;  1URE A;  3GAQ A;  1GGL A;  3FA8 A;  1O1U A;  2ASN X;  1KT3 A;  3F8A A;  3PPT A;  1PM1 X;  4TJZ A;  4YDB A;  1O8V A;  1YUP A;  4CK4 A;  3EMM A;  1A3Y A;  3CBS A;  4TKH A;  4LZU A;  4XME A;  3JSQ A;  4QAE A;  3VG5 A;  4DQ3 A;  1H91 A;  3BDR A;  1YWD A;  2LB6 A;  1IW2 A;  2LKK A;  1JV4 A;  3KFI A;  2WEW A;  2R56 A;  3D95 A;  3KQ0 A;  1U17 A;  1CBS A;  4WBK A;  4BQU A;  1T0V A;  2QO4 A;  2QM9 A;  1LF7 A;  3ZUI A;  3FR4 A;  4HPC A;  1OBU A;  3DSZ A;  5HZ8 A;  2HNX A;  4AZO A;  5L8N A;  1AQB A;  3FIQ A;  5HZ5 A;  2F73 A;  4ORY A;  1JYD A;  2X46 A;  3TGB A;  5H8T A;  4ORU A;  4TKJ A;  1D3S A;  4XMH A;  1PEE A;  2K62 A;  3C78 X;  1IFB A;  2GC9 A;  3NPO A;  1BJ7 A;  4OMX A;  1TW4 A;  1T68 X;  5FFH A;  2WSJ A;  4GNY A;  3L4R A;  1XCA A;  3KFH A;  4NP1 A;  1KT6 A;  2RQ0 A;  2W2F A;  3FR2 A;  2FLJ A;  3FLL A;  4UU3 A;  1LIE A;  4YGZ A;  3JS1 A;  2E4J A;  5CE4 A;  5AQ6 A;  3TF6 A;  1LNM A;  1TOU A;  2RD7 C;  4QGV A;  3TZS A;  1QG5 A;  3FW4 A;  1P6P A;  2QO6 A;  1ERB A;  1PBO A;  4RUU A;  2W2B A;  4YGH A;  1OPA A;  3IA8 A;  3CMP A;  4OS8 A;  4M7M A;  1G74 A;  3U03 A;  5LJK A;  4YBU A;  4Y0S A;  1ICN A;  1ZRY A;  2L68 A;  4DQ4 A;  3EBW A;  3F9D A;  1MUP A;  5F7G A;  2ANS A;  3BX7 A;  3FA6 A;  2HLV A;  2WQ9 A;  4LKP A;  3OJY C;  3P6E A;  4TKB A;  2RCQ A;  5LKF A;  3WJC A;  1UZ2 X;  3FR5 A;  1I4U A;  1BBP A;  4ZHH A;  3HWG A;  1JJJ A;  2LBV A;  4ZHD A;  1EQD A;  4QZU A;  2RCT A;  2CM4 A;  5FEN A;  1X8O A;  1E00 A;  2CBS A;  4ORR A;  1FDQ A;  5EEE A;  1YWB A;  2FS7 A;  4YFQ A;  4D6B A;  1GM6 A;  1U0X A;  5L8O A;  3P6H A;  3U9P C;  4NNT A;  5HTE A;  3ZQ3 A;  1A2D A;  1FE3 A;  1ALB A;  1MX8 A;  2G78 A;  3EM0 A;  5C0N A;  4GE1 A;  3APX A;  2GTF X;  1E5P A;  1I06 A;  1NP4 A;  3FEP A;  4XMG A;  3FA9 A;  2YG2 A;  4I3B A;  3BX8 A;  5BVQ A;  4I3C A;  5F6Z A;  4YKM A;  1YP6 A;  1KQX A;  4I9S A;  3WBG A;  5HZ6 A;  5HZ9 A;  2WQA E;  4NNS A;  5EZ2 A;  1R0U A;  1JZU A;  2A13 A;  2Q4N A;  1BEB A;  1KGL A;  4YCE A;  5IO5 A;  1SXW A;  1JYJ A;  1S2P A;  3NAD A;  1SY2 A;  1ACD A;  1BWY A;  5B27 A;  1LIC A;  2WUT A;  4UU2 A;  5H9L A;  1GXA A;  3HWD A;  3QKG A;  1BSO A;  3DTQ A;  1EXS A;  3B2L A;  1DV9 A;  1Z24 A;  5H9A A;  3HWF A;  1SXX A;  1KZW A;  1QQS A;  2AT5 X;  2QOS C;  4IMN A;  1G5W A;  1ZNL A;  2OFR X;  1TVQ A;  3ZUO A;  4YFR A;  4A1Y A;  4AYH A;  3CQN A;  1ZNG A;  2X45 A;  1SXU A;  3O22 A;  3BY0 A;  1S7D A;  3STN A;  1ZNH A;  1LKE A;  4LZV A;  2XST A;  3P6F A;  2BLG A;  5IO7 A;  4IAX A;  4ZHC A;  3STM X;  4TQ2 A;  2JN3 A;  4QGX A;  5HAE A;  1KT7 A;  2N93 A;  1X8Q A;  4ZFX A;  2MM3 A;  1BLR A;  3P6D A;  3KFF A;  1S44 A;  3VG4 A;  2FWV A;  3WJD A;  1B56 A;  5H9K A;  1QWD A;  4EXZ A;  1VPR A;  3WJE A;  3PH6 A;  2R74 A;  4N7C A;  2QO5 A;  3CWK A;  4IB6 A;  2IFB A;  3G7X A;  1IKE A;  1TOW A;  2PY1 A;  3O19 A;  1EPA A;  3P6G A;  5BVT A;  3KZA A;  2ACP X;  4LKT A;  2GJ5 A;  3B2J A;  3FEL A;  3FW5 A;  3HWE A;  5LJH A;  3S26 A;  4IB8 A;  4OS3 A;  2NND A;  3CBC A;  4AZN A;  1A57 A;  1DF3 A;  4HPA A;  4OS0 A;  5LJD A;  4ZHF A;  4WFU A;  1HMS A;  2JU8 A;  1HBP A;  3IFB A;  2R73 A;  1JBH A;  1TXL A;  1ADL A;  2HMB A;  2XKL A;  4TNN A;  4YCH A;  4ES7 A;  5LKE A;  5LJC A;  1YP7 A;  4YH0 A;  4IBA A;  2G7B A;  2NNE A;  3APU A;  3STK A;  4EDE A;  2L9C A;  3UEV A;  5EED A;  4IB7 A;  1X8P A;  1OPB A;  5D48 A;  4GNW A;  4Y0P A;  2G79 A;  1BSY A;  4EFG A;  2FTB A;  4MVI A;  3NX2 A;  2NP1 A;  5D8J A;  1YWA A;  4HPD A;  1KQW A;  4PSQ A;  4ALB A;  2A3F X;  2OVD A;  1HN2 A;  1NP1 A;  4AZQ A;  3BU9 A;  1MX7 A;  3FEN A;  3BSZ E;  5K06 A;  5KID A;  1OEE A;  2HYS A;  1RLB E;  4HFO A;  3KFG A;  2AL0 X;  1OEK A;  1QY1 A;  3I0A A;  3BLG A;  4ORW A;  4GH7 A;  4GRJ A;  3ELX A;  4QGW A;  2AMM X;  2AT8 X; 
#chains in the Genus database with same CATH topology
 1HQQ A;  4CV7 A;  3HOE A;  1GKA A;  4YBP A;  4O9S A;  3T6F A;  1YIV A;  3FID A;  4QRL A;  2WR6 A;  5BVS A;  3RDO A;  1I78 A;  3PH5 A;  3NR3 A;  4QYP A;  3NQ3 A;  4DCB A;  1QY0 A;  3CKG A;  4BJ8 A;  1CBR A;  4ON1 A;  2OL6 O;  4KII A;  1A18 A;  3CR6 A;  4PJ2 A;  4BVM A;  4ZJ0 A;  3VG6 A;  4Y0Q A;  2AF5 A;  1IIU A;  1VYF A;  2OFM X;  1VWB B;  4TLJ A;  5DG4 A;  5LJB A;  1X8U A;  3I17 A;  3AKN A;  1QAB E;  2HZQ A;  2OFB A;  2KTD A;  1STR B;  1SY0 A;  4U9C A;  3TGA A;  1OEJ A;  2IZL B;  1NQM A;  2JGS A;  2OL7 A;  2A5C A;  1HY2 A;  1GT5 A;  1EUO A;  1SWT A;  4GKC A;  4MVE A;  5D4A A;  1L6M A;  4IB9 A;  3MX7 A;  3T2X A;  3UAQ A;  2CM9 A;  4JHQ A;  1BRQ A;  4Y0R A;  4YKO A;  1JJX A;  2JOZ A;  4U3Q A;  1ZNK A;  2POA A;  4I3D A;  4OMW A;  1U18 A;  2CZU A;  2KD2 A;  2X4M A;  3TGC A;  1IFC A;  4GGT A;  2AT0 X;  3APV A;  2AT3 X;  4RUN A;  4YMY A;  1GX8 A;  3C76 X;  4YDA A;  2JMB A;  4QNI A;  3HOL A;  3AEH A;  1NBX A;  3WXQ A;  3OBL A;  3C77 X;  4HPB A;  3VG2 A;  5F58 A;  4M6S A;  1SRG A;  1DFV A;  3VG7 A;  5HWZ A;  3FEK A;  4MVK A;  4A8Z A;  1KZX A;  3APW A;  1X71 A;  3MBT A;  3D4R A;  1WBI A;  4QYN A;  1SWU A;  1HMT A;  2UZ2 A;  3FDC A;  5HBS A;  3RDX A;  5HCC C;  2K23 A;  2Y32 A;  1UYN X;  5F6B A;  4MVL A;  4CDF A;  1SWO A;  1I05 A;  5EDC A;  3SZI A;  1LCZ A;  2A2U A;  3FYF A;  3P6C A;  3D96 A;  4AZP A;  1VWO B;  1EW3 A;  4O4O A;  1VWM B;  2RA6 A;  4MIS A;  4R0B A;  4KT5 A;  4NW4 A;  5D45 A;  1GX9 A;  4NLI A;  2L5P A;  1BM5 A;  1CRB A;  3ZWE A;  1SWQ A;  3H3I A;  1AVG I;  3LTW A;  4Z28 A;  2IZB A;  4GET A;  3MVF A;  2ZAI A;  1DZP A;  5EPQ A;  1EIO A;  2C1S A;  2FR3 A;  1Y52 X;  3U0D A;  2O62 A;  3O2Y A;  1VYG A;  4EEJ A;  1EPB A;  3D97 A;  4O3W A;  5EDB A;  2I5V O;  1LDO A;  5F2B A;  1SRH A;  2DM5 A;  1SLF B;  2Y3E A;  5LJG A;  5HA0 A;  3WYQ A;  1ZND A;  1VYO A;  4FGI B;  5CSE A;  3VPJ E;  3VU1 A;  5LJE A;  1BRP A;  3AKM A;  1LEL A;  1FTP A;  4IAW A;  1KOI A;  4XMD A;  3RZY A;  3WVM A;  2X55 A;  1B8E A;  2Q9S A;  3B2I A;  1DC9 A;  3RSW A;  1N4J A;  5IO6 A;  3CQR A;  1VWE B;  3BRN A;  3EW1 A;  1LPJ A;  1JQP A;  4GDA A;  1DF8 A;  4I9R A;  5JR8 A;  2OVA A;  4GZV A;  3S5X A;  4XMC A;  1KXO A;  4AZR A;  1QFT A;  1SXY A;  1Y0G A;  1YWC A;  3FA7 A;  5HCE C;  5KIC A;  1T8V A;  3SZJ A;  5CYB A;  3B2K A;  2Q39 A;  4O3Z A;  4ZH9 A;  2W2A A;  4MIR A;  2OY7 A;  4NLJ A;  1SWB A;  3P24 A;  4ORX A;  5BYP A;  3ELZ A;  1AB0 A;  1LFO A;  1B4M A;  2A0A A;  1D2U A;  1W6F A;  3UEU A;  1SY1 A;  1EII A;  3PEC A;  3WJB A;  3MG5 A;  2BC3 A;  1VWH B;  1HBQ A;  3EYC A;  1SWJ A;  4NV8 A;  2OFA A;  5IRU A;  3PDF A;  1NDJ A;  1GT3 A;  3RDS A;  4BOE A;  2F09 A;  4CDE A;  2MJI A;  3EBK A;  4GJS A;  5HZQ A;  1BSQ A;  3VG3 A;  1IKJ A;  1LIF A;  4GJV A;  1SY3 A;  4NYQ A;  5HA1 A;  2EU7 X;  5FAZ A;  3VHM A;  1ZNE A;  3WJG A;  2HZR A;  4Z6J A;  2OVE A;  2RTD B;  3N91 A;  2A2G A;  2CBR A;  2QMI A;  4K19 A;  5D47 A;  4ZR2 A;  1CBQ A;  4BBO A;  4I60 A;  2P8G A;  2L67 A;  2IZK A;  4BX5 A;  2A8G A;  4GUZ A;  2FKG A;  4N7D A;  1AEL A;  3NP1 A;  1DZK A;  3GE2 A;  4ARH A;  4KC8 A;  2C1Q A;  1I04 A;  1KT4 A;  2MWH A;  3NQ9 A;  1SWD A;  2HKD A;  4YFP A;  4ZHG A;  1EAL A;  1FEN A;  4WFV A;  2OYB O;  2RTL A;  3BS2 A;  3HK1 A;  4GGR A;  4BX6 B;  4I6S A;  4BGF A;  5B2A O;  1MEP A;  4ODD A;  4YGG A;  1LCW A;  2AKQ A;  2MO5 A;  4BX5 B;  4D6A A;  3SLO A;  1PMP A;  3VHI A;  3VE1 A;  2LBA A;  1SA8 A;  2NNQ A;  4O4X A;  4XMF A;  1CBI A;  1HMR A;  3Q6L A;  5L8I A;  1FEL A;  1K3B A;  1KT5 A;  2BT9 A;  2VFB A;  1HQP A;  1ICM A;  3NX1 A;  4IMO A;  3D9W A;  4ZH6 A;  1QY2 A;  3KVN A;  1VWP B;  2MF6 A;  1LID A;  4ZCB A;  2FKJ A;  3PQS A;  2ALL X;  1ML7 A;  1N7Y A;  2Q2P A;  1FJ1 E;  4COT A;  1X89 A;  3PP6 A;  2WWP A;  5B29 A;  4C5P A;  1DZJ A;  1NGL A;  1FEM A;  2JU3 A;  1SLG B;  2FR2 A;  3WJF A;  4A60 A;  1VWC B;  2GH7 A;  4U8U O;  1O1V A;  1VWJ B;  2RTO B;  5H9N A;  4U8U N;  5HTD A;  4ORS A;  1G7N A;  5DPQ A;  1E06 A;  2FT9 A;  1OBQ A;  3SAO A;  4BCS A;  2X8T A;  1ERX A;  4O4U A;  2AT6 X;  1GKA B;  2IZA A;  3K3L A;  2A5B A;  2Z4H A;  3OD9 A;  4KCA A;  2G5L A;  3PED A;  4A1H A;  1XKI A;  1OBP A;  2X32 A;  3UEW A;  3ZZV A;  2RTK A;  1G85 A;  4QZT A;  3RE5 A;  2CZT A;  2KT4 B;  3S60 A;  5F1E A;  2BS6 A;  2WEX A;  4ALO A;  3FMZ A;  1SRI A;  1GT4 A;  3RE6 A;  4AW8 A;  1LIB A;  1X8N A;  2GTL O;  4Z2P A;  3B2H A;  1CJ5 A;  3ZW0 A;  1B0O A;  2FS6 A;  2GTL N;  2Q2M A;  1MDC A;  3BU1 A;  4NYR A;  2BS5 A;  5CHK A;  3T1D A;  2OZQ A;  1HXL A;  1RXH A;  1STP A;  2AH7 X;  1EI5 A;  2F01 A;  4AZM A;  1N0S A;  2IZI A;  4JNJ A;  2X34 A;  3UEX A;  2OY1 O;  2ACO A;  2C4I A;  1DZM A;  1RBP A;  1MVG A;  2AVI A;  3RDM A;  2LFO A;  1VWL B;  1E02 A;  4ZGU A;  2JU7 A;  1GT1 A;  1QFV A;  2VFC A;  3LV4 A;  5KHP A;  2FRS A;  1URE A;  2WPU A;  3SZH A;  3ZW0 B;  3GAQ A;  1GGL A;  3FA8 A;  4OKA A;  1NQN A;  1SWL A;  1KL3 A;  3PK2 A;  1O1U A;  2ASN X;  2RTG B;  1KT3 A;  1K24 A;  3F8A A;  1SWP A;  1PM1 X;  3PPT A;  2KW1 A;  4TJZ A;  4YDB A;  1O8V A;  1VWD B;  1YUP A;  4CK4 A;  3EMM A;  3X00 A;  1A3Y A;  3CBS A;  4TKH A;  4LZU A;  4XME A;  3JSQ A;  4QAE A;  4Y59 A;  3VG5 A;  2OF9 A;  4CPH A;  1Y55 X;  4DQ3 A;  1H91 A;  3BDR A;  1YWD A;  2LB6 A;  1IW2 A;  1E2T A;  2LKK A;  4CDD A;  1JV4 A;  4ID2 A;  3KFI A;  4KC7 A;  2WEW A;  4GU8 A;  4Z27 A;  1MOY A;  2R56 A;  4BX7 A;  3RY2 A;  3D95 A;  1RSU B;  3KQ0 A;  1U17 A;  4QQ1 A;  1CBS A;  3WZN A;  4IAB A;  4WBK A;  4BQU A;  1T0V A;  2QO4 A;  2QM9 A;  1LF7 A;  1JIW I;  3ZUI A;  3FR4 A;  3P02 A;  4HPC A;  1OBU A;  2QCB A;  3DSZ A;  2OY5 O;  3WZO A;  2DJG A;  5HZ8 A;  2HNX A;  4U46 A;  4AZO A;  5L8N A;  1AQB A;  2ZAG A;  3FIQ A;  5HZ5 A;  1SWK A;  2BHV A;  4BX7 B;  2F73 A;  4ORY A;  2IZD B;  1JYD A;  2X46 A;  3TGB A;  1SWS A;  5H8T A;  4ORU A;  4TKJ A;  1SWA A;  1D3S A;  4XMH A;  1PEE A;  5B5F A;  2K62 A;  3C78 X;  1IFB A;  2GC9 A;  3NPO A;  1BJ7 A;  4OMX A;  1TW4 A;  1VWF B;  2CAM A;  1SWG A;  3F6Z B;  4ZGF A;  4MEE A;  1T68 X;  5FFH A;  1LDQ A;  2WSJ A;  3L4R A;  1XCA A;  4GNY A;  3KFH A;  4NP1 A;  1KT6 A;  1Y9T A;  2RQ0 A;  2W2F A;  3FR2 A;  2FLJ A;  3FLL A;  1KL5 A;  1N43 A;  1LIE A;  2RTE B;  4UU3 A;  3JS1 A;  2E4J A;  4YGZ A;  4CPE A;  5CE4 A;  5AQ6 A;  3TF6 A;  1MK5 A;  1LNM A;  1TOU A;  2RD7 C;  5L3Y A;  1NC9 A;  4QGV A;  3RY1 A;  3TZS A;  1QG5 A;  3FW4 A;  4FBV A;  2FHN X;  4WHI A;  1P6P A;  1LUQ A;  2QO6 A;  1ERB A;  1AVD A;  1Y53 X;  4FBO A;  1PBO A;  1Y9L A;  4RUU A;  2W2B A;  2RTR B;  1OPA A;  3IA8 A;  3CMP A;  4YGH A;  5K67 A;  1VWK B;  5K68 A;  2FGS A;  5IXG A;  4OS8 A;  5AEO A;  4M7M A;  1G74 A;  2RTC B;  3U03 A;  5LJK A;  4YBU A;  4Y0S A;  3WZP A;  2RTA A;  3T6L A;  2G8C O;  3VHH A;  4L1N A;  1ICN A;  3V8U A;  1ZRY A;  2L68 A;  4DQ4 A;  3ZW1 A;  3EBW A;  2Z4I A;  3F9D A;  1MUP A;  3E3C A;  5AJC A;  3VGW A;  5F7G A;  2ANS A;  1STS B;  4CSB A;  3BX7 A;  3FA6 A;  4CDC A;  2HLV A;  2WQ9 A;  5B3M O;  4LKP A;  3OJY C;  3P6E A;  4TKB A;  2RCQ A;  2IZG B;  5LKF A;  1PTS A;  3WJC A;  1UZ2 X;  3FR5 A;  1I4U A;  1BBP A;  4ZHH A;  1JJU A;  3HWG A;  1JJJ A;  1LCV A;  2LBV A;  1GX3 A;  2OL8 O;  4ZHD A;  1EQD A;  4QZU A;  2RCT A;  2CM4 A;  1VWI B;  2FHL A;  5FEN A;  1X8O A;  1E00 A;  3VE2 A;  2CBS A;  4ORR A;  1FDQ A;  2X8S A;  3RBY A;  2IZH B;  1W4T A;  5EEE A;  1YWB A;  2FS7 A;  4YFQ A;  4D6B A;  4Y5D A;  1GM6 A;  1U0X A;  5L8O A;  1RST B;  3P6H A;  3Q34 A;  4GDZ A;  4OEM A;  3U9P C;  2OVS A;  4CPF A;  2RTM A;  4NNT A;  5HTE A;  3ZQ3 A;  1A2D A;  2ZSC A;  5AJB A;  1FE3 A;  4JO6 A;  1ALB A;  1MX8 A;  2G78 A;  1SLD B;  3EM0 A;  5C0N A;  4GE1 A;  3APX A;  2GTF X;  3NQK A;  1E5P A;  1I06 A;  1NP4 A;  1JMX A;  3FEP A;  1SRE A;  3HTY A;  1KFF A;  4XMG A;  3FA9 A;  2YG2 A;  4I3B A;  2I5Z O;  3BX8 A;  2OY8 A;  1VWG B;  5BVQ A;  2YMS A;  4I3C A;  5F6Z A;  4O4S A;  4YKM A;  1YP6 A;  1KQX A;  4I9S A;  3WBG A;  5HZ6 A;  5HZ9 A;  1SRJ A;  2WQA E;  4NNS A;  4O3X B;  5EZ2 A;  1R0U A;  1JZU A;  2A13 A;  3WYP A;  2Q4N A;  1BEB A;  2IZE B;  1KGL A;  4YCE A;  2X8F A;  5IO5 A;  1SXW A;  1N9M A;  3RDQ A;  1JYJ A;  1S2P A;  3NAD A;  3T2W A;  1SY2 A;  1ACD A;  1BWY A;  1SWE A;  5B27 A;  1LIC A;  2WUT A;  4UU2 A;  5H9L A;  1GXA A;  4NV7 A;  3HWD A;  4O49 A;  3QKG A;  1BSO A;  3DTQ A;  1EXS A;  1RXJ A;  3B2L A;  1DV9 A;  4O3Y A;  1Z24 A;  2Y3F A;  2KTS A;  5H9A A;  3HWF A;  1SXX A;  3AUM O;  5B11 O;  1QQS A;  1HXZ A;  2DJF A;  5HCD C;  1KZW A;  4GD9 A;  4EKV A;  2AT5 X;  2QOS C;  4IMN A;  4U8U M;  1VWR B;  1G5W A;  4FBR A;  1ZNL A;  2IZJ A;  2OFR X;  1TVQ A;  3ZUO A;  4YFR A;  4A1Y A;  3RDU A;  3CQN A;  4AYH A;  3JQO A;  1ZNG A;  2X45 A;  1SXU A;  3O22 A;  3BY0 A;  1S7D A;  1VWN B;  3STN A;  1ZNH A;  1LKE A;  3WZQ A;  4LZV A;  2XST A;  1MM9 A;  3P6F A;  2BLG A;  5IO7 A;  2M4L A;  2X56 A;  4IAX A;  3STM X;  4ZHC A;  4TQ2 A;  2JN3 A;  4B55 A;  4QGX A;  5HAE A;  1KT7 A;  1SWH A;  3EC5 A;  4CPH B;  2N93 A;  4I95 A;  1X8Q A;  5FQ8 E;  1JMZ A;  4ZFX A;  2MM3 A;  1BLR A;  2GTL M;  3ZI8 A;  3P6D A;  3KFF A;  1KL4 A;  1S44 A;  2BSZ A;  3MM0 A;  3VG4 A;  2FWV A;  3WJD A;  2RTJ A;  1B56 A;  4CPI A;  4DNE A;  5H9K A;  1QWD A;  4EXZ A;  1VPR A;  3WJE A;  1SWN A;  2MHD A;  3PH6 A;  2R74 A;  4N7C A;  2QO5 A;  3CWK A;  4GGZ A;  3OE3 A;  1W5R A;  2RTB B;  2IFB A;  3G7X A;  4IB6 A;  4YVB A;  1IKE A;  1TOW A;  2PY1 A;  3O19 A;  1EPA A;  3P6G A;  1N9Y A;  3KZA A;  5BVT A;  2ACP X;  4LKT A;  2GJ5 A;  3B2J A;  3ZW2 A;  4EQA C;  3FEL A;  3FW5 A;  1SWR A;  1SMP I;  1SWC A;  2RTF B;  3HWE A;  4OEL A;  5FQ6 E;  1AVE A;  2RTQ B;  4GK9 A;  5LJH A;  2RN4 A;  1RAV A;  1VWQ B;  3S26 A;  4IB8 A;  4ML7 B;  4OS3 A;  1SRF A;  4INN A;  3EW2 A;  2NND A;  3CBC A;  4AZN A;  2PI3 O;  1A57 A;  1DF3 A;  1UYO X;  4HPA A;  2RTP B;  1RXK A;  4OS0 A;  5LJD A;  4WFU A;  1HMS A;  2JU8 A;  1HBP A;  4Z2O A;  3IFB A;  4ZHF A;  2LA7 A;  2R73 A;  1JBH A;  3SOT A;  1TXL A;  1ADL A;  2HMB A;  1PBY A;  2XKL A;  4TNN A;  4YCH A;  5JD2 A;  4ES7 A;  5LKE A;  1YP7 A;  2RTI B;  4YH0 A;  4IBA A;  3RKG A;  3S5V A;  5LJC A;  2G7B A;  2NNE A;  3APU A;  2UYW A;  3STK A;  3WOV A;  2L9C A;  2RTH B;  3UEV A;  4EDE A;  2OF8 A;  1VWA B;  2QOM A;  5EED A;  4IB7 A;  1X8P A;  4BX6 A;  5IRA A;  1OPB A;  1WUB A;  5D48 A;  4GNW A;  4Y0P A;  2G79 A;  1SLE B;  4LQZ A;  5IRW A;  3PQU A;  1OSP O;  1IJ8 A;  3NBX X;  1BSY A;  4EFG A;  2FTB A;  1SWF A;  3NX2 A;  2NP1 A;  4MVI A;  5D8J A;  3HPE A;  1YWA A;  4HPD A;  2VDF A;  1KQW A;  4PSQ A;  2IZF B;  4ALB A;  2A3F X;  2OVD A;  3CKF A;  3ZW1 B;  1HN2 A;  1NP1 A;  4AZQ A;  3BU9 A;  1MX7 A;  4FQB B;  3FEN A;  4HWM A;  2RTN B;  3BSZ E;  5K06 A;  1OEE A;  5KID A;  2HYS A;  1RLB E;  4HFO A;  3KFG A;  4IRW A;  2AL0 X;  3SLJ A;  1OEK A;  2JW1 A;  1QY1 A;  4KH8 A;  1I9H A;  3RWX A;  3I0A A;  3BLG A;  4ORW A;  3LHN A;  3QQ2 A;  5B5G A;  3SLT A;  4GH7 A;  5FQ7 E;  4GRJ A;  4JGL A;  3ELX A;  4Z2V A;  4QGW A;  5B10 O;  2AMM X;  4L3R A;  2IZC B;  2AT8 X; 
#chains in the Genus database with same CATH homology
 4CV7 A;  3HOE A;  1GKA A;  4YBP A;  4O9S A;  1YIV A;  4QRL A;  2WR6 A;  5BVS A;  3PH5 A;  3NR3 A;  4QYP A;  3NQ3 A;  1QY0 A;  5HCD C;  1CBR A;  4ON1 A;  4KII A;  1A18 A;  3CR6 A;  4PJ2 A;  4BVM A;  4ZJ0 A;  3VG6 A;  4Y0Q A;  2OFM X;  1IIU A;  1VYF A;  5DG4 A;  4TLJ A;  5LJB A;  1X8U A;  3I17 A;  3AKN A;  1QAB E;  2HZQ A;  2KTD A;  1SY0 A;  4U9C A;  3TGA A;  1OEJ A;  1GT5 A;  1EUO A;  4GKC A;  4MVE A;  5D4A A;  1L6M A;  4IB9 A;  3MX7 A;  3UAQ A;  2CM9 A;  4Y0R A;  1BRQ A;  4YKO A;  1JJX A;  2JOZ A;  4U3Q A;  1ZNK A;  2POA A;  4I3D A;  4OMW A;  1U18 A;  2CZU A;  2KD2 A;  3TGC A;  1IFC A;  2AT0 X;  3APV A;  2AT3 X;  4RUN A;  4YMY A;  1GX8 A;  3C76 X;  4YDA A;  2JMB A;  4QNI A;  3HOL A;  3WXQ A;  3OBL A;  3C77 X;  4HPB A;  3VG2 A;  5F58 A;  4M6S A;  5HWZ A;  1DFV A;  3VG7 A;  3FEK A;  4MVK A;  4A8Z A;  1KZX A;  3APW A;  1X71 A;  3MBT A;  3D4R A;  4QYN A;  1HMT A;  5HBS A;  5HCC C;  2K23 A;  5F6B A;  4MVL A;  1I05 A;  5EDC A;  2A2U A;  3FYF A;  3P6C A;  3D96 A;  4AZP A;  4O4O A;  1EW3 A;  4R0B A;  2RA6 A;  4MIS A;  5D45 A;  4KT5 A;  4NW4 A;  1GX9 A;  4NLI A;  2L5P A;  1BM5 A;  1CRB A;  3ZWE A;  3H3I A;  1AVG I;  4GET A;  3MVF A;  2ZAI A;  1DZP A;  5EPQ A;  1EIO A;  2FR3 A;  3U0D A;  2O62 A;  3O2Y A;  1VYG A;  4EEJ A;  1EPB A;  3D97 A;  4O3W A;  5EDB A;  5LJG A;  2DM5 A;  5HA0 A;  1ZND A;  4FGI B;  3VPJ E;  3VU1 A;  5LJE A;  1BRP A;  3AKM A;  4IAW A;  1FTP A;  3WVM A;  1KOI A;  4XMD A;  3RZY A;  1B8E A;  2Q9S A;  3B2I A;  1DC9 A;  3RSW A;  5IO6 A;  3CQR A;  3BRN A;  1LPJ A;  4I9R A;  5JR8 A;  2OVA A;  4GZV A;  3S5X A;  4XMC A;  1KXO A;  4AZR A;  1QFT A;  1SXY A;  5HCE C;  1YWC A;  3FA7 A;  5KIC A;  1T8V A;  5CYB A;  3B2K A;  2Q39 A;  4O3Z A;  4ZH9 A;  2W2A A;  4MIR A;  4NLJ A;  3P24 A;  4ORX A;  5BYP A;  3ELZ A;  1AB0 A;  1LFO A;  1B4M A;  2A0A A;  1D2U A;  3UEU A;  1SY1 A;  1EII A;  3PEC A;  3WJB A;  3EYC A;  1HBQ A;  4BOE A;  1GT3 A;  2F09 A;  2MJI A;  3EBK A;  5HZQ A;  1BSQ A;  3VG3 A;  1IKJ A;  1LIF A;  4NYQ A;  1SY3 A;  5HA1 A;  2EU7 X;  5FAZ A;  3WJG A;  1ZNE A;  2HZR A;  2OVE A;  3N91 A;  4ZR2 A;  2A2G A;  2CBR A;  2QMI A;  4K19 A;  5D47 A;  1CBQ A;  2P8G A;  2L67 A;  4N7D A;  1AEL A;  3NP1 A;  1DZK A;  3GE2 A;  4ARH A;  4KC8 A;  1I04 A;  1KT4 A;  2MWH A;  3NQ9 A;  4YFP A;  4ZHG A;  1EAL A;  1FEN A;  4WFV A;  3BS2 A;  3HK1 A;  4I6S A;  4ODD A;  4YGG A;  2AKQ A;  2MO5 A;  4D6A A;  1PMP A;  3VE1 A;  2LBA A;  1SA8 A;  2NNQ A;  4O4X A;  4XMF A;  1CBI A;  1HMR A;  3Q6L A;  5L8I A;  1FEL A;  1KT5 A;  4AZM A;  2BT9 A;  4IMO A;  1HQP A;  1ICM A;  3NX1 A;  4ZH6 A;  1QY2 A;  1LID A;  4ZCB A;  3PQS A;  2ALL X;  1ML7 A;  2Q2P A;  4COT A;  1X89 A;  3PP6 A;  2WWP A;  5B29 A;  1DZJ A;  1NGL A;  1FEM A;  2JU3 A;  2FR2 A;  3WJF A;  4A60 A;  4U8U O;  1O1V A;  5H9N A;  4U8U N;  5HTD A;  4ORS A;  1G7N A;  5DPQ A;  1E06 A;  2FT9 A;  1OBQ A;  3SAO A;  2X8T A;  1ERX A;  4O4U A;  2AT6 X;  1GKA B;  3K3L A;  3OD9 A;  2Z4H A;  4KCA A;  3PED A;  4A1H A;  1XKI A;  1OBP A;  3UEW A;  3ZZV A;  1G85 A;  4QZT A;  2CZT A;  2KT4 B;  3S60 A;  5F1E A;  2BS6 A;  2WEX A;  4ALO A;  3FMZ A;  1GT4 A;  4AW8 A;  1CJ5 A;  1LIB A;  1X8N A;  2GTL O;  3B2H A;  3ZW0 A;  1B0O A;  2FS6 A;  2GTL N;  2Q2M A;  1MDC A;  3BU1 A;  4NYR A;  2BS5 A;  3T1D A;  2OZQ A;  2AH7 X;  1EI5 A;  1N0S A;  3UEX A;  2ACO A;  1DZM A;  1RBP A;  1MVG A;  2LFO A;  1E02 A;  4ZGU A;  2JU7 A;  1GT1 A;  1QFV A;  3LV4 A;  5KHP A;  2FRS A;  1URE A;  3ZW0 B;  3GAQ A;  1GGL A;  3FA8 A;  1O1U A;  2ASN X;  1KT3 A;  3F8A A;  3PPT A;  1PM1 X;  4TJZ A;  2KW1 A;  4YDB A;  1O8V A;  1YUP A;  4CK4 A;  3EMM A;  1A3Y A;  3CBS A;  4TKH A;  4LZU A;  4XME A;  3JSQ A;  4QAE A;  3VG5 A;  4DQ3 A;  1H91 A;  3BDR A;  1YWD A;  2LB6 A;  1IW2 A;  2LKK A;  1JV4 A;  4ID2 A;  3KFI A;  4KC7 A;  2WEW A;  4GU8 A;  2R56 A;  3D95 A;  3KQ0 A;  4QQ1 A;  1U17 A;  1CBS A;  4IAB A;  4WBK A;  4BQU A;  1T0V A;  2QO4 A;  2QM9 A;  1LF7 A;  1JIW I;  3ZUI A;  3FR4 A;  3P02 A;  4HPC A;  1OBU A;  3DSZ A;  5HZ8 A;  2HNX A;  4AZO A;  5L8N A;  1AQB A;  2ZAG A;  3FIQ A;  5HZ5 A;  2BHV A;  2F73 A;  4ORY A;  1JYD A;  2X46 A;  3TGB A;  5H8T A;  4ORU A;  4TKJ A;  1D3S A;  4XMH A;  1PEE A;  2K62 A;  3C78 X;  1IFB A;  2GC9 A;  3NPO A;  1BJ7 A;  4OMX A;  1TW4 A;  3F6Z B;  4ZGF A;  1T68 X;  5FFH A;  2WSJ A;  4GNY A;  3L4R A;  1XCA A;  3KFH A;  4NP1 A;  1KT6 A;  1Y9T A;  2RQ0 A;  2W2F A;  3FR2 A;  2FLJ A;  3FLL A;  4UU3 A;  1LIE A;  4YGZ A;  3JS1 A;  2E4J A;  5CE4 A;  5AQ6 A;  3TF6 A;  1LNM A;  1TOU A;  2RD7 C;  4QGV A;  3TZS A;  1QG5 A;  3FW4 A;  4FBV A;  4WHI A;  1P6P A;  2QO6 A;  1ERB A;  4FBO A;  1PBO A;  1Y9L A;  4RUU A;  2W2B A;  4YGH A;  1OPA A;  3IA8 A;  3CMP A;  4OS8 A;  5AEO A;  4M7M A;  1G74 A;  3U03 A;  5LJK A;  4YBU A;  4Y0S A;  4L1N A;  1ICN A;  3V8U A;  1ZRY A;  2L68 A;  4DQ4 A;  3ZW1 A;  3EBW A;  2Z4I A;  3F9D A;  1MUP A;  3E3C A;  5AJC A;  5F7G A;  2ANS A;  4CSB A;  3BX7 A;  3FA6 A;  2HLV A;  2WQ9 A;  4LKP A;  3OJY C;  3P6E A;  4TKB A;  2RCQ A;  5LKF A;  3WJC A;  1UZ2 X;  3FR5 A;  1I4U A;  1BBP A;  4ZHH A;  3HWG A;  1JJJ A;  2LBV A;  4ZHD A;  1EQD A;  4QZU A;  2RCT A;  2CM4 A;  5FEN A;  1X8O A;  1E00 A;  3VE2 A;  2CBS A;  4ORR A;  1FDQ A;  2X8S A;  3RBY A;  5EEE A;  1YWB A;  2FS7 A;  4YFQ A;  4D6B A;  1GM6 A;  1U0X A;  5L8O A;  3P6H A;  4GDZ A;  3U9P C;  2OVS A;  4NNT A;  5HTE A;  3ZQ3 A;  1A2D A;  5AJB A;  1FE3 A;  1ALB A;  1MX8 A;  2G78 A;  3EM0 A;  5C0N A;  4GE1 A;  3APX A;  2GTF X;  3NQK A;  1E5P A;  1I06 A;  1NP4 A;  3FEP A;  3HTY A;  4XMG A;  3FA9 A;  2YG2 A;  4I3B A;  3BX8 A;  5BVQ A;  2YMS A;  4I3C A;  5F6Z A;  4O4S A;  4YKM A;  1YP6 A;  1KQX A;  4I9S A;  3WBG A;  5HZ6 A;  5HZ9 A;  2WQA E;  4NNS A;  4O3X B;  5EZ2 A;  1R0U A;  1JZU A;  2A13 A;  2Q4N A;  1BEB A;  1KGL A;  4YCE A;  2X8F A;  5IO5 A;  1SXW A;  1JYJ A;  1S2P A;  3NAD A;  1SY2 A;  1ACD A;  1BWY A;  5B27 A;  1LIC A;  2WUT A;  4UU2 A;  5H9L A;  1GXA A;  3HWD A;  4O49 A;  3QKG A;  1BSO A;  3DTQ A;  1EXS A;  3B2L A;  1DV9 A;  4O3Y A;  1Z24 A;  2KTS A;  5H9A A;  3HWF A;  1SXX A;  1KZW A;  1QQS A;  2AT5 X;  2QOS C;  4IMN A;  4U8U M;  1G5W A;  4FBR A;  1ZNL A;  2OFR X;  1TVQ A;  3ZUO A;  4YFR A;  4A1Y A;  4AYH A;  3CQN A;  3JQO A;  1ZNG A;  2X45 A;  1SXU A;  3O22 A;  3BY0 A;  1S7D A;  3STN A;  1ZNH A;  1LKE A;  4LZV A;  2XST A;  3P6F A;  2BLG A;  5IO7 A;  2M4L A;  4IAX A;  4ZHC A;  3STM X;  4TQ2 A;  2JN3 A;  4QGX A;  5HAE A;  1KT7 A;  2N93 A;  4I95 A;  1X8Q A;  5FQ8 E;  4ZFX A;  2MM3 A;  1BLR A;  2GTL M;  3ZI8 A;  3P6D A;  3KFF A;  1S44 A;  3VG4 A;  2FWV A;  3WJD A;  1B56 A;  5H9K A;  1QWD A;  4EXZ A;  1VPR A;  3WJE A;  2MHD A;  3PH6 A;  2R74 A;  4N7C A;  2QO5 A;  3CWK A;  3OE3 A;  4IB6 A;  2IFB A;  3G7X A;  1IKE A;  1TOW A;  2PY1 A;  3O19 A;  1EPA A;  3P6G A;  5BVT A;  3KZA A;  2ACP X;  4LKT A;  2GJ5 A;  3B2J A;  3ZW2 A;  4EQA C;  3FEL A;  3FW5 A;  3HWE A;  1SMP I;  5FQ6 E;  4GK9 A;  5LJH A;  2RN4 A;  3S26 A;  4IB8 A;  4ML7 B;  4OS3 A;  4INN A;  2NND A;  3CBC A;  4AZN A;  1A57 A;  1DF3 A;  4HPA A;  4OS0 A;  5LJD A;  4ZHF A;  4WFU A;  1HMS A;  2JU8 A;  1HBP A;  3IFB A;  2LA7 A;  2R73 A;  1JBH A;  3SOT A;  1TXL A;  1ADL A;  2HMB A;  2XKL A;  4TNN A;  4YCH A;  4ES7 A;  5LKE A;  5LJC A;  1YP7 A;  4YH0 A;  4IBA A;  3RKG A;  3S5V A;  2G7B A;  2NNE A;  3APU A;  3STK A;  3WOV A;  4EDE A;  2L9C A;  3UEV A;  5EED A;  4IB7 A;  1X8P A;  1OPB A;  5D48 A;  4GNW A;  4Y0P A;  2G79 A;  4LQZ A;  3PQU A;  3NBX X;  1BSY A;  4EFG A;  2FTB A;  4MVI A;  3NX2 A;  2NP1 A;  5D8J A;  1YWA A;  4HPD A;  1KQW A;  4PSQ A;  4ALB A;  2A3F X;  2OVD A;  3ZW1 B;  1HN2 A;  1NP1 A;  4AZQ A;  3BU9 A;  1MX7 A;  4FQB B;  3FEN A;  4HWM A;  3BSZ E;  5K06 A;  5KID A;  1OEE A;  2HYS A;  1RLB E;  4HFO A;  3KFG A;  2AL0 X;  1OEK A;  2JW1 A;  1QY1 A;  4KH8 A;  3RWX A;  3I0A A;  3BLG A;  4ORW A;  3LHN A;  4GH7 A;  5FQ7 E;  4GRJ A;  4JGL A;  3ELX A;  4QGW A;  2AMM X;  4L3R A;  2AT8 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...