4EFKA

Pantothenate synthetase in complex with n,n-dimethylthiophene-3-sulfonamide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
289
structure length
280
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated biophysical approach to fragment screening and validation for fragment-based lead discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Pantothenate synthetase
total genus 91
structure length 280
sequence length 289
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4efkA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4efkA01
3SDBA 4ARCA 3ISJA 3VU8A 1NSYA 3CVUA 1U7XA 4FZJA 1TYBE 3FY4A 1WZ2A 1GTSA 2X3FA 3TZEA 3N9IA 5KCMA 2CUZA 3A4IA 1K4KA 3CLTD 4CDNA 1ILEA 2QUJA 4DDMA 1NUSA 3PNVA 3KFLA 4MW5A 3C8ZA 3TQIA 1J1ZA 2IELA 2YY5A 3E27A 4QREA 1IVSA 5J5AA 1U3DA 3PXUA 1EFVA 1OBCA 1WXGA 1JIJA 4MUJA 2BTEA 1K4MA 1N2IA 2X1LA 5KWVA 3CLRC 3UOWA 3FG9A 3OP1A 1NZJA 2YXNA 2YWBA 1IHOA 1EUQA 5DK4A 3HGMA 1I6MA 1MC1A 4MULA 3RJZA 1NYLA 5TGTA 1VLHA 4MLPA 3OTWA 4MWBA 2CT8A 3ZJVA 1EFVB 4EF6A 3L93A 1X8XA 1PFVA 1NUPA 1JGTA 2A1UA 4YBRA 5H16A 3DLAA 1MRZA 1N2BA 4KKVA 1OWMA 3FOCA 1IFXA 1H1TA 4WNYA 3N8HA 3IH5A 2E18A 3S3TA 4QBTA 4CT0A 4ZCTA 2A86A 2EJCA 2J08A 3G59A 4MWEA 4NZPA 3IOEA 2G36A 1OBHA 4UZEA 3RBAA 3AIIA 1O97D 4DE5A 4YP6A 1YUMA 2A1UB 3COZA 1JEEA 3H05A 4DLPA 4MUGA 4X0EA 3NBAA 1PFYA 3BL5A 2A7XA 1U7DA 1G8FA 2O5RA 1GLNA 1EXDA 1H3EA 1T6XA 2QJFA 2YWCA 4KR6A 4K0RA 4WSOA 2WQ7A 2DETA 2Z08A 1QRTA 1GAXA 2WB2A 4MW2A 4J75A 4TS1A 4F4HA 3ZJTA 5AHWA 3LOQA 1NUQA 2NZ2A 3MUEA 1IQUA 4MW1A 4MUKA 3IUBA 1JIKA 4ZCQA 2J5BA 3RHSA 3FI0A 2Z09A 4H3SA 3COWA 1M83A 1TYAE 2PIDA 2JA2A 5HUHA 1V8FA 3IMCA 4AS1A 1H3NA 2HMAA 3CR8A 3IODA 5IHXA 2QJOA 1R6TA 3GMIA 1NP7A 1T6YA 2BYTA 3UY4A 4EG8A 1M8FA 4U7JA 3Q10A 5TS2A 1ZJWA 1F7VA 2JAXA 4GRIA 5K0TA 3CVVA 5BNZA 1Q15A 2X0KA 1EE1A 1OD6A 4ND6A 3ZXSA 4JYZA 2V0GA 3CLUD 1KH2A 3ND6A 1B6TA 3VRHA 1QU3A 4MVCA 1PG0A 3A05A 3UK2A 2E0IA 3P0IA 1K97A 4G5YA 4ARIA 2CV2A 1BS2A 4K03A 2A88A 2J07A 3TS1A 3KT0A 4KPUA 1WXIA 1G59A 4G5FA 3ND5A 5JBNA 1JZQA 4PBSA 1MOPA 3ZXIA 4HJXA 1O95D 1MJHA 1WXHA 3AG5A 2A1TR 1TQ8A 3FDXA 3FIUA 4MWDA 2ZP1A 4XSVA 1KH3A 3PNYA 2PFSA 2E89A 3CLTC 3CLSD 1MB2A 3QE4A 3UC5A 1ZH6A 4RUKA 3X1KA 3SP1A 3LE8A 2OQ2A 4OUDA 2QJTA 2HZ7A 3AG6A 1MAUA 2GOYA 4EG7A 3KT3A 3TQOA 1I2DA 1ULHA 2VTBA 1TYCA 3TNJA 2DLCX 3P0HA 3CVXA 4MQ6A 4JZYA 3IOCA 3A2KA 2PZBA 1KQNA 3HV0A 2GKSA 1NUTA 4XFDA 4YP7A 1U3CA 4A91A 3CA8A 1KORA 1Q77A 5LM3A 3FETA 2J4DA 2IP1A 5LLTA 1PFWA 2O8VA 1RQGA 3IVCA 1J21A 1KQPA 2QUKA 4YP5A 4DDKA 4MVYA 2JANA 4I6EA 1WQ3A 4MUNA 1JZSA 2XRZA 4PY2A 2CYAA 3X1MA 3L92A 3MMXA 2QUIA 2CYBA 3IDFA 3FWKA 1J20A 2DERA 1J09A 1O94D 3H97A 1PFUA 3PRHA 4R0NA 4JXXA 4ZCPA 1JEDA 3ZIUA 5FO0A 4MAFA 4E1AA 5KHAA 5K0SA 2VXOA 4PBRA 4MWCA 1MBZA 1JHDA 1YIDA 4RPIA 4OJMX 2D54A 2QTNA 3K9WA 1KP2A 1NURA 1IQRA 4CDMA 1JIIA 1MAWA 1U0BB 1UFVA 2PXHA 3HFJA 3IOBA 1F4LA 3H99A 3RFFA 1GTRA 4HPWA 3VGJA 2A84A 1TEZA 1N3LA 2GM3A 2DR2A 4L2IA 3SEQA 1SURA 1G8GA 4L2IB 3GLVA 3IMGA 1YI8A 4ND7A 1VBKA 5EKDA 2CYCA 2ZUEA 1LI7A 1JMVA 1I6LA 1M8JA 1R6XA 1T9GS 4EG5A 4UZFA 1KQOA 1OWNA 2X1MA 1ZUNA 5HG0A 1QU2A 1FFYA 3INNA 1G8HA 2DPLA 1H3FA 1KKUA 1N75A 4ZT7A 1N77A 1T9GR 1S4MA 3ZGZA 4ZT2A 5TEWA 2H2AA 5DEOA 2DUMA 4DNXA 4I6JA 4MW6A 3U1VA 1WXEA 1WQ4A 4R2LA 3MLAA 1VBMA 2H29A 1O0CA 2RE8A 3AL0C 5DB4A 2IJGX 1KAMA 2HGZA 2R5WA 3SYTA 3TZLA 1KH1A 3JXEA 2RD2A 3RK0A 4MUFA 1F9AA 1VL2A 2TS1A 3MXTA 1JILA 2QUHA 2AKEA 1O96B 1Q11A 4MW9A 5IJXA 4MW0A 1IRXA 4ZT5A 2XRYA 1OWLA 2D13A 4ZT4A 1YUNA 5H7XA 4MUHA 4G6ZA 3SZGA 4EG3A 1WKBA 3SZ3A 4ZCRA 4JXZA 3MLBA 1NI5A 2CSXA 1FYDA 1R6UA 1O5TA 4I6GA 5FO1A 3K32A 4AQ7A 4S1OA 1I6KA 3DV2A 3KT6A 1GN8A 1N2HA 4ZCSA 4JFAA 2DXIA 4J76A 3IUEA 3DO8A 3KT8A 1COZA 3ELBA 4XFJA 3H9BA 4MVXA 4EGAA 1TFUA 5J59A 3Q4GA 3NV7A 3SEZA 5FNZA 1QRUA 1IQ0A 4EG6A 3IVGA 3N2YA 3GUZA 4NAHA 3COYA 4KR9A 2B7LA 2ZUFA 2QTRA 3LCJA 1M8KA 5LFAA 4EFKA 1MB9A 3X1JA 4NAUA 4F3RA 1NUUA 2DEUA 4HK4A 1QRSA 1KAQA 1K92A 3CVWA 1EJ2A 3DPIA 4Q16A 1A8HA 3G5AA 3HZRA 2J09A 1J70A 1LW7A 1OWPA 5HUJA 4MUIA 4NX2A 4BWVA 1KP3A 3AKZA 3UMVA 2CV0A 3HMQA 1P7PA 2AG6A 1PG2A 4R2MA 1QQTA 3CVYA 3N05A 1J1UA 5F23A 3CLSC 2V0CA 1KR2A 2PZAA 1WOYA 3P0JA 1N1DA 1ZH0A 1M8GA 4KPUB 2I1LA 4NATA 2VTBB 2EL7A 2OV4A 1M1ZA 3P52A 3M5WA 1O6BA 2NSYA 3G6KA 2AZXA 1O95C 3RK1A 1CT9A 2E21A 4DDHA 1OWOA 1EUYA 4PBTA 1DNPA 2A4MA 1O97C 1XNHA 1X6VA 3F3MA 3I05A 1GZUA 3H9CA 3CLRD 2D5BA 3COVA 4GU5A 1WY5A 3QTTA 1T6ZA 1N2OA 3D6UA 1VBNA 3ND7A 1QTQA 1WJGA 1WXFA 2CFOA 3ILVA 1XNGA 2Z3VA 3D6VA 3FHJA 1F7UA 1V47A 3A04A 4ZT3A 4NDAA 1Q19A 2PG3A 2QTMA 1TYDE 1QJCA 2PZ8A 4QRDA 5DASA 4EG1A 1YULA 1LI5A 4P2BA 1HYBA 2WSIA 3HL4A 1XNJA 4KR7A 1O0BA 1Y42X 1QNFA 4OUDB 4MUEA 3FNRA 3Q12A 3PNBA 4YMIA 1JECA 4CQNA 1N2EA 4HJRA 1N2GA 5TEVA 2WQ6A 1XJQA 4Q93A 1M8PA 1O94C 1EFPB 1O96A 4MW7A 2CV1A 5J58A 1YIAA 1N78A 1EFPA 4EG4A 3IMEA 2C5SA 4U8HA 3ZJUA 1N2JA 4MW4A 4DJAA 4ZT6A 4MVWA 3QTBA 3AFHA 1IH8A 4U63A 1D2RA 3FH0A 3CLUC 1GPMA 3NBKA 3IVXA 2A1TS 3ZUGA
chains in the Genus database with same CATH superfamily
2QLBA 3BMQB 1GZ7A 3OE7A 2YDYA 1KNXA 4QDJA 3CVUA 1KERA 4JI2B 1RCTE 1TYBE 2J5KA 3PQDA 4ER0A 2X3FA 1E7QA 4C4RA 1SR8A 2DCMA 3U5TA 2G7ZA 4M36A 4Q7QA 1E89A 4HADA 3U44A 2EARA 1CLUA 3A4IA 4B3BA 2VQDA 4DLUA 3QIAA 4CDNA 6NULA 3OZCA 1R7RA 1C0PA 5KNBA 4ECAA 1NNSA 3CWQA 3UPUA 3NANA 1AB6A 4YV7A 4Q6WA 4AX8A 2VSOA 4BP9A 1XRLA 2RHTA 1RBMA 1PR3A 2H7VA 5J63A 3N07A 5IKOA 4EKGA 2QYHA 3GJTA 4G0ZA 1YVEI 2JB9A 2XQIA 3HSKA 1CUAA 4ZJYA 1QAMA 1KO5A 5DM1A 2BTEA 2CZGA 4K88A 1RAGA 1CUYA 3QKUA 1GU0A 3W1EA 2OZEA 3RIHA 2AFRA 4C4ZA 1JX6A 1M67A 1USUA 2GASA 2X15A 4EJ6A 4LCBA 1QZZA 4O02B 4M2LA 3IC5A 1GA1A 4ALNA 5JQWA 4Y9UA 2H7CA 1TFRA 1TT5B 3IOMA 3N2KB 3RS5A 5JQGA 2JAOA 1BG6A 1VE3A 3HB1A 4HI0E 2HT1A 4AYWA 3K70C 2PO7A 4A2WA 4AUNA 1NNUA 5LQMA 2YUTA 5TDHA 3V7UA 3OY2A 3CW8X 4XGKA 2CT8A 2P5SA 1C7QA 2PXXA 3T4UA 1QTNA 3GP5A 1U1EA 1G42A 3GD5A 4UM9B 1X8XA 1XSEA 2PUTA 4UU7A 2WAMA 1C7FA 2QRUA 4KGZA 3QBVA 1UK7A 4L8VA 1E98A 3E81A 4XJTA 2CBXA 4QFMA 4HYQA 2GBPA 1T9AA 3D2CA 2Q2NA 4U7PB 2ZBGA 2Z5FA 3IH5A 3K8ZA 3U4IA 5FI0B 1E5XA 3T7EA 4BMVA 1NLUA 2Z4TA 4PO9A 2QM3A 3NTVA 5MGBA 4PYIA 1SCUA 3AUAA 1G5HA 1YZVA 3LPCA 5ENZA 1Z82A 3VKHA 2YH2A 3HA2A 4B32A 1LNQA 3BDVA 5ESWA 2OKGA 3F49S 4ZU3A 3T38A 2TMKA 4ARVA 4EECA 1GPBA 1NW8A 1RT9A 1LDEA 1H4VB 4MKHA 4CTMA 2RG1A 3IOEA 4H7DA 4YRQA 1A9SA 2HV9A 2P4EA 1VSUA 3AIIA 4NI5A 4ERNA 1R6AA 3THXB 4X3CA 2VCEA 2NVBA 3H9EO 5FBHA 1GNQA 3WYFA 3T3OA 3EFOB 3LCUA 1DKOA 2HNBA 3AR8A 3O8QB 2EKZA 5LIPA 4MH0R 3TUZC 1VLMA 1A50B 4B7XA 4F4IA 1EWQA 1Z15A 3NYWA 1JJIA 2XUJA 3A0RB 3V1TC 1MPXA 2K87A 4H4DA 1EFTA 3TIVA 4AG6A 2C82A 2G4LA 3DO5A 4LRUA 1U5BA 3D2BA 3KOMA 4P93A 3SNKA 3EAGA 2FY8A 1AKEA 4XWKA 1VE9A 1SIUA 2GILA 3OPMA 4EZEA 1X1TA 1U0FA 5NLLA 4QPZA 2FGJA 2XNDA 1OFGA 4BU1A 1Q2UA 5LC1A 2DETA 3DOCA 2QMEA 4R98A 4Q9AA 3AEUA 3FSJX 4ZOAA 4YRTA 4QZVA 5CIYA 1DRKA 5FBVB 3FFXA 5AOVA 5FQOA 4EF4A 4KQ1A 1E2EA 1GV0A 1NUHA 1QDLB 1H2RS 1PHRA 2D59A 5L3RA 3VHRA 3H1GA 1ZVJA 3WK7A 2X7JA 3QEOA 3OPXA 2ZB7A 1ZOOA 2GHQA 1JHQA 4KFSA 4C06A 2IYUA 5JYCA 3D7MA 4H0NA 4MVJG 2IXFA 4FQ5A 5KJFA 3SY8A 3AONB 1GUBA 2PXAA 1WCYA 3L6CA 4WK0B 2X7HA 3UQZA 3AL3A 4K3VA 1QWOA 2I0FA 2XIJA 2ZI6A 2ZSAA 3T3HA 4PXAA 4A8JC 2QL9A 2ZQZA 3KCNA 3L6RA 1ETHA 1ADFA 1J0BA 3A1DA 1DX9A 4BGUA 4RTLA 1Z0FA 1YZKA 2GCPA 2XCOA 1J8FA 4EG8A 1XAGA 4HMQA 4HYTA 2EHDA 3DXFA 4PHHA 4RK6A 5BW0B 3BFVA 4X1IB 3MCUA 1IOLA 1II8A 4OHFA 4I5EA 5CBPA 3K71B 3JVUA 2FKAA 1EE1A 4EPWA 4ZVLA 1N1MA 4DLKA 1H1LA 4EHKA 4DA4A 2V0GA 2BGGA 3O8OA 3BMXA 1EJ0A 3CLUD 2ZG6A 5JBIA 3AHIA 1GUDA 3GGDA 3D8UA 2FPKA 1BS2A 3HZZA 1ZH8A 1M3SA 3G1WA 3KNZA 4LCEA 2Z0MA 4JB3A 5C3MA 1CNFA 2YJ5A 3NC0C 2GPJA 5AVOA 4PSVA 2QJWA 4ADSG 1PWHA 1GVNB 2JEZA 3C3YA 1HFJA 2X13A 1LTKA 3FSRA 1ND6A 4XUDA 4A2CA 4PHGA 5INTA 3PUIA 3AG5A 4P84A 5F33A 3NJ4A 2YWRA 4FBLA 1LLDA 3HYRA 1IXYA 1F48A 3ICOA 3QG5A 5L8VA 1KYYA 2J6IA 1Z68A 1IJKA 4LSWA 4NOKA 4RDIA 2OYRA 3TX6A 4KWEA 3RV4A 2ZBDA 1MB2A 1N5DA 5G3YA 5AHOA 2C4VA 3RS9A 5L53A 2PWYA 2I9KA 4G0XA 3U7EB 1RMQA 3NGLA 4FB4A 3PUVA 3MN1A 1A95A 3QYPA 3IQDB 2OVBA 2XCLA 3G23A 4UVIA 4JXJA 4UBMA 2H3HA 4ZDWA 4LISA 3HCRA 3NV9A 3E0XA 1D1SA 4Q7EA 3QRWA 4Q4AB 2ZZNA 5EMJA 3ML1A 2W7TA 4V0QA 2XUGA 1VG0B 3TNLA 4BFXA 4YJHB 3H87A 1VTKA 3I4CA 2YVAA 4DADA 2FR8A 3ESQA 3OC0A 3C7TA 4ILEA 1AKQA 2XECA 3E18A 4Z7NB 3CA8A 4DTCA 2IYLD 1OW3B 1HGXA 4HAYA 4XPZA 1I7QB 2JRCA 3ONEA 4BJHB 3ZGNA 4US1R 3BSSA 4OTZA 2R60A 1VDZA 1C9KA 2HA0A 4MQFA 1MOQA 3LUFA 3R20A 1WQ3A 1CQJB 3OICA 5JASA 2KSQA 3FZEA 4LNUA 1E1DA 5CM8B 1CVLA 5ALHA 3QA3E 4CTNA 2I65A 4YUVA 3HEAA 1U8TA 1ATIA 1XTSA 4KSYA 4V2IA 1U3GA 3UW3A 1BX0A 5IH7A 2EVWX 2NUAB 4TKLA 1PFUA 4QVIA 4RD0A 3VM6A 5LOVB 3ASVA 1XDUA 3SR0A 4V0KA 3OWOA 2QPOA 1UDRA 4EMTA 3EVEA 1L8XA 2VJDA 1CR2A 3GUYA 1FLVA 2VXOA 1W88B 2GD1O 1GLGA 2WHEA 5HQ3B 3QOXA 2V3WA 4TTVA 4Q3EA 2B6HA 3B1ZA 1SWWA 4E09A 3C4JA 4E5UA 2QTNA 3LY7A 3HVJA 4J94A 1BS1A 2HXYA 2AYZA 4HLCA 4URVR 1Z29A 1GRCA 5FJJA 5CA0F 1L5NA 1HO3A 1ZBQA 4EHBA 4L9WA 2OA0A 3BGSA 2PM8A 5DNCA 2ISSD 1GTRA 1JEYA 4NJMB 3G2OA 1CY0A 1KSJA 5B4TA 5HJ7A 1EMDA 1NY6A 1FTNA 5TT0A 4KUHA 4KXNA 2BONA 2JFZA 2NUPB 3GLVA 3NVAA 3PUHA 4PC6A 4DRXA 2XB4A 3D64A 2ZRQA 2WHYA 3QU5A 4X93A 2M6RA 1V5WA 3JAWA 3M3HA 2CFIA 1T9GS 2V58A 1CUJA 1Z83A 3AMVA 3EGOA 1W5FA 2VF2A 3BTOA 4Q3CA 4Y0VA 2YHIB 4EUFA 1HUQA 2J9ZB 2VEDA 4HZUA 2JCSA 4N4AA 4R7ZA 1LXCA 3JZAA 5ERXA 4BNGA 2IWHA 5JDIA 3H4IA 1Z9BA 2JLQA 2A58A 2NX2A 5KTTA 2P69A 1RYYA 1X38A 3OE4A 3WYDA 1JWLA 2R97A 2B94A 1IZZA 4N8DA 1YD7A 4N5DA 3OTHA 1OYWA 2DUMA 1PZFA 4FSHA 4A16A 1VCNA 5JMTA 3QEBZ 2NYAA 1XV5A 3TCKA 1C9MA 5LQSA 3QKWA 1I3MA 4I5DA 4I8IA 3MD0A 5JFGA 1Y1PA 2OHGA 5AJYA 2EX1A 2XNKA 1EDBA 1WLSA 2G28A 3G7UA 4HS9A 3IAHA 4A1OA 2FRXA 5LQCA 1N5LA 3WB2A 4P53A 1I24A 2HJVA 2EBWA 2R5WA 3GEGA 1QFMA 5ALWA 3RUDA 4BRZA 3M6FA 1KVSA 1ISFA 1VHTA 2A67A 3D5TA 3AR4A 5ADVA 1NVWQ 3AYZB 4C0AC 3TBKA 3MTGA 1BFKA 1XD9A 2C1EA 2HTEA 4I7EA 4GPZA 2FFJA 2PUAA 1XMVA 3W1VA 4AW9A 1KGSA 4WKOA 4Y6LA 2XRYA 4D9FA 5TPZA 3OCWA 3M4ZA 1YUNA 1NFRA 3ZX4A 1NVDA 2BJWA 2MSLA 4MWTA 2CK3D 2W2KB 2JI4A 3RRMA 4B6OA 4EG3A 1IJBA 1GFZA 1IG0A 1L8LA 4G1FA 1QWSA 3AIOA 3DCYA 3U3DA 3UF0A 4BEBA 1W29A 2OK7A 3GIWA 4LS3A 4U6NA 1OB5A 3PWTA 1FYDA 4UUBA 1O5TA 3UAGA 2ZCVA 3IDQA 4AQ7A 2J5XA 1H2YA 3QITA 2I7CA 1PSWA 2R84A 3RSQA 5E1BA 3D3WA 3VC3A 1GFSA 3PITA 1I7NA 1AV6A 2PQ6A 2ERCA 2YY7A 2P6NA 4TRNA 5T64A 1FNSA 1X1QA 1Y1TA 1OYOA 1Z88A 2JFVA 1Q12A 3UJCA 4YIHA 4EY5A 1SHLA 4RD1A 2DXIA 4XJXA 3IUEA 1XL1A 3H1AA 4N0MA 3RT7A 2C9DA 5ALRA 4NXNB 5AW3A 3N5CA 5EIHA 1L5HA 2ZUWA 3DBLB 1Y9EA 1QIFA 3OEEA 1XD2A 1IG3A 1Q2XA 1SQ5A 2HHCA 3A3PA 3C0KA 5F7JA 5FR2A 3N59A 3G0BA 1V6AA 3EGVA 2HIAA 4YQEA 4IDBA 3GO4A 2B8EA 2ALJA 4WLVA 4QYXA 5KZMB 3DTVA 3WGQA 2ZJ8A 5AKXA 4ZZ2A 1HQCA 1SQFA 4DA8A 4HKTA 1Z62A 5HKOA 4MTCA 4W5JA 4DCCA 1RXCA 1M8KA 1GNPA 2GFQA 4J3JA 4RKFA 3SQOA 4DWJA 3U7IA 4QQRA 5H82A 2ZTSA 3O5AA 5CT9A 1U7PA 3W5BA 1TTHA 3VR4A 2C5BA 3GR6A 4E5VA 2I8AA 1JTFA 3QLUA 2CNOA 2YV4A 3MA0A 4MLDA 5KU1A 2MR5A 2PRKA 4I2VA 1ZIDA 4NU5A 2WNHA 4F4CA 3C1AA 3H65A 3KKNA 5EZ6B 1N7JA 5HA5A 1B23P 1QF9A 1NJ6A 4XR9A 1NTOA 4WKBA 2AG6A 1FUUA 3AB3A 3K53A 3MWJA 4JXKA 1JHRA 5JARA 3HLKA 1HYEA 4HDKB 1UBJS 4R9UC 2HYDA 3VC2A 2XBUA 4J3FA 2V3CC 3EMBA 1SVIA 3L8MA 2DB3A 2WBLC 1MEEA 5K0JA 4KPUB 4KVAA 1LVHA 4ZZ3A 4QG7A 4OB7A 4D25A 5GJBA 3P8ZA 3Q9NA 4E94A 1MIOB 4PE5B 3GEBA 4R51A 1OYYA 3FPKA 1ZVVA 4DDHA 3BH6A 5AW5A 1WLYA 4OOEA 3HL0A 2NO0A 1Z2OX 1KY2A 4QQKA 5CMLA 5CHEA 2GJKA 3ZZNA 1Q57A 5HF8A 5AVTA 4QGBA 1PV1A 5DDIP 3FYUC 3GZNB 4YUZA 5A7FA 4KHPB 1G3QA 3CX3A 3PCXA 1VL6A 1UMBA 1G5PA 2QTWB 2VQ6A 3L4JA 2CHEA 4BNFA 4KSCA 2P68A 4ZO4A 4WFJA 1CUIA 4NENB 1Z6GA 2BFEB 2R8BA 3D6VA 3QLVA 3DE5X 4QOJA 1JDNA 3BREA 4N9QA 3C8DA 3BDIA 2PGAA 1Z0IA 1RKBA 5AKKA 3AT1A 4PTZA 4Z9FA 5DGHA 4CFZA 1Q19A 2ZWMA 4L7QA 1NI4A 4DFDA 5B6JA 2A0WA 2DTDA 4YRJA 4OQLA 5C8ZA 1UH5A 3NATA 2PSDA 3TNYA 1YULA 5IC5A 1XTRA 4W5WA 3QFFA 5TQ0A 4GX0A 2AWNA 5LBUA 3PXGA 2UV8A 2R48A 3SHWA 2VK1A 1ZU5A 5TPZD 2EX4A 1KPIA 1K7SN 1Y42X 2G9VA 3BCRA 3AU9A 3KETA 1J4AA 1P0IA 3ILHA 3ZXUB 4C6SA 3QENA 2AJDA 3O90A 1EFKA 3BXFA 4MRMA 5C37A 3D0RA 4HJRA 3VU9B 2FPUA 4RENA 1XZIA 1XMPA 2H65A 4XWTA 2SNIE 1T24A 2JLCA 3ROKA 1O94C 4XVRA 3R76A 1PHPA 3DGEC 4QT0A 1TM1E 1FFHA 3C3WA 5D2CA 1ENOA 1YIAA 2P65A 2FLVA 3CV3A 4JR2A 5EQFA 5A7HA 4U8HA 4BTLA 5I7OA 1SVMA 5KVSA 1TF5A 1VLQA 3D81A 3OQIA 4KQMA 3TYXA 5KNDD 1WMEA 1HBJA 1CRZA 2RONA 3TJZA 3EZNA 4DJJA 5A4JA 1T8SA 4MPTA 1IH8A 4U63A 4BO5A 2O7SA 3ROTA 3BWCA 4B33A 1WMBA 4BKRA 3G7SA 2OGSA 3PX7A 1N7IA 3NBKA 4KDRA 4OQMA 5HFJA 1YDHA 2A1TS 1DDIA 5CNKA 2BFAA 4LOLA 4JHLA 2WU0A 4IV0A 1BA3A 4ZVPA 3STHA 1Z0SA 3PVZA 4K46A 4EHAA 1TAHA 2AN4A 1MJ5A 2EZ8A 2XMCA 1DL5A 4C6RA 1E9VA 2C84A 1WXDA 1O77A 2B9VA 2SKEA 4H0CA 3DUWA 2FSHA 3AV3A 3HYTA 5CLIA 1COWD 5FUVA 3TOZA 3ESYA 1AOXA 3DQQA 3IBTA 1I1QB 3AM1A 3FMVA 3I0MA 4Z4GA 3WXBA 1Z2NX 3DDWA 1MO2A 1T5SA 4UW9A 5DCYA 1HFKA 4NHEA 5JWHA 1EQUA 1P0PA 2PMFA 2R4UA 4YECA 4AY4A 6ABPA 1W25A 1PCXA 2QN6A 1OUMA 1XDZA 2HCTA 3AESA 3AILA 4I8XA 4KO1S 1IBSA 2BVNA 3DDOA 1EJBA 3I9MA 4FEAA 3EH2A 4MUJA 1GPWB 1A9QA 5B2EA 1N9GA 1BN6A 2JK0A 3LO5A 2ECOA 4OKSA 4IHJF 4ZEOA 1QDUA 1NVAA 3DONA 1Q20A 3FG9A 3FNHA 2X2EA 3FRIA 5J5VA 3ZHBA 2R6CA 3HJHA 4JQSA 2IFTA 1MF7A 1R5BA 1DG3A 4ZOBA 5DVZA 3UAXA 1NXTA 3HR8A 5JZOA 4IIJB 3KB2A 3WMGA 4O1IA 3WAJA 1T29A 1G17A 1UOQA 3JALA 3NLLA 3C2QA 4OUKX 5TF4A 1LX6A 2VYNA 3FYCA 2W11A 3CTMA 3NHZA 3O7WA 4IY1A 4JVNA 1W85B 1KP9A 1X8KA 2P1RA 3HKCA 3PFFA 5TGTA 5TQ2A 3HA5A 3TECE 1FUIA 2D3TA 1O1YA 1E1CA 2YRWA 2BKEA 1Y3CE 2FZGA 3K6JA 3AJDA 2CXTA 1YZHA 4PPYA 3BERA 5BR8B 1P4HA 4DV0B 2XZPA 4RVOA 1GR1A 1US8B 2WKSA 4KKVA 2GUWA 1IEXA 3QPWA 4FMCB 1V16A 1VKRA 5IT0A 2R62A 3U7HB 3L1JA 4OHUA 2YXBA 3PHGA 1FDIA 3QNMA 1SCAA 4O29A 1NVMB 2P6PA 5CFZA 3PI7A 3R6DA 3WA6A 3H5TA 3EYWA 3IMKA 1MGPA 1DJOA 2ODPA 4TMXA 5JFOA 4ETMA 1WETA 5EJIA 4ZI7F 1IPFA 1EWVA 2Y3IA 3GLGB 1T0BA 4BMZA 1ISJA 1NN0A 1U99A 2EZ4A 3ZKWB 4K87A 1TUGA 4LZLA 4DF3A 3KQKA 4TXLA 3HCEA 1K27A 1XMOB 2PUGA 2UUAB 4M0UA 3PD0A 3EEIA 1TE2A 3KQPA 1QYCA 1X39A 4IQ4A 4JP5A 4X0EA 4M6WA 1OZHA 2J45A 2R6FA 4KAFA 4BV8A 3PR3A 5EZ5A 3GUVA 3BILA 3C15C 1D4AA 1XQYA 2RCNA 1J8DA 4CG3A 2SICE 3E2PA 4L3WA 2BEWA 1N5JA 3CIFA 4PW0A 3ZVRA 1EWRA 3SE0A 3TIXB 4HAOA 4KR6A 3OE5A 4ZHQA 3X1ZA 4TTJA 3VJRA 4AECA 2PTGA 4DQUA 4YRSA 1QLWA 1ZVQA 3NHJA 1O6GA 2BV3A 1V43A 1VYUA 3DDSA 4J75A 5JG7A 1GVHA 3A10A 5B3JC 5C53B 3K0FA 5BURA 4CF4A 4TQGA 2VKTA 4MVJD 4UQOA 5ITSA 4KH0A 3PFWO 4MPDA 5DMXA 2FCRA 3BMQA 2X0RA 2VBCA 2XAUA 4YI3A 4NFSA 4RELA 4LFBB 1K2VN 1U90A 2JIRA 3TMKA 1JALA 1NYRA 5HUHA 1DOAA 3ZEAA 1EXVA 2QRGA 1SCJA 1W93A 2H7YA 3TM5A 1DBWA 1QGUB 2EBUA 3CW2A 2ZR8A 3G5LA 3NGMA 4NQZA 5DW0A 1OE0A 4X94A 1Y1RA 4UHBA 1NMYA 1H23A 3ESXA 4RMIA 2QZZA 5IXSA 2W42A 1T5BA 1PDWA 2CHFA 1C0KA 5IUKC 2BYTA 1T9DA 3S2ZA 1WEHA 4O4IF 4CM8B 2CSUA 1F3OA 1KAGA 1SG9A 1T9BA 4CKEB 1Q6YA 1ZJWA 3SU8A 4TTRA 4L72A 1RXWA 1NPTO 5G3ZA 4DR6B 2V9PA 5EP1A 5K0TA 4KQ9A 2B61A 5IK2D 4CL3A 2V8OA 3EMDA 1YBMA 5K6RA 1JA1A 4D4KA 2ZBFA 5KTKA 3BEDA 1MD9A 3OX2A 3KHTA 2NZ8A 3DXXA 3GJ4A 3NUGA 5E7MA 3HBNA 3A9VA 1LWNA 1ZGAA 5IBRA 3NTUA 1YNOA 5BUSA 2JVJA 2VATA 5CDTA 2DUWA 3QVMA 1ZM9A 4LRYA 3TD2A 3VAZA 1P7WA 3CRVA 3ESAA 4JC0A 4MKRA 1K6EA 4UU8A 2C2GA 3I83A 3FOBA 5F1OA 3NONA 4GDFA 1MVLA 3G89A 3QX7A 1H0RA 3N53A 4Q1EA 3QYAA 3A26A 2PGJA 3NHBA 4RS3A 5TIIA 3OM0A 1EU1A 4XUEA 3UGQA 2SCUB 1G291 1FU7A 1WD5A 2I71A 1L4GA 4H08A 4IJKA 1L5ZA 1RD4A 5LMZA 3R7LA 2WPDA 3A6HA 4HTFB 3FDZB 3EGXA 2J7KA 3JR3A 5CX1B 3L79A 5BUCA 2HDNB 4OP2A 3ZLVA 5H8WA 1MEJA 3T7AA 1CEYA 4IAOA 1T4CA 4GKKB 1HE1C 2C1XA 4AS3A 5JSKA 3RSSA 2FR1A 4UMDA 1LPMA 3M6IA 3EZXA 1V1RA 1UZAA 3Q7QA 4IM7A 4RF3A 3KQQA 1N9KA 4LEIA 1TYCA 4RPLA 2VNIA 1N2SA 3W3ZB 1KY3A 3DBHA 1KFBB 1MO3A 3GD7A 2LD4A 4RFSA 1EBUA 1T9CA 4BCBA 3PVCA 2HPZA 1V4BA 4UOZA 1EINA 1IMJA 1UMDA 3EZLA 4N6GA 1S8FA 2FW0A 1VRCA 1QDEA 1H8EA 1TVMA 4KIWA 4OP3A 1C3JA 1LK0A 1JE0A 4DUYB 5E1OA 2QQFA 3V7FA 1IOZA 1PT7A 3H3XA 4D7AA 2RHLA 1F1JA 4RKYA 4C0KA 2OAP1 1T13A 5CA1B 1CQPA 3FCOA 4CR7A 1U2GA 3MJRA 5C51B 1A8SA 4R69A 4MQLA 1DQPA 2VRBA 1CRWG 1QONA 1J21A 1L4UA 1XG5A 2D8MA 4TKVB 3INRA 4GPAA 2WOOA 3WICA 1IY1A 3WLPA 5AUNB 1HFWA 4D6PA 4CPDA 4KE7A 1WPXA 2ZIEA 5EVJA 1NT2A 1SN7A 1EJ6A 5KYUB 4OQYA 4M83A 4MEBA 5FJIA 1Z38A 1Z6PA 2YFHA 1Y9DA 5EE3A 2H2HA 3Q2KA 3AI3A 4I55A 3ZUPA 3FNGA 1P2UA 3ZV3A 3DBOB 1RCUA 1F06A 3GVHA 3DTTA 3LCVB 2BISA 3QPDA 4JVMA 4QXQA 1K86A 1ZZGA 3DO6A 2IYAA 1V11B 3CU5A 3EIEA 3R44A 1U81A 4N39A 3RNLA 1C9EA 5K3CA 1QIJA 4PLTA 3NDRA 3B6MA 1GEEA 3C14C 1BFUA 3T9CA 1EP1B 4DR1B 1XAHA 4M22A 2YWFA 13PKA 2CFSA 3GWGA 4TYPA 1BGVA 2JJYA 3AXSA 4UPVA 5DBOA 4DMUB 1R50A 4N3BA 1MBZA 1AUOA 1NNEA 3ZZUA 3L8HA 3O4JA 3ZU3A 4AY3A 4F0JA 3I61A 4LX0A 4R41A 2JASA 4KVFA 1LRLA 1T0PA 1P33A 3SFZA 3WL3A 1IHXA 2QZJA 3RVOA 3WMFA 4D8XA 1JIIA 2FWBA 5HW0A 3QVWA 2X86A 2XCQA 4CDRA 1M2JA 3OZAA 1UFVA 2ATXA 3NT2A 3RT1A 2OG2A 1JIQA 4MHSA 3WK5A 2IX3A 3VNVA 4HFRA 4GR9A 5AXBA 3PSHA 4W4TA 1TEZA 1TZMA 4UHJA 3CEHA 4XUCA 3CISA 2RKWA 3MBOA 4G5SA 2XTJA 1VMKA 4ZEXA 4AM8A 4CKBA 4UUQA 2IW1A 3GLFA 1BDIA 1VJDA 4M7OA 3RS3A 4EPYA 1NVVQ 4G5RA 5EKDA 4F3YA 3U48A 5C5CA 2ZJ6A 3PJEA 2HIMA 2AS0A 3H5VA 3K72B 5EEGA 4C4AA 5ALGA 4D80A 1JEQA 4NCIA 1FTWA 1JHOA 4L8YA 4QYTA 3Q0EA 4HWRA 5H9WA 5A2GA 1DO8A 5F4ZA 1V9LA 4UXHA 3U4AA 2IHJA 3MWEB 3U9SA 3ORFA 3PJGA 3PD7A 1KA9H 2RGWA 4MKZA 5JJKA 1Y3HA 4P1ZA 4W5RA 2QTVA 1NXVA 4EA6A 3BE6A 2PPVA 1WQ4A 3L4EA 1RM3A 2HMUA 2YW2A 1J2JA 1PFQA 2XE6A 3NRBA 3PPIA 4YXWD 4UD6A 2GKOA 5ECYA 2J3LA 3RABA 3VSDA 4MYCA 3PDHA 4POAA 4NY1A 2BMEA 2XQJA 4PFKA 5LCXA 5GIOE 1DKMA 1JG3A 1EM8A 1TGYA 2H92A 3DZIA 3KOZA 4B7ZA 1M6WA 2GHTA 1RQ7A 2QENA 3JXEA 4WJLA 1W94A 2QRMA 1WHTA 2VHCA 4UCWA 2ZXEA 2CUKA 1TADA 5MN5A 5K3FB 3PR1A 2PMEA 5TQJA 3HI6A 2RGGA 2EDCA 1ISIA 1FU4A 2Q2OA 4X84A 2FVXA 3HVRA 2W48A 1PGOA 6Q21A 1SD2A 2W6ZA 3U1BA 4MUHA 1DAEA 4MQEB 1RQNA 4BLRA 2QGZA 3F8SA 1U2GC 3OQ6A 4OSOA 1T1GA 3S29A 4JJ6A 3ZU6A 2PD3A 4RHUA 2WD7A 1ZL0A 2CMGA 3PF8A 2DHQA 3KE9A 3LFTA 3WG9A 4BVHA 1UAAA 2FX3A 5EZSA 5EXTA 1CR1A 1HEYA 3KQSA 3MIZA 1MRSA 3INGA 5FO1A 1KGDA 4A8PA 3VVLA 4XDHA 1GN8A 4KO3S 4ZCSA 1NG1A 4LRWA 1RXSA 4EEXA 2G9ZA 3H5NA 2PAFA 3IKMB 4YCAA 5H83A 5CFNA 2F8SA 4RX1A 3UHAA 4POOA 5AVXA 2AMFA 2NUTB 3OD1A 3RRFA 4AIIA 2R6R1 4XFJA 3S70A 4ZO9A 1RAFA 5JROA 4EGAA 1SIWA 1R9MA 1DJPA 3BF8A 1RPJA 1WL8A 1TA0A 4MS3A 3I6MA 4EO7A 3AC0A 3HQ4O 1POWA 1R66A 3P4UA 1U4SA 3OZDA 1U0JA 3QPUA 3CXRA 1E2QA 4B6GA 4JLAA 2XR1A 4IWYA 2B37A 4C0HA 5JAHA 5KKNB 1ACLA 4Y2RA 4REOA 2HCBA 3RYIB 2A3RA 2F67A 3GUZA 1F2TA 2YJ3A 2H51A 3NM6B 4DG8A 2E48A 4PCAA 3PV0A 3OLQA 3DD1A 2ODEA 1XTBA 1GQOA 1UZMA 3PE4A 4EPVA 3VR0A 4Y1RA 2ZIUB 4DLAA 3DF9A 4A6XA 1JEYB 4G84A 1YBVA 2W6CX 3FF4A 2AW5A 3TG2A 1A8HA 1R12A 4YQYA 2FSPA 1F5SA 4C0JA 4ND2A 2IYVA 2F4NA 2H9YA 1Q7BA 1RJFA 1V5IA 2A0UA 3A2NA 3NNSA 3PB3A 4OPMA 4PS0A 4D4IA 3KXKA 4O0MA 4XYLA 3AYXB 1U3UA 2PU7A 2IYXA 3KQWA 4HQLA 4MV8A 4LYHA 2CCJA 4PC1A 4BEJA 1N33B 4AN4A 3OOWA 5C7IO 4QUAA 3IP8A 3A7DA 3H5AA 1OILA 3BRWD 4A82A 4MVJA 1ZC4A 3CRZA 1T35A 3TFQA 3TLXA 4RGVA 2QKYA 3ER6A 3OOYA 2AJLI 1NVBA 3LGSA 4G4SO 4R8RA 4IXTA 3DR3A 4ND5A 1LRJA 2Z5VA 4AMGA 4N54A 4HAWA 5HQTA 3AF1A 1Y5LA 2FX5A 1I4WA 1EUYA 4LOKA 4B35A 1X6VA 2OWEA 2YW9A 4ZGGA 1MABA 2NU9A 3AERA 1T5OA 1YOBA 1SK8A 3IULA 1UF9A 3AEQB 5FWDA 3QTLA 1V37A 2PUHA 2V98A 1ABFA 4NOJA 5DNYB 4FFBB 1JLSA 4K6OA 3LTEA 3KBBA 4ENPA 5EXSA 3X2SA 5KSPA 2FQ1A 4QTTB 2AJ8A 1U7TA 3ILVA 4P31A 5GM2A 5H4GA 1P5FA 1EHYA 2XXJA 1BVRA 3O1JC 1EE2A 2QMQA 3UWMA 4EI2A 4ZIRB 3O95A 1GNRA 3HRHA 1FS4A 1M0WA 5K3FA 4WZAE 3GEDA 3GLGE 1V7ZA 1PWEA 1MB3A 5DASA 3DQZA 5AK4A 5G2FA 3IVMA 1XU9A 3Q3GE 5EIAA 4MS4B 3FGZA 4ISBA 3K9NA 3FTFA 1U0LA 4RHTA 4YDQA 3ZZTA 3O6VA 3FDJA 3MXOA 5DTEA 3HXMA 2PH7A 3GNSA 3T5BA 2HFJA 4JVSB 1OFUA 1FYXA 2HCRA 2TMGA 4M7PA 2PLNA 4OHCA 4C08A 3ZNNA 4OHWA 1IK6A 5G2OA 5A5GA 4G2NA 4KFRA 1P72A 2I3AA 4RTQA 1NBIA 3NC4A 3U3XA 2G1JA 4LE1A 5LP1A 1NVXQ 3SX2A 1NRWA 4E1BA 4F72A 3X1YA 3VR6H 2ZSHA 2CUTA 4LTMA 2O07A 2Q6KA 3MT9A 3HYLA 1L5VA 5PNTA 2PZFA 2BBWA 4B4WA 3IBFA 3MS2A 4DDTA 3CLUC 1V6CA 4BLPA 5CCBA 4RTKA 4X8HA 5F2OA 4D9IA 4ZVNA 5K4AA 4N41A 4YRKA 1XJ5A 1N2ZA 5IN4A 5DBGA 2ZLBA 4PAQA 1Z0KA 1R8SA 1UDWA 2H31A 4K9NA 4XPIA 5HKLA 4YCMA 1F2TB 2OO7A 2EZTA 2FEOA 3I2IA 3R5HA 4GVPA 4YV0A 3M49A 3UWKA 1BCSA 4CUJA 4Q3KA 3VH2A 5DWDA 1XO1A 1YL7A 1W4LA 4UM9D 1U8CB 4YC7A 1ILEA 4L22A 2WVJA 2CY0A 3UJNA 2D1SA 5D85A 4X62B 1DEKA 2FAXA 4TUYA 1X7DA 2I2BA 2XB8A 4Y30A 4MW5A 1DWPA 1M2HA 1QC5B 2I4TA 1LW6E 4BV9A 2QE7D 4J2TA 3RUCA 4P4GA 3L7KA 2WUWE 3DL4A 3P2IA 4JH0A 3UA0A 3WZ2A 4NG5A 4RDXA 4A03A 1WX1A 3QWAA 2GPWA 1TUEA 1AQYA 2JEOA 2LUOA 4FNGA 3B60A 3MYRA 3IERA 3BL8A 3BAZA 1PNVA 3QHPA 2GO1A 1XTKA 4CR8A 5M7EA 3R3VA 3CLRC 1ODCA 3LL7A 4O0LA 3KZ1E 3E2MA 4XKJA 4B2YA 2D1YA 3I32A 3TRJA 3GJ8A 2YL2A 3JU3A 1FRVA 1QG6A 2FUEA 2W93A 4NFLA 2ISCA 3GW8A 4W82A 1RRGA 4NEQA 4ZV7A 1JVBA 3OF5A 1KE1A 2CK3A 3WLNA 3HA3A 3HBMA 5JZ9A 5ECWA 3C7AA 3IJPA 1FX0A 2RGDA 4HEA6 3X1WA 4GM4A 1G8JA 3HCCA 3H9QA 4F38A 3JWGA 3L6DA 4OV6B 4YO8A 2RIRA 5EMKA 4DQ0A 2A57A 3ZWYA 1CIVA 4TLEA 3V3KA 4Z4QA 1XRRA 1NBMA 4V03A 3T9BA 1B43A 3JQBC 3EFHA 5H16A 1RZVA 1PR5A 3C1OA 3V2HA 5IASA 4NENA 3F5DA 1MG0A 3SG0A 3MW8A 1MX3A 3EW9A 3OUZA 3Q6MA 1V45E 3EXAA 4JV5B 4AJJA 1EH5A 2ZIVB 1YACA 3B89A 4D9NA 3UT0A 1V1MB 4UDNA 4CBVA 1RM4A 3EQZA 4BQRA 4X9XA 4PC7A 4HQKA 3N7TA 4I4TA 1L8AA 3NDJA 5LUBA 5TF0A 1KMNA 4M8NE 4BCCA 1YR7A 2G2SA 3EDQA 1KQ3A 1N2CA 1SA0B 2XNSA 5CNMA 4C30A 4UJ5A 1F20A 2UZ1A 4MUAA 5FF9A 3FGOA 5JWOA 1XB2A 2K2WA 4MKIA 3C3DA 3AOEC 1E7MA 3U13A 4YP6A 3COZA 3VYUB 3F3SA 1W6UA 4YJ2B 5E8JA 2D6FA 3K7EA 1NP6A 4ZYYA 1TZBA 1E7SA 1TZCA 5EMMA 4UE6A 3TO5A 4YIKA 4DT1B 3UNXA 4LI3X 3UXEA 3HPQA 4ER3A 1NBHA 1GGNA 1U6IA 3A9RA 5HTKA 1QH8B 2DR3A 2QJFA 1Q1AA 1QANA 4ND8B 2ID8A 4XCQA 4RJLA 5KTYA 1FNMA 3BPSA 4TTTS 4K0RA 4A3SA 4I5FA 4E2YA 4WZAA 1KIFA 1VDMA 2FX2A 3EVGA 3IFSA 1ZSNA 3GV0A 5FOUA 3RS2A 5LU9A 1T5HX 1WUHS 4DNPA 3FLBA 1ISRA 1KZ6A 1FY2A 2ZIFA 4LTDA 5SZHB 3BTVA 3WYBA 1ZICA 1ZUHA 2IZ6A 2CXXA 4AZ0B 1Y33E 1KK2A 3I23A 2PAAA 4ZJUA 4JWTA 1D4ZA 4GECA 2QGNA 4K9RA 1M83A 2ZT6A 1RHJA 2F1IA 1A72A 3L7AA 3D4LA 4IGKA 4HEJA 4YLYA 2VSNA 1FFSA 3OEHD 3BBPA 2RH4A 3E9DA 4BVJA 3W3AD 1UPTA 1AH2A 2EWWA 2HMTA 4MHOA 3VO9A 2PFKA 4LC0A 4BVLA 2VA8A 1H9BA 2R00C 3DWGA 2YFYA 1UFKA 3NFYA 1ECJA 2O52A 2QV0A 2XYPA 1SD5A 3I2KA 4DLVA 3RU9A 5MDHA 3PWKA 4F3TA 3LS2A 4G5HA 3WIUA 4ZMSA 1TKCA 4ZVUA 1OC4A 4BYGA 1XN4A 4HWGA 3RARA 1I10A 3UJ8A 4ISCA 3B7PA 1DRWA 4C7OB 1CB7A 3FCYA 1Z0DA 1E63A 3J7TA 1B6TA 3N3BC 4JFRA 2W8ZA 4HGYA 3P0IA 2J30A 1HTWA 1LPBB 4M0CA 3OT4A 2E5FA 1E2MA 3L6UA 4O4HA 3Q0IA 3VZCA 1GG9A 3OTIA 4CJXA 3RLFA 3ACDA 2VRCA 4YAOA 4KMRA 3VVMA 1VZ3A 2Y05A 2FWPA 1E8DA 3AR6A 3FMIA 5TT1A 2ZBPA 5F7OA 3EXEB 5BN1A 1JL3A 3DL2A 4PV7A 4ZN6A 1VKHA 5LKRA 4MDFA 4PYMA 1RQLA 3CUUA 2BD0A 2CHGA 2I29A 2Q3FA 4XOIA 5EUCA 3UJ3X 1YQ9A 2HA2A 1XWIA 1A5ZA 4LG1A 1XDSA 4FEEA 4C3UA 4P7GA 3GXBA 3EZ9A 3KZOA 5A4KA 4TTQA 5JCPA 2UVQA 1OLUA 3SQMA 3HDHA 1B4DA 3DVAB 5GP1A 3KVVA 4JWKA 2CB0A 3F74A 3JQBA 4G09A 1HEIA 3CJQA 4HHEA 5FFNA 1ZH6A 4AKGA 3GQVA 1Y5MA 3M6WA 2HF9A 1J9EA 1WULS 2AEMA 3QBEA 5T6BA 1IC6A 3RTDA 3RVJA 4V1CA 1GTMA 3AETB 2C83A 1FFEA 3FTPA 5JH7A 1XQ6A 4MEAA 1E0JA 2BM9A 5C5DA 3AEZA 4AJKA 1OA1A 3DQPA 3QVKA 2ZBVA 2P2DA 1K7FB 1JEAA 1M7HA 1XEAA 3A4LA 3F2IA 4O08A 1KOGA 4KIUA 4CCAA 4DV2B 1U04A 3BMOB 2IE8A 2PZBA 4WGGA 2ZAOA 3T4EA 2GKSA 1BRTA 1USVA 2HRZA 2HIHA 3JYQA 5FBLB 1CS0A 2ZJYA 4EBFA 5A4FS 4F93B 4MJXA 5C81A 2O1EA 5H80A 4N65A 2J4DA 3HZHA 3TX2A 4CEJB 5HGXA 1MKYA 2IHYA 4PO1A 2JFWA 1SOWA 4C0LA 2JI9A 4LKOA 3WLQA 1RYFA 4CMIA 4E2FA 3C43A 4PF1A 4P8RA 1XALA 1ZUD1 3WLJA 2WHQA 2VP0A 5AOBA 1HE8B 4M1WA 4PX2A 2QZ9A 2XE8A 4XLLA 4CMCA 4RC9A 3LF2A 4AWAA 4ZQEA 2JH3A 4PY2A 1ZVKA 3EUFA 2C29D 2AOUB 2P6UA 2LKCA 4G8CA 1LV8A 2O2JA 5AT1A 4C05A 2QUIA 4KAJA 3UWDA 1QM5A 4HBZA 3SK0A 1DAFA 1EM6A 3UFXB 3KR0A 3UWSA 4BTVA 4IIGA 5C46F 2M6SA 3M6VA 2HI0A 3KHKA 1QR6A 3E5NA 1NJFA 1GPDG 2VWGA 3H5WA 4Y6QA 4ZQIA 1NIJA 2PZJA 2G88A 3B3QA 2VZEA 3DTVD 1TM4E 1TK9A 5FO0A 3OIDA 2Z2JA 1F0NA 3T8YA 4UATA 2AKYA 3H17A 1B41A 1DEXA 4LZAA 1DT5A 3IS3A 5E7JA 4Z0HO 1J5PA 3OX3A 4AO8A 1EFAA 1BMTA 1CZKA 1JXQA 4W8HA 4W9RA 4RJTA 3IPRA 3K35A 2D0DA 4FFLA 4NCAA 5FBWB 4FIDA 1IBCA 1QFJA 3CT6A 4G5QA 4ZOLA 4EHNA 3IJRA 3OKCA 5HVNA 3MT0A 4NNPA 4N7JA 5JJBA 2OFOA 3JR7A 5CYFA 3K8YA 3SOPA 2C0CA 2Q21A 4FE4A 1U8FO 4RV5A 5JCOA 4BC1A 4LBWA 5LXTB 1GUZA 1WMDA 3IOBA 1FBNA 4B40A 3LO8A 4JJKA 1RR6A 4PYKA 1ODFA 3AY0A 3SIRA 3N8KA 3K70B 621PA 4R9VA 2Q4TA 3EJWA 4JBLA 4IX1A 2XBLA 4L27A 1JDUA 1VECA 4QHYA 1ZAKA 4EG5A 1RWNA 1YKFA 2ETVA 4R5HA 2QL5A 3UXYA 3ECCA 1XDWA 4MRRA 2CHUA 3WYGA 2KHZA 1G20E 1UOOA 1JPVA 3OBBA 1FP6A 2HBZA 3K96A 3PEFA 3CSUA 1G8HA 3PKJA 3PQ8A 4NFHA 4ENSA 4Q03A 4PICA 1EAMA 5J23A 1N77A 3VJKA 1EX7A 4NF2A 1FNNA 4X00A 4Q15A 3D5EA 1SIBE 5CA0A 1DXQA 1LI4A 4E11A 1S4MA 4DEYA 2PLAA 3TSOA 5BO5A 2QN8A 1QFXA 1SVKA 4WK4B 4MW6A 4NSNA 2YZMA 1AKWA 1NFQA 2Z98A 3W5JA 3WWYA 4DVGA 4MV1A 2JLWA 2VHXA 1XLTC 5EJ7A 3EVNA 4YJHA 4CL2A 3GMSA 4ZI2A 2ZJ5A 1NY5A 3FNFA 3HCWA 4MS1B 1L4NA 1MV8A 3FVTA 3FVRA 4C07A 2Q4DA 3TR0A 1FJHA 3H9UA 1H94A 4XWWA 2CFCA 2IJGX 3KPUA 4R1LA 2ZT8A 4DLXA 2BFOA 2HGZA 1QHXA 4R1UA 1V71A 3KP1A 3TRHA 4Y9SA 4DS3A 3GARA 3TZLA 3NYRA 3MTEA 1UC5B 3EISA 3MUFA 4I2NA 4EY6A 2AJBA 3KQVA 4M1SA 5DP1A 4MUFA 4P32A 4UNQA 2O8NA 4B81A 3SQXA 3OOSA 4BE9A 3G6WA 3EX7C 2NAFA 4B7UA 4IH9A 1HY3A 3DBIA 3WISA 1XKQA 2GYVA 3OOEA 2GRAA 1YZNA 3IUYA 3T7SA 4P34A 4JP2A 1AA6A 2DE0X 3F9RA 5LZ4A 5FLEX 5H7XA 3Q6NA 1NU8A 1OH8A 1UXHA 5TGDA 1A1SA 1SCKA 3RRNA 2IS1A 1XE3A 3GUHA 3NAQA 5ALOA 2MSEB 1P81A 2GAJA 5LQKA 1UK9A 3D6FA 5GADl 3AVYA 3W2TA 3CLVA 4QBFA 2NACA 5AJUA 3GJ0A 4KN8A 4CE6A 3L43A 4GGMX 2W6NA 5J2UF 4XM1A 4Q4AA 3I3OA 4Y6OA 4I55B 3DLHA 2EF1A 3FDIA 2NXEA 4UHKA 2P7HA 3KKLA 5A04A 3SVTA 3PTZA 4AYXA 3AEUB 1XFAA 1W36D 4F2HA 4IGIA 3DO8A 1KJZA 1T8TA 3H9BA 1MR3F 1NLFA 1XZEA 5FOWA 4ZQHA 1DV1A 2VPYA 2O2GA 3TVTA 1BWSA 1DQSA 3TVYA 3EIFA 2NU7A 1SQ6A 1LQ2A 1CFJA 2LBPA 2H4YA 3KB1A 4HC4A 4HDRB 3QXXA 4R0MA 5HFAA 3HJAA 1GFWA 4XB2A 4HFJA 5TVKA 3N0TA 3EAQA 3OQ1A 4HXFB 2ZRDA 2XODA 2ZS9A 4M37A 1W73A 2AZTA 2DSNA 4XX0A 1W8IA 2FN8A 4ZXPA 4HNAA 1UDBA 3L8FA 5I9NA 4KMMA 3DPUA 3NR2A 1W87A 3U7RA 1FA9A 2CJXA 5IAKA 1OV4A 5HF5A 4D4GA 5CBPB 2ZVPX 3NUZA 2M6LA 3HZRA 4BB9A 4DNOA 4DV6B 2Q3HA 1L6RA 1FDUA 2MYUA 1RWXA 2PA3A 2HA3A 5KOHA 3D8TA 4L4UA 5EMLA 2IYWA 2VNHA 1UEXC 1M72A 2F1HA 3JAMA 3FFTA 1J1IA 3F7NA 4HNQA 4TSKA 1ZK0A 5EUQB 2WFLA 4HAIA 2RAFA 4LOIA 2WE8A 4WXRA 5FNVF 3SBOA 4Q9JA 4C6TA 4TX1A 1EA7A 4DLZA 3NIWA 5FIUA 1MVOA 3T52A 1PUIA 2BOVA 3OJXA 4UCQA 3IQXA 2RCYA 2J87A 5AK5A 3PL1A 1XK6A 3A1CA 2Q07A 4E21A 2XRFA 4Q7LA 4LRQA 4YUWA 1P9OA 4NATA 1RJ9A 4NS1A 3RSGA 3ROQA 3R3WA 3WKCA 3BGOS 2WVHA 4HDOB 3TE6A 5BT9A 1D1QA 2UYGA 3FZQA 3OEHA 1O95C 3BRCA 2AZXA 4M0KA 3D4IA 1XJ0A 1GAEO 2YJ4A 2Z9DA 3HYCA 1BVYF 4W8OA 2CHQA 2E4VA 2XJ4A 3WAKA 3UCXA 3ZTYA 2QNIA 5ALNA 5HILA 2ZCUA 4AURA 3ORRA 4A10A 2WF8A 3ID6C 1BKSB 3N58A 1NWHA 2WEKA 1HSOA 3BAFA 3PHBE 4RNDB 4CQMD 3UB4A 1OU4A 2QM0A 3V7YA 5JDCA 3ZE2B 1U28A 3LFUA 3ZQUA 1Y9AA 2A14A 2YYSA 4LPSA 1F51E 2GK6A 5FKJA 2GLTA 2I80A 2XMRA 1RPTA 3LX5A 2LTAA 2FEMA 2GPNA 3M4JA 1XNGA 4PZDA 5KEIA 5SZKB 3ZHZA 1OREA 3EWSA 5HDQA 1I4OA 3C5VA 3ELWA 3PPXA 3LUHA 4FLFA 5IAAA 5GJVC 3M4YA 3WSWA 4HXGA 4YMGA 2VPTA 3D0QA 3FGPA 4KX5A 4O3FA 1UOEA 4KXUA 1RACA 4LGYA 4F4DA 5A4AA 4H6VA 3BCUA 3AF6A 2FEAA 4P2BA 5EHIA 2ZRNA 3ZDFA 4BVEA 1IN5A 1W1IA 3QHAA 3SQDA 5ADWA 3GT4A 5DF1A 3CRQA 4MUEA 4L9RA 2XOEA 2A5JA 3Q12A 4JX9A 4MV6A 4PZCA 4EJ2A 3W8EA 2GSDA 3H3FA 1AKNA 1CQJA 1E58A 5AKYA 1GTL1 5FPHA 2FOLA 1WA5A 5EC8A 2VJLA 5M34A 4TM7A 3KJNA 3V6MA 2O8EB 4R9SA 4U00A 2VNJA 2ZWVA 1TNDA 3KQOA 3NW9A 5CK5A 1QG2A 1VC2A 1ZR2A 6CHYA 1TT7A 3SJZA 4C89A 1T5TA 1G64A 1KEZA 3HY3A 4J6FA 1LKZA 3AOGA 1E0SA 2J0EA 2CFRA 3I2YX 1BKYA 3LWDA 3R0QA 1BA2A 1CR0A 4IQFA 4MS3B 4PXYA 1C0LA 4ZKEA 4L3OA 3A70A 4ZAYA 3VDRA 3LUCA 4X7RA 3QBDA 4TL6A 1OXMA 1UK8A 3I45A 3AHHA 1BXKA 5FTLA 2RI1A 2BFFB 2GTPA 3MMZA 4RK0A 1I5RA 1USGA 4LJ9A 4WLOA 5CW1A 3TVDA 2XH8A 4RA6B 3P2EA 4D97A 4G0PA 2C7PA 1OJLA 1TF7A 3NTOA 3MNFA 5K1ZA 4FFMA 4QJ4A 3RJTA 1FFXA 3AEKA 3SYRA 4MGHA 2B6NA 1NSYA 3L0DA 3E3MA 4E1VA 5JXWA 2X4IA 4GPTA 4IOJA 1D6NA 2AC2A 3FWPA 3A1SA 1F6BA 1P1BA 1N8SA 1TOAA 1I1NA 2Y68A 3DMNA 4R1NA 5A4IS 1Z0ZA 3QUAA 3NHMA 2PRJA 3E35A 1C1XB 4XLTA 2V7GA 4B47A 3N9IA 3NYIA 4NU6A 1F8UA 4QUIA 3RJ5A 1M2GA 2DM6A 2W83A 1OZ0A 1H5NA 3E03A 3QMWA 4QVGA 1YOVA 4B48A 5A6SA 3PTLA 4CEIA 1XKXA 2I1VB 4R7TA 4RPJA 1T5IA 3RKRA 3T1HB 3OLXA 4MIOA 4QUDA 3DMTC 2G9UA 1IVSA 2HKIA 4B79A 2IEBA 3HDTA 4IKEA 5KOHB 3C98A 2XZDA 2G0TA 1JR3A 1MEOA 1WY7A 2SKDA 4GZ6A 3GZNA 3ZGLA 2QR2A 4ZTUB 1K4MA 1WHSA 4NZOA 4JHXA 4C4TA 2H0QA 4N7RA 1W2WB 2ZJBA 4O4IB 4NZNA 4QPJC 3WGTA 1EGMB 1BJKA 2PJDA 4RZIA 3ELDA 1EESA 2AG8A 2HSZA 5DLDA 1PVOA 4FE7A 4IOLA 1LLFA 2YC2C 1QRDA 2PEYA 4X6UA 3ZCVA 2XYHA 3ZWVA 3SGLA 1V5GA 5I3CA 1VG9B 2XMDA 4R1OA 2Y0DA 1Q1BA 1TUIA 4QPDA 2DBQA 5BPFA 4DR3B 1JHXA 5JDCC 3QX3A 1JN0A 5GWXA 4I50B 1LGYA 1RWWA 3OCYA 1E79A 1T3ZA 1NW6A 3K31A 1K8RA 3O3CA 2LVBA 4KRGA 5FHRA 1EVYA 2I3BA 3PEYA 2V0NA 2FPWA 4LYYA 4BO4A 3VU9A 4ZTZB 2CEKA 2LR0A 5IABA 4QBTA 3TW0A 1EDEA 4BP3A 3O4HA 2XI4A 2Y99A 2HWUA 1GCAA 3ED5A 1SO8A 3F96A 3FCUB 4N8EA 3LHDA 3OJLA 4HDNA 4MWEA 5THKA 1WCIB 5TLSA 2HQBA 1VJ1A 1KEWA 1R27A 3N7UA 1NIPA 3KTFA 2CLEB 4V0SA 1XR3A 4EAQA 3KC2A 1BCRA 3SNHA 1P4AA 4MQUA 1JHAA 1QTIA 1Z08A 3EZGA 1HQYE 2A1IA 4ZDJA 1OT3A 1GQQA 2A1UB 4TN5A 4ND1A 4QTYA 3DV0A 1HR0B 2FG6C 3AGQA 3LQRA 4NMWA 1QHNA 2G9QA 4WW0A 2BP7B 1SBHA 2OB1A 3EXHB 3HKBB 4UEWA 3BFPA 2K4MA 4M60A 1Q0TA 3DEAA 4JU8A 2IXBA 1FDTA 1QHHA 1AKTA 3QUCA 1YE3A 4ZGWA 1AT1A 5L6MB 1B6GA 3KLNA 1UXIA 2PUVA 3DP9A 4UKDA 3SOZA 4MLCA 4NWIA 3W90A 1NQWA 1MQAA 1RS0A 3AHFA 5ALKA 3RRJA 3R5KA 2O0KA 4H9GA 1AHPA 4NXMB 2I4NA 4BBJA 1EWKA 4CKCB 1EIWA 1IQUA 1H2AS 1ZA1A 4WCFB 3S2SA 1RWQA 4UU1A 1Z36A 3DR5A 4R68A 4PM4A 1JKJA 3BIXA 1X7ZB 4J90A 5BR1A 3M83A 3DTVB 1CHNA 1IULA 1GXSB 2VG8A 3FAZA 4WNAA 5DSXA 3KR9A 3RHZA 2SBTA 3HJBA 4R3WA 4R8SA 3ZGOA 2NPFA 1HKUA 1DKQA 5AHRA 2DF8A 5CTAA 2WP8J 4Q7MB 2ACWA 2PZEA 1W0KD 4JJ4A 4DB2A 2Y0BA 2YBDA 2GI4A 2I4LA 2O9JA 2W2LD 5EUBA 4BHTA 4YJGA 4EO9A 2BGRA 4CWAA 1Z5ZA 1NL3A 4D8TA 3GMIA 1B0AA 4ENRA 3G2NA 5F2NA 2A5DA 1D6JA 2DPXA 1C1XA 3BHJA 1ULAA 3I6BA 1M8FA 4LPKA 3RU7A 1DRJA 3AZPA 3KWFA 5KMGB 4FYVA 4FIZA 4GRIA 4F97A 3VSAA 5LKAA 5DWQA 5IH3A 3PU6A 4OM8A 4ND6A 1OD6A 1T2VA 2QUBA 3JYOA 4EPTA 5F2EA 5TV2A 4JYZA 3TDKA 1I3LA 2Q8QA 3AO0B 3RI3A 3ZU5A 3GU3A 2J3KA 3P9QA 4IIUA 2OD9A 4J1TA 1R4MB 4YYEA 2VWPA 5JAPA 4XZ3A 1VOTA 3D7NA 4JI5B 3WQBA 1G8MA 2J07A 4X97A 1TX4B 1IN6A 4HN2A 1EQ2A 3L7YA 4JKYA 2QP9X 3G02A 3TTWA 2QYTA 1ML3A 4PBSA 4PFJA 4KPGA 4MK4A 1KEEB 2C57A 5L4SA 1ONNA 2H1FA 3CNBA 2BFDB 2VJAA 4F2DA 1PEKE 3KKMA 3MVEA 4MWDA 2HA5A 2J48A 4XSVA 4JLDA 1R9NA 1YTLA 3THWA 1OFTA 2CDCA 5HWSA 2BBSA 2AR7A 4TKZA 3BMNA 3CLTC 1BDBA 4O6VA 1I9CA 3Q9LA 2PEZA 1W4ZA 5CM2Z 5GGXA 4EHLA 3Q87B 4RVFA 4ZYTA 2ZATA 2C2OA 2CLDX 2ECPA 4OEHA 5AI0A 5JO0A 4YCCA 4KGVA 3HM9A 5G1OA 1AGYA 3EXIB 3GI1A 3IEKA 4DUGD 3V1YA 4AP6A 3GLIE 4Y18A 1J07A 5EL0A 1MHTA 5LUAA 1QP4A 4L85A 2Q2WA 2P6MA 1T26A 3X2EA 1B76A 4JEMA 2ZRJA 2VYQA 1XIVA 2X0IA 3WJ2A 4BJ3A 4G0WA 1JBQA 5H1YA 4EUHA 3IP6A 3BIFA 4JZYA 3F7MA 2WM3A 4MOWA 5JVDF 5KJ1A 1LZKA 1MCZA 2RHWA 5J40A 5TJ9A 3W04A 4A91A 1KOJA 1QV7A 2NZVG 5T7BA 4ZRNA 3VTKA 4NH4A 1SUWA 1Q77A 1PJ4A 3UJ7A 5BW8A 5SICE 3QWIA 4W1PA 1JEOA 5G1PA 1LRKA 1US8A 1NYQA 3SBEA 4TSRA 3TQSA 5B1EA 4NZ9A 2OD2A 1W34A 3DZ8A 1XA4A 4NIMA 3EXG1 1V7PC 4JP1A 4KXVA 1KDVA 4Q4JA 3AR5A 2HQOA 4C2TA 2V7BA 2EKLA 1KFJB 4OJNA 5I45A 4IDGA 1GU7A 4KLCA 5JLJA 2QQ0A 2EBHX 2H1CA 1RDFA 3K3PA 4I4TF 4OB6A 3IE1A 4F8JA 2EKDA 5C32A 4WN9A 1JB9A 2QT1A 1LK5A 2OV2A 3FRHA 5BVGB 4FFSA 4MMXB 2GNOA 2UVPA 1G6OA 2XE7A 1U8EA 4PG5A 3UOGA 2IOHA 3C6XA 3GDOA 1PX0A 5AVSA 1SVOA 1NKVA 2ENUA 3HY4A 3WK4A 4DCOA 4CDGA 5E1MA 4DGQA 4NBLA 2I7VA 2NIPA 2J59A 1ZW6A 3DGFC 3JRWA 1TUBB 1YK1A 4CKEA 4DJ5X 1N8KA 1SKYE 4IJVA 3REOA 4GAEA 4BL5A 2CLFB 2C7OA 3I39X 1H9CA 4IV5A 1Q7TA 1XZDA 4JCOA 4JJ8A 3DFIA 3E6AA 1YRWA 1EBFA 5A02A 4IWNA 3TNDA 3KB6A 4Q19A 1FSPA 4XI9A 2FH5B 1TD9A 1WG8A 4OQFA 5AICA 4GF5A 2PS0A 1E92A 3WLEA 1AK9A 1KP2A 1ECLA 2NO5A 3L8GA 5HCNA 5L45A 3OQOA 4B4OA 4YFYA 5J2UA 3RO7A 1JUDA 1QE0A 5A9TA 1X9IA 3ND9A 2P0AA 2WA2A 3A8TA 5FBRB 1Z13A 2JVIA 3AUUA 2P7IA 1NBMD 1V39A 1C1DB 4RCZA 4EUSA 4L2IA 3ROFA 3QFHA 4IHJA 3L77A 5ALXA 2HMSA 2JARA 2ILVA 1OPRA 2VHTA 2DBRA 4FGUA 3CW9A 4S1NA 3R0ZA 5WRFA 4YDRA 1M8JA 2Q9AA 3I37X 5BSUA 4QPPA 2VFAA 4WXEA 4CZ2A 2C92A 2WHPA 4H7KA 3A9SA 4MKGA 3GDFA 1LPOA 3WOVA 1UBFA 3STUA 4COKA 4EA8A 4EVQA 5BMOA 1XEFA 1LPPA 1LB1B 3SF8B 2DKNA 4P0PB 2MMGA 3JWJA 3F6EX 4PVDA 5IX8A 5CXUA 5AOCA 2ZYAA 2Z2IA 3I5MA 2BGNA 2Y4OA 2ZSUA 5HJ2A 4ZT2A 3TQCA 4CM8A 4IIBA 1J5EB 1ND5A 5ABPA 1V8OA 1CS4C 1S2DA 2G77B 2G71A 4HEA1 4YCJA 3ZWKA 1IRIA 3P27A 2ODNA 4LSGA 3NNDA 3D31A 5KVQA 1V3TA 2X1HA 2I2FA 4ENUA 3D1VA 5I9TA 2Q9BA 4U3JA 4J7UA 3BIJA 4EJSA 2P2LA 4OBBA 1JIUA 3UJBA 2G63A 4D9BA 3NOQA 1JWAB 2DCUA 2R96A 3HBAA 2FUKA 1T2EA 3MT8A 1B2LA 1Y1QA 2FF5A 2ATEA 3BG5A 1ZHHA 2EFJA 2VVTA 1GTJ1 5GONB 2RD2A 3BDAA 4Q66C 4QODA 2P4SA 3VOTA 4IHAA 4P0QB 1ABEA 3PS9A 4LXUA 4FGKA 4JC5A 1R5OA 4KRXA 4RZUA 4DQVA 1UJ6A 2WKRA 1RI1A 3N2ZB 4ZC1A 2P77A 2G17A 2D13A 4OY3A 1E99A 5FOXA 3RC7A 2EP8A 2G8NA 4PPFA 1THGA 5D1HA 2IXGA 1KE2A 1WKBA 4HQOA 2FPIA 5G0WA 3PHHA 2C2ZA 1BRMA 1WCWA 4HGRA 1ZCJA 2Q8PA 4AMBA 4WASA 4JOSA 5CGZA 4Z9BA 4LRTB 3U56A 2R1ZA 2ZUVA 3L1IA 1KTIA 2VF7A 4WJKB 2JI8A 5FCDA 1X3LA 3DZHA 1T3SA 3M6XA 1T5DX 3B7GA 1VMEA 1XU7A 2CJYA 5E9QA 4EA9A 3IOYA 4AYTA 5IVKA 2NMVA 2OBMA 4H6PA 4J76A 3BWMA 2FE1A 5KQSA 2HEGA 3DHYA 1IM5A 4GPEA 2GPYA 3QW4B 1FYWA 4H59A 4UMFA 2HBYA 4M9UA 5F3WB 1RIIA 3PIIA 1ANKA 5H3CA 5FPYA 2IK8A 3OZFA 1U6KA 4EFMA 3T34A 4JI6B 3CMMA 4N8SA 1ULZA 2BMAA 2NNWB 2RIPA 1TUBA 4P5PA 1L1FA 1YL6A 2GA8A 1OBVA 2Q62A 5JCXA 1CRLA 1YI0A 3FFAA 4CUZA 2JK1A 4YCBA 4WE3A 1QGUA 4ZCLA 3EN0A 5F3DA 5F5XA 2PN1A 2ECQA 1WABA 2MINB 2OXRA 1E2HA 1MB9A 5CT8A 4FW9A 5KYWA 5TC4A 2G6BA 3HB0A 5BNIA 3BWBA 1P5ZB 1D0IA 4MYHA 3VKWA 3ZN2A 4AF7A 2W2XA 1X0VA 3LRXA 2EJBA 4S2EA 2H1OA 4P35A 2INGX 4IIDA 3S7TA 4QICA 1ZN9A 2QQEA 3DDZX 3E9YA 1NJ5A 1J70A 1W9HA 4CMHA 1OWPA 4URWR 4BE4A 4BZQA 3N5KA 5BVHA 3A4MA 4JR0A 1JQ5A 3AI1A 1KP3A 5D1NA 3L9WA 4TLMB 5J9FA 3TL3A 5AO9A 4CMAA 5JTTA 1VA5A 3ZHVA 1RC0A 2C97A 2GCIA 4R2MA 1PK9A 1GG8A 1CF2O 4BRUA 1QH9A 3CF4A 3C4QA 1RMYA 3NJ8A 4LDZA 1BX1A 5ER9A 4XTRA 3GG9A 3LUKA 4TLBA 2NV6A 5C31A 1NZFA 4E3WA 5ITWA 3AW9A 4BATA 1HYQA 4ED9A 4DV5B 3W5VA 1A77A 1SVWA 3GPDG 3NBMA 4ZO7A 1GTVA 1NAHA 1EBBA 3TOVA 1FTGA 2D7CA 2COEA 2H4ZA 2W2LA 5J4KA 1O97C 3O8NA 2W2QA 2XUPA 3H1BA 4M1YA 1PR4A 4KDFA 2I87A 1T2AA 2D5BA 1E2DA 3ZNOA 4C0SA 3G1TA 5KVVA 1T4CB 4ID3A 4FHCA 1OGYA 2OPHA 1NM5A 2M2IA 2VF4X 2DPYA 4ZV4A 2HAEA 3AF0A 4LWQA 1QCDA 1RWPA 4RV4A 1N6HA 1ZINA 3WB9A 1S2GA 4H7JA 2CFOA 1ZGJA 1Y7HA 3GQBB 4M9ZA 4K26A 4H6XA 4Y6RA 2A9QA 3GXOA 3WFZA 2ECKA 4F1KA 3EPKA 3VO1A 5C18A 1DAPA 4EGSA 1B6RA 1UPFA 1PL8A 3M33A 3N76A 1DRUA 3L0CA 4NBWA 1N0WA 5K51A 3WDMA 4D9JA 3AVOA 3ZWWA 1CZHA 5ESDA 1JSCA 2NYUA 4WZBA 4GC5A 1JLMA 2QVZX 1N6LA 2F3TA 4RMHA 4U6QA 5JCJA 3U9LA 3VH4A 5JPDA 2UAGA 4QXRA 2EWVA 4UNNA 1T36A 3OKFA 5MHTA 3ER9A 2V59A 1AK2A 4I3GA 5DFAA 2IHNA 1O08A 1YFKA 2JA1A 1NLZA 2VBFA 1I2MA 4CIAA 4O5AA 1YR6A 1HT1E 2Q4OA 2ZRKA 4GC9A 4Y6PA 3IE2A 3TWOA 4DIOA 4QFCA 3FGNA 2ON6A 4H3VA 4Q9LA 4X20B 3TR5A 1LS6A 3PUWA 3WNBA 1QB7A 2RK3A 4L5IA 4QXMA 1E9FA 4PYOA 3I30X 4R2WA 4QOEA 3HU1A 3VNRA 3WRYC 4ZYXA 4V1CI 4JLVA 1DFHA 3ABSB 4D02A 4EG4A 4BEWA 1V3VA 3PGKA 2QHXA 2JRLA 2JVKA 6YASA 1XI2A 5HDBB 3CE9A 3EHDA 1H6AA 3KQMA 1OX4B 1TEVA 1NU6A 3H2ZA 3IBGA 4O25A 1FXSA 3PEEA 4IYJA 5CFLA 1UJ2A 3H3JA 3IGFA 4XOUA 1RC8A 3B7WA 1RLJA 4TMWA 1V95A 3SDBA 3ZWMA 6PFKA 2JLRA 5E0OA 4LJ4A 1JAYA 1HF3A 1M2WA 2GJ4A 2QVLA 2X6RA 4M98A 2XX3A 1YUBA 4I14A 5CJPA 5IMBA 1WZ2A 1GHTA 1ADJA 3AR7A 5K3DA 4A8HA 1CUHA 1KYZA 2NO6A 2WYUA 1JSZA 3EGIA 3SKXA 1NXPA 3GC6A 5FUWA 2ZRMA 4II2A 4TVKA 4L5YA 5ICEA 2WWVD 2FSSA 3IESA 1UQUA 4GYWA 4GW3A 4ESEA 2BWJA 4D0GA 4MI1A 3C85A 3EVZA 2QMYA 1MZPA 1FFWA 2R8EA 5JSFA 3I9KA 1K5GA 1HC7A 4OYLA 4AKIA 2J9FA 2FJ0A 1PZNA 2R66A 1Z5PA 1V5EA 4WOPA 4A26A 1GP2A 3M0EA 3ROGA 3QVUA 2UYOA 1MMFB 3GLHE 4F6RA 1TMYA 4OHYA 2X4DA 2IEIA 4KJZA 3H42B 4MJ7A 4RFVA 2I7TA 1NQXA 2BH2A 3PLRA 2R6DA 1DVRA 1ODJA 3K0AB 3OP1A 4PS1A 3FDFA 5FLYA 5KYXB 4M76B 3UB3A 4RADA 2C4TA 2BFBB 3JYHA 4Q9HA 5BN5B 5E38A 5ADUS 3TG8A 1JHZA 4P4TA 4TMVA 3K6KA 4JGGA 3OHPA 1NVFA 4RZ2A 5MF6A 4G5GA 2V6BA 3NU1A 5JS7A 1JG7A 2V03A 1LQUA 1WDWB 3VNUA 4TT3A 2LPMA 4NBRA 4JLPA 4MYDA 3DEZA 3G2PA 5BQPA 2WJWA 1ZNQO 4EF6A 1BROA 5JFTA 4FX2A 3UTCA 2NPOA 4DXDA 5KHLB 1NM5C 2HSWA 3A31A 1NUPA 1OXBB 2QTAA 3Q98A 4IIVA 1AZWA 5IUNC 3RFUA 2C9OA 2Q3EA 3ZCUA 5E3IA 1AURA 4RH3A 4FWTA 3U7GA 2NTVA 3HN2A 1WHTB 5KC8A 2VRCD 4FC6A 4IQ0A 5SYMA 1JQKA 2E18A 3MPOA 3O9ZA 3I6ZA 4DWOA 3HN6A 2RMKA 3M89A 2DSTA 2DPMA 3O9VA 3U3OA 5BR4A 3CS3A 4FJ1A 2E1RA 3GDWA 5CIWA 5C1DA 4JGBA 3GJQA 2D0OB 3ZY6A 2EJCA 3MJ4A 4QXAA 3V1LA 2JLAA 2OXIA 4OGWA 3H2YA 1XELA 2WF9A 2CBZA 3QOYA 4Q4LA 4AF8A 3F5SA 1VYHA 3KTOA 4GBGA 3TFWA 3W77A 1OBHA 2YOHA 5KBYA 1OZGA 4YUXA 3JZDA 1JQEA 5DYYA 2FMIA 1OHHA 3GMDA 4YXFA 3WNVA 3WNCA 1JMKC 4EB8A 3OLCX 1KDTA 3DYBA 5AFSA 4L02A 3H16A 5ALYA 4FFWA 1SUEA 4DIUA 1N3YA 2YOFA 4HG2A 1YIOA 2XUDA 1T6XA 2EWMA 3PDCA 1AQIA 1QHSA 3EXG2 5D6OA 1KF0A 5TVGA 3CNNA 1N6NA 1VI6A 3OM1A 2Q1WA 4GOXA 1F8FA 3A58B 4GMHA 5T41A 3VYWA 5DN6D 2JPDA 3KJGA 3IR7A 3R3ZA 4ZOEA 2IS4A 1DAIA 2J41A 4FMBB 3U3RA 2PLWA 3QJYA 1HLDA 1VE5A 4C3VA 4H60A 3C8HA 1PZEA 4WZBE 4M89A 3D3KA 5AVYA 3VMMA 2BMJA 1ULUA 1FRFS 3NKVA 3R9XB 4UPEA 4YRZA 2OO5C 1OLSB 4JODA 4F91B 4UEQA 1Y3DE 2ZOSA 3BD6A 4GKJB 1VBFA 4EYGA 5I9BA 2ZYUX 2HB6A 4PONA 4DRXB 5JS6A 2Y2VA 4JROA 1V8DA 1KQFA 3LBYA 3PUXA 4PZUA 3OQHA 3GVPA 1N8TA 3BYZA 3CPSA 1M2FA 1I14A 1SCNE 2OECA 3L6BA 4FX5A 4IUYA 2IYFA 1W4CA 5E4TA 1OV6A 4XVHA 1C7IA 3LCMA 4L8GA 1DBPA 3ZK8A 1UWCA 2PO5A 2VUIB 5AW4A 2NP7A 1AMNA 3AVQA 3HKDB 1H5QA 2JIMA 5JANA 1NP7A 3H9JA 5ILQA 2JHCA 2HJSA 3LECA 4K3UA 4M3NA 4F1WA 4KLAA 3RAGA 1TC2A 3ZLBA 1JMYA 1V2HE 1Z18A 1BGXT 2WZCA 1O4WA 4DSOA 3U16A 2RSLA 4BRSA 4DKJA 1VM6A 2QRNA 2MDTA 2MCFA 3WLKX 3CVVA 3N0RA 4N47A 1WZNA 2PV7A 4YRBA 2J0UB 4IDQA 4AL4A 3ZXSA 2DJIA 4URHA 3SHTA 5FOTA 5LU8A 3MBIA 1ZOIA 3AP1A 4YPFA 3MCTA 3ITKA 1OLXA 1PZHA 2MTBA 4QWWA 2ZE6A 4ZAZA 5LXTF 2QTLA 3O1LA 3W5IA 3X2FA 4RKWA 4EGQA 4ACBA 4NYIR 4HXYA 1NAIA 2A2ZA 4GNRA 4EITA 4CMJA 5AK0A 3W7VA 1CQZA 3EDMA 4TWBA 3SSOA 3T3DA 4UREA 1EEXB 2IS6A 3RC3A 1TQ8A 1TW3A 2CMKA 3H0CA 1GZ6A 4XDGA 3BIOA 3PXCX 2X19A 2Y1DA 5AM0A 2V97A 3BB1A 5AVUA 3M82A 3AEQA 4JA2A 3SM3A 4YUAA 3CZAA 1RM5A 3R5TA 3NVKI 2GRJA 1AKVA 5K2OA 3I9JA 4IJ5A 3R23A 2JGAA 3CNEA 2Z57A 3GLHA 4IIFA 4W5TA 4RD6A 4FPXA 3NOOA 5AM4A 1UMKA 2H4JA 4L8WB 1E8MA 3F9CA 5CJ2A 4PLHA 1TU0A 5DHQA 2BTOA 5CBKA 1RFLA 3KYCA 4CV0A 4WOJA 2QN7A 2PL1A 4EW2A 2HBRA 5J4YA 1R0YA 2P3OA 1FFDA 2ZTLA 2VTBA 1AJEA 2CLHB 2WJ4A 3EZFA 3ETLA 4WK6A 1ZIPA 4UHCA 2JGJA 4AKSA 2JBAB 4RTNA 1JP7A 1VPLA 3DAPA 4A8JA 4BGIA 4Z86A 1D09A 1CDZA 2DLCX 2ZGVA 1GZ3A 1Q0PA 2P9YA 5G02A 2D2XA 2QSUA 3MTJA 4TT8A 3RT9A 1S1CA 3OLZA 2XGJA 4YP7A 3KOXA 3WMXA 1RP1A 4EL5A 2G5ZA 3HU5A 5CAEB 2AG0A 5AVJA 2Q46A 2JFFA 2GYYA 2JGDB 3K2BA 3E8MA 4MWOA 3A9WA 3P20A 4MO9A 3KJQA 2IYPA 2DTXA 4UNIA 3WBKA 1ZU4A 1V7CA 3FSEA 4IPTA 1YA6A 4JN6B 3UYLA 5A5DA 2GPSA 2RETA 3BWYA 4MVYA 4UEKA 4DA6A 3B5EA 5K45A 5KNCD 1ABBA 2OFPA 3TLYA 5BPHA 3DM5A 2EFYA 3F6SA 1KI6A 3HCAA 2OHHA 4ZDIA 2PX6A 3CTPA 5TMPA 1ADYA 3FWNA 3BHIA 3BGIA 1ACJA 3OQBA 2LZ0A 3IEIA 4J43A 4CCYA 3A06A 2NVWA 2O2EA 1C41A 1PD0A 1R1DA 4ALLA 4DBVO 3E9EA 3OIYA 3PGJA 3KJEA 3BVPA 3FJOA 3OPVA 4HL6A 4ZCPA 9GPBA 1IBRA 4P0TA 5ITZA 3DUFA 1KC1A 3TAHA 4HWOA 4QXOA 1U9JA 5CYGA 1GPKA 2XA9A 1QKIA 2I6XA 2JIPA 2XZTA 3E3NA 3ENNA 3MSXA 4MVJH 4YP0A 5E1DA 1WO8A 2OP0A 4EEKA 4F6LA 4YRMA 3KU4A 3FHTA 1GITA 3BULA 1H4SA 4V38A 2F2TA 4M86A 3IA2A 1UODA 1EVQA 1Z5GA 1AN9A 2J6HA 1CY8A 2H2DA 2OUIA 4BO8A 1NBOA 4WACA 4QOFA 4LGMA 3WB1A 3H4TA 5BP7A 4Q3DA 4HGOA 2PU5A 4KGXA 4RIGA 5FBQB 2OGTA 4Z9XA 1QIKA 5FL7A 1E7YA 3OPNA 5IAEA 3HFGA 2Z2XA 3KSZO 3LUJA 2GNAA 3RTGA 2BHRA 1R37A 3PFIA 1W49A 2OR3A 4D6XA 3FPFA 1G8GA 2CLMB 4BEVA 2C7QA 1VCOA 2OT3B 1MT0A 2VUHB 2ZUSA 4N5LA 5LD2C 1O5OA 4X66B 2H5LA 4YAEA 4DGSA 2VNSA 3NS7A 3FX2A 1FFYA 3NTRA 2ZUUA 3FNEA 3D4BA 3H0KA 2WSLA 4MGEA 1I3CA 2FSIA 3IUQA 1HLPA 3GLKA 4Z2YA 2I52A 2P30A 1EFCA 4DZZA 3VR4D 2XA1A 2JF0A 4C7MA 1S8AA 1XKTA 4ZI3A 1DAOA 3NEPX 2QROA 2DPGA 2CMDA 2HU8A 4LQCA 3ZHSA 1E1YA 1PEDA 4R01A 2E85A 3D6MA 2ZFUA 1XRJA 1BU8A 2ZBUA 4WVFA 1XMXA 1WXEA 2KE5A 4HLUC 3C6MA 4BP8A 2IQ5A 3CO5A 2AXEA 2O8FA 1MGOA 5EWLA 2GF9A 4NNJA 2QUZA 1C1HA 1N5KA 2OCBA 2ZTMA 3WHIA 2PT5A 1EP9A 5F12A 4BV2A 1N9GB 3IIJA 2GZ1A 4RDHA 4HP8A 4L50A 4G8JA 5U1PA 1GGVA 5LQJA 5L7YA 4YASA 3ZU2A 3DJYA 3EVTA 2VDOB 1MNQA 1CVIA