4EFKA

Pantothenate synthetase in complex with n,n-dimethylthiophene-3-sulfonamide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
289
structure length
280
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Integrated biophysical approach to fragment screening and validation for fragment-based lead discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 91
structure length 280
sequence length 289
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4efkA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4efkA01
4EG5A 4ZT5A 2X1MA 1XNJA 2AKEA 3IOCA 3M5WA 3TS1A 4GU5A 1MC1A 3QTTA 1QQTA 4DDKA 3SEQA 3ZUGA 2RE8A 1NZJA 2EL7A 1MRZA 3NBKA 4G6ZA 3FI0A 3VRHA 2J09A 3NV7A 3FHJA 2A1UA 2PZ8A 1O97D 4JXXA 1KQOA 4MUNA 4OJMX 4QBTA 3N8HA 4ZCPA 2AZXA 1GZUA 1N2EA 4AS1A 3ZJTA 5FO0A 3A2KA 3HMQA 4DE5A 1JILA 3KFLA 1G8HA 4ARCA 1DNPA 4X0EA 1ZJWA 5HUHA 1ZH0A 1EFVB 1JEDA 5TGTA 2DERA 3IODA 1M8GA 1MAUA 3N9IA 2CYAA 2YWCA 4KKVA 4YP6A 2OV4A 1HYBA 5J5AA 3MUEA 3D6UA 4K03A 4MLPA 3CVXA 2QUHA 1NURA 2D54A 2YXNA 2R5WA 1MB2A 2VTBB 4MUFA 2EJCA 3NBAA 1G8GA 4WNYA 2CFOA 1T6YA 4G5YA 4XFDA 2BYTA 3K9WA 1WY5A 3DV2A 2WB2A 2CT8A 1ZH6A 1OWPA 2J4DA 5DK4A 1EUQA 1F9AA 1JIKA 1N78A 1O94C 5H16A 2D5BA 3IDFA 1B6TA 1KH1A 3GUZA 2PG3A 2IP1A 4NZPA 3H05A 4ND6A 4ZCRA 5HUJA 4DDHA 1QRTA 1A8HA 2JAXA 2PFSA 1TYBE 3ZJUA 1XNGA 1OWNA 4PY2A 1R6UA 4ZT7A 5LM3A 4XFJA 1MBZA 2D13A 2PZAA 5DASA 1PFVA 3CVWA 1F7UA 4MW6A 2IJGX 1NUTA 1OBCA 3JXEA 3KT8A 3X1KA 1VL2A 4MVCA 3Q12A 1ULHA 2A1UB 3F3MA 3UY4A 4KR7A 3TQOA 2YY5A 4MUJA 3IH5A 2QJFA 1OWOA 2JA2A 1N2OA 2HMAA 1JIJA 1KORA 1JECA 1N75A 1NUQA 4YMIA 4ZT3A 1KAQA 2QTRA 1N2GA 3X1JA 2Z3VA 4L2IA 3C8ZA 4HJXA 4DLPA 1J1UA 2V0CA 4CDMA 4KR9A 3VGJA 2H29A 2J08A 2A4MA 3G59A 1Q19A 4YP5A 1UFVA 1FYDA 2CV1A 2Z08A 1J1ZA 2TS1A 1G8FA 1NYLA 3X1MA 4UZEA 2HZ7A 1O96A 1KP2A 4KPUA 3L93A 4ND7A 4GRIA 1F7VA 3RBAA 1Q77A 4CT0A 3IOBA 1N3LA 1WXIA 4JXZA 4MW7A 4R0NA 4H3SA 2NSYA 1K4KA 3ND6A 4ZT4A 1NSYA 1T6ZA 2A7XA 3MLBA 1JIIA 1RQGA 3SZGA 1XNHA 3RJZA 1WZ2A 2Z09A 2QTNA 3ZGZA 3INNA 1IHOA 3CLRC 3IMEA 1PG0A 2QJOA 4NATA 3SP1A 3TZLA 3E27A 1NI5A 3COWA 1H3NA 1IH8A 4A91A 1P7PA 4ZCSA 1KR2A 4QRDA 1K4MA 1R6TA 3P0HA 3AG5A 1JZSA 1YI8A 1M8JA 4EG3A 1M8FA 5K0SA 1IVSA 1NUUA 4ARIA 3HL4A 2DXIA 3CLRD 1I6MA 3P52A 1TYCA 3RK0A 4MW5A 1MB9A 3H97A 1WQ4A 2QUJA 3FY4A 1J21A 4E1AA 1O0CA 3GLVA 1WXHA 2GKSA 1FFYA 1YUNA 3KT3A 1EXDA 3HV0A 4EG1A 4CQNA 1I6LA 1KH2A 1KKUA 3A05A 4MW9A 1KQPA 1ILEA 1O6BA 1N2IA 3UOWA 4PBSA 4L2IB 4OUDA 1IQ0A 1MAWA 1OD6A 2C5SA 3FETA 5FNZA 1U3DA 3P0JA 3CA8A 2QTMA 5DB4A 1TFUA 2X1LA 5TEVA 2G36A 3A04A 3CLTC 4MWEA 3LE8A 4EG7A 4MW1A 1N2BA 1EFPA 2AG6A 4DNXA 1WJGA 3IVXA 1O96B 4KPUB 1N1DA 1JEEA 4ZT6A 4FZJA 1TYDE 2O8VA 3Q4GA 4MW0A 3S3TA 4ZCTA 2WQ7A 2QJTA 2E18A 3PXUA 1H3EA 5LLTA 4NAUA 2CSXA 4EG8A 3RFFA 3UC5A 4MVYA 4MUGA 4QREA 3G6KA 4BWVA 1PFUA 5BNZA 1U0BB 3IUBA 1S4MA 3HZRA 1KQNA 1YULA 4EFKA 1PFYA 5LFAA 1O94D 4MWCA 4YBRA 1VLHA 4R2MA 3A4IA 4MVXA 3FH0A 1V47A 3UK2A 4R2LA 4MUKA 1TYAE 1WXEA 2VXOA 1I6KA 2X0KA 4XSVA 1O0BA 1D2RA 1KH3A 3N05A 4Q16A 5TS2A 2A86A 1OWMA 3IVCA 3L92A 3CLSC 4P2BA 1I2DA 4U7JA 1IQUA 1LI5A 3AG6A 1K92A 2E21A 3AIIA 3SDBA 4PBTA 5KHAA 1WKBA 5K0TA 1VBMA 5H7XA 3CVUA 3H99A 4EG6A 1VBKA 4OUDB 1X8XA 2OQ2A 3CLUC 3TQIA 3COVA 1U7XA 3ZXIA 3FNRA 3ZXSA 2O5RA 1CT9A 3CLSD 3AKZA 3H9BA 1EFPB 2PIDA 4HK4A 2V0GA 4AQ7A 1OBHA 2GM3A 4ZT2A 2E0IA 3K32A 1NUSA 1G59A 4MULA 4MQ6A 4MUEA 3COYA 3IUEA 2J5BA 4S1OA 3AFHA 1M1ZA 1GLNA 1WQ3A 2XRYA 2A84A 1KAMA 3CLUD 2GOYA 4ZCQA 4K0RA 3IVGA 3DPIA 4U63A 1O97C 4F3RA 1N2JA 2QUIA 1NUPA 1QRUA 3BL5A 4YP7A 1T9GS 1O5TA 1T6XA 3G5AA 1YIDA 2CV2A 1GTRA 5KCMA 4J76A 1Q11A 1H1TA 1U7DA 2JANA 1MJHA 4MUHA 2HGZA 2X3FA 1COZA 3COZA 3VU8A 1YIAA 2H2AA 4EGAA 1JHDA 1OWLA 1R6XA 4HJRA 1JGTA 1ZUNA 4MUIA 2RD2A 4MVWA 1EUYA 1M83A 2ZUEA 2CV0A 4MWDA 1KP3A 1T9GR 1BS2A 3FIUA 3IMGA 1O95C 1QNFA 1IQRA 3KT6A 1F4LA 4PBRA 2CYBA 3IMCA 3OTWA 5KWVA 2DLCX 1QJCA 3DO8A 5JBNA 2A1TS 3SEZA 1SURA 1N2HA 1EJ2A 5AHWA 3UMVA 1Y42X 1H3FA 2BTEA 1M8PA 3ND5A 4MAFA 1J09A 2B7LA 1O95D 1XJQA 1QU3A 2DEUA 2XRZA 5EKDA 1WOYA 5DEOA 3CLTD 1NP7A 1X6VA 3PRHA 1QRSA 1IRXA 1J70A 3SYTA 2CUZA 4EF6A 3MLAA 3PNBA 2DUMA 4NAHA 4Q93A 1IFXA 5HG0A 2A1TR 4MW4A 3RHSA 3SZ3A 1N77A 1VBNA 4UZFA 3TNJA 3CVYA 5FO1A 1V8FA 3MMXA 1M8KA 4RUKA 1TEZA 4EG4A 2WQ6A 4CDNA 3FWKA 3ILVA 1WXGA 3OP1A 3RK1A 1U3CA 5IHXA 4JYZA 4F4HA 4JZYA 4DDMA 3CR8A 1TQ8A 3HFJA 1JMVA 3Q10A 4J75A 3FOCA 4DJAA 2IELA 3ELBA 3AL0C 1EFVA 3HGMA 3H9CA 4MWBA 4NDAA 2I1LA 3GMIA 3ISJA 5J59A 2NZ2A 1LI7A 2DETA 1GN8A 1YUMA 2CYCA 3CVVA 3MXTA 3PNVA 3U1VA 5F23A 3I05A 2DR2A 2ZP1A 3KT0A 1J20A 3ND7A 4MW2A 1K97A 2YWBA 1QTQA 4WSOA 2ZUFA 1GPMA 3FDXA 2DPLA 4HPWA 5IJXA 2VTBA 1MOPA 1WXFA 1Q15A 3LCJA 2QUKA 3LOQA 4I6EA 5J58A 3DLAA 4TS1A 3IOEA 1GTSA 1LW7A 4G5FA 4RPIA 4U8HA 3QTBA 2A88A 1PG2A 3P0IA 3N2YA 3PNYA 1PFWA 3QE4A 3FG9A 3ZJVA 2J07A 4KR6A 1QU2A 4I6GA 2E89A 4JFAA 2PZBA 3ZIUA 4NX2A 1JZQA 2PXHA 1GAXA 2WSIA 5TEWA 3TZEA 3D6VA 4I6JA 1EE1A
chains in the Genus database with same CATH superfamily
3GLFA 4ZI7F 2AKEA 1JEAA 1Z5PA 5IMBA 2J0SA 2XNKA 4MHSA 5CVJA 3JVVA 3GPDG 2W6JA 4I3FA 1FEZA 4UQPA 1PUXA 2NZJA 3RBXA 4DSOA 3DJYA 1G55A 1Z33A 2RJNA 5ANRB 1VIDA 3D3KA 3C3CA 4HDOB 4KMOA 4Y18A 1SUWA 3TR6A 4L6CA 3OLZA 1E2NA 1K8YB 1XZKA 4LC0A 5T64A 4TRJA 1W1WA 1XD2B 3ENKA 2JAUA 1K6JA 2QY9A 4E30A 3BRQA 1UEIA 2J67A 3TW6A 2AZXA 5HJ5A 1M6NA 4KXQA 5FNVF 5H59A 3RT7A 2YXBA 2C0CA 3RSOA 4TN1A 3UCFA 1LPBB 2M98A 4UARA 4A8JA 4EDFA 5AHXA 1KMCA 2GM9A 2YUIA 4DE5A 3PC2A 1Y9AA 4PC3A 5YASA 3B89A 2RONA 4PANA 2W6CX 4C3ZA 4OJTA 5K0GA 4YQFA 1IM2A 1Z5UA 2G6TA 1G3IA 1MD9A 4RGBA 3ST7A 4P86A 5JJLA 4WK2B 1VKOA 4YMVA 2QIOA 2F3SA 2Z98A 1W1IA 3U5TA 3AGPA 4ZAVA 1DEAA 2NU9B 3VM6A 4B4OA 4MGZR 3OQMA 1S7CA 1ACMA 1FA9A 2OO5C 3KOWA 1YR7A 2QS9A 1Q6ZA 3FUWA 1P0IA 2GN8A 2YFQA 2C0PA 5TB5A 1T2DA 5KSPA 2NVBA 2QYSA 3BSSA 1EAYA 3X43A 2W8BA 4AZSA 3C3EA 3G5LA 5DFAA 4WNYA 1KWGA 4XWAA 3BWEA 4R7ZA 2FQ1A 3L0SA 1WNFA 5DIZA 1DIAA 5EE9A 4IG9A 1EH5A 4JGGA 3ZHOA 1QO0D 1LQ2A 2ZE7A 4MINA 3OX2A 3PHJA 4W7SA 3FPKA 5GM1A 2XDAA 3BXHA 3X1WA 1O6CA 1ABEA 1IUOA 1E7SA 3GLSA 1SVUA 1I4EB 4Q9DA 3FPSA 3PE3A 3Q9NA 4WIAA 3OKFA 3C24A 2EU8A 4H35A 1GRRA 3AY0A 1RQ2A 1IBRA 2PX8A 4X1YA 4PZCA 3RCBA 5HWSA 1Q2UA 1TB4A 2ISSD 2PFGA 2WSLA 3ZTWA 2GD1O 2P3QA 1FP4A 5BXQC 2QX4A 5HUJA 2WAAA 3GJXC 4FNOA 2ENWA 4M98A 4PFQA 1YFZA 2X42A 3OJFA 4H6WA 2CKDA 4BFZA 4ZT7A 1A8IA 1YSCA 3O73A 4N8DA 5KBYA 1QB8A 1PZGA 3HEAA 5DASA 2B8JA 2XGJA 3AIKA 4GPBA 4FHGA 4YT8A 1W8DA 1RXYA 2OORA 3OTHA 4YCDA 4G0WA 1MOSA 3DBOB 3JQ9A 4JWKA 1UBNA 4MH0R 4O3FA 5LCXA 4OXNA 3EEFA 3DONA 3EC2A 4D43A 3O3CA 4LVNA 3F1KA 4YUAA 3FHCB 4BMDA 2EZTA 1ZCFA 5IDYA 1OZAA 1OZ0A 3JAKA 1QYDA 3WQRA 3WRXA 1E61A 4IDDA 3ZCRA 1HDIA 4RD6A 3SHFA 5BR4A 1J9ZA 3OU7A 1YGPA 2BTQB 2PANA 1JECA 1P72A 3R0XA 3ESDA 4NICA 3O31A 2HIHA 2W2PA 2CWWA 3QX8A 2HJGA 2DC1A 3CT4A 3PFIA 2GXSA 1YDFA 4HAIA 5K3SA 1FSZA 5CLIA 1K2WA 2HJ9A 5C1IA 2H1RA 5B55A 5DT9A 4M0EA 1T4DA 2NG1A 1KZ6A 2VVTA 1B14A 1W0KD 3DXZA 3BMCB 4R8LA 4F4JA 5EP4A 2OFPA 1C8LA 1WUHS 3DTTA 1ZKMA 3LTNC 1Q91A 1QGYA 4UPDA 5BMVF 1ITZA 1IAVA 1Q19A 5K4HA 5HRUA 2OMEA 5EJ2A 3E1SA 2YFKA 2Y1FA 2Z08A 5FWAA 1QH1A 4I55B 3VDRA 1U0EA 5CNMA 5F7XA 3BMOA 4JN6B 1NYLA 1CQZA 3GX1A 2FFQA 3QZUA 4M7OA 4PQYA 5HKLA 3OTGA 4FYHA 3T0IA 4JVOA 4CIVA 1PV2A 2Z30A 2VO1A 2IZZA 2CJYA 5BN3B 1WXIA 1RADA 5DP1A 4CHGA 2HV9A 1Z83A 2VSYA 2P40A 1EQAA 4ITUA 2C3YA 4Y2HA 2R85A 2VBCA 1S8OA 3HPQA 5IJAA 2HQ1A 1DG9A 3IDAA 1D4ZA 2XCQA 3DCJA 4RQBA 3LPLA 1RQGA 4OLBA 4N82A 2OCKA 4JI8B 3HXMA 1OHHD 4LYFA 1LBEA 1RIIA 3S2UA 2BMFA 4NMXB 3HDTA 3OEWA 4F12A 3HNRA 1DRVA 3FRJA 1U99A 1N6HA 5CVVA 5HFAA 5SZHB 2NV6A 5D5HA 1ZVJA 4JSTA 2QYHA 1XMVA 3IQDB 4OHZA 1YASA 4DBZA 3ZE2B 3U3DA 1WF6A 1U0JA 5DM4A 2RHTA 1D07A 2TYSB 5AT1A 5AJTA 2QUAA 1ODCA 4ARSA 3KZKA 3EQZA 1NMEA 2AL7A 3NBXX 2BGMA 4UEJA 3WZMA 4JR0A 4CKXA 1RS0A 2VCEA 1MJ5A 4CG3A 4F3KA 2J46A 3MOGA 3RVLA 2C2ZA 4HN9A 4MP8A 1XRJA 4PHFA 1H2EA 5ELXA 2CNWD 4ZK2A 4WJZA 3GEPA 4OG2A 4EG3A 1ZBDA 1E9AA 2BZSA 5EJAA 4IX9A 3IBSA 2A52A 2JI7A 3EEQA 1UBOS 1YWGO 3HMKA 3J7TA 4JDPA 4X6YA 4Y6LA 5HF6A 2O57A 2DT8A 1RXSA 2PWZA 2WZDA 2BT4A 5EQFA 3M0EA 2VZEA 4ERNA 1GD1O 2HMWA 3KJIA 1U2QA 2VP4A 2NT4A 2FG6C 3JRNA 3RRXA 4E1AA 4N01A 1S4QA 5C35A 1U80A 3WK4A 4IIFA 5HTOA 1JJ7A 2GKSA 4EUEA 3A4TA 3Q3HA 3VFDA 5LDHA 3FOAA 1AGPA 4C0QC 1ISGA 2V7TA 5T3YA 4GGOA 2ZBFA 1TL7C 1ZU5A 4BX3A 5HFNA 2F8SA 2D2XA 3P2KA 4MW9A 1DTSA 3BEOA 5BSTA 3EEYA 2N1BA 4US0R 5G4KB 3ZWQA 4L2IB 5CAEB 1P33A 3K0FA 4L57A 2AR0A 3NOXA 4AY5A 1KO7A 5CVUA 2ZR9A 2I7XA 3WLJA 1IC6A 2RHDA 1WPGA 5E9JA 3I5YA 4A5OA 3I6MA 3KETA 1JVNA 4KN6A 5ALNA 2AQ8A 1IATA 3LF4A 1ZCAA 5SY6A 4H7HA 1KI4A 2UZ3A 3EZYA 1QAQA 4KPEC 2PL3A 4ZT6A 4M54A 3O3NB 4L8FA 3UPTA 3FDJA 1Y1LA 1SN7A 4OI1A 2DQZA 2W90A 2ZVPX 4FFLA 4KLZA 4XR4A 3CUUA 4CM7A 3D0QA 2YHBA 1YKFA 4RSRA 5LMZA 3CNOA 3RFFA 4YMUA 1I32A 2PMCA 3VR3A 4HMQA 5FL7A 4NECA 1UMKA 4PZUA 4GIBA 1YFLA 3VZQA 3QY0A 5H80A 1Q0SA 2I7TA 1FCJA 5IFKA 2ZPAA 4S35A 3I92A 4FR5A 3EAGA 1J9EA 1MGOA 3DDSA 1YAJA 2RGUA 4BV2A 3AUAA 4N49A 1CDDA 4L8GA 4JP3A 4YBRA 2V5UA 3WRYA 3ZC3A 3CKLA 5ALUA 4XIJA 4IIDA 2P9JA 4NOJA 2JGEA 3PFFA 2G4LA 3QBJA 2R86A 5EXPA 2OFXA 1ZXLA 2GGSA 2R7NA 5J43A 3VPHA 4QVIA 5F12A 3GUUA 4OP2A 2ZJ7A 3BF7A 4LGYA 3UCEA 1M5TA 1GA4A 3GIWA 4JB0A 3ZCSA 2ZCJA 1JSCA 1S89A 3NHAA 4BQSA 1YD7A 1N6LA 4IEEA 2JHAA 4M0DA 5CFQA 5EJ8A 4QU0A 5FTNA 3VR0A 4NPHA 4ZMSA 1DAKA 4F85A 4DY6A 2AOUB 3ICWA 1CIJA 1NC1A 2OC4A 1EVQA 3IVCA 2HU5A 2WOOA 3AJDA 3H9UA 2KPOA 1DIBA 5EMHA 3PX7A 1E4EA 1PJAA 2VLBA 9ATCA 3Q87B 3UWSA 5ARCA 3R6TA 3QW2A 1D2NA 3DP7A 3N86A 1MPTA 2EFGA 4FOPA 3LPCA 2GF9A 5BW8A 4BKOA 1VG1A 1NXPA 3TG2A 3WQHA 4CW7A 5FUWA 1Z2NX 3RLFA 1TZMA 3L04A 5H7XA 4DS3A 1Y6JA 2NTYC 3L7DA 1W5TA 4RELA 1Z0FA 4XR9A 3EZFA 3GDHA 5I48A 1WHSB 3IKJA 4AJ2A 5ITVA 2VHCA 3L6BA 3VDMA 5KSYA 2BE7A 4V1CI 3KQTA 4BVAA 2OV1A 1U7XA 3TTVA 3QQPA 2R65A 4FZRA 4F91B 2ZEJA 3CW8X 2RGWA 2X40A 3CLSD 4FKBA 4IVNA 4MQFA 3V8QA 2NYRA 2HNKA 1B41A 2WFZA 5ITSA 3GJYA 5CPBA 3DDCA 5BR8B 4LNAA 4MVJG 2JCBA 4OFBA 1KZHA 4BQEA 3O8OA 5E6SA 2JLWA 2ZJ5A 4IFEA 3WK7A 1DKUA 2FEXA 1A8QA 4HEQA 3X1DA 4DHWA 3G1TA 3H2SA 4NXNB 2W93A 3KAPA 1F2TB 5IH3A 2DUJA 4NC9A 4Q9LA 1LK5A 3LF1A 4FFSA 2UDPA 4G25A 2YNMC 4V03A 1SOAA 5KYXA 4L4YA 2X8JB 4ZCLA 2FG7C 2IUUA 2VZ0A 1G5HA 1Z4PX 2PSDA 3BL5A 3NAZA 4DV5B 1GTZA 2C31A 5BOVA 1O5TA 1S2OA 4R1UA 4WCFA 2CV2A 1SR8A 1BMTA 3BHMA 4B6RA 3PGVA 3TLEA 1V35A 1M1NA 3T7SA 1U7DA 4YEDA 2WWIA 3HACA 2ACVA 5A4KA 1YQQA 2L19A 5KO2A 4WBSA 5IU6A 5LZ5A 2W4MA 2ZBVA 4X1KB 4YV0A 2VN8A 1K8RA 3QH4A 5HIMA 5AVQA 4RKYA 3R77A 2NGRA 1ZUNA 1XQXA 2O2JA 4KMRA 2HSJA 3HB1A 4FGUA 1V11B 5CGQB 4W5QA 3RC2A 1PS9A 2QZ9A 4C7KA 2VPIA 2B37A 3CMMA 1JHUA 2XQKA 4JBHA 1KSGA 3MT0A 3NGMA 3S0JA 1FC0A 4RQTA 1L5HA 3ONDA 2CV0A 2GD6A 1R4MB 1C0IA 2V9ZA 1O9HA 3L4JA 2FSGA 5CEEA 3RUIA 3RV4A 1P1IA 4C6TB 1K7XB 3PF9A 3V8RA 5L7TA 1P1JA 4A6PA 2P0AA 3IT0A 4G1EB 3U3RA 1Y34E 2CYBA 4PBRA 3NUZA 2GCGA 1JL3A 2PYDA 3M2PA 4B3JA 5GVRA 3Q41A 4Q7EA 1V3QE 5FP0A 3C7KA 4RY2A 4BFXA 1LXCA 1EFRA 3IURA 3I9V6 1OTYA 5HDBB 2R4TA 3LLSA 4Z3OA 2CE2X 2XMPA 1X9IA 3IHTA 3R2JA 3GLGA 1JYSA 1ZU4A 2JLSA 2QX8A 4GI1A 5CURA 1K5DA 5I8WA 1I3LA 4LZNA 2EEZA 5JEDA 2C7PA 5JH7F 2N47A 4AP9A 2BR3A 5KNDA 3BQNB 3V33A 2BFPA 4YRNA 3GRZA 4C43A 2Q6TA 1GHTA 4E11A 2ZKLA 3OEHD 3PDIB 3A9UA 4R8SA 5F33A 1VMDA 5J5CA 3RRBA 3SBEA 3PRHA 3P5BA 2WAOA 3HJGA 5A4IS 1NE2A 1W48A 3EOZA 2QLJA 1GXSB 3JAWA 4A92A 1G8AA 1W85A 3UWOA 2EP5A 4JS0A 3B1ZA 4G86A 2X8LA 2K6GA 3NIFB 2Z56A 2PLRA 1PZHA 1OTHA 2WHPB 4BVEA 3H16A 4ENVA 3RNOA 3NHMA 1K0FA 1JIQA 1FRVA 3VX4A 1SKQA 4X65B 2RJOA 1JDJA 3ICVA 3KAQA 3U4AA 5BVGB 3PQ2A 2GCOB 2C4VA 4IIGA 4HGRA 5HYVA 3PFGA 3S2IA 2HYIC 2WE8A 1PQ4A 2WKRA 3N74A 4ZO8A 4WFJA 5D3ZA 5JJCA 2JLXA 5ECYA 4XAQA 1YFJA 2EBWA 2VHXA 4RV5A 3C5VA 1RVDA 4FHZA 5IHXA 5KTPA 3R20A 4JYZA 2XUHA 1XUOA 1GZHB 1H6AA 1QHHA 4KXYA 4JZYA 1E0DA 1IY2A 5EFOA 3ZHBA 3CR8A 4C4PA 5F3DA 2UYOA 2XB4A 2BEWA 2IRWA 3KZ1E 1BYUA 2WKSA 4MJ7A 1KK0A 2V65A 4FJ0A 4GDFA 2OEPA 4EF4A 1WCIA 3IX7A 4TZKA 4MA5A 3ZOZA 5JSZA 3LKZA 3M82A 2Q8NA 5HIIA 3TOXA 3TLKA 3F8SA 1NUAA 3MXTA 1NFQA 3MIIA 4OEHA 4EMTA 1WETA 4EGJA 2J3KA 1T0JB 3HO6A 3W5BA 1WPQA 1NWCA 3QFFA 3KQQA 1Y4UA 4P6VF 4UAUA 4JLUA 3DWEX 2OC9A 4A0QA 4F56A 4LY9A 3QPBA 1QFYA 5KNCA 1AXGA 2B4TO 2I67A 4OO3A 1AMUA 1WSDA 3TQSA 2OD9A 5LKAA 1LBHA 4BXOB 1L5SA 5CXUA 4EJ0A 2ZDQA 5FLEX 4I6EA 1ZCJA 1HTWA 5BT8A 3KVYA 1XLVA 3UVEA 1HTTA 4N03A 3M6AA 4WBNF 1BEEA 4QNNA 4N6NA 4U8HA 1TVMA 1MB4A 3WDSA 2E4XA 1PFWA 3UGKA 1Z5WA 2P35A 2J07A 3AEKA 3GNSA 3CEJA 3MD0A 4RDCA 2XYQA 4MRMA 1OH6A 3IKMB 4TTSA 4JI2B 1J8DA 1GAXA 3CXUA 3TGWA 4AUMA 3CRW1 5C3UA 4N1AA 1FP7A 3OPNA 4QRIA 3F3YA 3RVPA 2QPLA 2WJAA 2ZSFA 3CN7A 3D6VA 1PLKA 2W2KB 3E4CA 4HFMA 4HWOA 4J91A 1E79A 5ILQA 3STWA 3ES9A 1BHQ1 2W22A 3N70A 4GMKA 4DG5A 3GP8A 3J7AC 3F6SA 1LGYA 2IYVA 3FFBA 4DNPA 3BFVA 2DB3A 4KR0A 4HNGA 4EITA 3DBVO 3CG4A 2I8AA 3DD1A 5TVGA 3KQKA 1X77A 4Q9HA 4C7OB 3BMQB 3JYQA 3KV1A 5K0BA 1XJ0A 3K73O 1UBFA 3LUAA 1LNSA 1ZVKA 2J45A 4GMGA 1E3SA 4M9UA 2YJGA 5U4QA 1GLVA 3CBQA 1M9NA 3EA4A 3L01A 5B1EA 3V1TC 4HTAA 4N5HX 2GH1A 4WECA 5B4VA 4FT2A 3OCYA 5FTKA 4LQ4A 3V5NA 2XZPA 1C3EA 2CB0A 3K3PA 4ALIA 2PUEA 4X0EA 3ZH9B 5CYOA 2A53A 4ZHQB 2ZE6A 4K6OA 4QXRA 4C7MA 3PUIA 1QPBA 3D59A 1A9XB 4JP8A 1UBTS 2WD7B 4JLVA 4RPHA 2R8OA 4F7DA 2YHIB 2WYHA 2VDRB 4A5SA 1QBKC 3O9ZA 5JQGA 2WDZA 5K8LA 2UZ1B 1IBSA 1CY8A 4J29A 4PFKA 1WUKS 2YMPA 4RLSA 2X86A 4V0MA 1E7MA 5DSTA 1WVMA 3UFBA 2K87A 3H8JA 4LGCA 3QE2A 9LDBA 4OIFA 2Z58A 2FDXA 1M6WA 5ALDA 2I8LA 4FI3C 5CNKA 1L2TA 1BCRA 3D6AA 4OQLA 4QATA 1ZNYA 1LPNA 1NXQA 3WQQA 5CXXA 5KSZA 4YDSA 3GBVA 1FDTA 2HQOA 3IP3A 4MV0A 1G4HA 2M6LA 3EDCA 4XWWA 2OXTA 4FFVA 4L0DA 5KWIA 4FNAA 2FKNA 4M1YA 4R81A 1IEXA 2RIPA 5CM8B 1CZRA 1O94C 3F6YA 4UMFA 1CS0B 4TZTA 2HV8A 1P2TA 1Y5LA 2FXVA 3A6JA 3WBJA 1N2CA 5I9LA 4PZLA 3SICE 2G2SA 4FNGA 1A8SA 3ZCQA 4ZQGA 1R0BA 1E62A 4NZPA 4NEQA 3U7QA 4D45A 1RQRA 4U6NA 2J9YB 1JHPA 3ZTTA 1RWWA 3N7AA 3SZRA 3ZY6A 1TYBE 5U9CA 4KCGA 1GQRA 5I9BA 5EERA 1X9HA 5ES3A 3LBAA 3PR3A 2FZ4A 2P9BA 1YS1X 3GRRA 1SKUA 4K9NA 4XFJA 1IE3A 4BKPA 1D1TA 4Y0NA 2H31A 1Z2PX 2BFDA 3H84A 4XCVA 1ZICA 1LTKA 1L5YA 2EKDA 3UN1A 1RXEA 4P34A 5ADHA 4FQ8A 121PA 1MT3A 1E9RA 1WZUA 2G8NA 1NTRA 4MPRA 1ZG3A 2IF2A 4CMGA 4DUPA 1R8YA 5I9SA 1UH5A 4US1R 5FLKA 3AY6A 2DLNA 5E9QA 4EVIA 3F5SA 1YQEA 1VRVA 2IXDA 1II8B 3N28A 4PRLA 3UWDA 5KINB 1GAQA 1AN9A 1TUIA 2NZUG 3HJFA 3R6WA 4CI0B 2B21A 2CLIB 4JAVC 4JDUA 3OC0A 3AI1A 2CXSA 3PP8A 3IAEA 3ILYA 4DMLA 4PVCA 5JSFA 1JPJA 1NVAA 3IAAA 3IALA 3X1JA 2Y4OA 2Y8EA 3ONWA 3ZHYA 1NYRA 3FCYA 1KBZA 4PE5B 1VE9A 5CLGA 1M2VA 3NP9A 3MWEB 4A7PA 5C46F 2QXYA 4J4BA 3KPJA 1Z4LA 4LNUB 1SY7A 1QTRA 3R9KA 2A4MA 4YP5A 1MVOA 2CLLB 3RNLA 2OGZA 3U3KA 4DEYA 1YQDA 1V1MB 5BQXA 3VNAA 4L7QA 2H1IA 1ENYA 2YH2A 3DO6A 1IXYA 2AJLI 3ZQ6A 3OX1A 3ZGYA 1VTKA 4OKSA 2OYCA 3LFUA 4XVCA 4YMHA 5KMGA 1XLTC 3I01M 4GRIA 1OU0A 4EJFA 4MS3B 3KXLA 5ENVA 5AICA 4MR9B 3VYUB 5IVPA 1L5MA 5KYWA 1TU3A 3G0OA 3JCZA 1A5ZA 2NQ8A 3K96A 3OZ7A 4YWHA 5WRFA 4UBJA 3SZLA 3RJTA 5IVDA 5BYKA 2OBYA 1GRNA 2ODTX 2AC2A 3OFSA 3R7BA 4YIHA 2GLUA 3OPXA 4TSFD 1ZEMA 2CLEB 3TWOA 4LF9B 3RKRA 1NDHA 3VVCA 4C5CA 4IZOA 2CHVA 5DM2A 2WSSD 5AM0A 2ID7A 3UJCA 4C7XA 3QE9Y 1BW9A 2DTDA 2RK3A 3D3QA 4EB3A 2NO0A 2ZPUA 1X80B 4F6RA 4RENA 2AG5A 2H5IA 3AR3A 1GNLA 2JJ2D 1JDSA 1AGYA 1TIPA 2MJLA 3FKJA 4TPKA 2J48A 1ECGA 4CMCA 3BH0A 1YBFA 3H18A 3ZV7A 2JIDA 4B1FA 3IJPA 3U3ZA 1ISIA 2XMBA 3CSSA 3FTQA 3BRWD 3VR4H 3SNKA 1YZ3A 4GQIA 4M36A 3HL4A 4IWYA 2I62A 3EQ8A 4I4NA 2CDRA 1DG1G 4JI5B 5J4LA 1ZZGA 3PXXA 3H3JA 4B2PA 2JJ1D 5AM4A 2IKSA 3HB5X 3VC2A 3KTFA 4RH3A 4HAVA 1DTWB 3LAWA 3BD7A 1IZ8A 3LYUA 3HYCA 3A14A 1O58A 2O1SA 1G9XA 2A3NA 4JUCA 1YUNA 2GBGA 4YAWA 4EG1A 2NXWA 4U7DA 1R7RA 3JQEA 5EUMA 3DT8A 1MTOA 1NN0A 1CUGA 3VO2A 1O6BA 1SUBA 2G06A 2ZS8A 4ON9A 1BCSB 4XYLA 1JIXA 5K05A 2H2FA 3E84A 3L77A 5FNZA 2J9ZB 3JQFA 4NHEA 3N2KA 1T35A 4Z4HA 2HEGA 3LUJA 3WYGA 2VBGA 4EVRA 5EJ9A 1DJLA 2Q1WA 4BMSA 4D8YA 2H4FA 5BUZA 3C8UA 2HLDA 1V5FA 1AK2A 1JYEA 4MSUA 2NOAA 4NENB 2QNIA 2NTVA 1L7EA 4LYJA 4RANA 4ZV9A 3RS4A 3VU3A 3B6MA 3BXPA 4P9NA 4DLVA 1SK8A 2XH8A 3Q4GA 4J1NA 4DWWA 1WB6A 1UXIA 2E6KA 1XJWA 1RLJA 5IVKA 3GEEA 2JI6A 3OD1A 1NM5A 4PRZA 5T4HA 3TL2A 1HT2E 4LJKA 4XD2A 5IDVA 3UC5A 2HQSA 2BW0A 3DB1A 2NSJA 4BWVA 4E5KA 1U0BB 4CV2A 1S01A 3FX2A 2FV8A 1OLSA 1XJCA 2WU8A 1ONPA 3NDRA 4WFKA 2BGTA 4BHTA 5DTEA 1JQJC 2OBNA 4U6QA 1GGHA 4KFTA 4OBBA 2HK8A 3TAXA 2BLNA 3FVQA 3W0LB 4D8TA 1ZRHA 1SG0A 3VX3A 3CF0A 2A50A 1O94D 1Y8QB 1SCDA 4IH9A 1VLHA 3E1GA 3IKTA 5EQJB 1AURA 1JWLA 2XBMA 1T9KA 1R27A 4NY1A 2QRPA 3EBLA 3A4IA 3LXXA 4MWOA 3GVIA 4BX9A 3N6VA 3OLVA 1KMHA 5K51A 4YMGA 1OXBB 4J2TA 1TLTA 3VA7A 1M0SA 3AYZB 2PLNA 4Q18A 3QVJA 2NZ8A 4HR7A 6CHYA 1E1NA 1K63A 1TQ2A 2V7GA 4YMWA 2VHTA 3KLNA 4MVJF 1G4UR 3P4YA 2EJUA 3U4MA 4NABA 2WVJA 2QM7A 3H1TA 3OZGA 3SC2A 2JVKA 3AETA 8ATCA 4HUQA 5DYNA 2I6UA 3A2MA 4NG4A 3PB3A 1KFEB 1Z6TA 1MKYA 2WF5A 3B6JA 1VFPA 4MO9A 2XMQA 3ZE0B 4D7AA 1T26A 3NHJA 2ERCA 3LLCA 2RARA 4L8LA 1YT5A 1SXPA 2PR2A 4X20B 2E21A 2NUAB 4GNKA 1GCAA 2ZT7A 1DAGA 1QKJA 3L2OB 2C5FA 3SYMA 1FUYB 1UBMS 1NV9A 1PEAA 3EGWA 3LWBA 1H8HA 1TMGE 3AY7A 2FPPA 3VNSA 4BGIA 3HL0A 2PNJA 3SXJA 3K0EA 5KKAA 3TYXA 1S3IA 4HAZA 4NYMQ 1XRPA 3COVA 1AQIA 1SBZA 2QK4A 4ZWNA 4TMTA 4C22A 2G1KA 1JJIA 3DOHA 4S12A 4B3BA 3OI7A 1AKTA 3FBWA 1CT9A 3OIYA 4W9NA 1FBNA 4B46A 1WTCA 2WKQA 1EZZA 3F8WA 1ST3A 1ZR2A 1XZ8A 4JJEA 3EDRA 1ZGBA 2XIJA 2WY2D 2IE0A 3ADPA 1J7KA 1CRQA 3I76A 4QYIB 1TJPB 1EP3B 4N5MA 4B84A 5INTA 2DFKB 4JQYA 1NUSA 4IOLA 3RVJA 1G59A 3NEYA 1H4TA 5K0NA 4MUEA 3KDAA 1OY1A 4PG4A 1AO0A 1RRPA 1DKQA 2VP5A 5JW6A 5JATA 2GZHA 2VK4A 3G13A 4DSAA 3IR5A 4JKOA 4AO7A 1GQQA 3UB4A 1EEXB 4GUDA 1UK9A 3M2TA 4TT8A 1GAEO 3UENA 5DM1A 1NVTA 3F5FA 1UM8A 1DCFA 2PT9A 3T7JA 3Q3EA 4BN5A 5CDHA 3WADA 4A6DA 5J2UB 5JR3A 5E7MA 1PZEA 1F17A 2VPTA 2Y27A 4J76A 1B1AA 3VR5D 4BASA 4CUKA 5AQ1A 1C4XA 1FFHA 1H1TA 1VSVA 2JANA 1SKAA 1FUUA 2C2GA 3COJA 4JUDX 4FDLA 3VAAA 1Z6XA 4H7FA 1SHKA 3IT1A 3MYYA 3E61A 1KARA 4ZI2A 1V25A 2P4SA 2RHCA 3EW7A 4XUGB 1C1DA 3FR7A 4MVWA 1A04A 1DDGA 4E22A 4PWZA 3T9EA 5AM3A 1JUDA 3WK5A 1BGXT 2O8NA 4G36A 3A1WA 1DOZA 1OXKB 1WP4A 2EJTA 2PMDA 4QEDA 2QW0X 1A4UA 2FEPA 3HYRA 4WMLA 1FQOA 2W83A 4B81A 1GG2A 1QNFA 1IQRA 3EVFA 5CEJA 4ZMBA 4RM3A 1RYYA 1T2EA 5B6PA 2O0KA 4F2HA 1HLDA 3CZ4A 3CW2A 2GM4A 5CA1F 1AKNA 1YQXA 1KVUA 1U1CA 2RGYA 4B32A 1JAYA 3JASB 1J4AA 1ZD4A 2PKQO 4TROA 2Y1CA 2UV8A 3LQRA 1LRJA 3OE7A 1QP7A 4LHVA 3ILXA 5IG2A 3H1BA 4HX2A 4JGIA 1MABB 5AHWA 5KC8A 1VMKA 3GD5A 1OAOC 1X7HA 3ZDCA 1M8PA 1R10A 1EPUA 3B85A 4K6KA 1KNXA 4R2XA 4D9FA 5JXJA 2SNIE 4QPNA 1DO2A 1LJ8A 5AKXA 1PDWA 1Z4KA 3FYHA 3P96A 5KCZA 1WOYA 2HB6A 1ZQ9A 4RDXA 5CA1B 3QLVC 4LRYA 1NF8A 5BVHA 4HT3B 4F46A 1DO0A 1ECBA 1Z38A 4OAOA 3DLHA 5F1OA 1JQLB 3M4JA 4EZBA 4UM5A 3LPDA 3HZZA 5TPWB 3P20A 2FMIA 3OKPA 3F6PA 3O94A 1KA9H 3GARA 1H05A 5L3ZA 5ITZA 2Q45A 4JL8A 3RHSA 2HNAA 4MKZA 1QH8B 2O7NA 1D2AA 2D1SA 3FKSA 4OK5A 1XTRA 3AR9A 3SXPA 5KSWB 4DWOA 4ZIRA 4F2GA 4BMNA 4JR1A 4HV4A 4URXR 4WL0A 3UJ3X 3FWKA 5AVOA 4NV0A 1ZW6A 4B47A 5I7RA 2ZB7A 3WLOA 4OX9B 5HCIA 2PKRA 1KO5A 1MIHA 1VP9A 3U0VA 3IPAA 5K3FA 3JQ6A 2VKQA 1NR5A 4QHTA 3R3UA 2C78A 1EP9A 3MLEA 4B87A 3F6BX 1WP9A 5AK0A 4FFPA 4OSOA 3MMZA 3EODA 1LKZA 4CM8A 2V7BA 3DUFB 4BQIA 2V6IA 4OJNA 1YU6A 1U3TA 1MVLA 1DB3A 2RHBA 2P6PA 3IO5A 4C7BA 2I1LA 1P61B 1R0RE 2V6MA 2QL6A 1OI7A 3LUBA 1IZ9A 2ZIGA 4D3DA 1YZKA 4K9MA 5TMEA 2IOYA 3KLPX 1FUIA 1OXSC 1E0SA 1G0OA 5F23A 3JWEA 1LH0A 1SZJG 3GJTA 1FU4A 2HLHA 1UXKA 1X13A 3ND7A 2XYPA 1E3EA 3D5TA 5HILA 1L8XA 1BHO1 2HJWA 2Q07A 4Y2XA 1XX6A 2ZUDA 4GM0A 5A5FA 1U4SA 2QUZA 2V3WA 1AGXA 4FZ3A 4HO1X 4HPWA 4QELA 3WIOA 4B35A 2XEDA 4QOIA 4I5DA 1QZUA 4QXQA 4AZ3A 3V4RA 1AS2A 2V6GA 5JANA 2PKXA 3EX7C 4TTPA 2C9MA 3LY5A 1U65A 5DNWA 4GUAA 3ZJVA 4GQBA 1NW9B 5E2IA 3GHYA 4IQ0A 2NUTA 4WGFA 4Q02A 3O8NA 5EIOA 2BHTA 2JFVA 4BNGA 1VJ0A 3WGZA 4WOCA 3STXA 1AQYA 2ODQA 4BBPA 3CY6A 4BNNA 2IHYA 4Z4FA 5FI5A 2EJBA 1GQFA 1FNNA 2FN7A 3CZ5A 3EXEA 3IKLA 1SC4A 1WCYA 3P0RA 5GZ3A 2QLNA 2G70A 4GU5A 1WCV1 2PZJA 3SFZA 4GWGA 2DAPA 4HDNB 1G16A 5CK4A 1X1EA 1E2MA 1ZD1A 2Y4NA 3OUTA 4HLUA 2R7KA 1MRZA 1ZH2A 3EF0A 3NBKA 4HQRA 2VJOA 5E6RA 5ELMA 3EVTA 1T2FA 3B3QA 1SXHA 2Y66A 3I6ZA 1GGEA 4XYGA 2PUGA 5AW3A 3VZPA 1CB0A 4AP6A 4B9EA 3KZMA 1X42A 4QPCA 3FOZA 5FPHA 5ABPA 3DFZA 5CDYA 3KQYA 4O1HA 3U56A 4TOIA 4LFCB 3KKMA 3L1HA 4M0PA 2A5GA 4BU0A 4R5MA 1BHJA 1A3CA 2OY0A 4BBJA 2WJIA 3WRVA 2EKBA 3H13A 2HWWA 5LXTF 3EASA 4UUNA 2WTBA 2J32A 1W73A 3BRCA 1XHEA 2ON6A 1A0OA 4Z0PA 2VXCA 4QPJC 1VLMA 5DYWA 2QENA 4F6LA 2OOKA 3X1YA 4Q39A 4UZSA 4ZP1A 1T2NA 4YRKA 1Z4NA 5ILOA 4C0AC 3QLUA 3CVXA 3U3JA 2Q5FA 3ZVNA 2V7VA 4HB4A 4WX2B 4IIJA 2WU0A 3MFQA 3HCEA 5EXDA 3T5TA 1KVRA 4YREA 3LDFA 4IP0A 1AO3A 3E48A 3B1JA 2D0OB 1F6DA 3B38A 1DAFA 1HUQA 1CHDA 1N1MA 4LSWA 3EC7A 1B2LA 3RAFC 3UHFA 5HOEA 3T9CA 3QV1A 3U13A 2ZJ0A 3D4BA 2A54A 1LVUA 2CDAA 5TMDA 3WQBA 4NZZA 5I7EA 3IBTA 3GCDA 3M6VA 3RUFA 2ZYHA 3E82A 3O6VA 3CEMA 5TS3A 4R83A 2MU1A 3PNSA 3NETA 2VA9A 2YV3A 3KCNA 1I36A 1E1RA 1CR4A 1M34E 4RMIA 2P30A 4JC4A 1KAEA 2DQSA 5DM0A 3EXG1 4FYYA 3SXUB 2WWWA 4LZPA 2XWJI 1ZGHA 2HXGA 2C5LA 4BZQA 2YQ5A 4RAOA 1Z4MA 3I9MA 4W1PA 1L4UA 4YPFA 3LT2A 3REFA 1N8NA 3TQTA 3MJ4A 3ZPXA 3UC9A 4MW6A 2FP4A 3I2IA 4W5WA 2YWDA 4ONEA 1JWBB 1R0CA 1B93A 2XUZA 3FDZB 3KT8A 4N6GA 4P3YA 1VKZA 4LSGA 4TTRA 2H06A 2QIPA 1H2ZA 3FWPA 2QZZA 2PX3A 5EE0A 4NJMB 4Y2GA 4AN4A 4BNJA 4JODA 1I13A 3BHNA 2YY5A 4GOOD 2AFRA 1PYGA 3CUSA 2INGX 2BV3A 2X8WA 1TC1A 3IELA 1CZNA 5E7IA 1J0DA 1TYZA 3PQ4A 4ZXFA 4XOUA 4DUYB 1I7DA 10MHA 3WO0A 2ZJZA 1Y3IA 5LIPA 4L15A 3MTBA 3GC6A 3ZQ4A 1EDDA 1J2UA 3CUKA 2Q1SA 4KK4A 2NPFA 1RTKA 1GYRA 1FLNA 2F1OA 4I5GA 4F8YA 2HREA 3HVRA 4FT4A 4FD3A 4RQAA 1N6PA 3L7AA 3B3FA 4Q7MB 3A6KA 2DKNA 2X13A 2FW7A 2J31A 3MRVA 2WT9A 1RLTA 1X0VA 5AO9A 4BDSA 2FU5C 4I4TF 5GINE 3F9IA 5B3KA 1I3OA 1E32A 1UFQA 3X2EA 3AP3A 4IOMA 4ESHA 5FTMA 4RA9A 3P19A 2XRMA 3ZCXA 1I4TD 1UK6A 1B43A 1VGVA 3PYXA 4U2FA 4CTJA 4DJJA 4ZTZB 3UJAA 4ITRC 1Q57A 3KKNA 2FLKA 4TV9B 5LP6B 4N0QA 4KIJA 5I7OA 3WL6A 3FLEA 4A1OA 2RGXA 3HXPA 3AQIA 4I7EA 1GU7A 1FVOA 2BEVA 2J9RA 1JDTA 4M1ZA 1ISPA 2A7XA 4A0GA 4E94A 2GXUA 4UBMA 1DV1A 1OUMA 1NAHA 1C80A 2CBGA 4WY2A 3IXQA 3H5TA 4KLNA 2WLSA 3RJZA 3BDVA 5JD6A 4L5JA 3ONEA 2COUA 2A0YA 1ZQ1A 2IW3A 1CK4A 3CSDA 4JBGA 5BURA 5CBKA 4EA6A 3Q11A 2W48A 1EUZA 3BKXA 2IPAB 2R47A 4ZJZA 1G5RA 1GZ6A 4DG8A 4YXFA 4HS9A 5CB4A 5ESRA 1FLDA 4LVCA 3Q8MA 1XIVA 2Q49A 3SGLA 2XZLA 1AZWA 1KYTA 1JXQA 5A7GA 4OHKA 2RGRA 2I4NA 2GXAA 2B8EA 2FYTA 3ZKWB 1LPOA 5HGXA 3MILA 4DIOA 1AJEA 1KZYC 1GILA 3QP9A 3I6IA 3VDQA 1J8YF 5MN6A 2CFIA 1M6HA 3KB8A 1ABFA 3RVBA 5IASA 2BFWA 3DA8A 3I37X 1FTQA 1HOTA 1G6KA 1ULTA 4HDSB 5AKEA 3RS9A 2C42A 2CHUA 2DPXA 3W6UA 4NU5A 3U4CA 1JI0A 2VBFA 4FCVA 5AKJA 3W6PA 1Y89A 1P60A 3G0CA 3MJVA 5I3CA 4UDXX 4S2EA 1RHUA 3BHJA 1KKUA 3LA8A 2GJ8A 4JT8A 4KAXA 1BWSA 4WE3A 5EZSA 4BFSA 5KTMA 1QRRA 1W93A 3DR3A 2Q9BA 2YW9A 4Q3BA 4YAKA 1ECCA 5A3SA 1TCVA 1GA1A 4IQGA 1VPTA 1QS0A 1XOIA 2H5EA 2ID8A 4J0JA 4RZXA 4ID3A 5FHRA 4PV7A 4ZTBA 2BSXA 3A04A 4WFIA 4XASA 4ND5A 5IC6A 4CLEA 1BWRA 2CVZA 1QXSA 2IEBA 3BA1A 3FSGD 1V9CA 4OMDA 2C99A 2HD4A 4LFAB 3DOJA 8LDHA 3RANA 1XEXB 1VJRA 2DLDA 1DKMA 3SDZA 3DNPA 1GG8A 1I80A 2C1EA 3R3HA 4XRRA 4TM8A 1D6MA 2C82A 4WLNA 3OCZA 4YJ2B 3T3HA 3UK7A 3K2EA 2VJNA 3GUHA 4O2AA 3K0BA 3L9WA 5H8WA 1N3IA 1VA4A 1Z8HA 3ANNA 3N07A 4R69A 2C96A 3K5IA 3HZOA 1XTKA 2PH3A 1CUJA 1ZRSA 3H7IA 3RVDA 3ZBPA 1THZA 3ZDFA 4RWEA 4BFCA 5BNZA 3MJSA 4QU8A 1BEZA 2PBLA 4X92A 4Q4JA 3PJDA 4DT1A 5CCEA 1OBOA 3DHYA 4ZVRA 3UHOA 2EWVA 2QTZA 3D6HA 3KO8A 4L08A 2OAQ1 4ZARA 5EY5B 2YIVX 3PWZA 4UD2A 2PRKA 3MBIA 1GPBA 2AEJA 4RJKA 1KNQA 2ADMA 2YXDA 1E0JA 1OE0A 4IXTA 5KQRA 1YRBA 1SG6A 2NVUA 1XQWA 1U28C 5AW2A 4IJMA 1DC7A 2NV0A 2R62A 2EL9A 3L7JA 4LE1A 1Z2CA 2XSZD 2IYUA 3O8DA 5BQFA 1EVEA 3U40A 1AOXA 3TJRA 3NC4A 4MUKA 3UMYA 5D8DA 2YJ5A 2VJPA 3G9UA 1NZFA 4N7JA 3WP0A 4YUYA 4G97A 2GZ2A 3KVOA 4TUYA 4GX5A 2J4CA 1QO0A 4WLVA 3KJHA 3RVOA 2H57A 4YJHA 2Q27A 1XMPA 5AKKA 4L4SA 1DKPA 3MQ2A 4QUEA 5DCUA 4MWSA 4HWPA 4RDIA 5IF3A 2Q1YA 4BKQA 5L7WA 2OQIA 4ER3A 2FZCA 4J7XA 1ZIDA 4PAQA 3RSCA 1MO2A 1RBQA 2AT1A 5DGTA 3CVJA 4TXHA 5KHAA 1DSSG 2DT5A 3F9CA 2Q2OA 5BQPA 1GY8A 4NYMR 5JSYA 1SVOA 4HWSA 4FLMA 2RHGB 2X1VA 3E5HA 3VO1A 1SCIA 2YWHA 3L7OA 5A9SB 2OQ2A 2J3DA 2QPOA 3A6ZA 2XAAA 4EZIA 5LL6P 1NBME 4X54A 4CFSA 1TQ6A 5DJ5A 3RU3A 1A5TA 2Y6VA 1NPYA 1E9DA 4UXHA 2Q6OA 1BXZA 2AN3A 4NH0A 4OXRA 4CQLA 5JTTA 3R9XB 2X2EA 2PIDA 4GOLD 5B1YA 2N42A 4TSRA 1T8UA 1YVEI 1Z6ZA 2V4ZA 2VYCA 3NWEA 4PHCA 2PUCA 1TVKB 1P31A 4HAYA 4LYGA 1VHQA 5G0TA 1TMYA 3SBOA 3SKYA 3TUJC 3ZK8A 1LLQA 1V9LA 3ZCTA 3QEMA 3IUEA 1DBSA 2F59A 1L9XA 2JZCA 5ALGA 3F6CA 1ZL2A 2R00A 5FPQA 2HO5A 2R3SA 1KY3A 2WFLA 4N12A 4C6HA 4RO0A 4G09A 2BOVA 1TGYA 2GOYA 4KU4A 1QIFA 3ZWCA 3OF5A 2G72A 1URPA 3JPYA 1V6CA 2DBQA 3GPCA 5DNVA 5TQ2A 1EDBA 1W0KA 4ZEXA 2XYHA 2W2LD 2PQ2A 1RSZA 2GEFA 3WLSA 3ND8A 4LG1A 1K89A 1T6XA 4WHMA 1K0UA 4BE7B 3JWHA 3B9BA 1A95A 3E3MA 3BXZA 4INZA 4UCXA 1H2AS 3O38A 4WZZA 2VZ8A 4ZAZA 3TVTA 1YZLA 2FLVA 1WEKA 3Q7PA 4H18A 4UE6A 3FYUB 2X3FA 3ROMA 4CKEA 1KR5A 2GTHA 4DLSA 3IAFA 3D3EA 2J59A 3R7WB 5K01A 2ZYSA 4LYAA 2BGNA 4NJEA 3ZLUA 4HGQA 4GPAA 4OQPA 4D9BA 1E4OA 2C3PA 2IHUA 5ALQA 1AMNA 3L41A 4YP1A 3UWPA 1ZD3A 3WP1B 3ABZA 3QV2A 5DOVA 1ZIYA 3T7DA 1SU8A 1N6NA 1HK7A 3GLTA 5IK2D 1V43A 5TY0A 1Y8CA 2G83A 2G7ZA 2GHQA 2MMGA 2OHIA 1HE2A 1GV0A 3GFPA 4QTZA 4A82A 4L5YA 1OHHA 1Y3HA 1A98A 1LK7A 2PSJA 4IJWA 2JCSA 1CQJA 2CE7A 1E9BA 3IMGA 2NU6A 4A8HA 1W30A 2EQ5A 5MGBA 4L4RA 4MUMA 3KT6A 4ZCMA 3ROKA 4R0MA 1XZMA 1ONBA 1CD5A 1K2VN 1WG8A 2SBTA 3QPVA 1VJTA 2YIDA 4HC4A 3TLZA 2O8FA 1RBYA 1WKCA 3JQBC 3BD8A 3KTAA 1NF9A 3F7TA 2H1OA 2J9GA 3IIIA 4PLGA 1G0NA 5JDIC 3FSRA 2CJPA 4ERXA 3QJ5A 2O2SA 1LDEA 1G3QA 3TZBA 1IXKA 4N3AA 1J1IA 2CNWA 2Q29A 4F8EA 1N2HA 4KJXA 3LNCA 3VJLA 3RAJA 1EIZA 1Q92A 4I1UA 3DOUA 3QUBA 4ZGWA 4TYYA 4GXNA 1IZ0A 1K1EA 5I4CA 2QRKA 5EJIA 1N32B 1T1EA 1V16A 4H2DA 4DCVA 4CLHA 4TQ9A 3TN7A 5UKDA 4RQUA 1X6VA 3Q2IA 4PYMA 4TMWA 3TRHA 4RTOA 1EJBA 4KI0A 2Q0QA 3RYFB 1JIVA 2CUZA 2NXCA 2O05A 3ET5A 4H08A 4HH1A 4CR7A 1H9BA 4LRTB 4FYKA 3UUEA 1NQUA 3ROGA 2RGAA 3U2QA 4URVR 2PWAA 1XDBA 4Q48A 3TNJA 4PG8A 5FCDA 3EISA 4OK3A 1XZCA 3BGWA 4YX9A 3Q40A 1ADCA 1TEZA 5IYZF 1XD2A 1I14A 1KZGB 2I65A 3BX1A 4AJ9A 4L0CA 4NF2A 1NE7A 2JLYA 1RRMA 5KNCH 3AVWA 2OPBA 2JBAB 1B1CA 1AB6A 2B3DA 1XMXA 3AI3A 2FSVA 3D5QA 4F4HA 2Y0EA 2YJZA 1IN8A 1SRQA 3EG5A 4X5OA 5IPFA 1XCMA 4MV4A 4JT2A 3GJ3A 1TQ8A 2J1LA 1BJRE 2Y1EA 3F3KA 3HFJA 2YVKA 3R1IA 1GNRA 1V4BA 4J75A 4G4GA 4O5AA 4JYAB 1OFIA 5TE9A 1RKVA 1AUVA 4PRYA 4H6VA 1QGDA 1YB4A 4UE2A 3GF4A 1QO9A 5J59A 2WA2A 1I4OA 2FUEA 4O6VA 4FINA 3KSUA 1QCCA 2X0JA 5IANA 3W5AA 2X2FA 5HK9A 2NU9A 1KYWA 2PYIA 2VXBA 3FYTA 3OQJA 2HN9A 2E4VA 2A9OA 1FQKA 3A1VA 4JYPA 4LE2A 4MS4B 5L95A 1F8FA 5EIWA 1QF6A 5K3BA 3ITDA 3KEOA 3MWDB 4ZO9A 1NF3A 2DFPA 3REQB 2X5XA 4NS1A 5DWDA 5B1HA 4RACA 4DARA 5AUPB 2BCGY 3REGA 3AVVA 1YB5A 2WUWE 3A1CA 4XZ3A 1BOFA 1EFKA 2XMGA 4FDUA 4BNTA 1QO7A 4D6XA 3LYHA 1V2GA 5BR7A 2W42A 2Z8YA 4AJPA 1BEUB 1YR8A 2FN3A 3O1LA 2E9SA 2PU5A 1HH4A 2HDOA 1XXLA 4FJ1A 1V4VA 5KQLA 2GPBA 3FYSA 3KC2A 1PWZA 3CH4B 3LUGA 1XPOA 4Y1EA 3ISVA 2L42A 3WXMA 2OYSA 2Q3MA 3WKBA 4B7XA 3LQQA 5FTJA 3WBKA 1DC6A 1CUUA 1N7HA 2A2ZA 2ZFUA 3CYFA 1YVUA 3DMTA 4BV3A 4ZT5A 5J40A 2YV5A 5BSGA 4JKYA 3W6NA 1TX4B 1TCBA 2X2OA 3KOYA 1ZNQO 1WMSA 1QMPA 2ONKA 1CIVA 3RUCA 2BKEA 4N3BA 5AHRA 2ONJA 4AG3A 4B0PA 3IVAA 2PV7A 1NGSA 1P1KA 3G89A 4DLRA 3FGZA 4AFNA 2VBIA 1EP2B 1N0VC 1NZJA 2EL7A 3O8QB 1E2FA 3OAAD 4XTRA 1UBRS 5DKFA 1VM6A 5DEIA 4DV3B 2PN1A 3NV7A 5A3QA 2FSSA 2JVIA 2ZU0C 4QOHA 5E38A 1DP4A 1CRLA 3L8MA 2YASA 1N5OX 5BSRA 1S2GA 5D7NA 4EK9A 4QKQA 2UVPB 3H19A 1B6RA 3ASYA 4MB6A 1GU1A 2BTQA 4UNNA 5TARA 5FWYB 4AJEA 3IAS1 1ZJWA 5C1DA 2CLDX 2AKAB 4CKWA 2PPLA 4ZVQA 2B4RO 1OX5A 5K0JA 1YR2A 4QQRA 3DBLB 3FNBA 5JZVA 4J9VA 3KOUA 1SCUB 2IDJA 2ZTSA 2TMGA 3LCVB 4I4IA 4E5MA 3SR0A 3BMCA 1EHIA 1J8VA 2CVHA 1P9LA 3L79A 3TIIA 3UQZA 5GONB 3G2PA 1XL0A 1DT5A 4BMCA 2QG6A 1M2FA 1ZX1A 1TM2A 2AJTA 1XLWA 4P7KA 3NOOA 3SJBA 2IF0A 3WLPA 2D1QA 4Z53A 4I55A 1PEYA 3FTPA 4YQEA 1FSPA 5HPYB 2WABA 3HU2A 3HKDB 2VTBB 5HJ7A 5H68A 1P0PA 1X15A 1II9A 1R9JA 5DE3A 2CXPA 3U4IA 3RRYA 3NWOA 1PN3A 1VMAA 4Y9SA 5EMKA 3RHZA 5BN3A 4JP5A 2MTBA 2FW6A 4X8LA 3O90A 4PZYA 3K1TA 4BO2A 2ZBUA 3ZWBA 3KJNA 5CB6A 2QYOA 1KPGA 5B7GA 5KPJA 3LRTA 1YVRA 1N0IA 1SELA 1T3GA 2QZSA 3L82B 3DEFA 4IIYA 5SY9A 4DABA 5KQSA 4OTZA 1XZLA 1S0UA 2EW8A 3BGVA 4C01A 1EFLA 1JFFB 4OKNA 1PLJA 5E9WA 1JTFA 5FI1B 1MTZA 1Q17A 2BBTA 1XF1A 1W76A 2FKAA 2H1SA 3FB1A 3MF4A 4LOHA 4X84A 3SI7A 6Q21A 3H05A 3CKYA 1E3DA 2EBUA 3PC6A 4EFNA 3KQNA 3IP1A 6ABPA 2VAWA 1E2JA 2WHEA 1U8AA 3H5IA 3V4OA 5MHTA 2ZI4A 3I4CA 3ZLBA 1Y6ZA 3UJBA 4KITB 2PD3A 3KB1A 3TKAA 4ETIA 1D7OA 1F14A 1OASA 1D2GA 1E2DA 3DOCA 4PPYA 5DN9A 1C30B 3KL4A 1O1YA 4P31A 1EXMA 4POAA 5AKHA 3ESCA 3BWDD 1C0KA 1DL5A 3LT0A 4FU0A 3BMNB 2FMFA 3P2JA 4KLAA 1NUTA 4OKIA 4QECA 2W70A 1VL2A 4KIGA 1Y9ZA 2DHEA 3LZCA 1EE9A 3Q9UA 4A4DA 4KR7A 1Z26A 4H16A 2BGLA 3C3YA 5DOZA 1RPJA 5SV2A 2O8DB 5HHTA 3VPCA 1UPCA 2PQMA 3BH6A 1ESEA 4ZPJA 2XF8A 2FWPA 421PA 1FUEA 3OEHA 3V7YA 2LKDA 4BLRA 3URMA 3NC1C 4C6RA 3D6JA 1T4MA 4OI2A 5AK4A 1N75A 3UT0A 2OKGA 5IWCA 1UCFA 3KOXA 2QB5A 2EQAA 5FLYA 3E3NA 1KDTA 2OCYC 1F8XA 1HZZC 1Q0QA 4I4CA 4MWTA 4OQEA 4UM8B 5G4KA 4L2IA 4S24A 4R71A 1QKKA 2DWCA 2NTNA 1EK2A 3D6TB 1IWOA 2W9XA 4J0IA 4DLPA 5CDUA 3K2QA 1RHMA 1XZFA 2YJ4A 2Q99A 1VHJA 3VGJA 4D3FA 5E3JA 4E6EA 2PZGA 2XB9A 3D8UA 3EVZA 2R84A 1W49A 2P27A 4QC2A 5DNEA 2CV1A 2R2GA 2ZRNA 3KXIA 4BTEA 4UVDA 3IA7A 1YL7A 4D44A 2IECA 1GCGA 1E6EA 3RYTC 3B1KA 3CEPB 5C5DA 5IULC 1UFRA 2G7MC 3PD0A 3V1UA 1F7VA 4X91A 2ZUWA 4LRUA 4FMBB 5ICEA 1L5ZA 2B8NA 3DKPA 3PEYA 3ZGVA 4BNDB 2B5OA 3DW1X 3FIJA 2VNKA 3GG2A 5BYAA 3C70A 3S2ZA 1CUCA 3CLVA 4URZR 5EJFA 5KTRA 2NM0A 3HRIA 2XNCA 1KO4A 2PL5A 4JD5A 2C57A 2PFKA 2QQ0A 3AOEC 4Y1FA 1BHSA 1NVKA 1AHIA 4LCJA 4P80A 4PAOA 2ZT5A 5JPDA 5JVDA 2JJYA 3Q8XB 2ST1A 4OA8A 3DMRA 4J03A 3SS7X 5JALA 5GJBA 3PX2A 2QRQA 3UK6A 1WLYA 1H94A 3VR2D 4RULA 1RKQA 3QHAA 2QGZA 3NUGA 5LR6A 3D3WB 3P5SA 4NYJQ 3DZKA 4OOFA 1JBQA 2IU3A 2OBBA 2YOFA 4RZSA 5FOVA 2ZSKA 2XCOA 5IBCA 2HA6A 5IS2A 3DL7A 1Z8FA 3GVHA 1GZ3A 3IDQA 5FFFA 5CLFA 3QU7A 1PYDA 2X0NA 1ISRA 3GRPA 4MKGA 1BE8A 4OGGA 2AOUA 3SCZA 4B17A 4IS2A 4HLNA 1A9RA 1OI3A 3AHEA 3M8KA 1RAIA 1TZJA 3PTLA 4BN0A 5C9ZA 1E1YA 3OU2A 4MOWA 5KDDA 2ZT6A 3FY4A 1SXIA 4O4LB 4R1QA 2OM6A 3VH1A 1FYXA 2Q4TA 3SIWA 4S1WA 2I9KA 3FZEA 3N7UA 2CJFA 1X7ZB 4W63A 4UU7A 4BO5A 5T6MA 4OHRA 1X19A 5IXJA 2Q9UA 3SSNA 3TIGA 3ZCPA 4QXPA 1SD1A 2OCDA 1WHSA 1FRNA 3TMYA 4TLMB 2R7LA 4JZKA 2NXNA 4P4TA 1W4LA 2WJJA 1OF1A 5ES4B 4JYMA 1K5HA 2HCTA 1GWNA 1GVHA 3I5UA 2LBPA 2X9LA 3ACBA 3WA6A 1AD2A 2LV8A 3LE8A 1ZD5A 2OGWA 2ZIZA 2ZYDA 4MB2A 4TRMA 4DNXA 1V1RB 5JT1A 3UIEA 4XQ0A 3WISA 5FWXB 3DGFC 4YQZA 2VRCD 4GW3A 3J81A 2FRXA 5FR2A 3U26A 1NOJA 3VGPA 2AOXA 1QZ3A 1U2GC 4OU4A 3JWIA 2E18A 2Q0XA 5BSEA 1ZD9A 3GFSA 1ZJ5A 3QUTA 4NCNA 1QDLB 5ITWA 1OH8A 5TLSA 3JU3A 3NANA 1Z5ZA 3RSLA 4ISCA 3WYNA 3OZBA 4ACAA 1F2TA 1FFBA 2YMQA 4F9FA 1QTNA 4GP9A 2F43A 2J41A 1XZDA 1K6IA 3SQNA 4C0HA 4PM4A 4DV1B 1JDUA 1GUBA 1MENA 1YS4A 3ZV3A 2I5PO 4N7MA 5JECA 3VSEA 2DSTA 1QE5A 1ZKDA 4Q19A 4YT5A 4DILA 1XNQB 3FNQA 4UHFA 1EESA 2P91A 4EQ6A 4YHHB 3USZA 3L7CA 4TVKA 2HM7A 2WICA 3ELYA 3ETJA 3FH0A 2RETA 3RWMB 3FCSB 4PX2A 3WWPA 3CFHL 2X6QA 4C2BA 2HLNA 5DNYB 4X1KA 2CFSA 2NNLD 2TMKA 3Q72A 4Q82A 1X94A 3DC2A 5F73A 2Z2IA 3EZLA 4U4AA 1F8GA 2B0JA 2I6QA 3EXHC 3IEPA 1EUDB 2Q5JA 3LYAA 2MCFA 4AN0A 3DYBA 3N05A 4PGGA 3S8MA 5I9NA 1V11A 4MARA 1QIEA 3WHLA 2ZWAA 4Y2RA 3ELWA 4UTZA 5EPEA 1C7IA 4UTNA 1R4MA 2V55B 3ORHA 5DVZA 4XB2A 4JJFA 3I2JA 4AD8A 3BUSA 1U9JA 2PZLA 1ZSNA 3JYPA 2VNJA 5DGIA 4IIXA 3QIAA 4OGFA 1DMSA 3T9FA 4R7GA 4AKEA 1JVSA 1MC8A 2XGOA 4MRAA 2FW0A 1U3GA 4RV9A 3RU9A 4PBTA 5HKKD 3NDPA 2WM2A 4MPTA 1UOPA 4B3MB 1KRXA 3HP1A 1LC3A 3MTAA 5EWMB 3I09A 1YQTA 1R0KA 3E8SA 1ZESA 2WJHA 3CLUC 5HMLA 2FZLA 4NV1A 4YDQA 4HDQB 4GPEA 2P1RA 1CP2A 1RWOA 1PTJC 2CWDA 2Q7XA 3PFBA 2WI8A 3W5VA 4HWRA 1K68A 2AR9A 3QW4B 3QPCA 1POWA 3MRTA 4IIHA 4ZAGA 4OXQA 2PO7A 1WU7A 4U9HS 1V6AA 1JV2B 4AZVA 2QU7A 4B3CA 4XQEA 1IBLB 1M34B 3ME5A 4D1YA 3PDIA 2I6FA 4R9RA 4HFNA 1XCBA 4Y9TA 2C3OA 1T3TA 3A3PA 5JCJD 4DVGA 1NJFA 1BQ3A 5IKXA 1J8FA 5JAQA 2ZI7A 2GQ0A 2WYIA 4UCWA 3R8CA 2JJMA 1WXDA 1YS2X 2OBMA 3L4SO 5FUBA 4HSEA 5FWNA 1GXSA 1Z4JA 2KWIA 3L4BC 5EI5A 2X9QA 4H3VA 1PJBA 3SQWA 3SVZA 3IVGA 3B8EA 5AI0A 1ISJA 4RXMA 2GTIA 4YRQA 1BA3A 1U0LA 2WHPA 3G2HA 3K0CA 3HS3A 3OICA 3TSCA 5BVGA 1QRUA 1DZ3A 1M2NA 5EKTA 2AWNA 3QFSA 4XM0A 1YIDA 4DKJA 3R5HA 5CJJA 1GGFA 1NIJA 1XALA 2H0AA 2XWQA 1ZFNA 2FLWA 3GZNA 5AJXA 1L7MA 2HJVA 3EAQA 3WBBA 4TVSA 3PSHA 4JSRA 1CHNA 4KWCA 5HZMA 3D6FA 3LTEA 2Y0BA 3O0DA 2YRXA 3GA5A 4KODA 1E2EA 3HVHA 4KX3A 3DUWA 3VTFA 3WB9A 1NONA 4Z4EA 2OWDA 1RXUA 4WQMA 4PF1A 5BYBA 3FTDA 3H2YA 2J85A 1G7RA 1HEUA 3VJKA 5G41A 1Z39A 1YA8A 3FVRA 3OFJA 4RJIA 1B2RA 4ZREA 2ZSIA 3IBYA 2G9NA 3WIVA 2CZGA 3GU3A 3L8CA 2O5EA 2QNRA 4UTOA 3SX0A 4E3WA 3PC7A 3SHQA 3KJEA 2AB0A 1AKWA 1UBLS 4TSFA 5K0EA 3AFNA 1T6NA 4C3UA 2IBTA 3ELUA 5DW0A 1K3FA 1CEQA 1W25A 2OTCA 3P2EA 5AM5A 4H1WA 1RP7A 2QMUA 2WSSA 1XKLA 1IONA 3AXSA 3D6MA 3Q85A 4MGEA 5AI9A 5DO9A 1DDOA 1YTLA 4HAOA 3ZWDA 1E9SA 1QYXA 1YR6A 3S28A 4D80A 5GY7A 5CITA 4RPLA 2JJ2A 3EZ7A 3PRKE 3W9BA 3K9QO 4BXOA 1C7FA 1T8WA 1FJXA 1YA4A 3ISTA 3NTRA 2WP8J 2XD9A 3H04A 2GAOA 3CH7A 3HU5A 3S2GA 2F1JA 1QLHA 3OPQA 4KDCA 3VI3B 2FZWA 4NFYA 1TKBA 4CODB 3QVOA 3BRWA 3NTOA 3ND5A 2XKAA 4MAFA 4XGRA 5IXYA 1J09A 1A9QA 1PWYE 3IT2A 3K1ZA 1WLSA 4CLOB 2JJ1A 4WNAB 1UEJA 4Y2YA 1OCEA 4RHTA 1ODIA 1XTJA 4RYDA 2XXJA 1N92A 4FFDA 5J1TB 2W2KA 4XXHA 1QRSA 4WXYB 3FZGA 1PZMA 3QVGB 2A67A 2CF6A 3CXRA 3E7PA 5IXSA 1P1RA 3CNLA 3NHPA 4WKBA 3PQDA 5TR9A 1V8OA 3H4VA 3EEBA 2DUMA 1MMFB 2EFDB 3NOQA 4PO8A 3FVTA 3HH8A 3TI9A 3U0BA 2VUHB 3DLPX 4RTJA 2DBYA 2X9NA 3EC1A 2V6FA 2W71A 2WAYA 2ZLBA 1XCJA 3LHIA 3T35A 4AN1A 1XB2A 2HPVA 2Y1OA 4BP9A 5JNVA 1FE8A 3LF2A 1P7YA 4C7OA 1R5NA 1ZN2A 3NC0C 1XWFA 1UJNA 2B30A 3HVIA 3OH8A 2H7XA 4LJ9A 2KBFA 2GB4A 4MPJA 2H4WA 3IDZA 4ZYZA 5KPDA 1WXGA 2RC6A 1JTVA 2BBWA 3B36A 4X94A 4URFA 4OM8A 3ADBA 3Q7IA 3DXYA 3KHTA 3IQFA 4MCIA 2FI1A 4KJZA 5DMHA 4CG0A 1SD2A 2RH9B 1ZD2P 2PSHA 3DV9A 1P1HA 1P4JA 2XLBA 4ZHQA 3I5XA 5JHHB 4MWBA 3KEQA 1JG2A 2C03A 4B3RB 4NNJA 3E23A 3HY4A 3RIGA 5AUOB 2WD7A 4D99A 2QDKA 2YHIA 4Q3DA 5KSOA 5DN6D 5REQB 1NZDA 2Q4RA 2X5OA 3AIMA 1OZFA 1ESMA 1GZ4A 2EVWX 2UZ1A 3PNVA 4YAIA 5DSXA 4OA5A 2MIIA 3KIPA 3RGGA 4RXTA 1FXUA 1VDMA 5D6NA 1TAGA 2ZP1A 2EZ8A 4LZOA 4UVIA 2FPOA 2Z9BA 1MNQA 1I7NA 1NC3A 1YI1A 3BIFA 4PSAA 1SB8A 4TLAA 5ALHA 3WJAA 5KNBD 4PPQA 4CF3A 5KWEA 2EZUA 4KDFA 1F38A 1RRFA 2BZ1A 2P2DA 3H2JA 4GOND 3R3VA 4I9NA 1TC2A 3WL5A 2ROQA 4AURA 2QYTA 3DLBA 3KR2A 4OREX 3V4LA 4Q1DA 4J1TA 4MJ3A 3LCJA 2F8MA 3OC6A 5J58A 2D2EA 2J3LA 3LDUA 3NS7A 3BT7A 5I8PA 1TCUA 4EJMA 3IOEA 2VQ3A 1QNLA 4LYDA 2GEJA 1PZFA 2VHJA 3MTDA 5MDHA 1X86B 1ATZA 2XADA 1Q16A 2QR3A 1KIMA 1CS0A 1JHMA 3LY7A 3ZIUA 3OZFA 2W8BB 3T61A 2PXHA 4FIZA 4RHFA 2JFFA 3TBKA 4D0RA 1MFZA 3AFGA 3U6KA 3QWHA 4P7GA 1YL5A 4LGMA 4UJ3A 3UAVA 1Z88A 5F64A 2X1MA 2PUFA 2R8YA 1BSVA 4BVBA 1Z35A 1T36B 1TLFA 3WMGA 4E51A 2FPSA 4GC5A 2CCKA 1CY2A 4UFPA 3ZEIA 3ZVMA 1E20A 3VSAA 3OHMA 2ZSAA 2UKDA 4OQDA 4CM9D 1HL3A 1VE1A 5CJ2A 1TIBA 4FR2A 3L8DA 1Y1QA 5TGZA 3W2GA 1AQUA 2R79A 2WLTA 3IB6A 4IKOA 3HL6A 2FHPA 3QPDA 4G6ZA 3VRHA 4OQMA 3IAS6 1C3JA 4P81A 5K6AC 1KEZA 1XZJA 2DQKA 4AYWA 3OBIA 1I8TA 4E15A 1JYFA 1NQVA 2FRVA 1VDZA 3ILSA 3THXA 5ALWA 1HT1E 3LM8A 5DBGA 5J4HA 3I9LA 2EFJA 3JYNA 1II8A 5C4GB 4ALKA 1DFHA 2BY4A 2QRUA 1UXHA 4MYTA 2VJKA 2GEDA 1G8HA 1U11A 2E48A 2EQBA 4G9BA 3T7IA 4RGVA 5K8IA 1SUAA 4ALJA 1RWXA 2OL4A 2VF8A 1Z6PA 5BN5B 1AHNA 2BDUA 3JAKB 4IXJA 3OE5A 2WOJA 4QARA 1U3VA 4GXRA 4XB1A 3TDNA 2G16A 5DT2A 2FPRA 3P2YA 3ZNOA 3N9IA 1VG8A 1IYZA 1U3WA 2ADFA 5DCWA 1VXRA 2C94A 1WXXA 1O8BA 2O2HA 1A97A 5JTUA 3CV3A 3JSXA 4LNUA 4M99A 2JGNA 4L6AA 3DDWA 2BAGA 1NMQA 3AF3A 4K8OA 3VR5A 4F3NA 1V1MA 2QRLA 2II6A 3BWXA 1CUZA 1RXVA 4EI9A 3DJFA 1MB2A 3F4LA 5PNTA 4E5VA 1ND5A 4U2EA 3CO0S 4QASA 3A0RB 3T95A 1WMEA 2EHJA 2JIOA 2XWBF 3FROA 4MR9A 4RK7A 1QFXA 3A26A 3W90A 5LYJB 4NCIA 3KTOA 1Q7CA 2K7FA 1XVIA 1QYRA 4B4UA 4C9BA 4Z1OA 2OHFA 1F9AA 3BMOB 4JB8A 4PIMA 3TLXA 4BBAA 3A7DA 5H16A 1Z47A 2VDNB 1G1AA 3FGOA 3I2KA 3LY9A 3PFWO 2CVQA 3FUVA 3QKTA 2ZPTX 1LVHA 3FNIA 3PR1A 4M0FA 1CZKA 1PBTA 4QJ5A 4P3XA 1JQKA 2I22A 1X1TA 1ISSA 4WPGA 4KVFA 4Q7LA 4TQAA 3TAUA 2IOHA 4DSUA 2REXB 2FFHA 4UTXA 5ED0A 1A8HA 1X80A 2P78A 3PZBA 4H3KB 5CH8A 1XNGA 3P0FA 4UBNA 4GR4A 4EEKA 3ZV5A 3FHLA 4AQYB 2PCLA 4HVAA 2D13A 3K70C 1E6MA 2OKCA 3FJOA 2XCRB 3DLCA 4BMXA 1TVEA 3WGMA 5DBIA 2V7UA 4QVKA 4UBLA 1KIFA 3LGSA 3EDMA 3GGSA 3A6LA 2ZXEA 1ZMRA 2JGDB 1KFBB 3Q12A 2OVFA 5J4YA 3H1EA 3LDGA 3OJWA 3ZXXA 2IE8A 4ZOLB 2E4UA 3ABQB 1M2JA 4ZAXA 4JP1A 1XMOB 2C8VA 1QVAA 2WUFA 4P3KA 5KVVA 3G2IA 2JCXA 3ENQA 1UKEA 1PGQA 2ODEA 1DTWA 2VDOB 3BULA 5A6VA 4ZVNA 3IB3A 1I5RA 4IH4A 4DADA 4H27A 2B2XA 3W8EA 5EG5A 1ANKA 4Z51A 2C5BA 1ZM4A 2JI8A 3GGPA 2QTRA 1BH2A 2IYSA 3O7WA 4BNFA 1I0LA 3O03A 1QV7A 1WUYA 2I0FA 1NQOA 2H1VA 2MSNA 2WFAA 4IINA 1BCSA 1KXJA 4UUPA 3PEEA 4I81A 3STHA 3L8GA 1BVUA 1UJMA 2EZ9A 3O1JC 4AW9A 3OLQA 1XN1A 3PRJA 1Z2DA 1I7LA 2I6SA 3GDWA 4RYLA 4S0ZA 1PVOA 3IP9A 4M7PA 2HO4A 2TS1A 1RJDA 4RL4A 4BVKA 2FZ5A 1GPDG 2GAFA 1T1SA 4NENA 3GG9A 5FQOA 4TZ6A 4KGVA 2XQJA 2R8EA 2CMHA 3CCCA 4R31A 5JRZA 2GN9A 2VAVA 3IOBA 2VPQA 4LWPA 3GGOA 3LPAA 4GYJA 1JU3A 4E2ZA 2XYGA 1WU8A 2IVFA 3ABRB 1CJSA 5D7BA 4GI5A 3UKDA 4FEEA 1R1DA 1S3FA 4IUBS 2AJBA 1ENPA 1KYIA 2WJYA 3EGIA 4NDZA 1JJAA 5F52A 5K99A 4IMRA 1G66A 2UUPA 2O7VA 2PWBA 1HMPA 1M0TA 1XD8A 4OHCA 3S2EA 1GP2A 1BDMA 3RBVA 1GL7A 1Y8QA 3TUIC 2I80A 2QRNA 2GMWA 1IH8A 2HCJB 1YDEA 2PX2A 2YBDA 4NYJR 1ZUWA 4FK8A 1FNSA 1SPBS 4KO3S 2DPHA 4BB6A 5A9SA 4CIWA 5FYQA 3RU7A 3OO1A 1ZSYA 1U8XX 3P0HA 3KSDO 2FG5A 2XHZA 4CV0A 1YI8A 3TX6A 2EBHX 3MUNA 2I8CA 4YALA 4RTQA 1GAWA 1XCGB 1AQNA 5LQUA 4AMVA 4LA4A 1LDBA 3PVZA 2CL6X 4I1SA 3ZHSA 4F3YA 5MFZA 4H6XA 5LYYA 4W5TA 1XMIA 4QO7A 3QBEA 4CIDA 1E4VA 2AD5A 2RHOA 3B5EA 3JTMA 3ZHVA 2DTXA 4CM6A 1RWMA 3FSEA 4YTEA 3VTAA 4ADSG 4LXIA 1U9IC 1MB0A 4GLFA 4V39A 1BS1A 1W75A 2C3UA 3QYAA 5B4UA 3CFFL 1HGXA 2NUAA 1AV6A 1JS1X 2VTEA 2IHVA 3T1NA 3IVRA 1PR6A 1R0LA 3FRIA 3NNSA 5GP1A 4AMBA 4ZK6A 4TYQA 1EAMA 1E5QA 4JL6A 1VFNA 5KREA 1DAEA 2GVNA 1L8OA 1VJDA 2ZVJA 5DZSA 2SECE 4ENSA 1QK4A 4D92A 3QSGA 3GRFA 3IPYA 1ZGCA 2AV6A 1EVYA 1JFSA 1AH2A 4CETA 2GPWA 5LN1A 4HVLA 4KQEA 3LVRE 4RZ3A 5AXBA 2V6JA 3BYZA 3GA0A 1C4OA 2VDUE 3HN6A 5EXCA 4QYIA 4CIAA 1JEEA 2GKGA 4FZJA 4MW0A 4AB1A 3H8WA 1K7FB 3N2NA 3RJ9A 1HDXA 3HZHA 1L0BA 4PNPA 2W4QA 3Q15C 5LLTA 2G4CA 3D7MA 4NAUA 1KOJA 1SMKA 1QWOA 4EENA 4X85A 1RWNA 1VL5A 4FUQA 1J33A 4XFKA 1JR4A 1PWEA 2H2IA 4W1RA 1JEQB 2EGHA 3K6RA 5IN4A 1HX7A 3HYLA 4HSGA 3ESRA 1ZGZA 2LCFA 2OCIA 1NBMD 1YE5A 4EBBA 1MO3A 2EYQA 4KYTA 5FUQA 5J2UA 4EA9A 4I3GA 1NY5A 5LFAA 1BU5A 1L4KA 2P90A 3ICCA 2VJLA 3GJ4A 5CXSA 5E2BA 1EWVA 3MK31 3GELA 2AK2A 3RAGA 3THSA 2P9CA 3MWKA 1XP5A 3C4JA 2Q4OA 5A71A 2QNBA 3X2FA 3WLQA 4NU8X 4WKCA 1C4WA 4KTVE 1O9BA 1BMFA 3BDAA 5JS6A 1XZGA 2IPLA 4B5KA 5KOIA 3PTZA 1P9RA 1SU4A 3TVYA 2AYZA 5CIYA 5AJZA 4BQOA 2WZQA 2VI5A 2GBLA 1Z06A 1YH3A 1OWMA 1G98A 4GHWA 4WDQA 3G8CA 1XTUA 4M1WA 1GPKA 3HLKA 1MR3F 3MWLA 4LIPD 4QYTA 2YWRA 4JA2A 4JLAA 1J2TA 3ITEA 1RRCA 1E9FA 3DVAB 3P9NA 4IPTA 3NATA 4TTJA 2F48A 4PNEA 3KS9A 4AKHA 2IQ5A 2GO7A 4WA7A 4KN9S 2Q5OA 2NVOA 2CNKA 2XBLA 4HNQA 3UUGA 2EATA 4ZVTA 1L5HB 3HJAA 1W9MA 1IPEA 1NHWA 1SUEA 5B5SA 1QF7A 2VQFB 3OY2A 4ZYTA 3MTGA 1NXSA 1VCIA 1U98A 1TE2A 1X8XA 1ZLYA 2DHQA 4KEAA 3JASA 1XAGA 4BO3A 3CURA 4IWNA 1Q1QA 2P2SA 1UOQA 2YL2A 3STUA 1WZNA 1FMFA 3DO5A 1FTYA 3HSYA 4PC6A 4BRUA 1LWOA 3EH2A 1MABA 1U0HC 5F4ZA 4EW6A 4RETA 1Y9DA 4KFRA 1LLFA 2PKQP 4LCEA 2IS2A 1ZZEA 2GBFA 5E7QA 1UDAA 4RORA 2D2FA 3PPXA 1SM4A 5HOQA 1YS9A 1BZYA 3QNMA 2WTXA 2RH5A 4OQ4A 5DTMA 3SZUA 4B7CA 1PZXA 4S04A 4CMAA 4EPXA 3E7DA 3OG9A 3IULA 3A3OA 1EEHA 1G3UA 3K0HA 3PLAE 2FGJA 4LF5B 3PEVA 2P7HA 2J5BA 3G23A 3AFHA 1M1ZA 4TKUB 4REQB 2QDXA 1HNXB 2A84A 2FUCA 3VNVA 5TPWA 5TXGA 2BFEB 4EY4A 1SZDA 3FZQA 3OFVA 1Z0ZA 2OSVA 5D85A 3H5AA 2CXXA 2EHDA 2PPVA 3KWMA 3H5OA 1Y7PA 4JBNA 1QH8A 4F3RA 5KOJA 5H3HA 3FVWA 4XWKA 1XT6A 1RZVA 4PYLA 1DKLA 1TK2A 3PEFA 1W6UA 1CNEA 1JDZA 3JAWB 3KQOA 5IWAB 3AR6A 2PUWA 3ED1A 3MCUA 2AE2A 1XK6A 3DBIA 5JNRA 3ORYA 3DE7X 5SICE 3I9NA 1B0ZA 1OILA 2FMUA 2KE5A 3ZTYA 3JQCA 3PYMA 5FBZA 3QEAZ 1B3RA 2IYNA 3RJMA 1CXZA 1MC4A 1Z5VA 3BG5A 2FPLA 2OHHA 1XELA 2ZATA 3BM5A 1UXGA 1DS6A 3NLLA 3NI2A 5AJHA 2H08A 3HN7A 4FS8A 3DUFA 4GLJA 1MAHA 1P8JA 1ZIOA 3C5CA 3G7NA 3NHFA 4MMYB 2PU7A 1ID1A 5B2EA 2IHTA 4NBUA 4RCZA 3PUJA 4KXWA 3G0GA 3W4JA 1DAIA 3D02A 4EWLA 4OATA 3L06A 2VYQA 4QEKA 2E87A 4Q3KA 1VPDA 4JB3A 3V1YA 3PC8C