4EFKA

Pantothenate synthetase in complex with n,n-dimethylthiophene-3-sulfonamide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
289
structure length
280
Chain Sequence
b'PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Integrated biophysical approach to fragment screening and validation for fragment-based lead discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 91
structure length 280
sequence length 289
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4efkA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4efkA01
1GZUA 1N2GA 2PZAA 2ZUFA 2GOYA 3AL0C 4MUKA 5TEVA 2CT8A 1TQ8A 1N3LA 1KORA 3CLSD 2PZBA 2QUJA 3IODA 3AG6A 1O97C 1RQGA 2Z08A 3IUEA 3ELBA 2HZ7A 1OWOA 1NUTA 1QQTA 3RBAA 4MUIA 3CA8A 1NUSA 1EXDA 4G5YA 3CLUC 2XRYA 4HK4A 1Q11A 4ZCSA 1N2EA 5FO1A 3SZ3A 1M8KA 1R6XA 5TGTA 4JXZA 3IOEA 3MXTA 1MB9A 1J70A 3HFJA 1PFWA 4MW2A 3KT8A 2Z09A 3FIUA 1XNHA 5HUHA 1ZUNA 3SYTA 1OD6A 4L2IB 2JAXA 2PXHA 4E1AA 4G6ZA 4MLPA 1KP3A 4MWEA 2GKSA 5BNZA 4NATA 1Q15A 5J59A 1WOYA 4JYZA 1U7XA 3VRHA 1COZA 1G8FA 1U7DA 2OQ2A 1Q77A 3DPIA 3IOCA 3X1MA 4MVWA 4NZPA 4RUKA 2NSYA 4WNYA 4ZT6A 1MRZA 5J58A 3IUBA 2CYBA 4J76A 2I1LA 3Q12A 4MULA 3CLRD 4R2LA 3VGJA 1TFUA 3IH5A 3TQIA 1YUNA 3L93A 4CDMA 3UK2A 1JHDA 3GMIA 3QTBA 1T6ZA 4ND7A 4A91A 3FNRA 4JZYA 2QJTA 4I6GA 5DB4A 1NI5A 1XNGA 1NUPA 1O94C 3VU8A 1M83A 1ILEA 4DJAA 1T6XA 1WQ4A 4F3RA 2A1UA 1PFYA 2QUKA 1VBMA 3PXUA 4JXXA 1TYDE 4MW6A 1JEDA 4DDMA 1HYBA 3CLUD 3H97A 4GRIA 4J75A 4CQNA 1G8GA 4HJXA 1D2RA 2QJFA 3CLSC 2QTRA 3UMVA 2BYTA 3G6KA 5KCMA 3PNBA 4QBTA 4MWBA 3P0JA 3A2KA 1EE1A 4UZFA 4MQ6A 2X3FA 3ZJTA 3CVWA 4K0RA 4ZCRA 3HGMA 3X1JA 1FFYA 3N9IA 1QU2A 3OTWA 3AFHA 4EG8A 4KR9A 3DV2A 5FO0A 3C8ZA 1WZ2A 3FWKA 3INNA 1WQ3A 4YBRA 4ZT2A 2AG6A 1PG2A 3ZXIA 2DXIA 1KQPA 4DLPA 2CV1A 3HZRA 2WQ7A 1H1TA 3FDXA 1J1UA 2CV2A 4L2IA 3JXEA 3Q4GA 2H29A 1S4MA 2E0IA 3HL4A 3N8HA 2WQ6A 5IJXA 2YWBA 4S1OA 3SEZA 3PNYA 3H9CA 5LFAA 1EUYA 5KHAA 3RJZA 1OWNA 1T6YA 3ZIUA 4MWDA 2A4MA 2A1UB 2DETA 2VTBB 3CLRC 1GTSA 2G36A 3MUEA 2JANA 2CSXA 1O95D 1EJ2A 2HGZA 1O5TA 2RD2A 3M5WA 1QRUA 4EFKA 2J08A 1MAWA 3MLAA 3U1VA 1ULHA 4GU5A 4MUFA 1LI7A 1NSYA 3ZJVA 3FY4A 1YULA 2DR2A 4NAUA 2E89A 1J1ZA 2D5BA 2B7LA 1EFVB 1V8FA 1NURA 1WXEA 1N75A 1U0BB 1VBNA 1VBKA 2CYCA 4ZT4A 1IQ0A 2YXNA 1JIJA 3SP1A 1KP2A 4CDNA 1F7UA 3QTTA 1QRTA 4DE5A 4YMIA 3COVA 4EG4A 4MVCA 3AG5A 2E21A 3UC5A 4AQ7A 1YIDA 4MUNA 5K0TA 3KT6A 1J21A 1M8GA 1XNJA 1JEEA 1KAMA 4PBTA 1JIKA 4EG3A 4R0NA 1GAXA 3IMGA 1YIAA 4NX2A 3UOWA 1NUUA 3RFFA 1QNFA 4CT0A 3FH0A 2A88A 2AZXA 3MLBA 4MW4A 3KT3A 3IVCA 1N2BA 1V47A 2XRZA 3KT0A 4YP6A 3ISJA 3G5AA 2JA2A 3FOCA 1TYCA 1JIIA 4ZT7A 5H7XA 3FETA 3LCJA 3ND7A 1PG0A 3SEQA 1JMVA 2A1TS 5HG0A 2VXOA 1F9AA 2PZ8A 3IVXA 2OV4A 1ZJWA 3D6VA 1EUQA 1MJHA 3GUZA 1T9GS 3K32A 2A86A 1K4KA 4KPUB 4DNXA 1GLNA 5F23A 4QREA 4K03A 1O96B 5DASA 2X0KA 3H05A 2H2AA 5LM3A 1WXFA 1TYBE 2QUIA 4MUHA 1OWPA 4EGAA 2VTBA 1NYLA 4U8HA 2AKEA 4EG6A 1O95C 3HMQA 4MWCA 1O0BA 2C5SA 2PIDA 2IELA 2O5RA 1K4MA 5IHXA 1N2IA 3TZEA 1QU3A 2V0GA 2QJOA 1N77A 1VLHA 1N78A 1IH8A 4MW9A 2A7XA 1JILA 1EFVA 1M8PA 4KKVA 5TS2A 4EF6A 1DNPA 1N2OA 5K0SA 1F4LA 1IQUA 1I6LA 4DDHA 1BS2A 3AIIA 3COZA 3RK1A 2ZUEA 1K92A 1WXHA 3NV7A 3QE4A 2NZ2A 1F7VA 1FYDA 1NZJA 1MAUA 3NBKA 5FNZA 1R6TA 1U3DA 1O6BA 4MW1A 3IOBA 1J09A 1Y42X 2PFSA 3FI0A 4YP7A 3A04A 2QTMA 2HMAA 2IJGX 2TS1A 2DLCX 4XSVA 3FHJA 3TS1A 3RHSA 3CR8A 3N2YA 3LE8A 5H16A 1LW7A 3PRHA 4HJRA 2J5BA 4MAFA 3IDFA 1NUQA 1MC1A 2A84A 1OBHA 4PY2A 1YUMA 5EKDA 4F4HA 2R5WA 3ZGZA 1M8JA 1A8HA 1XJQA 2DPLA 3P52A 4PBSA 4MW7A 2CV0A 4OJMX 4KPUA 1X8XA 2YY5A 3L92A 2D54A 3CVUA 1IVSA 1G59A 3ZJUA 1O96A 2CUZA 3TZLA 3CVXA 1OWMA 4ARIA 3PNVA 1P7PA 3ILVA 4ZCPA 1GPMA 4PBRA 3IMEA 1QJCA 4U7JA 3X1KA 1EFPB 1JZQA 3ND6A 5HUJA 5JBNA 4HPWA 2D13A 2V0CA 3A4IA 1QRSA 1WXIA 1PFVA 4R2MA 4XFJA 4P2BA 5J5AA 2DEUA 4MUJA 1OWLA 2A1TR 4WSOA 5TEWA 3MMXA 3S3TA 1U3CA 1KQOA 1H3EA 1KR2A 3D6UA 1T9GR 1J20A 3ZUGA 3H9BA 1MBZA 1LI5A 4I6JA 4YP5A 3CLTC 1IHOA 3Q10A 1QTQA 2E18A 1O0CA 1TYAE 3IVGA 2GM3A 3P0IA 4Q93A 1MB2A 1KQNA 1I6MA 3G59A 3ZXSA 3DO8A 3DLAA 2DUMA 1KH2A 2DERA 4ND6A 1KH1A 4EG7A 4EG5A 1N2JA 2CFOA 4OUDB 5DEOA 3SZGA 1KH3A 1M1ZA 2O8VA 1ZH0A 1X6VA 2PG3A 1Q19A 1GTRA 2WB2A 2EJCA 3OP1A 3GLVA 2X1MA 1CT9A 3FG9A 2EL7A 3COYA 4ZCQA 1IRXA 2QTNA 1N2HA 3TNJA 4XFDA 4MVYA 1PFUA 1SURA 4EG1A 2WSIA 3E27A 1I2DA 4ZT3A 1O97D 1OBCA 4JFAA 1H3NA 1NP7A 4KR6A 1H3FA 4G5FA 1I6KA 5DK4A 1KKUA 1YI8A 4AS1A 5AHWA 4KR7A 4Q16A 1WXGA 1EFPA 1R6UA 1ZH6A 3SDBA 4RPIA 3CLTD 1JGTA 4U63A 1KAQA 1WKBA 3P0HA 3A05A 4FZJA 3HV0A 1N1DA 4NAHA 3KFLA 4MW5A 3N05A 3AKZA 2BTEA 4DDKA 4MW0A 1WJGA 1K97A 1JZSA 2QUHA 4NDAA 3BL5A 4ZT5A 3UY4A 1TEZA 4MUEA 1UFVA 2X1LA 2J09A 4UZEA 1VL2A 4ARCA 2J4DA 2J07A 4H3SA 1WY5A 3F3MA 3LOQA 3RK0A 3NBAA 3IMCA 1B6TA 4BWVA 4ZCTA 3H99A 3COWA 4MUGA 2IP1A 4QRDA 4X0EA 5KWVA 5LLTA 2RE8A 4OUDA 3CVVA 2CYAA 1O94D 1MOPA 3CVYA 2YWCA 1IQRA 1IFXA 2ZP1A 4MVXA 1G8HA 4I6EA 1JECA 1M8FA 2Z3VA 3I05A 3TQOA 3ND5A 4TS1A 1GN8A 3K9WA
chains in the Genus database with same CATH superfamily
3B85A 1Q0RA 4D26A 2J9FB 3ZWAA 1D1SA 1JIXA 3U4IA 4KU4A 1C1YA 4LBYA 1THMA 3LVRE 4O2AB 1KZ6A 3TVTA 5HE8A 2IBTA 1TW2A 1O97C 2JA1A 2OAQ1 3GBVA 1YRLA 5EERA 2A5DA 1E0JA 3FUCA 3FMFA 4H0NA 4UTXA 1EUDA 1E2FA 2G9VA 5K2OA 1L4MA 1QP0A 1U0GA 3IT1A 2I7CA 3PHCA 2AWOA 2UXDB 1FQWA 2WIDA 2PMBA 2ZG6A 3H8WA 5CCEA 4ZDWA 5EHXA 4DM4A 3IOEA 1I2AA 1NKSA 1ZICA 3MGBA 4JI6B 3MW8A 1RC8A 3MWDB 1XA0A 3HA2A 4FZ3A 3RTAA 1M5TA 3FW1A 3OX1A 4RK4A 1V3UA 3NDRA 3HCBA 1UKBA 4U2CA 4KUHA 1H2FA 2A50A 2O54A 2Q2OA 2BHNA 2FG7C 3M82A 5IK2A 4KO1S 1FP6A 2D1RA 1QTRA 1Z17A 2JAXA 2OUKA 4R84A 2ZROA 4RD3A 3IP8A 4E94A 3QEBZ 1UKCA 3DZDA 4B0PA 1ADBA 1K63A 3WJ1A 3AW8A 4RTRA 2NVBA 1COZA 2YIDA 3LOPA 2C4TA 1G8FA 3KQSA 3ZWBA 1RQLA 1YB4A 1Z0KA 2B1QA 2GTHA 4AJIA 1B8PA 3GUYA 4HX5A 1JFRA 3LGSA 4TYMA 5BQ5A 3U4QA 1SOUA 1GUAA 1YB5A 3IP7A 4D0GA 3KD2A 4ZD6A 1CXZA 2CYBA 3O2QB 4IUDS 4PZEA 5AVUA 3FAKA 1YD7A 4M7PA 3WFZA 4DCJA 4E30A 3VA7A 3INTA 4OJYA 3A4VA 4MQ5A 1J07A 2D7JA 2ZTUA 5FQNA 1PT9A 2DSNA 2VHQA 4CM8A 1DKMA 3LCMA 3QVWA 1GU0A 1JHDA 1I1HA 1QS0B 2IKSA 4EJFA 3TF5A 4A91A 5LYJF 2ZATA 4XQGA 4PU0A 2Q1WA 4O4HB 1Z6GA 1ZOLA 3FUTA 1EG7A 1MUUA 5BQXA 2JGRA 1UFQA 2DFKB 2XTNA 3M5PA 1Z7WA 3S6JA 4IQ8A 1M83A 2DBRA 3P9XA 3IXMA 2XE6A 3GP5A 1GNLA 4H1TA 4M2LA 3H6GA 4DWWA 1M2OB 2A1UA 3DTNA 3F7NA 4BAZA 4BNNA 4XJTA 3DVQX 4R01A 4EEXA 1JQLB 2AZMA 1QONA 1S02A 4BL5A 1HG1A 1X1EA 2IYAA 2F1IA 5K5EA 2GWHA 3AEZA 3B38A 3GK3A 3V32A 1T43A 1VSVA 5I7SA 4DSAA 3UA0A 3GEDA 3JD0A 4WZAB 2GZHA 4DCMA 4F5WA 3WIOA 2GILA 3ZKWB 1LJ8A 1XZJA 1XD8A 1XCMA 5C7LO 1R6VA 3H0EA 1O95A 4JLVA 1L5MA 1JHVA 5IBRA 1P60A 4TL7A 3PXAA 2QOEA 2XT6A 3P0JA 3AIOA 3A2KA 3H1TA 3HFGA 5DP2A 5ALSA 2FOXA 4B4VA 4DR6B 4K9OA 1JIQA 4QUKA 5ALRA 4KYUA 3ZQKA 3SJBA 1ZVVA 2XZTA 3TEJA 4GX0A 1FFYA 4IPTA 1NNEA 2ZXEA 1KSJA 2H4ZA 3AHIA 1QFMA 2K7FA 1AA9A 5IDYA 4Q1DA 1XE3A 3VNVA 5E4JA 4PEVA 4PONA 3NHZA 3GU3A 2VHUA 4BQOA 4D82A 2VUHB 2FUCA 4DQKA 3O90A 3SGLA 4KP7A 1OJLA 1QKJA 3JXEA 3L7CA 2QVCA 2JIZD 2BHSA 2W8BA 3C15C 1KY4A 1XKTA 2IYRA 2ZRJA 1H05A 3GR6A 3MWYW 1T2EA 4IHQA 4O3FA 4Q12A 4CU5A 2FDCA 2IGTA 2RGUA 3O91A 4H1VA 4RIFA 3TECE 1K3UB 3T5TA 4QO7A 1Z39A 3GLGA 3W1VA 4D9EA 5CIYA 1E8MA 4R2KA 3DEYX 3QIAA 3F8TA 4CRWB 2WF7A 2WTAA 2R1VA 1KO4A 2EJVA 3A06A 3OZFA 3U5TA 3GCGA 2P4HX 1H5QA 2G67A 3HL6A 1T0UA 2CSXA 5CTJA 2QE6A 2YUIA 4J0JA 4KGZA 2H1SA 5LXTF 3UUFA 4PX5A 2D2XA 5DSTA 3K20A 3C4VA 3HY6A 3GF4A 3PQ3A 2GS9A 4PR0A 2QD2A 4JI0B 1GSOA 1WNTA 4YMLA 4GAEA 1A8UA 2P7IA 3GARA 2CVZA 3IP9A 1YULA 3EASA 5LPNA 3AFIA 2E89A 4IDQA 4KWTA 2D5BA 1AV6A 3CUYA 2NO6A 1RMQA 5CAEB 3NFYA 1LC3A 3IIEA 2ZDQA 3EAFA 4DT1A 5A9SB 4O6VA 4LVUA 4CBVA 1Z82A 1ONBA 3KB6A 1LPAB 2K2QB 2QRUA 2WAMA 3FYTA 3NWJA 3K1TA 4DE5A 1Z45A 2GPBA 2JKYA 3QW4B 4R1QA 2DR0A 2OCGA 2AOTB 3AK4A 4NXNB 3ICOA 4ZICA 2X6TA 4J0CA 4WUVA 2FP4A 2L2QA 1CULC 1B0PA 2DFVA 2ZLBA 3ENNA 3KT6A 4A82A 4BGIA 1DAGA 1GL9B 4DS3A 5B4VA 1I9CA 1Y9EA 1BVRA 2HK6A 2Q4RA 1DX6A 3KSZO 4D4IA 2V74B 4NX2A 2XMZA 1VGQA 3T4EA 3UOWA 1WB4A 2H85A 2BGJA 4Y9TA 2W71A 1ONSA 2H5IA 2PGAA 1YQ9A 2WFLB 4TMZA 3UIEA 1ZD8A 2BFFA 4BDSA 1A2BA 3IVCA 4CE6A 5B58C 3SDSA 4JJGA 4GSLA 3DM9B 4NICA 3D4NA 4IG4A 3M3DA 1WZNA 5JXWA 5TMEA 5B5SA 2J6CA 3GLGE 3LYAA 3U09A 1X70A 2QVLA 1DEXA 2IHYA 3ZCXA 2YXEA 2QL7A 4DLSA 3AP2A 4IQ4A 5FT9A 4K40A 3IALA 4DCTA 5KX5F 3BMNB 1VIVA 1F9AA 1TZKA 2H31A 2OD9A 5F2NA 2QVBA 3PJGA 2NU8A 5TX7A 2KSQA 1ELOA 1GCGA 1J9GA 2CFCA 2NV6A 2PZLA 1T5DX 5J1TB 3EIHA 1WABA 3ANMA 2PH3A 1E7SA 3KZ1E 4IFEA 3HJNA 5E7QA 2F9MA 1JYEA 3DZFA 2VF4X 1W52X 2FSUA 2BI7A 3B60A 2VHJA 3FZYA 4K5QA 4YJGB 1KDVA 3RC2A 3HSYA 4ALLA 3ZD9A 2YV1A 2OHOA 3KHSA 4RVSA 1URPA 1UK7A 3NTXA 3CYFA 4YXWD 1KAOA 1CFJA 2H2AA 5IH7A 5BR8B 3DC7A 5IDVA 3WOVA 1N2CA 2CXOA 1DV2A 1SXIA 5GVSA 1HI9A 5AQ1A 2ZBFA 3TTSA 1W2HA 5KCZA 1SJ9A 3LQRA 1UBFA 4EB6B 5I7UA 3NTOA 4OBXA 1BJTA 5A5FA 1O0BA 1RAGA 3QWBA 3HA7A 2HTFA 4RK5A 4X85A 2Q0HA 4C3ZA 4ZOCA 4DV6B 3T34A 3IYLW 3O4IA 4LHWA 3W6ZA 3UGKA 2IW3A 1A4RA 1QK3A 2XKKA 1B23P 2OOSA 3J7TA 3OJOA 1OAOC 4I14A 3TQTA 3TZEA 3ACDA 1N5MA 3HEAA 4DLUA 1FMJA 1WDMA 3O84A 2HD4A 3HYSA 1N78A 4FMCB 1QIEA 3V1UA 4FM9A 2HJSA 5EIHA 2PD6A 3QVXA 4R2XA 1EK1A 3V1TC 1UXHA 1L5NA 3VPHA 4DVJA 4BMYA 3NHRA 4OHZA 1CZHA 1CUGA 2VJDA 2WWRA 3UMYA 3ZCVA 1QF9A 2IXFA 5F7XA 1CY2A 3A6EA 4ND4A 4NENA 3B6ZA 2OL4A 4L73A 4N82A 3IRUA 3LT1A 2O57A 3UMCA 5IULC 2QR2A 4XD7D 3TTWA 2NXCA 4HDRA 2V55B 4WKBA 5U9CA 2BJWA 3D3KA 3GX1A 3HP4A 3ZDBA 3RAFC 1M1YB 3F7TA 4JDUA 1LDBA 4IVQA 2GO7A 3MUFA 1Y42X 3O6VA 4Z3OA 1HRKA 3FI0A 2I3DA 1LPNA 3IEKA 3JPYA 5IYZF 5JAIA 1E61A 4XGRA 5A1JA 3TAHA 4RF5A 3ZQJA 3FHJA 3K35A 2W48A 2YHIB 3W7AA 3CR8A 2WILA 5EA2A 4EYSA 3ERCA 1ES9A 4J03A 2VSQA 4JLBA 2W0MA 3FSRA 2NYRA 1EK0A 2ZYUX 2CXUA 1E6KA 3BJMA 3OM9A 4IJMA 3L0ZA 3CE9A 3EXHA 4HZUB 1UZAA 1QFSA 3JAKB 2V5VA 3I12A 3MIZA 1N2CE 4LJYA 2J41A 3U3KA 4MYCA 1S4QA 1SQGA 5DVZA 4Z4FA 3H9JA 1QC5B 1UT5A 3KEQA 4PGHA 5EKDA 2V9ZA 1MZVA 2V3VA 2AOVA 1JHYA 1T4MA 4HVAA 1EH5A 2NN3C 3EDYA 2DPLA 3TKYA 3P52A 3QVUA 3WWDA 4O4JB 2NU6A 1OT5A 4YH1A 1CUHA 5F7OA 1FFBA 1G6Q1 3B6MA 3CZAA 2IHVA 3GJ0A 3PSHA 3RSFA 5AM5A 3VJLA 2C1EA 2YQ5A 4CR7A 1OFIA 2D54A 1A2OA 2OAP1 4UARA 3KQUA 5CEJA 2QYSA 2HDWA 2PR2A 2PGOA 4BUCA 1U2GA 3DOCA 1N8SA 2IXGA 5BRAA 2FUG1 3A1UA 3UKJA 3H2IA 1R50A 3TCKA 4HH3C 1N36B 1SKBA 3LZ6A 2Y92A 4B8WA 5MGNA 1QE0A 2Y99A 3HB7A 3GGPA 2KLBA 2IK8A 2RGNC 4G89A 2QMQA 1CQXA 1CR6A 2NU7B 1XU4A 4GD3Q 4BHTA 4ZEMA 3ADPA 3AL3A 2R00A 4AZ3B 1TZCA 3ZGOA 4YRPA 2POQX 4MUJA 4ARUA 1OWLA 5JJBA 4M53A 3EJWA 1XNQB 4NY1A 1FUEA 1VSTA 2PIAA 2IVFA 5KTTA 2D4AA 1H9CA 3S4YA 2RGNA 2WU0A 3U44B 5TT1A 4RTOA 1TPYA 3G5TA 2A0XA 3ZLTA 4C6TA 1U2EA 4EP1A 5HR5A 3IQWA 5CVEA 3AR8A 3H9BA 4L28A 3EQZA 3WYCA 2XOKA 3OX2A 1QAOA 1Y5NA 2YW2A 1YONA 1JLSA 1EFRA 1E9EA 1N3BA 4YJ2B 5G0TA 5TQ2A 4EMTA 5K6AA 4LHVA 1J7JA 2E18A 3GYBA 4QYWA 1GFIA 2J7KA 1XK7A 3E1SA 3DQQA 1AXGA 3P0IA 1OLSA 4XJSA 4DMHA 1OVGA 4WKOA 2R4UA 5AJWA 2O3QA 2ZVJA 3ZXSA 2EFDB 1NJ8A 3PK0A 2PTHA 3LQKA 4TSFD 4Z7NB 4AKGA 1IUPA 4GBMA 4LJ9A 1XQVA 4MS4B 5ABPA 1TCVA 3LBAA 5AK6A 2NP7A 1PR4A 1K9VF 1UK6A 1KH3A 3A7DA 3RUFA 3F5MA 2JG3A 2CW5A 4X66B 1NXVA 2HWKA 1VLMA 1GKUB 3J80A 2DP4E 2EBFX 3THYA 3RSSA 2RKWA 4G67A 1G20A 2J87A 2JI7A 1OW3B 1ZK2A 1HTWA 4JIGA 4M88A 4DG8A 4PSDA 1O08A 3RS8A 1RZ3A 3JVVA 4ZO9A 4LOHA 4A5OA 1UKYA 3OPYA 4F5ZA 4FCVA 2PUVA 2J3IA 3VZSA 3L3BA 1UM8A 2C7RA 2PYIA 4I36A 2MOKA 3AV3A 3E3NA 2UU9B 3MTBA 2RHMA 1FFHA 3D6NB 4RHEA 4WD3A 5EJMA 2QBYA 4NNJA 1TA9A 5JAPA 3B8EA 5F76A 2G40A 4LVOA 2QK4A 1SD1A 4PZDA 4BEBA 5BQ3A 1MEJA 1XTQA 2H3EA 4N9QA 5IJAA 1E1KA 3DB1A 2W4MA 1VHWA 1GTRA 3M6WA 3EBOA 2OVBA 1I4EB 3AY3A 3WGOA 4E08A 1E9VA 3FFXA 4RPIA 2BW0A 3EEQA 3TI7A 4BFUA 1Z68A 2GEJA 3Q8XB 2H52A 1G291 2IE8A 2I0FA 3LXUX 1SUPA 3ZU6A 4KFTA 2C3UA 4L4ZA 4AVYA 1BDJA 1U4SA 2C4NA 2J30A 1HE4A 4ARZB 4IVRA 5JEEA 2EDCA 1L4YA 1WB6A 2P9YA 4RYLA 3KWFA 4X24A 3U7QB 4D0SA 3WK8A 3E7PA 3O1IC 2Z2YA 4MW0A 2WD9A 1NVTA 3FPJA 2V03A 1NMYA 1UPCA 1Y1LA 2PRZA 1I80A 3PXBA 3ZVLA 5JNLA 3WAGA 3UPUA 1GR1A 1BQEA 2FW6A 2W6OA 4DBZA 4MITA 1G20E 1AQUA 1U80A 2WAAA 4ZO6A 4ARVA 4XWYA 1T10A 2LTAA 2ZIXA 3QEMA 1QH9A 1KPGA 3QMWA 3KJFA 2CHQA 4RC9A 1E66A 2WFZA 1K5GA 4JKOA 1NWCA 3GO4A 1PJ8A 3CONA 1SR8A 1K9SA 2IIQA 3CUVA 4RFSA 3H9QA 2EX1A 1NBAA 2VJBA 3STHA 1BRTA 2XDYA 5EWMB 1RYHA 5I9NA 1Q5PA 1VJ0A 4HZGA 4TSRA 2R8ZA 3NXKA 4FQ7A 3CVVA 4Z7JA 1C1DA 3IBGA 3KAPA 4DNPA 3QKRB 3TNDA 5BMOA 3QPWA 4XASA 1VG9B 3WDLA 3BRCA 1J99A 1XZBA 3SIRA 4OSEA 4MVXA 3RYHA 4XDYA 4LRTB 1F6WA 4O2LA 1EP2B 3EISA 1BHSA 5EFZA 8ADHA 5DBIA 2R48A 4X1IB 4B87A 4CQMB 1XEFA 4EFNA 1E3EA 4WXHA 3BMQB 2WE7A 4TPKA 4Q1FA 2G7MC 5GADl 5AKXA 3RC7A 1IPFA 2E4XA 1P6UA 3EG9B 4QPZA 4FOSA 1EX7A 4Y0AA 1H1LB 4O0LA 1YS9A 3FM9A 1W5SA 1JI3A 3UGJA 2I3ZA 2VXCA 1RI2A 2P9JA 4PZLA 4Q4AA 5LQMA 1EIWA 1E2DA 3GN1A 4PS1A 3EXEA 2PUTA 1ENOA 2XIJA 3G0HA 1J49A 4C01A 1CUBA 2ZIAA 3RVNA 4Q3OA 4NZZA 5CXXA 3FGPA 3OQ1A 2Q5JA 1XB2A 4JEMA 3SFTA 3SZ3A 1B8UA 1ZBQA 3E35A 3FTCA 1K5HA 2Q27A 4LWZA 3ANTA 1UKZA 3I6QA 3OVMA 3E0QA 1DJNA 3DLIA 5DSXA 1YR3A 2ZRFA 4AJHA 1GFZA 1P2SA 1M33A 1FW6A 1D09A 1A8QA 2C4VA 2L69A 2P6MA 2YZ7A 2Z09A 5JJ5A 1F2VA 3AIMA 2W6JD 1Z0DA 5HUHA 1RXIA 5CGZA 1JDNA 5J4LA 1J8MF 3I52A 1F2UB 4P6VF 1QSGA 2FSGA 3OTIA 1O0SA 5EHGA 3TW8B 3P9PA 1MO4A 3FHTA 4BNFA 3FWZA 1XCLA 5BN5A 3QBTA 2QV0A 4H4DA 3A1TA 5BN4B 4MR7A 1NJ5A 2PKCA 3HFSA 2FPPA 4LNHA 4CMCA 1ZH8A 2DWQA 4QQ8A 1XP5A 3UTDA 3ZHOA 5H4HA 4HUTA 5JZVA 1HYEA 3TXYA 3K8OE 1YA8A 2I8AA 1Z2EA 3BOSA 3UCFA 4HH1A 4DQVA 4RQUA 1Z4IA 4DA7A 5CH5A 1GN9A 3PYXA 4OKNA 3HR4A 1PZMA 3H13A 3VMFA 3L49A 3ZGLA 5EIXA 2JFBA 1D2NA 4HEHA 3ESYA 2GX6A 2PUHA 2P6UA 2QX8A 4WNAB 5JD3A 4D8TA 2VWGA 2OHJA 2WYHA 4CQJA 4D7AA 2YY7A 4NABA 3CR3C 3OJCA 4R71A 2XTAA 3D8UA 3ND9A 1E2JA 3FYUB 5DCWA 4AJPA 1BMFA 1LRJA 4M1YA 3IBSA 4YP9A 1NUPA 1G21B 1T9AA 1UOOA 2VCEA 5FL7D 3ZNOA 3F8SA 3I2JA 5J5VA 4MGEA 1KI1A 2ZJ1A 1PFYA 3BJIC 1GHTA 5DLYA 2VK2A 4YCMA 1Q44A 1NDUA 2VHEA 3H0CA 5FBRB 1GRRA 3H97A 4TGLA 1PJLA 1HOTA 3PKZA 2FPXA 4YAEA 3KUCA 4IIXA 4BJ1A 4YRGA 2XYRA 4DR5B 2AMYA 4Y9DA 3I4CA 3TKLA 2PH1A 4JBXA 4O2AA 3I2GA 1Y6ZA 3S2YA 3IV9A 4IGIA 4JNKA 4Q48A 5KSYA 4P2GA 1Y63A 5EE9A 4JP5A 3HV2A 1WB9A 4OAPA 4PLWA 1ILWA 3LXMA 4Z4CA 1EE1A 1W44A 1YR1A 4IHKA 2X3FA 5ECWA 1OLXB 3KQOA 1RWVA 3DBLB 1BC5A 2R6HA 2R6GA 3R5HA 2PMEA 4N1AA 1JHUA 2HJ9A 2W6ZA 3CRRA 4FYXA 2AQIA 2PVSA 3RQSA 5JI3E 5L4LA 3DAGA 4XJXA 2I87A 2F4NA 1USVA 3QLUC 2XLBA 3BKWA 3P26A 2FSHA 4HAZA 4YBRA 4M83A 3INYA 3AB7A 4N6GA 1L5LA 1Y4ZA 2WU3A 1T8RA 4IO1A 1PG2A 2E4VA 3B2QA 3N2IA 4RY8A 4ZCIA 2P5SA 5JCPA 4PC2A 2ZXUA 3SF0A 1ZUHA 1BE1A 3HS3A 4TKZA 4OH7A 2DYKA 5KPJA 4KO2S 3LUPA 5J2TB 2BE9A 4YPFA 1KXZA 4Y9SA 1OHHA 5GTDA 1AXEA 1AQLA 1T9HA 2ZSBA 1KFKB 5A6SB 3STVA 3NIDB 5HK9A 1KNXA 2QJRA 4QOHA 4QGFA 3UZUA 3QXXA 1FB5A 3ULKA 4F2DA 3OIVA 4Y2VA 3DLBA 3THXB 2D62A 121PA 1L9KA 2OCXA 2YWBA 3BL6A 3A3YA 3QHAA 1EUYA 1B74A 2DAPA 2ZYVX 3OCYA 1YBVA 2OK8A 1UJCA 1X7WB 4NSNA 4O2BF 3MAGA 1EVLA 1UL1X 4TZTA 2VTBB 1V6SA 4E5KA 5FUMA 5EFOA 1GEGA 3DKKA 5BUSA 2VWPA 4WJZA 4MRRA 4N65A 1P1RA 3KLBA 5JWHA 1QS0A 1FDIA 3KQLA 2IS6A 1RQXA 5LJIA 3W8DA 4BVBA 1G7RA 3S28A 4P9NA 4GVPA 1BXRB 3PU6A 1FSPA 4O4HA 4GPAA 5F3WB 3TGWA 3FY4A 4DLAA 2HPAA 2V58A 5K0CA 5IDXA 4ZTUB 5ISMA 1CUEA 2R44A 3BFVA 3C5WP 2QI9F 3L8GA 4W8OA 5T6MA 1KY5A 1WXEA 2B1RA 2HA0A 1U4NA 4CM1A 1ZISA 4V39A 1M2OA 2XB4A 2O7RA 2YXNA 1GVNB 1P7CA 1YRWA 1Q1NA 3HGTA 4J90A 4TLMB 1G55A 3B1XA 2EZTA 3I9NA 4YP1A 5FFNA 1L5GB 4B5LA 1B8VA 3FVVA 4EG4A 4DDWA 1Q0TA 3D4PA 2WJPA 3ETEA 1NQXA 3SDZA 2O8EB 1K5DA 1L8OA 2WF8A 3ND8A 4WZAA 1WKCA 3ZKWA 1FE8A 4DMRA 1J21A 1IK6A 4JQCA 3L7MA 4LRXA 4XVHA 5IU6A 4UFPA 2IS4A 3A6KA 1PUXA 5LQUA 4LV5B 2FOIA 5BR1A 4EPYA 1YC5A 3PRYA 2VC2B 2YXDA 3PR2B 4YCLA 2Z30A 2OC4A 3E6AA 1KSGA 2BBWA 3R76A 4AY6A 1G6OA 2AN1A 3CI0K 1RWOA 1Y9DA 5JJCA 1DOAA 4KGVA 4I19A 1PR2A 3LP6A 3F6PA 1H1DA 4X8HA 2QI9C 3QNMA 4RIHA 2I2CA 3DJFA 3FOCA 1N5KA 2YMMA 3JYLA 3MWEB 2G82A 4KH0A 3PJDA 5JASA 2NP6A 3G13A 1MJGM 1VJTA 1USIA 1UXIA 3ZZNA 1UT6A 1LUAA 2CFRA 1FPQA 3HNPA 3A9RA 1X94A 3HR7A 2OZLB 4K6HA 4RA6B 5AW8A 1CUSA 2WSLA 4OL9A 4HX9A 3W3AH 1EKXA 4CL2A 1O57A 1CB0A 2BN4A 3A1CA 5CT4A 3OFJA 4RXMA 2XVMA 4DC0A 4B5KA 1CF4A 2GEFA 5K8IA 4TMTA 3TD9A 4ZOLB 2WSSA 3S8EA 5DYTA 1XKLA 4Q47A 2HH9A 4BMVA 2PBLA 3R7DA 4PX9A 4OSOA 1IYZA 2DFPA 1C1XB 2W2NA 2W42A 1E63A 1NPDA 1QVZA 3VDXA 4DZTA 2AKEA 2COKA 4GI1A 2HSZA 2OCLA 4IUCS 3W5DA 1KVRA 1TT7A 2N75A 4RHUA 4BZWA 2MSCB 5C51B 3P2MA 1GFWA 3P9RA 4WZAE 3TEMA 2YRWA 3VOBA 2X23A 4C87A 3AFNA 2PGJA 5MHTA 5D2CA 1N5IA 2SKDA 5IEBA 4YREA 3GLTA 4EJ2A 5DM1A 1JILA 2I65A 4KKVA 5CAEA 4U0KA 1ZKMA 3UUEA 2AXEA 1SG9A 2OBYA 4F21A 2PKQP 3T38A 2GD2A 5A9SA 1TK9A 4PQGA 3KLPX 2RB4A 4HB4A 2NZ2A 2AC2A 2FFJA 2VRBA 3RKSA 5L95A 3IBCA 2QS9A 2AOTA 3PX2A 3R09A 1OXMA 4DA0A 1G0OA 4RCVA 3PDWA 5FPYA 2BGUA 1EBFA 4OX9B 1E2KA 1IJKA 2YRFA 3BERA 3E81A 3WL6A 4R81A 1PQYA 1ZY2A 1HLFA 3FOEC 1ZINA 2REOA 4PFJA 4KFSA 1J90A 3OZIA 1R9MA 3NEYA 5HXAA 3ZH9B 1NL3A 1DG1G 1FUIA 1NRJB 2WFLA 4GWKA 5DWDA 1EP9A 3BVPA 3W5HA 2QF7A 1ZIPA 1YWGO 2C8JA 2R3SA 4MWSA 1CUCA 4P3KA 3PIIA 1OIXA 4WLFA 3T3MB 2HXSA 3VC2A 1D0IA 4DN6A 4CM9D 4MAFA 2FPGB 1YMQA 4U2KA 4XTRA 1Q14A 2IDZA 4P36A 5J2UF 2BSXA 4RH0A 4KNWA 4NMLA 4CIAA 4R8KA 3BMNA 2HM7A 1QP4A 1XLTA 3KZCA 3D0RA 2PL3A 3DHNA 4MARA 4AO7A 4RACA 2WWYA 2YWJA 2YS6A 1A8HA 4ND1A 4PXYA 5LZ5A 4M38A 4ZVNA 1DBIA 4RKRA 4MW7A 4O5AA 1CLEA 1XN1A 3KZVA 4UNIA 4YJGA 3HPRA 3TOCA 2FFAA 1P9WA 5LQSA 3L40A 1G59A 3H0KA 3ZXXA 4LX0A 3O3MB 3R7WB 4DLNA 1S89A 4RXTA 2J0VA 2BHRA 4KAXA 3K0HA 4E14A 3QMVA 3WL3A 2VAVA 4EB6A 4XYBA 2R8EA 3BH7A 4IDAA 3FDIA 2ZOSA 3WYAA 2ZT8A 3GJ4A 1EFCA 2A9OA 1VDZA 3RBXA 1GDTA 1IVYA 4N18A 1ODSA 2BR4A 4COOA 1G8MA 3VZQA 3ZS9A 4ID3A 1H6BA 3KR0A 1Q3HA 1V5WA 1DIRA 1P1IA 2H18A 2JRCA 3HP1A 1OI2A 1O2DA 2CUNA 4GYWA 4LKOA 5EJ2A 1BWPA 1ZG3A 1QAQA 3MQ4A 4IHJB 3PEVA 1DWUA 4KWCA 4WGFA 2DMRA 3CEHA 5AOCA 2GTIA 2BTQB 4NMHA 5A4KA 5HS4A 1G60A 4TV8B 1Z6YA 2NYVA 2JJQA 4YT5A 1Q20A 2JEOA 1KI6B 4DLYA 3OCVA 3URKA 4GXTA 4E5MA 1NR5A 1WF3A 2HEGA 2L19A 4BX9A 3FLAA 1R18A 3I32A 4CKWB 3VR1A 4L50A 3HKCB 3TIFA 3VR3D 3ZUGA 2QLJA 3ZHRA 2AZDA 3ML1A 1ZCBA 1K6XA 2HDHA 4JLWA 5B6IA 5SV2A 3BWCA 4S2UA 2PT5A 4F45A 2A5JA 1W4LA 2G4CA 1M1YA 5DZSA 1UBOS 2P7HA 1QCZA 5BSFA 3B20A 1RBZA 4A5SA 3ONVA 2DGDA 4LSMA 4I5IA 4RJTA 1ZGHA 3BWDD 4UEOA 1VL8A 2JK1A 1MB2A 1P1BA 1YCGA 4X60A 2XYPA 4D3YA 1O03A 4MNTA 2YHIA 1VPEA 3AHEA 4Z49A 2XCTB 2AB0A 2JIMA 2NQ8A 5FJIA 2GAJA 3AHDA 3R7FA 3A58B 4AJOA 1K8QA 1Y98A 2Z2JA 3G89A 3T15A 4XX0B 2UUOA 5DHAA 1D04A 3HVHA 5EXEA 4C2BA 3PUXA 4WCFC 3KVNA 3UG7A 4N8SA 5EYPB 3W7VA 2BDUA 3URMA 5CCXA 4DCSA 4HZUA 1OZHA 3CRW1 3JAKA 3BWBA 1N34B 4YAOA 4DCNA 4ENVA 1D6JA 1OIVA 3GLVA 1Z08A 2V6BA 3I30X 1QC5A 1RFGE 5I9IA 3QNUA 3DDCA 4R2JA 4DBLC 4GOND 4KK3A 2C9MA 4Y6GB 2DFDA 1WZIA 2QTNA 1LH0A 4MQEA 2GSDA 1KBZA 2C9CA 5SY6A 2G4LA 3WS7A 5BRJA 1HH4A 3ZBTA 4QEKA 5D8DA 3KTFA 1PZHA 1X74A 2OP0A 2ZJ5A 4FTWA 4G2TA 2ZYSA 1WO8A 3VZPA 1PQ4A 1MJFA 1GGKA 1ZQ9A 2AW3A 3GQVA 4GKJB 1OTYA 3T9EA 3X3HA 2VEOA 4URYR 1KO1A 5JXJA 4OP1A 1NZFA 2J3KA 3KE8A 3E8SA 4CTMA 4ZYUA 3L84A 1N25A 4KR6A 2QE7A 3BXXA 2JVIA 3O7MA 3S5JA 1TTTA 3IV6A 3ZNNA 5DK4A 2JLCA 2AN5A 4OK6A 4JY7A 4GR5A 3EPKA 1ZC4A 1TJYA 3T9FA 3QVOA 1JKJA 3DDWA 2O7SA 2NU7A 4Z53A 1XAGA 1Z2CA 4W5HA 2HU8A 2KI5A 1M1YE 4EW3A 1MX9A 3RJTA 2VP0A 4OQQA 2C9OA 3FROA 3V42A 4AZ3A 2I34A 3ADKA 2JD1A 5JTTA 4AMUA 2O3TA 5TV2A 5LZ4A 3IT0A 4CMBA 4NAHA 1W85B 4PYNA 4P80A 4PSKA 1P4AA 3KTDA 1SPBS 4RK1A 6CHYA 2VYFA 1TB4A 3DO5A 4M6WB 2G5CA 2OA0A 3W5AA 1QHSA 1UEXC 4V2UA 2UUPA 3DHEA 1SVOA 2G8LA 5JZ9A 1B41A 3FFBA 1GO2A 2XUPA 3P0FA 1JJVA 3EZ6A 2X4DA 4MB0A 4PAGA 3RNOA 3EY4A 4FP9A 4AJJA 1H2WA 4BFLA 1QYIA 1J8YF 5DTMA 3TAXA 4YJ2A 2H9AA 4RH1A 3SS7X 3C7TA 5B7PA 5BNWA 1F0PA 2BFOA 3F6YA 4YA6A 1K6JA 3UHFA 4V1CB 5JMTA 1Z63A 5AVSA 1P19A 4C2TA 4MDEA 1X2EA 2FZEA 5C1DA 4W6ZA 3SY8A 5HKKD 4GX5A 4MIOA 4WFIA 1SBCA 3C0KA 2RGDA 4KPGA 4CJXA 4Y1GA 3CF4A 4MS4A 1Z5WA 4H3KB 1OXKB 3RU3A 2PUEA 5AKKA 3G5UA 1VIMA 3JWPA 3KQVA 3QEJA 3KO8A 3KWMA 2WP0A 2R6AA 3DUWA 2CYAA 5LZ8A 4UMVA 4ZA2A 1X1TA 4TROA 3ZCUA 4LTNA 2P2NA 5A02A 3AY6A 1A82A 1JLLB 5IJZA 3N0WA 1Z4LA 2H59A 2WR8A 1B76A 3MRSA 4I1OA 3M4JA 3BXFA 2BCGY 1U1EA 1B8OA 3QKSB 1GUBA 1UXOA 3PRKE 1C29B 2O2JA 4BVFA 1FDRA 3GY0A 4M8LA 1NW9B 1YB2A 1Z2DA 1GPYA 2XUAA 3HYTA 4E2FA 2HWUA 4JLJA 4E32A 3O8DA 3PQEA 4QTYA 2WM3A 1QJ4A 3ZI0A 2XPCA 3F2VA 3BWXA 2YVKA 3CZ4A 3EHDA 4HS9A 2NTYC 4MUIA 4TV9B 1FZTA 4GBED 4ZU3A 3JQ9C 4DY4A 2KJQA 2PZGA 4KJXA 3B3GA 4N0PA 4BO2A 5JQGF 4NG5A 1KARA 5I7WA 3MZ0A 1STOA 3KYBA 3C5EA 3HR8A 1QM5A 1RP7A 2CJFA 3NG1A 1I7NA 4RSRA 5EP1A 2R6ZA 3DVRX 5TGTA 1DT5A 4MGZR 3ZDRA 4DIKA 3O4FA 5AJUA 3UB2A 2OZEA 3ZW9A 4Y2PA 1FLVA 1P72A 1WAMA 2QM0A 1NC1A 3ZLBA 2MINA 5TC4A 5JT1A 2G5GX 4R4JA 5HCUA 3NKLA 4OBWA 5AVWA 4HWOA 5ELXA 1NJSA 2PSJA 1Y3BE 4B47A 1PSWA 4ARZA 4M0DA 4E1AA 1DRUA 1KK0A 1U3TA 4ZAYA 3PPXA 1H0RA 4Q01A 5KC8A 2H2GA 3AUUA 4MP3A 3T3DA 3U7QA 2JJ1D 4M87A 1L7DA 3I6BA 5KYNA 4MYTA 2OPHA 4YCSA 4EHBA 3GIWA 4I4TB 3TJZA 4DQLA 3UJNA 1GYPA 1RLJA 4JIMA 3CLVA 4RUKA 2BP7B 3NBXX 3CLHA 4QGSA 4OHCA 4IOKA 5JMPA 3SHQA 1GTJ1 1HT3A 2QTBA 1LTKA 4B3JA 4DZRA 2R60A 4QM7A 1R4AA 2I1LA 4MULA 1DMSA 1ONNA 1KAGA 3RFXA 3HK2A 1LQ2A 1Z6ZA 3VFDA 1AKUA 4TWRA 2XXAB 3PD0A 2YC2C 4CF7A 1HL3A 1U90A 2WTEA 3VSEA 3P2JA 2GJ4A 2J0UA 2Y0CA 4DJDC 1E5DA 1E1QD 2HMWA 3JQ8B 5EWMA 1PTJC 1QOQB 1T9CA 1UC4B 5PGMA 4PSAA 1TFRA 3KOXA 4HSEA 4QBFA 4QNRA 3A6PC 1C50A 1VB5A 4NK4A 3QKRA 4PIMA 5E9JA 3P0RA 4LJSA 4PC7A 1XXHE 1K08A 4Q24A 4KR3A 1Q3TA 3CUKA 1VBMA 4NYJR 1JH9A 2ZUWA 4AT1A 4ENPA 4EW6A 4JT8A 4X8MA 4X1IA 4CQMA 4GGMX 4UJ3A 2RG1A 3EGXB 2OOKA 4LIPD 1IM2A 1ECBA 2OKGA 3BMQA 3CT6A 3PI7A 3VBCA 3H6KA 1TJPB 4TQGA 5A62A 1JEQB 4GSYA 3NT5A 1V0JA 3EG9A 4YMSA 3I9V6 4IH4A 1E7YA 3LTNC 3O1LA 1H2AS 1H1LA 1RKQA 2GNPA 2IOQA 5KCMA 2HIHA 4TKVB 2WWFA 3TTVA 1FLAA 4MSUA 4HGOA 4EOGA 1EWYA 5AOAA 2AN3A 2VQ6A 4MQ6A 3SXUB 4L74A 5ADHA 1N6KA 4WOBA 1NT2A 4L16A 2AE1A 1E92A 3E18A 3TRHA 3R9IA 4EBBA 4ZIRB 3NHPA 3RREA 5KKAA 4D81A 1ZMRA 3DV2A 4BFWA 3NHAA 4CT5A 1WVGA 1WQ3A 3QXHA 3VYSB 3WIUA 5KNCA 1NDQA 3O1JC 2GRJA 2UKDA 4K9RA 4NYJQ 5LD2C 5EWLB 3K30A 3MJDA 5EN4A 5LLDA 1MD9A 1VYUA 1M2EA 4E5DA 5IABA 3LY9A 3W9SA 1F2UA 2X4IA 1U31A 2ECOA 3TW8A 5EJEA 3T9AA 4I9HA 3CJRA 4KB5A 4BFCA 3U4CA 1P2BA 1E2PA 3HBFA 5BN4A 3LPNA 1MX3A 1AGNA 4J0QA 1ICIA 2CXPA 1XEAA 3D6TB 4ZGBA 3OM8A 3TDKA 4V24A 1V43A 3E3OA 3OSZA 5KHAA 4KPEC 1D8AA 1KPHA 5GV8A 4BU0A 1VI2A 3FPEA 1QYRA 2ORIA 5JLJA 3L7DA 4PYIA 1U0JA 1XVTA 3FYUC 4L0MA 2FJUA 3VPGA 1H8ED 3HB0A 4MH0R 1CEQA 1T3SA 2FSVA 1E98A 3S68A 3RG2A 2QMZA 4WHMA 5EXXA 1YT5A 5AVRA 4IDFA 3H7AA 1Y5RA 3GCWA 4WNAA 1N3IA 1GP2A 1Q7RA 1T4BA 5A05A 2QRGA 5U4XA 1P1HA 2IXBA 4DAEA 4TSKA 2JZOA 4O2RA 1K4YA 5ALXA 5BUQA 2C2YA 3U7RA 4TTVA 1AGYA 1G21A 2OB1A 4EI9A 2QAGC 4XXHA 5DGIA 1R74A 1XG5A 3MS7A 3FCAA 3FDZB 4F9GA 1XJWA 4KMMA 3NGMA 4DLLA 5EJ7A 3DEIA 1E1QA 4KYVA 3SICE 4JLNA 5SZHB 3F9RA 1OC2A 1CKEA 1XD2B 4R3NA 2G16A 2CE7A 3AI7A 2WJ6A 5G53C 5H3HA 1YDHA 3BXZA 1A50B 3PS9A 1KRHA 4TKUB 2AK2A 5ALNA 3SAJA 3SKYA 3V8QA 1Z34A 4N5NA 1KAMA 2BH9A 4PBTA 4WFKA 3UJ7A 3C1AA 3H2BA 4QX6A 4LJ7A 4FQ8A 2WD7A 3BM5A 1HFJA 1ZK1A 4KPFC 2FSIA 4MA5A 2BDTA 2NZWA 1AO0A 1OLXA 3TBHA 1ZVQA 3DBLA 2ZAGA 4CUJA 4TXHA 1Y8ZA 3BUSA 1RYBA 1FBTA 3KT0A 4RJLA 1E3QA 3ZHQA 2ZUSA 4DEVA 4BQIA 3KZKA 4B3SB 3WRVA 1TO6A 1JA9A 3ZDCA 3F96A 3C87A 5EKXA 2XMCA 2QIOA 1DINA 4CFSA 1VKOA 1RWWA 1M67A 4L4UA 3WGHA 4YJ3B 2BBOA 4RWZA 1G5QA 2BGNA 3OZDA 4RNDB 4TLEA 1AU9A 5G0WA 4O4LB 1CQPA 3GUZA 5A6SA 3K8ZA 1T9GS 4E6EA 3LFHA 1NJFA 4N7RA 1L4EA 2HADA 1Y3FE 4EWLA 4O0MA 5MF6A 2OK7A 4PRKA 4ROTA 3VYWA 3M4XA 4CIBA 3THXA 4E5VA 1T6BY 3AI2A 5DNCA 3RSGA 1X7WA 1Y1QA 4P3YA 4KFRA 4KXYA 3VPDA 4FS8A 1QIFA 1FMCA 1Z5NA 3INRA 3JTEA 2VTBA 1T13A 3ENWA 3NRJA 4QO8A 5H3LA 3SQWA 2YVUA 1JH8A 3BJRA 4B34A 1OI3A 4NFHA 8MHTA 1EBBA 3OMXA 5GV7A 3V2GA 2CVQA 1QG0A 5EIOA 5IBPA 3V8BA 2ID8A 1N2IA 3BZWA 3GELA 4R9RA 4ZGWA 5HKAA 3S8YA 1WMAA 1BXRA 3EFOB 4WA8A 3DM5A 1QLJA 3LW8A 1VE7A 4G9GA 3MK31 1M8PA 1A8IA 4YC7A 1NTRA 3LCVB 5H68A 3LX8A 4D8WA 5HZHA 4GKKB 1EZ4A 2OAEA 5FOVA 1VCIA 3FBTA 2PS1A 3QIVA 5FOSA 4J6EA 3NV7A 2EEZA 3BIOA 4AFNA 1UBMS 2C61A 2ZQZA 3QITA 1J6UA 3ANLA 1NZJA 2OUIA 3R5FA 2C58A 2O8EA 2EZ4A 5KNBH 2G28A 4KQMA 5JCZA 2WLTA 1R9GA 2VYCA 3FRIA 1U6IA 1K7EB 2QP9X 5H9VA 2OGTA 4CG1A 3ZWKA 2IPNA 2RARA 4A9AA 4YMWA 5HOQA 4XSVA 2JGDB 1PHPA 4ML3A 1B43A 5LVAA 2YYAA 3S2UA 1GGNA 3DLHA 5AXAA 5DT9A 3QENA 1NI4B 2OCDA 3RGWS 3FMIA 1EP3B 5DBEX 1Y48E 3D2LA 3IDFA 2CNKA 3K3PA 3WRXC 1NP6A 3MWEA 2EKQA 4PN3A 2GPWA 4R0MA 5GONB 5SYAA 2X77A 4ESHA 5IFKA 5J3JA 1RXWA 4X65B 4Y0VA 1S7CA 3D4IA 4CI0B 2OZLA 4RA6A 4V03A 4FQ5A 3HH8A 4WL0A 3ROEA 4H17A 1QORA 3BH6A 4E1VA 2JRLA 3KPYA 3MPUA 4QPPA 1KJ9A 1L1RA 5CDHA 2DC1A 4ZTZB 4L3OA 1TMGE 1TTPB 3RJ9A 1VE6A 3DE0X 3FVWA 3MPOA 1U7OA 1ESEA 4ZOLA 3SMQA 4RSGA 4UNSA 1GR0A 3JQAD 1FNDA 4I8XA 1GG2A 3MRXA 2C07A 4M0MA 5IASA 1WCV1 2H7CA 4NOLA 3WNBA 4NBSA 4EVRA 4IKEA 5FOWA 2VS1A 2F3PA 4MEAA 1HQCA 2W9XA 5T4BA 4BN0A 4QU0A 4UDOA 4D42A 3ZK8A 3TTXA 1FMFA 1EFPB 4RM2A 4W5OA 4HPWA 1WW3A 2I2WA 3NBYC 1B0ZA 2FKAA 3NUZA 3UKDA 2FPUA 2AXNA 5DRYA 4XW2A 5A0VA 5DGXA 2AEMA 3ZZTA 1M2WA 2JGNA 2WP8J 2IP2A 4W9RA 4YJFB 2I7XA 3PNQA 1KYIA 4FKZA 2LCFA 5C53B 2DEUA 1LLDA 1I2BA 2XUOA 4C78A 1QYDA 4CTNA 1DL5A 3DZHA 2H4FA 2X13A 3OIGA 3B3AA 3R3WA 4AO8A 3G5MA 3WLLA 3SHTA 2IECA 1AMUA 2RCYA 4YCBA 5T5QA 5FWYB 1N1EA 2UVQA 2WV7A 2WVGA 2REXB 2PRKA 5GJWC 3LUJA 2GEUA 3UAVA 4Y0NA 2IV7A 4XUGB 1QB7A 5KYGA 4BKRA 4IXJA 1ZGBA 5DGCA 4NZOA 1RPTA 4PYJA 1TF7A 4IKPA 4CODB 5FBVB 4RULA 2R0QC 2YZKA 5JDCA 5AM1A 1LK5A 3OOWA 5TNXA 3BMCB 3SJUA 1IULA 1XTJA 2JS7A 3PWTA 4X7PA 5EINA 1O1YA 4P32A 3FOWA 1W25A 1PKEA 3ISVA 1E3DA 1RLMA 1RZUA 1W48A 1SVNA 5FH9A 5IKMA 3MFYA 2XGJA 2C7PA 5EIFA 3TWOA 1GPNA 4Y8VA 1F6BA 4OLBA 2QRPA 1AKEA 5FTMA 3RAGA 1GUDA 3EWNA 2FPGA 4G0QA 3WL8A 4DSOA 2PG3A 4Y2SA 4HQRA 2AG5A 5GY7A 1GA1A 4LE1A 3DMYA 1G18A 2PH7A 1XVIA 3AJEA 3WICA 1ZJ6A 1Y81A 3GGJA 3BCRA 1X7XB 1DP4A 1ND5A 4UBLA 4CKEB 1E2NA 2JDIA 2NSLA 2WT9A 1CQIB 5T4HA 3B1VA 2Q6KA 3F2IA 4MRSA 2WU4A 2BEWB 3NT2A 4QYIB 5BO5A 3U0BA 2ZK7A 2AZ4A 1FFGA 4E22A 2VTVA 2N9UA 2O1XA 2I6UA 3DB2A 2VDLB 3F46A 3WL4A 3R23A 2GLXA 3P9IA 3R7WA 4JFAA 4OHYA 3EULA 3FB1A 3ITEA 4ZODA 4N3NA 4CU2A 2BMJA 4JJKA 3WHLA 4AI6A 1FVHA 4LDJA 2ZEJA 4FSDA 4OYRA 5A4FS 1Z0AA 4KR7A 1JB1A 3F1LA 1YR9A 2QWXA 4PXAA 6YASA 3QEOA 5JVDB 1P81A 2F59A 5COQA 2FE4A 5ALTA 4F38A 3SDBA 4KIGA 3DOUA 3QFCA 4ZI3A 5ITWA 4ZPXA 1ATIA 3SI7A 2YYSA 1FF9A 1GSIA 3NDIA 1ZUNB 4IHJA 4PWYA 3P0HA 2WLSA 3A05A 3S81A 3LMKA 4RMGA 1MT3A 3B82A 5ED4A 4TV8A 5TPWB 1R12A 4MW5A 3OWHA 1KI6A 1EU1A 1E3JA 2BTEA 2G9ZA 3VXKA 3GFBA 4PCLA 1K89A 1JZSA 2QRLA 3CNOA 3SM9A 4ZJYA 3R24A 1XBTA 5KU7A 3U60B 1S8OA 1GG8A 2V54A 4QG7A 1NSFA 2F7SA 4CNBA 1V8ZA 3LC2O 1B8NA 5IAGA 3KAQA 2KBEA 2YOGA 2RGAA 4S0XA 1AKMA 3ZPXA 2X5OA 1RJ9A 1TQ2A 3A9UA 1LBEA 4KODA 2OLKA 5EPEA 3LY7A 1N2XA 1SIOA 3A6DA 1Z9BA 3P4XA 1FMTA 1YZHA 3IILA 1BH6A 5TGZA 2AFVA 4AIRA 2GCEA 4UVIA 4X0EA 4D80A 2F3TA 4L9SA 4QSHA 1A95A 2Y1LA 4H31A 1K8YB 1X1RA 5KTPA 3HXMA 1EGQA 2O2CA 2QNRA 4WGGA 4B6QA 4ZEXA 3DE7X 4XX0A 1T5HX 4GM4A 4LV8B 2CE2X 5EYPA 1U0LA 2WYUA 4TT3D 1CR0A 5FAKA 2FI1A 3L7OA 4JITA 3VR6D 2WI8A 5EUQB 2VOJA 4WTOA 4C0HA 2AFIB 2H06A 4X71A 2IV3A 2WFAA 2VUUA 1D4FA 1P7VA 2DWCA 1DQSA 2FWPA 3GJQA 4I50F 2VR1A 4Q3KA 4QRIA 4TUYF 2QTZA 4RL4A 5HCIA 5JAZA 2R5FA 3FTFA 4ZK2A 3QE2A 3ZQ6A 3ND5A 1ITZA 3ODPA 1ZD1A 1VYTA 2FX5A 2XQIA 3O94A 3FLEA 3IQZA 2CLLB 2GOYA 3JZMA 3CX4A 1LA2A 3BXOA 3G2PA 4IIFA 4M7RA 5FPTA 4W7SA 4WBXC 5FL3A 2I4IA 3CLSD 1OBFO 3PJFA 4WK4B 5AKLA 1UUFA 1FP4B 1Z4KA 2XCIA 4FYIA 3M2PA 5LP6F 4DV4B 4CKCA 2EHJA 2X7JA 5J47A 3BJZA 4BP3A 1KZGB 3CV3A 1OTXA 5B55A 4OHPA 5CMLA 1ZQ1A 5FPSA 3IDSA 1VP9A 4D3FA 2GR8A 2Q99A 2LBPA 3GRRA 3ET5A 2FMKA 4FC7A 3VZBA 1IIRA 1HKUA 3TINA 3ONFA 3T5GA 3SYRA 4L51A 4V38A 1C4XA 1J70A 3HFJA 3QP9A 4MW2A 1ZI9A 5JCJD 3GDOA 1NFFA 3GB9A 4BC0A 2MTBA 1DBWA 2JF0A 1C0LA 2Q2NA 3VDNB 3SYTA 1OD6A 3TSYA 1RP1A 1UIRA 4BHRA 1ECLA 2UDPA 5IBCA 1SM4A 4HNUA 3H4VA 3LHSA 1W85A 3QHPA 3G1WA 2CHGA 4HLUA 4KREA 4M6WA 5CIQA 2XCRB 2ZBEA 4L9AA 3DPIA 3W4KA 2GAOA 2IQ5A 2PX5A 2IYUA 2UUAB 1NWHA 2X15A 1Y0BA 5D3ZA 2GVZC 4DSTA 1BSVA 4NFLA 4O4IF 1LS6A 4FOLA 3ZTWA 2B7CA 1SXJB 2HA4A 5JDIA 1K0FA 4DLWA 2FPIB 5DBGA 3GZJA 4DMKA 4V1CA 4AJEA 4RKYA 1YXMA 3UJBA 4LF6B 1JS1X 1YZKA 2JCVA 3KQQA 5HIKA 1L2TA 4GDMA 3UK2A 1U02A 3HB5X 3GMIA 2ZBPA 3RIYA 3TRJA 4TVSA 3VU9A 2NT3A 1W88B 2I7TA 3M9LA 1XV5A 3PUJA 4TVOA 4Q9JA 4BO1A 1W0JD 1KTIA 1JEYB 2CNDA 2GBLA 3PE4A 4FE4A 1CSEE 3JQ6A 1ECJA 4MA0A 2X6QA 3M2TA 1QR2A 4UBKA 1P75A 4JXJA 5FYDA 3MJHA 2G04A 2JFOA 4HYQA 3U3MA 2NTNA 4JK3A 3VO9A 4C4YA 1MEOA 4ZU1X 2W2KB 4Z0PA 1TRHA 2XKBA 4LYEA 5F9MA 3X1WA 4W9MC 2ZB8A 4P3OA 1RLUA 4AJ9A 5KYWB 3S2IA 5C7YA 5EUBA 5KQLA 4ZOEA 1BEZA 1ORRA 2AMVA 3QKSA 4LZWA 2P78A 1WG8A 2NXEA 4YAIA 1XDBA 2G1KA 1A9SA 3HJTA 3CLSC 4R9NA 4DRZA 5KAPA 5JD4A 2GCIA 4PO9A 3WISA 5F35A 4PWZA 1NG1A 3ETDA 3ZK9A 2X2EA 4CMHA 2YVQA 2XKAA 2XW6A 1CVLA 1TJ3A 4G5XA 3T5AA 5IBQA 2O48X 4L5AA 1KSHA 4ES6A 4HGRA 3UA3A 4TV9A 3HJBA 1ZOSA 5DNUA 3ZJTA 2CVPA 4ME6A 4FD3A 3CBGA 5I7RA 1UDXA 4Y6LA 4K05A 4H4CA 1OGIA 1MO5A 1YQDA 3NONA 3EWAA 1EZ1A 1R15A 4PTZA 5CT5A 3EZLA 3TD2A 2HJRA 3E53A 1WZ2A 2AK3A 3FWKA 4U7FA 4UE3S 1IHUA 3USZA 1Z56C 1ETUA 2X2PA 2AG6A 5DN6D 3DKIA 4H18A 1KFCB 3E9NA 3OZCA 3PGXA 3CFYA 3BXGA 3ICPA 3R6LA 4GPTA 5AHOA 4YV1A 1ISRA 2FQXA 1OFTA 2OBXA 2X8LA 4UVEA 1J1UA 2UVPB 3OEWA 1SK8A 4M7WA 5B7GA 1XD9A 5D87A 4FYMA 3PQ4A 2ISSD 1H69A 1SUIA 5K3SA 2R6DA 3RRJA 5AW6A 4YGXB 1OKKA 2J85A 3RE1A 3K0AB 1N32B 2CDBA 4BRUA 3FXAA 5FFMA 3CEAA 5I9SA 4F6RB 1NPTO 1SU4A 2OBBA 4I4TA 4ZDJA 1KHHA 5HMMA 3SEZA 3GP3A 1J22A 3GPDG 3PNYA 2HUPA 1OH5A 2BP7A 2P0YA 3GNLA 4LXXA 3WQBA 2IF0A 3DMDA 4N41A 4JYBA 4WJKB 3BE6A 2WD8A 4LZJA 4FBGA 3C3CA 4NESA 5AKYA 3V55A 4E5PA 5A4MS 4LY6A 2XITA 4YEDA 4Z8YA 1XYVA 4MEBA 4ZYTA 2XXAA 1TYZA 4L8YA 4R68A 2MSLA 2VEDA 2XVYA 3MLAA 1SOMA 2HRZA 3O3NB 3OBBA 1ULHA 1OV4A 2IEAA 4BVJA 2XUGA 1HT0A 2J0QA 2QX7A 2OBNA 4URWR 3WLOA 1ZPDA 4QUDA 4X6XA 8ATCA 3B9QA 2PX3A 1QZUA 2WHYA 4LI3X 5JSYA 2H11A 3B8HA 3EC7A 4RWEA 4MZXA 5ESWA 3FKQA 2YS7A 5CFZA 2FEMA 4IMPA 1XQXA 4R1SA 1WETA 2JFUA 4QTTB 3LDHA 1L7QA 1NXPA 4WT7A 2CYCA 3LYHA 4LA4A 4KDRA 1KO7A 3VJMA 3AVXA 4CDNA 1CR1A 1GKYA 3F98A 4D4LA 3EGXA 1AO3A 2VP4A 2DH6A 3UC5A 3OQMA 4M0FA 2DTXA 2HPVA 2HBQA 3IKVA 3VYTB 4YLEA 5EJ9A 4PAQA 2O0HA 4KOAA 5IVIA 1XNJA 3AUFA 4N7JA 4WCDA 2JAUA 3V4ZA 4TKVA 4UUQA 4XM2A 3WK4A 3BD6A 3D7MA 4M1TA 3VPFA 4WBNB 1DXYA 3FH0A 2QY6A 3K8YA 1I14A 3SXUA 1JFLA 4C6SA 2EG9A 2FZ4A 5G2OA 1RAEA 4AP5A 1NF8A 3F73A 3MLBA 3V4SA 3FR8A 1B0AA 3KT3A 4O1HA 5C2JB 1THTA 4ZIRA 4AWBA 4AIIA 4ZQHA 2HCFA 3PENA 4K6GA 4OU4A 1ISMA 4UM9B 1HETA 5C8XA 4R3UC 3H1EA 1EK6A 1PW7A 3D4OA 3NU1A 4AKEA 1YBMA 2VXYA 3LCJA 4Q9DA 1MT0A 2RHWA 4UUNA 4XQ0A 2FWNA 4AAYA 3ZWOA 4CKBB 3UJAA 2O3RA 4G4GA 2EKBA 5EWLA 3UH1A 3HACA 1E6CA 1Y33E 3E5MA 3G2NA 3SN6A 2VKQA 4JHLA 4M60A 2I91A 2B94A 4H3HB 3KX2A 5FOUA 4FNOA 3LQYA 1BKSB 3LBIA 2FSPA 4FMPA 3ZN2A 4BUJA 2PUGA 2F2TA 2G25A 3B6IA 1FDVA 5H9WA 3W3ZB 4F86A 1J2YA 2XNDD 2ZJ7A 3PQDA 4L5CA 4ESEA 2IPMA 1CF2O 3N1UA 4HDAA 2Y6UA 3MJFA 1JVNA 1G5TA 1YU9A 3IHLA 4B6RA 4P7BA 2BJVA 4PPFA 1EGVB 2IEIA 2XODA 3DA8A 2DHQA 1TYBE 4B3DA 1KEZA 3JRXA 1LSSA 5B12A 1HORA 5F9FA 3FB4A 3LQ2A 1XU9A 3ONWA 2B69A 4V3BA 1AHPA 3HLKA 2G9RA 2AJBA 3BIFA 3B1YA 4PG6A 2A5YB 2IELA 2ZS9A 3HU5A 3L79A 4CUZA 3SKVA 1MPXA 1L4GA 2QORA 2AG0A 2P9QA 1E3LA 5AKEA 3BS4A 3KJXA 3C3YA 3W7BA 1GQ2A 1MB4A 1P18A 3GEBA 2V7TA 4IV0A 4UC0A 2X2OA 4I2VA 2A7XA 1G98A 2PSHA 1K2WA 2BI4A 2QIPA 4LMRA 5HOEA 2NADA 3GFRA 2HIMA 3ZXUB 1I9GA 1N2OA 5H59A 1FY2A 3G8CA 3RWOA 3Q7IA 1MC5A 5EUMA 2W2TA 3FTNA 1Y7HA 4YHBA 2C8LA 1UJ4A 3KZMA 5D84A 1XD2A 4GOMD 2QGZA 3OM1A 4G07A 3UWMA 4B6SA 3DVLA 4IGAA 5ESRA 5CH8A 5CLFA 2BMEA 4TKUA 3TNLA 4PSCA 1YDMA 4XA8A 1A97A 4D46A 1GGMA 1E2QA 3WKCA 2B8EA 4IYRA 5HMLA 5JNTA 5CHEA 4JC8A 1QE5A 1NW7A 3QKIA 3W5UA 1V8DA 2TS1A 1E0KA 4G8DA 2OHHA 4RSHA 4JDPA 2P9HA 1H8HA 1XZNA 2GD1O 3O5AA 3QSYA 2E3JA 3AGQA 5KINB 4EUSA 3LPDA 4DMGA 3E9QA 2C2HA 5F7ZA 5KVVA 1ZJ4A 3ISTA 4KRGA 3AF1A 2C00A 2B6HA 2H8GA 3HDQA 3M6MD 1TCUA 2ACEA 1BHQ1 4QBIA 4QPDA 3RI3A 3E9EA 1BS1A 1K2VN 5C34B 1Q1QA 3G2LA 2W2XA 3H1GA 4YJ3A 3VTFA 4CM5A 5KJFA 1R0RE 4YCAA 1F17A 2PUWA 4EK9A 4LWOA 2G77B 2TMGA 4B3XA 4K2HA 3ITDA 4O4LA 3EUAA 3VR2D 4CIDA 5HJ7A 1YI1A 4RK7A 1RMTA 1JR6A 1P5HA 4OJMX 2A54A 3HSKA 3A2LA 3PFCA 4AY5A 5GIOE 2ZZNA 1SXHA 5CNKA 5GMOA 1U0TA 2H57A 1M3SA 2PS0A 3O47A 1HA3A 1GGFA 1R4NB 4R0VA 1EINA 2FV8A 3ICVA 4KVFA 4PX3A 3RSHA 5CW2A 1EEXB 2A9KA 1VG8A 3IXLA 4LHYA 1FYXA 2FPLA 2P2SA 4RZ3A 1K3TA 1X3LA 2NO4A 4QYSA 5F1KA 1H6DA 2Q0SA 1D2EA 4KWHA 2OM6A 1DIOB 3NC1C 4ODIA 4UFOA 4X6LA 2EJWA 1PEDA 3WFIA 4IJVA 3W79A 1USWA 4D92A 1AF4A 3FCYA 3O03A 4MYHA 1XEWY 3NH9A 1L7XA 2XOEA 2J3HA 2W2LD 3EFOA 4JNCA 3RVKA 4ICIA 4HH4A 1CIJA 1Q0UA 1JLHA 2X8WA 1SVIA 3ZYZA 1A9ZA 4J0EA 3L4JA 3VISA 2AIRA 1U7UA 1SULA 1VCMA 3HVRA 3H2JA 1VKNA 4TLLB 4YUAA 5DHPA 2VVTA 3HTXA 1UZMA 4I4IA 4EW1A 2WPDD 1XJ5A 2FPKA 2X22A 3GQBB 1NDHA 2F1RA 3GRUA 4GI7A 1X92A 4HVTA 1E18A 2VBFA 3V4VB 1EWRA 1LV8A 5EQDA 1CUJA 4UTRA 2C54A 2OWDA 3N76A 4J2TA 3V8PA 5MN4A 1W4RA 4ACAA 4HRVA 2OLEA 1F8GA 2JGDA 3G8AA 1WPXA 3K53A 3BE4A 4ZVRA 2YW9A 4CWAA 3TG2A 1TAUA 3OEYA 4RE5A 2GF0A 1G5RA 1MO3A 1BA2A 1Y6JA 4P84A 3Q2KA 1N2JA 2NUBA 5DBHX 1NI4A 2C5AA 2XYVA 4NE9A 3QX3A 2O8VA 1M1ZA 2NXWA 3MB8A 3HDJA 2RB5A 4GEGA 1J0BA 1UPXA 4YT2A 3CZPA 1PHRA 3N39C 3DTYA 3FNGA 3Q3GE 4QUBA 4U7TB 3WGZA 5BUCA 3FG9A 5JNSA 1R0YA 4PRLA 3RU7A 1YJAA 2QZ4A 3NZEA 2G5PA 5DCYA 1PX2A 2RH4A 4MINA 2P6OA 1JJIA 4YI5A 4TLDA 3FDJA 1GOTA 4G9EA 5IAEA 4N01A 3RU2A 3BXHA 4CG2A 1KYQA 3O3OB 2Z5VA 5GJBA 2WWHA 2QL6A 1XZMA 2DRIA 4NFYA 2LUOA 5I7EA 1W4BA 2UXBB 2VJOA 3RS9A 3WA7A 1YS6A 3BG5A 1ULSA 3AKCA 3VAYA 3ENKA 2I3GA 1WBBA 1YUBA 2FMXA 4HNTA 2IZ6A 2CDCA 2QMOA 4MMZB 2IS2A 3V1YA 3N7AA 3I0ZA 1GQQA 1A2KC 1YRQA 1CRQA 1EFPA 4BBPA 1P5ZB 1JI0A 1T0PA 1YQUA 2JFVA 4Y2YA 4EKIA 4PTYA 2E4ZA 5JMOA 3K6RA 3RT1A 3ESBA 4UHCA 1WWKA 2RKBA 4D3SA 4YJFA 1COWA 2FPWA 5B3JA 2H63A 3VR4A 3WGTA 2J9RA 1GQOA 1RAAA 1QRRA 3WLSA 1NUHA 1XALA 4RCZA 4JD5A 3EZGA 2Q6OA 4LFBB 4EH1A 2GK6A 4XWKA 1U2QA 4A1FA 4OXKA 1M1NB 1CZKA 2V65A 1OI4A 4C7VA 3K09C 3GLFB 5FWYA 3C5CA 3MTQA 1VSQA 2DECA 1D03A 4L6CA 4LV6A 4YV2A 3ZWWA 4URVR 1OVMA 1AUQA 4C0JA 1U1DA 4M8SA 3F6RA 4K6KA 5HTKA 3E3AA 2I9PA 1ENZA 2QTAA 3BHNA 3KSUA 3OO0A 5AVOA 3TLKA 1V45E 4EHHA 1SC4A 2HSWA 4QUIA 1OXSC 3A32A 3BMCA 3C1UA 3GLKA 3PUHA 5JRZA 2O14A 5LZ7A 2HU2A 5GP1A 3OPYI 1T36A 3D0OA 3DMHA 2EKDA 4KSCA 3T35A 3DV9A 1SQFA 4GMGA 2Y4NA 2BKLA 4QPJC 3C3JA 4FDUA 4YROA 5FULA 4AUKA 4BTVA 2RE8A 4X1OA 2ZR7A 3FJOA 3GGOA 1SQ0A 1QF7A 3BIXA 1PDWA 4FYKA 1ZEMA 4YX9A 4EYOA 2OP1A 2VT7A 4ZOAA 2G1UA 2Z3VA 2ZPUA 4OB6A 1C0PA 1P5JA 3Q5EA 4DG5A 2JFPA 5K8UA 2W6MA 1CRWG 1X7XA 1JDJA 3K9WA 3QZUA 4IVNA 4URUR 2VH2A 4AXBA 4LISA 1VJCA 3ZE6A 1ZOIA 4QYIA 4RZIA 1JZTA 2BEWA 3C8DA 4Q3LA 5AVXA 1HQYE 1Q0PA 1G9SA 2GN8A 3HHEA 2QLFA 3IODA 4MZDA 5G0UA 4AX4A 3SVLA 1THGA 1T34A 2C1XA 3CXUA 4PIPA 4LGMA 1IOVA 3NTRA 4JL8A 4OK3A 2CD7A 3T3PB 5I7FA 4YRQA 4CCAA 3P20A 3P9NA 4AP6A 1GD1O 3QRWA 3ZU3A 4LK3A 2LD4A 1HXHA 1W1IA 1P1CA 2ZB2A 4QL3A 4E03A 4LJLA 2V7QA 3B13B 2VRNA 3I5XA 5BN3B 1HEYA 4G5YA 3CLUC 5FBKA 1RLIA 4BNXA 2PSEA 5FO1A 1ZCFA 3FZGA 1X9GA 2FHPA 1HV8A 2CHVA 3FVTA 5JVDA 4WLUA 1CY8A 4RFVA 5ECGC 1MORA 3TEFA 1G19A 3EOBI 1Q6YA 4LSZA 5CT6A 4ARCA 1GJRA 5EMMA 3VNQA 2JH3A 4JEUA 3T1OA 1OC4A 3U3ZA 5LA6B 2IEGA 4D79A 3R2JA 4NOKA 1ZUNA 1MH9A 3FPFA 4BNGA 3I2IA 1D0SA 2E5WA 3NHBA 3B70A 4RU1A 4RW0A 3KEOA 5DIZA 5K7SA 3GLHB 5TPWA 3FWNA 1BKDR 4JYZA 1WOYA 2WY2D 1N9GB 3VRHA 3GV0A 4U39A 1IDN1 2QN9A 3AM1A 2FPRA 3QY9A 2GKOA 1W76A 2W0SA 3CQ9A 5AJTA 1WCIB 2OSBA 4M8NE 3X1MA 3AR6A 5DULA 1E2GA 5G41A 5AVYA 2N42A 3PQ5A 3OE7A 4ZT6A 4D57A 1VJDA 4FINA 2YJGA 3WLPA 1M6VA 4I1PA 4ZHQF 4U2DA 1RYZA 2HBYA 2V3WA 3OD1A 5DMXA 1C41A 3Q12A 2YJ6A 1KVSA 4OQEA 3WLFA 5JO9A 3CLRD 5EJAA 1QVAA 4ALIA 1PT7A 1RNLA 4JJAA 1GARA 4LE0A 1PEKE 1RCFA 3FLBA 2Z1MA 3TQIA 1X15A 1YUNA 5KVAA 4KRFA 1G1AA 1Z5PA 2V45A 1DQZA 4Y6PA 3RS4A 3UHPA 3ETLA 1XFDA 3FA2A 3M5DA 3ZIDA 4JZYA 2O2EA 3C85A 4BU1A 2FYTA 4DNQA 5GPBA 2VHTA 1HEUA 2CL7X 4PC1A 5DNVA 3N0XA 3PCTA 3E03A 1HFEL 3IP6A 1EGMB 4K81B 2Q7OE 2XHEA 4UNPA 3B78A 5I5GA 3RROA 3R5SA 2X0DA 4DJAA 3FSGD 3HLTA 5F4ZA 4HMOA 3Q8MA 4DILA 2PQMA 4UAGA 3JWEA 2OGSA 5AIBA 4JXXA 1JDZA 3ZWXA 1D4AA 3PUWA 3G7UA 3ORYA 4NMXB 5I7AA 4CQNA 3R40A 4KN5A 4Q7QA 3VTAA 1X38A 2CCJA 1B3BA 4OEHA 4EO7A 1C0IA 2WSBA 1AMNA 2C84A 1LZLA 2LP4Y 1YJ5A 2O0JA 2X9GA 3DFZA 3MOIA 4W9NC 2VYVD 3H7IA 5TMPA 2WSYB 4I2NA 1FP4A 3SBXA 1FYVA 2VDPB 4LPSA 2A0YA 4Q4HA 3NOQA 4RJ2A 3CN7A 4X9XA 5C18A 1ZZEA 5FF9A 2GHIA 3PC6A 4F3TA 1LFDB 1ID1A 2B99A 4G56A 4EY3A 1QHYA 4CF6A 2Q6VA 4QYXA 3CZQA 5K3FB 4W9NA 4YAGA 1ZA2A 2VSNA 3EUFA 2OBLA 2WYIA 1RYMA 2O6HA 2WWWA 4LJKA 1B1CA 4QAJA 2GW4A 1EZZA 1PGPA 1WM1A 4X94A 1P7ZA 4D6PA 1DMRA 4QQKA 2PUJA 3DDZX 4Q9LA 5BW6B 3LCCA 1L5YA 3K2QA 2D5CA 3ZWNA 3KHUA 3L7AA 4G0ZA 4BZPA 1HEIA 1G7SA 4ZALA 4CF3A 4LWQA 5GAJA 3G0CA 4N0QA 4JQOA 4RABA 4F60A 1EPUA 1LLUA 1TA0A 2W22A 1H4VB 1ZM9A 3LWBA 1V35A 3EMKA 4PVDA 1N6RA 1NQVA 4CGYA 4BY9E 2BZSA 1V5IA 2C3PA 4PG8A 5JU6A 1DIGA 3N8HA 1V3TA 2NIPA 2QTTA 3DTVB 4M0LA 3TGPA 4FU0A 1TW3A 4KXMA 1OBOA 1RTKA 4C03A 3JTMA 1PJZA 1FFDA 3TL6A 2H7XA 1SXJA 3SG0A 5DNYB 1Q7GA 3QVTA 4F5YA 3ONNA 2FPIA 3T7JA 4UPDA 1U8ZA 3CLRC 3WLNA 2B83A 1NQ5A 3QYPA 4JYMA 4UREA 1TAQA 4EYKA 4J2OA 1EJ2A 3FRJA 3H9EO 3T5DA 1Y6FA 1OX5A 3AONB 1RDFA 3A3PA 1Z13A 4WUTA 5CW1A 4E2XA 3TX2A 4DEYA 4MWTA 1W88A 2Q3CA 1S9DA 1SCUB 3IA2A 3IP5A 5CFNA 4K6MA 5DISB 1JEYA 1GEEA 2H51A 4PM4A 1C7ZA 1XMQB 1LRLA 4PV7A 1N6NA 1PJ2A 2B7LA 2NO5A 4P3PA 1IZ0A 4CL8A 4AF7A 1I4OA 3QYJA 3PNPA 5HIMA 3W5JA 1MDFA 3TYXA 1ZSNA 3HJGA 4BQQA 4ZT4A 2W2KA 3TOZA 1JIJA 3P4UA 3WK6A 3QFTA 2INGX 3RUHA 1KP2A 1ODLA 2WKRA 5KYWA 4KWIA 5CNMA 1UJNA 1CDZA 3GOQA 3OT4A 4Z54A 5LSAA 2RI6A 3GEPA 5HBGA 3WMGA 1XI2A 2PPVA 1PGOA 2SKCA 4J8PA 1IWPB 1YJ8A 1Z0ZA 4U6SA 4JBWA 5CNJA 3TM4A 4BFYA 1FP7A 4ENTA 4HVCA 4R0NA 1K0UA 1GQYA 4K9DA 2WPNA 5EXSA 1VKRA 2DBYA 5AJHA 3NWOA 4L07A 4TQUS 1X86B 4YRLA 1PNVA 4COKA 2OZPA 3AGPA 4R31A 4RDIA 1MGPA 4R1UA 1O6FA 4XB6B 5EXTA 5IM5A 4MHTA 1W0KA 4EY5A 3T7IA 2V8BA 3QELB 3VVLA 2W6ID 3DFKA 1Z38A 2WKQA 3KKZA 2QU7A 3ISJA 3UMGA 1ZNXA 4AY4A 2JA2A 1VE3A 3SQLA 1P80A 4M86A 4DPLA 1TYCA 4A0GA 3FETA 4AMBA 1ZD2P 3ND7A 1SXJE 2XNKA 3QVJA 4OGFA 3D6AA 5ALKA 3NBZC 5HG0A 4P7GA 3PFBA 3TIGA 2B2CA 3DSRA 3EVZA 3VU3A 4FZRA 1OZ0A 2UVPA 3NTVA 4F46A 3G02A 4XDGA 1OMOA 1L5ZA 1U5CA 1OOEA 2A0FA 2FRDA 2H4HA 1TMKA 3EAQA 5TS3A 1K4KA 2WA1A 3K0AA 4IMJB 3RASA 4GFDA 1GLNA 1MAHA 2V6FA 1QUFA 3MMZA 3S29A 5D7BA 4QREA 4EHFA 3PT5A 4F6RA 2ZJFA 3LC0A 1CQWA 1N3YA 4Q6BA 2ZQYA 3PC8C 3D8NA 3KLOA 3N74A 4B4OA 1AN9A 1D1TA 1K75A 2HMSA 1QYXA 2QUIA 2YRXA 3IR5A 2H17A 3U31A 2GBIA 4TTIA 2H4YA 2L18A 3IXQA 1KHTA 4JBHA 3LC7O 2I6TA 4JQZA 5CHYA 3EVFA 3IAFA 3NOXA 3S5UA 4ZC1A 3PEFA 4G01B 3HA3A 2VFAA 3TQRA 1GZ4A 3PC8A 2XT0A 2ZS8A 4AF6A 4ZVKA 1NRIA 3KL4A 1Y9ZA 4LVNA 4PZ0A 2IEYA 5TQ0B 1ECGA 2QJOA 3ABRB 2BFEB 2B37A 3OQJA 4L08A 4EGFA 1AQNA 2B2NA 1I8TA 1X77A 3TZQA 3AZOA 2VNAA 2EYQA 3PDJA 5TS2A 5DBOA 5DX8A 4NEHB 2F3UA 5GVRA 2GEBA 3DNMA 3VNAA 3WV5A 4CMEA 4FMDB 5K0SA 2O8NA 4N54A 5J23A 2ZE5A 4DCCA 3K0FB 2Q1YA 1LGYA 3COSA 2H5JA 2Z8YM 2QSZA 3KVRA 3MWLA 3OEHA 1FRVA 1QRAA 3PYLA 1U1GA 1N1GA 3K2IA 4PLHA 2EF1A 2I2XB 2ZE7A 4HB3A 1L7NA 4OBEA 3A27A 4GQBA 3IQXA 4JC0A 4QBKA 1YRHA 3K0KA 4LFCB 3V7YA 4B6JA 2OILA 5KNLA 3MJ4A 2GBGA 1E1RD 2EL9A 2FX3A 3T1NA 4C3UA 2IWRA 2JIOA 4UMDA 2VQSA 1SKUA 4FHCA 3EW9A 2GM4A 4WBNA 3WX0A 1DKPA 1AK1A 4GICA 1TM3E 1CRLA 3QYFA 1RWMA 1M0WA 4JJIA 3SJZA 2DLCX 1ZNYA 2WUWE 5YASA 3SC3A 4RPLA 3WLHA 1HDOA 2E4AA 3IURA 4ZTBA 2ZTMA 3PE3A 2E87A 4BNJA 3TZBA 1FNMA 2G06A 1GV0A 4G2NA 2Z6UA 3DOOA 1W4AA 4Z7OB 3L4KA 2QEQA 5LYYA 3TL3A 2D7DA 2ZBQA 3P4YA 2OXIA 2OXFA 2GH1A 5CLIA 4CKBA 4K86A 2PE5A 5DOZA 1SHTX 3DUFB 4BLRA 2G63A 2JHGA 3AEQB 3FJYA 4FI3C 1ZH4A 2WK1A 3PKIA 5F1PA 1PZFA 3JD1A 3LTEA 2PRSA 1B4DA 3D5QA 3I92A 3TCXB 2YJZA 1PV4A 4FR2A 3QU4A 2JLWA 3D3WB 1AE1A 3GGDA 4HR7A 4YRSA 1J42A 1IVSA 4F9EA 1L3IA 2ZSJA 2IDJA 1MVLA 3RYTC 5A9TA 4YRIA 3ZTTA 1Q83A 4XVCA 1N0UA 2DTDA 4BYMA 1P91A 2H9YA 2VP3A 3UJ8A 2GBPA 2H00A 2CWWA 3KKOA 4BAUA 1OB5A 3N8KA 2GB4A 1M2NA 1PI3A 2QX6A 2ZTHA 3K05A 3PFGA 2A4KA 2V97A 3PC4A 4NU6A 4Y2UA 1UXJA 2IEZA 4OHRA 4L6AA 5A1TA 3KQPA 2PZEA 2Y1OA 3T5BA 4QUHA 5KJ6A 1HPLA 1VDMA 2PO7A 2WAXA 5HYVA 3UHAA 2FMHA 1DARA 5JWOA 1I1QB 1LTQA 1HQKA 3K5PA 3QPDA 4BBAA 4O1IA 3VR5A 1LBTA 2PFGA 3LBFA 2AW5A 5E6UB 1SRRA 3I01M 4H16A 2O59A 3EEBA 1ZITA 2CB0A 1JX6A 4OHXA 4UQPA 1VPLA 2VAMA 1QGED 1ZP6A 1YGYA 3CO5A 1K8RA 5EUCA 3R7NA 3REGA 1JJBA 3I9V1 3D3EA 3L8YA 3O8BA 3X2FA 3NV9A 1Q0QA 3DZBA 1DS6A 3LUCA 2QNIA 3OPNA 4N39A 4LYYA 3T3IA 3HEMA 3ODGA 3WTBA 5IN4A 3T9CA 3K6SB 4P0PB 5ERXA 5KVQA 5FOTA 1POWA 1ATZA 5KTNA 4I6JA 4JUAA