4EFRA

Bombyx mori lipoprotein 7 (crystal form ii) at 2.50 a resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
235
structure length
234
Chain Sequence
VPNDILEEQLYNSIVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRLIFAENAIKLMYKRDGLALTLSNDVHGNDGRLAFGDGKDKTSPKVSWKFIALWENNKVYFKILNTERNQYLVLGVGTNPNGDHMAFGVNSVDSFRAQYLQPAKYDKDNLFYIYNREYSKALTLSRTLETSGNRMAWGYNGRVIGSPEHYAWGVKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30kDa protein
publication title High-resolution structure of Bombyx mori lipoprotein 7: crystallographic determination of the identity of the protein and its potential role in detoxification.
pubmed doi rcsb
molecule tags Unknown function
total genus 78
structure length 234
sequence length 235
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4efrA02
2NVHA 2P39A 4ZFUB 9ILBA 2DREA 3N0KA 1AVXB 4I4XA 4I4YA 3CA6A 3MPPG 3ZX7A 5B2HA 2RSTA 3W9TA 4KEIA 4ZFWB 4J2YA 4FVVA 2D1ZA 1DZDA 4J23B 4AN7B 1HKNA 3A21A 5BVPI 4I4QA 5JMCA 4GAFA 4ZGRB 4ZKTB 1BFFA 4ISRA 3I2AA 3UD8A 2R9KB 1F31A 4I7IA 4ZBVB 4LO1C 2Y9GA 2K43A 2NP0A 1FMZA 4G9NA 5BQUA 4EB2B 3ZC9A 1ISWA 1TFMB 2LIQA 3VEQA 5BXPA 1EYLA 3OBTA 3RTJB 1S0FA 2KKIA 4CJMA 4P6AA 1MC9A 1AVAC 1A8DA 1EPWA 1SZ6B 2F2FC 2DRYA 2Q3NB 1XHBA 3POKA 4JAWA 4LO7C 1SR4A 1BFCA 2VSAA 3CRGA 3JUTA 1OQLB 1S0GA 2HW9A 4P0JA 4XFUA 3BAHA 3OGFA 3BB2A 3WO2A 3S8JA 1TIEA 3RSJA 1AXMA 3FJ9A 1W3AA 1I1BA 3FJFA 3K1XA 4X37A 2D44A 1Q1UA 4DENA 4Q9GA 4IZXA 3FJHA 3UD9A 2Y9WC 4I4OA 3S8KA 4IY8A 1PWAA 4IYBA 4XFTA 2VUAA 2HZ9A 1JT7A 1EV2A 4KEJA 2VSEA 3F1RA 4WBCA 5GAQA 5BXTA 3QR5A 3A22A 4I4SA 1S0BA 31BIA 1JY0A 1M2TB 2Z48A 4GP3A 4A7KA 2E4MA 1ISZA 1V6WA 1W3GA 4OEGA 1L2HA 1IHKA 1QQKA 3BAQA 3IIRA 4I1BA 2AQZA 1S0EA 3BRDA 1ISXA 4OWLA 5BOWA 5BQUC 2FFUA 4QC4A 4D0TA 4ISQA 3IM7A 1FN0A 2VU9A 3WO4A 4IZEA 3WO3A 3UJ4A 3CRHA 3VT2A 3O44A 4EEEB 1ABRB 1Q03A 1V6UA 1DZCA 3IM6A 1HWMB 1FWVA 2Y9XE 1FV3A 3FFZA 1BLAA 4FGFA 1ISYA 1SR4C 1YF8B 3CU1B 3OJMA 4L4HA 1W3FA 1WBAA 4Z9WB 5G00A 4I4VA 3UJ0A 1S0DA 4I4PA 1GGPB 1WBCA 3HN1A 3H6RB 2FO1A 1R8NA 3HOMA 3LLPA 3MALA 1K5UA 2VLCA 4Q9PA 1KNMA 2VXRA 3E8LC 4LO2C 2WRYA 4TLPA 3OJVA 5DUYA 3H6RA 3H6QA 3RMXA 3AH1A 2ZQOA 2ERMA 1YTOA 1DQGA 3V79C 3SNVA 5F8WA 4QBCA 1AFCA 1D0HA 4HR6C 2NYYA 2E4MC 4A7ZA 2MLLB 3BX1C 2D24A 4IY9A 1AVWB 1FV2A 1Q04A 1DFQA 3PG0A 1PZZA 2ET2A 3IAGC 3BA4A 3O5WB 4G6JA 2VXTI 3I29B 4QKSA 1I1EA 1AVUA 5FNXA 3WINA 4Q91A 4EFRA 4I0YA 4F83A 3VT0A 2XOAA 2ESUA 2FDBM 3P53A 1YYNA 4GAIA 1IOBA 3FJJA 3AKHA 3D7WB 3HALA 2Q9XA 3CA3A 4L4IA 3VSFA 5F8SA 1YBIA 1PC8B 3Q7XA 2AXMA 5D61A 5F90A 4I4UA 3CA4A 3BAGA 2NZ9A 3O4OA 1G9CA 1PUUB 5EHAA 1IT0A 1DJSB 3RMYA 6I1BA 4LO3A 1FQ9A 4IQPA 3BAVA 5EG6C 4LO2A 3ZXGA 2KLLA 4EFQA 2KH2A 1R8OA 4II0A 4P0KA 4D0ZA 1HCDA 4P0LA 1BFBA 3F62B 3FJKA 4H04A 3AKGA 3FJEA 4X39A 1IRPA 4A7YA 1RY7A 5FZZA 1JQZA 2UUSA 5BP5A 1QQLA 5DVHA 4PC4A 2HWAA 5FNWA 1BASA 2ZQNA 41BIA 1HWPB 3BA7A 2IHOA 3CAHA 3AH2A 3V0BB 1YXWA 1TP0A 3VT1A 4OEEA 3EF2A 3AH4A 1MD6A 3RTIB 1EVTA 2AAIB 3FJAA 3O4BA 2ZR1B 3TC2A 1BFGA 4HA2A 3OJ2A 1JTCA 3UD7A 4I1EA 4QALA 1RG8A 3P6IA 3WMVA 4ZOTA 1N4KA 3V0BA 3WINC 4IHZA 4GOVA 1ONKB 5BXSA 2QYIB 3AJ6A 3HSMA 1WD4A 5D62A 2FGFA 3WMUA 3BRFA 1E0OA 4J2KA 2KI6B 4IONA 2RQ9A 1DFCA 3FJCA 3PUBA 2D23A 5DZUA 1Z4SA 2X2SA 3N7MA 4X38A 1J0SA 4GP0A 1DLLA 2BEBA 4DEPA 3O4DA 1ITBA 1DQOA 21BIA 3BAOA 4LO3C 2D7RA 3FJ8A 3O4CA 3Q7WA 1G82A 3A07A 3R4SA 3AZWA 1S0LA 2IWTB 1IJTA 3CRIA 2GO2A 3I2XA 3N7KA 3LTQA 5I1BA 3NBCA 4QD2B 1T9FA 1JLYA 3FJDA 1JT3A 1V6XA 1XZZA 1T4QA 5BP5C 3ZXDA 2NTDA 3CA0A 3PHZA 4J2SA 1TWEA 1NUNA 3BADA 4I3NA 3UDAA 1BLDA 3N7LA 2K4AB 4H9WA 5FZYA 1HCEA 1TTUA 1HWOB 1PUMB 2YUGA 3HBWA 3KMVA 4QKRA 2J3PA 3BTAA 3P6JA 1UPSA 3O4AA 2KI4A 3NBEA 3VUOA 7I1BA 4EKXB 2K8RA 3CA5A 3AJ5A 4OW4A 3AKFA 3FJBA 1JT4A 1TOOA 3A23A 3AKIA 1S0CA 2GZBA 2WBCA 4I6IA 1G9AA 2MIBA 2D22A 1ISVA 3R4UA 3OBRA 1XG6A 2NM1A 1G9BA 2BEAA 4KBBA 4Z8SB 3IM5A 2X2TA 4ENDA 2HWMA 3CA1A 8I1BA 3NJ5A 3QYDA 4XKIA 3FUOA 3PMEA 4J2XA 3B9UA 3T8SA 3BAUA 2P23A 4HJJA 1XYFA 5DSSB 1BARA 2FFVA 1M16A 4I4RA 2D43A 4I2SA 3AZVA 1RZOB 1K5VA 3Q7YA 2DS0A 4LO0A 1CVSA 4G9MA 2D7IA 2D20A 3BRGC 1IRAX 3FUQA 2L5XA 3O49A 3CQAA 1WD3A 5BXRA 3N7JA 1RMLA 1DIWA 3HMYA 4QD2C 4KEKA 5F8YA 1QXMA 2AFGA 1Z0HA 2DRZA 4LO8B 4EFPA 1HWNB 2M49A 2BFHA 3VSZA 1HIBA 1NZKA 1P63A 5E24E 1FMMS 1TWMA 4GOYA 4JP0A 1FWUA 4ZLBB 1G9DA 4AN6A 4JQ0A 4OWKA 2Y9FA 3H6SE 4F34A 1AF9A 4OUJA 4I8MA 4G1RA 4I96A 2QN4A 3JRRA 4I37A 4JKXB 3OGGA 2RG9B 2I1BA 2LIEA 3BA5A 3WA1A 4OEFA 4LO1A 3V0AB 3FJIA 4USOA 3VWCA 5JLVA 4QO3A 4USPA 4LO7B 4XFSA 1CE7B 1IILA 4X3AA 1BA7A 4JRAA 4ZA3B 4D8HA 4DCKC 2F8XC 4OWJA 2F2FA 5HPZA 4R6UB 3ZC8A 3V0AA 5D63A 3ILAA 5FZUA 4LO0C 3NBNA 4QBVA 5EC5A 1V6VA 4JPZA 3FGMA 4G6MA 1JT5A 3O3QA 2Z49A 4ZFYB 4KC3A 1FGAA 4JKQA 1ILR1 1II4A 1VCLA 1Z2VA 2MC2A 4YOLA 3NBDA 3C9ZA 1JLXA
chains in the Genus database with same CATH superfamily
2NVHA 2P39A 4ZFUB 9ILBA 2DREA 3N0KA 1AVXB 4I4XA 4I4YA 3CA6A 3MPPG 3ZX7A 5B2HA 2RSTA 3W9TA 4KEIA 4ZFWB 4J2YA 4UY4A 4FVVA 2D1ZA 1DZDA 4J23B 4AN7B 1HKNA 3A21A 5BVPI 4I4QA 5JMCA 4GAFA 4ZGRB 4ZKTB 1BFFA 4ISRA 3I2AA 3UD8A 2R9KB 1F31A 4I7IA 4ZBVB 4LO1C 2Y9GA 2K43A 2NP0A 1FMZA 4G9NA 5BQUA 4EB2B 3ZC9A 1ISWA 1TFMB 2LIQA 3VEQA 5BXPA 1EYLA 3OBTA 3RTJB 1S0FA 2KKIA 4CJMA 4P6AA 1MC9A 1AVAC 1A8DA 1EPWA 1SZ6B 2F2FC 2DRYA 2Q3NB 1XHBA 3POKA 4JAWA 4LO7C 1SR4A 1BFCA 2VSAA 3CRGA 3JUTA 1OQLB 1S0GA 2HW9A 4P0JA 4XFUA 3BAHA 3OGFA 3BB2A 3WO2A 3S8JA 1TIEA 3RSJA 1AXMA 3FJ9A 1W3AA 1I1BA 3FJFA 3K1XA 4X37A 2D44A 1Q1UA 4DENA 4Q9GA 4IZXA 3FJHA 3UD9A 2Y9WC 4I4OA 3S8KA 4IY8A 1PWAA 4IYBA 4XFTA 2VUAA 2HZ9A 1JT7A 1EV2A 4KEJA 2VSEA 3F1RA 4WBCA 5GAQA 5BXTA 3QR5A 3A22A 4I4SA 1S0BA 31BIA 1JY0A 1M2TB 2Z48A 4GP3A 4A7KA 2E4MA 1ISZA 1V6WA 1W3GA 4OEGA 1L2HA 1IHKA 1QQKA 3BAQA 3IIRA 4I1BA 2AQZA 1S0EA 3BRDA 1ISXA 4OWLA 5BOWA 5BQUC 2FFUA 4H75A 4QC4A 4D0TA 4ISQA 3IM7A 1FN0A 2VU9A 3WO4A 4IZEA 3WO3A 3UJ4A 3CRHA 3VT2A 3O44A 4EEEB 1ABRB 1Q03A 1V6UA 1DZCA 3IM6A 1HWMB 1FWVA 2Y9XE 1FV3A 3FFZA 1BLAA 4FGFA 1ISYA 1SR4C 1YF8B 3CU1B 3OJMA 4L4HA 1W3FA 1WBAA 4Z9WB 5G00A 4I4VA 3UJ0A 1S0DA 4I4PA 1GGPB 1WBCA 3HN1A 3H6RB 2FO1A 1R8NA 3HOMA 3LLPA 3MALA 1K5UA 2VLCA 4Q9PA 1KNMA 2VXRA 3E8LC 4LO2C 2WRYA 4TLPA 3OJVA 5DUYA 3H6RA 3H6QA 3RMXA 3AH1A 2ZQOA 2ERMA 1YTOA 1DQGA 3V79C 3SNVA 5F8WA 4QBCA 1AFCA 1D0HA 4HR6C 2NYYA 2E4MC 4A7ZA 2MLLB 3BX1C 2D24A 4IY9A 4MZHA 1AVWB 1FV2A 1Q04A 1DFQA 3PG0A 1PZZA 2ET2A 3IAGC 3BA4A 3O5WB 4G6JA 2VXTI 3I29B 4QKSA 1I1EA 1AVUA 5FNXA 3WINA 4Q91A 4EFRA 4I0YA 4F83A 3VT0A 2XOAA 2ESUA 2FDBM 3P53A 1YYNA 4GAIA 1IOBA 3FJJA 3AKHA 3D7WB 3HALA 2Q9XA 3CA3A 4L4IA 3VSFA 5F8SA 1YBIA 1PC8B 3Q7XA 2AXMA 5D61A 5F90A 4I4UA 3CA4A 3BAGA 2NZ9A 3O4OA 1G9CA 1PUUB 5EHAA 1IT0A 1DJSB 3RMYA 4MZGB 6I1BA 4LO3A 1FQ9A 4IQPA 3BAVA 5EG6C 4LO2A 3ZXGA 2KLLA 4EFQA 2KH2A 1R8OA 4II0A 4P0KA 4D0ZA 1HCDA 4P0LA 1BFBA 3F62B 3FJKA 4H04A 3AKGA 3FJEA 4X39A 1IRPA 4A7YA 1RY7A 5FZZA 1JQZA 2UUSA 5BP5A 1QQLA 5DVHA 4PC4A 2HWAA 5FNWA 1BASA 2ZQNA 41BIA 1HWPB 3BA7A 2IHOA 3CAHA 3AH2A 3V0BB 1YXWA 1TP0A 3VT1A 4OEEA 3EF2A 3AH4A 1MD6A 3RTIB 1EVTA 2AAIB 3FJAA 3O4BA 2NS2A 2ZR1B 3TC2A 1BFGA 4HA2A 3OJ2A 1JTCA 3UD7A 4I1EA 4QALA 1RG8A 3P6IA 3WMVA 4ZOTA 1N4KA 3V0BA 3WINC 4IHZA 4GOVA 1ONKB 5BXSA 2QYIB 3AJ6A 3HSMA 1WD4A 5D62A 2FGFA 3WMUA 3BRFA 1E0OA 4J2KA 2KI6B 4IONA 2RQ9A 1DFCA 3FJCA 3PUBA 2D23A 5DZUA 1Z4SA 2X2SA 3N7MA 4X38A 1J0SA 4GP0A 1DLLA 2BEBA 4DEPA 3O4DA 1ITBA 1DQOA 21BIA 3BAOA 4LO3C 2D7RA 3FJ8A 3O4CA 3Q7WA 1G82A 3A07A 3R4SA 3AZWA 1S0LA 2IWTB 1IJTA 3CRIA 2GO2A 3I2XA 3N7KA 3LTQA 5I1BA 3NBCA 4QD2B 1T9FA 1JLYA 3FJDA 1JT3A 1V6XA 1XZZA 1T4QA 5BP5C 3ZXDA 2NTDA 3CA0A 3PHZA 4J2SA 1TWEA 1NUNA 3BADA 4I3NA 3UDAA 1BLDA 3N7LA 2K4AB 4H9WA 5FZYA 1HCEA 1TTUA 1HWOB 1PUMB 2YUGA 3HBWA 3KMVA 4QKRA 2J3PA 3BTAA 3P6JA 1UPSA 3O4AA 2KI4A 3NBEA 3VUOA 7I1BA 4EKXB 2K8RA 3CA5A 3AJ5A 4OW4A 3AKFA 3FJBA 1JT4A 1TOOA 3A23A 3AKIA 1S0CA 2GZBA 2WBCA 4I6IA 1G9AA 2MIBA 2D22A 1ISVA 3R4UA 3OBRA 1XG6A 2NM1A 1G9BA 2BEAA 4KBBA 4Z8SB 3IM5A 2X2TA 4ENDA 2HWMA 3CA1A 8I1BA 3NJ5A 3QYDA 4XKIA 3FUOA 3PMEA 4J2XA 3B9UA 3T8SA 3BAUA 2P23A 4HJJA 1XYFA 5DSSB 1BARA 2FFVA 1M16A 4I4RA 2D43A 4I2SA 3AZVA 4MZFB 1RZOB 1K5VA 3Q7YA 2DS0A 4LO0A 1CVSA 4G9MA 2D7IA 2D20A 3BRGC 1IRAX 3FUQA 2L5XA 3O49A 3CQAA 1WD3A 5BXRA 3N7JA 1RMLA 1DIWA 3HMYA 4QD2C 4KEKA 5F8YA 1QXMA 2AFGA 1Z0HA 2DRZA 4LO8B 4EFPA 1HWNB 2M49A 2BFHA 3VSZA 1HIBA 1NZKA 1P63A 5E24E 1FMMS 1TWMA 4GOYA 4JP0A 1FWUA 4ZLBB 1G9DA 4AN6A 4JQ0A 4OWKA 2Y9FA 3H6SE 4F34A 1AF9A 4OUJA 4I8MA 4G1RA 4I96A 2QN4A 3JRRA 4I37A 4JKXB 3OGGA 2RG9B 2I1BA 2LIEA 3BA5A 3WA1A 4OEFA 4LO1A 3V0AB 3FJIA 4USOA 3VWCA 5JLVA 4QO3A 4USPA 4LO7B 4XFSA 1CE7B 1IILA 4X3AA 1BA7A 4JRAA 4ZA3B 4D8HA 4DCKC 2F8XC 4OWJA 2F2FA 5HPZA 4R6UB 3ZC8A 3V0AA 5D63A 3ILAA 5FZUA 4LO0C 3NBNA 4QBVA 5EC5A 1V6VA 4JPZA 3FGMA 4G6MA 1JT5A 3O3QA 2Z49A 4ZFYB 4KC3A 1FGAA 4JKQA 1ILR1 1II4A 1VCLA 1Z2VA 2MC2A 4YOLA 3NBDA 3C9ZA 1JLXA
chains in the Genus database with same CATH topology
2NVHA 2P39A 4ZFUB 9ILBA 2DREA 3N0KA 1AVXB 4I4XA 4I4YA 3CA6A 3MPPG 3ZX7A 5B2HA 2RSTA 3W9TA 4KEIA 4ZFWB 4J2YA 4UY4A 4FVVA 2D1ZA 1DZDA 4J23B 4AN7B 1HKNA 3A21A 5BVPI 4I4QA 5JMCA 4GAFA 4ZGRB 4ZKTB 1BFFA 4ISRA 3I2AA 3UD8A 2R9KB 1F31A 4I7IA 4ZBVB 4LO1C 2Y9GA 2K43A 2NP0A 1FMZA 4G9NA 5BQUA 4EB2B 3ZC9A 1ISWA 1TFMB 2LIQA 3VEQA 5BXPA 1EYLA 3OBTA 3RTJB 1S0FA 2KKIA 4CJMA 4P6AA 1MC9A 1AVAC 1A8DA 1EPWA 1SZ6B 2F2FC 2DRYA 2Q3NB 1XHBA 3POKA 4JAWA 4LO7C 1SR4A 1BFCA 2VSAA 3CRGA 3JUTA 1OQLB 1S0GA 2HW9A 4P0JA 4XFUA 3BAHA 3OGFA 3BB2A 3WO2A 3S8JA 1TIEA 3RSJA 1AXMA 3FJ9A 1W3AA 1I1BA 3FJFA 3K1XA 4X37A 2D44A 1Q1UA 4DENA 4Q9GA 4IZXA 3FJHA 3UD9A 2Y9WC 4I4OA 3S8KA 4IY8A 1PWAA 4IYBA 4XFTA 2VUAA 2HZ9A 1JT7A 1EV2A 4KEJA 2VSEA 3F1RA 4WBCA 5GAQA 5BXTA 3QR5A 3A22A 4I4SA 1S0BA 31BIA 1JY0A 1M2TB 2Z48A 4GP3A 4A7KA 2E4MA 1ISZA 1V6WA 1W3GA 4OEGA 1L2HA 1IHKA 1QQKA 3BAQA 3IIRA 4I1BA 2AQZA 1S0EA 3BRDA 1ISXA 4OWLA 5BOWA 5BQUC 2FFUA 4H75A 4QC4A 4D0TA 4ISQA 3IM7A 1FN0A 2VU9A 3WO4A 4IZEA 3WO3A 3UJ4A 3CRHA 3VT2A 3O44A 4EEEB 1ABRB 1Q03A 1V6UA 1DZCA 3IM6A 1HWMB 1FWVA 2Y9XE 1FV3A 3FFZA 1BLAA 4FGFA 1ISYA 1SR4C 1YF8B 3CU1B 3OJMA 4L4HA 1W3FA 1WBAA 4Z9WB 5G00A 4I4VA 3UJ0A 1S0DA 4I4PA 1GGPB 1WBCA 3HN1A 3H6RB 2FO1A 1R8NA 3HOMA 3LLPA 3MALA 1K5UA 2VLCA 4Q9PA 1KNMA 2VXRA 3E8LC 4LO2C 2WRYA 4TLPA 3OJVA 5DUYA 3H6RA 3H6QA 3RMXA 3AH1A 2ZQOA 2ERMA 1YTOA 1DQGA 3V79C 3SNVA 5F8WA 4QBCA 1AFCA 1D0HA 4HR6C 2NYYA 2E4MC 4A7ZA 2MLLB 3BX1C 2D24A 4IY9A 4MZHA 1AVWB 1FV2A 1Q04A 1DFQA 3PG0A 1PZZA 2ET2A 3IAGC 3BA4A 3O5WB 4G6JA 2VXTI 3I29B 4QKSA 1I1EA 1AVUA 5FNXA 3WINA 4Q91A 4EFRA 4I0YA 4F83A 3VT0A 2XOAA 2ESUA 2FDBM 3P53A 1YYNA 4GAIA 1IOBA 3FJJA 3AKHA 3D7WB 3HALA 2Q9XA 3CA3A 4L4IA 3VSFA 5F8SA 1YBIA 1PC8B 3Q7XA 2AXMA 5D61A 5F90A 4I4UA 3CA4A 3BAGA 2NZ9A 3O4OA 1G9CA 1PUUB 5EHAA 1IT0A 1DJSB 3RMYA 4MZGB 6I1BA 4LO3A 1FQ9A 4IQPA 3BAVA 5EG6C 4LO2A 3ZXGA 2KLLA 4EFQA 2KH2A 1R8OA 4II0A 4P0KA 4D0ZA 1HCDA 4P0LA 1BFBA 3F62B 3FJKA 4H04A 3AKGA 3FJEA 4X39A 1IRPA 4A7YA 1RY7A 5FZZA 1JQZA 2UUSA 5BP5A 1QQLA 5DVHA 4PC4A 2HWAA 5FNWA 1BASA 2ZQNA 41BIA 1HWPB 3BA7A 2IHOA 3CAHA 3AH2A 3V0BB 1YXWA 1TP0A 3VT1A 4OEEA 3EF2A 3AH4A 1MD6A 3RTIB 1EVTA 2AAIB 3FJAA 3O4BA 2NS2A 2ZR1B 3TC2A 1BFGA 4HA2A 3OJ2A 1JTCA 3UD7A 4I1EA 4QALA 1RG8A 3P6IA 3WMVA 4ZOTA 1N4KA 3V0BA 3WINC 4IHZA 4GOVA 1ONKB 5BXSA 2QYIB 3AJ6A 3HSMA 1WD4A 5D62A 2FGFA 3WMUA 3BRFA 1E0OA 4J2KA 2KI6B 4IONA 2RQ9A 1DFCA 3FJCA 3PUBA 2D23A 5DZUA 1Z4SA 2X2SA 3N7MA 4X38A 1J0SA 4GP0A 1DLLA 2BEBA 4DEPA 3O4DA 1ITBA 1DQOA 21BIA 3BAOA 4LO3C 2D7RA 3FJ8A 3O4CA 3Q7WA 1G82A 3A07A 3R4SA 3AZWA 1S0LA 2IWTB 1IJTA 3CRIA 2GO2A 3I2XA 3N7KA 3LTQA 5I1BA 3NBCA 4QD2B 1T9FA 1JLYA 3FJDA 1JT3A 1V6XA 1XZZA 1T4QA 5BP5C 3ZXDA 2NTDA 3CA0A 3PHZA 4J2SA 1TWEA 1NUNA 3BADA 4I3NA 3UDAA 1BLDA 3N7LA 2K4AB 4H9WA 5FZYA 1HCEA 1TTUA 1HWOB 1PUMB 2YUGA 3HBWA 3KMVA 4QKRA 2J3PA 3BTAA 3P6JA 1UPSA 3O4AA 2KI4A 3NBEA 3VUOA 7I1BA 4EKXB 2K8RA 3CA5A 3AJ5A 4OW4A 3AKFA 3FJBA 1JT4A 1TOOA 3A23A 3AKIA 1S0CA 2GZBA 2WBCA 4I6IA 1G9AA 2MIBA 2D22A 1ISVA 3R4UA 3OBRA 1XG6A 2NM1A 1G9BA 2BEAA 4KBBA 4Z8SB 3IM5A 2X2TA 4ENDA 2HWMA 3CA1A 8I1BA 3NJ5A 3QYDA 4XKIA 3FUOA 3PMEA 4J2XA 3B9UA 3T8SA 3BAUA 2P23A 4HJJA 1XYFA 5DSSB 1BARA 2FFVA 1M16A 4I4RA 2D43A 4I2SA 3AZVA 4MZFB 1RZOB 1K5VA 3Q7YA 2DS0A 4LO0A 1CVSA 4G9MA 2D7IA 2D20A 3BRGC 1IRAX 3FUQA 2L5XA 3O49A 3CQAA 1WD3A 5BXRA 3N7JA 1RMLA 1DIWA 3HMYA 4QD2C 4KEKA 5F8YA 1QXMA 2AFGA 1Z0HA 2DRZA 4LO8B 4EFPA 1HWNB 2M49A 2BFHA 3VSZA 1HIBA 1NZKA 1P63A 5E24E 1FMMS 1TWMA 4GOYA 4JP0A 1FWUA 4ZLBB 1G9DA 4AN6A 4JQ0A 4OWKA 2Y9FA 3H6SE 4F34A 1AF9A 4OUJA 4I8MA 4G1RA 4I96A 2QN4A 3JRRA 4I37A 4JKXB 3OGGA 2RG9B 2I1BA 2LIEA 3BA5A 3WA1A 4OEFA 4LO1A 3V0AB 3FJIA 4USOA 3VWCA 5JLVA 4QO3A 4USPA 4LO7B 4XFSA 1CE7B 1IILA 4X3AA 1BA7A 4JRAA 4ZA3B 4D8HA 4DCKC 2F8XC 4OWJA 2F2FA 5HPZA 4R6UB 3ZC8A 3V0AA 5D63A 3ILAA 5FZUA 4LO0C 3NBNA 4QBVA 5EC5A 1V6VA 4JPZA 3FGMA 4G6MA 1JT5A 3O3QA 2Z49A 4ZFYB 4KC3A 1FGAA 4JKQA 1ILR1 1II4A 1VCLA 1Z2VA 2MC2A 4YOLA 3NBDA 3C9ZA 1JLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVH A;  2P39 A;  4ZFU B;  9ILB A;  2DRE A;  3N0K A;  1AVX B;  4I4X A;  4I4Y A;  3CA6 A;  3MPP G;  3ZX7 A;  5B2H A;  2RST A;  3W9T A;  4KEI A;  4ZFW B;  4J2Y A;  4FVV A;  2D1Z A;  1DZD A;  4J23 B;  4AN7 B;  1HKN A;  3A21 A;  5BVP I;  4I4Q A;  5JMC A;  4GAF A;  4ZGR B;  4ZKT B;  1BFF A;  4ISR A;  3I2A A;  3UD8 A;  2R9K B;  1F31 A;  4I7I A;  4ZBV B;  4LO1 C;  2Y9G A;  2K43 A;  2NP0 A;  1FMZ A;  4G9N A;  5BQU A;  4EB2 B;  3ZC9 A;  1ISW A;  1TFM B;  2LIQ A;  3VEQ A;  5BXP A;  1EYL A;  3OBT A;  3RTJ B;  1S0F A;  2KKI A;  4CJM A;  4P6A A;  1MC9 A;  1AVA C;  1A8D A;  1EPW A;  1SZ6 B;  2F2F C;  2DRY A;  2Q3N B;  1XHB A;  3POK A;  4JAW A;  4LO7 C;  1SR4 A;  1BFC A;  2VSA A;  3CRG A;  3JUT A;  1OQL B;  1S0G A;  2HW9 A;  4P0J A;  4XFU A;  3BAH A;  3OGF A;  3BB2 A;  3WO2 A;  3S8J A;  1TIE A;  3RSJ A;  1AXM A;  3FJ9 A;  1W3A A;  1I1B A;  3FJF A;  3K1X A;  4X37 A;  2D44 A;  1Q1U A;  4DEN A;  4Q9G A;  4IZX A;  3FJH A;  3UD9 A;  2Y9W C;  4I4O A;  3S8K A;  4IY8 A;  1PWA A;  4IYB A;  4XFT A;  2VUA A;  2HZ9 A;  1JT7 A;  1EV2 A;  4KEJ A;  2VSE A;  3F1R A;  4WBC A;  5GAQ A;  5BXT A;  3QR5 A;  3A22 A;  4I4S A;  1S0B A;  31BI A;  1JY0 A;  1M2T B;  2Z48 A;  4GP3 A;  4A7K A;  2E4M A;  1ISZ A;  1V6W A;  1W3G A;  4OEG A;  1L2H A;  1IHK A;  1QQK A;  3BAQ A;  3IIR A;  4I1B A;  2AQZ A;  1S0E A;  3BRD A;  1ISX A;  4OWL A;  5BOW A;  5BQU C;  2FFU A;  4QC4 A;  4D0T A;  4ISQ A;  3IM7 A;  1FN0 A;  2VU9 A;  3WO4 A;  4IZE A;  3WO3 A;  3UJ4 A;  3CRH A;  3VT2 A;  3O44 A;  4EEE B;  1ABR B;  1Q03 A;  1V6U A;  1DZC A;  3IM6 A;  1HWM B;  1FWV A;  2Y9X E;  1FV3 A;  3FFZ A;  1BLA A;  4FGF A;  1ISY A;  1SR4 C;  1YF8 B;  3CU1 B;  3OJM A;  4L4H A;  1W3F A;  1WBA A;  4Z9W B;  5G00 A;  4I4V A;  3UJ0 A;  1S0D A;  4I4P A;  1GGP B;  1WBC A;  3HN1 A;  3H6R B;  2FO1 A;  1R8N A;  3HOM A;  3LLP A;  3MAL A;  1K5U A;  2VLC A;  4Q9P A;  1KNM A;  2VXR A;  3E8L C;  4LO2 C;  2WRY A;  4TLP A;  3OJV A;  5DUY A;  3H6R A;  3H6Q A;  3RMX A;  3AH1 A;  2ZQO A;  2ERM A;  1YTO A;  1DQG A;  3V79 C;  3SNV A;  5F8W A;  4QBC A;  1AFC A;  1D0H A;  4HR6 C;  2NYY A;  2E4M C;  4A7Z A;  2MLL B;  3BX1 C;  2D24 A;  4IY9 A;  1AVW B;  1FV2 A;  1Q04 A;  1DFQ A;  3PG0 A;  1PZZ A;  2ET2 A;  3IAG C;  3BA4 A;  3O5W B;  4G6J A;  2VXT I;  3I29 B;  4QKS A;  1I1E A;  1AVU A;  5FNX A;  3WIN A;  4Q91 A;  4EFR A;  4I0Y A;  4F83 A;  3VT0 A;  2XOA A;  2ESU A;  2FDB M;  3P53 A;  1YYN A;  4GAI A;  1IOB A;  3FJJ A;  3AKH A;  3D7W B;  3HAL A;  2Q9X A;  3CA3 A;  4L4I A;  3VSF A;  5F8S A;  1YBI A;  1PC8 B;  3Q7X A;  2AXM A;  5D61 A;  5F90 A;  4I4U A;  3CA4 A;  3BAG A;  2NZ9 A;  3O4O A;  1G9C A;  1PUU B;  5EHA A;  1IT0 A;  1DJS B;  3RMY A;  6I1B A;  4LO3 A;  1FQ9 A;  4IQP A;  3BAV A;  5EG6 C;  4LO2 A;  3ZXG A;  2KLL A;  4EFQ A;  2KH2 A;  1R8O A;  4II0 A;  4P0K A;  4D0Z A;  1HCD A;  4P0L A;  1BFB A;  3F62 B;  3FJK A;  4H04 A;  3AKG A;  3FJE A;  4X39 A;  1IRP A;  4A7Y A;  1RY7 A;  5FZZ A;  1JQZ A;  2UUS A;  5BP5 A;  1QQL A;  5DVH A;  4PC4 A;  2HWA A;  5FNW A;  1BAS A;  2ZQN A;  41BI A;  1HWP B;  3BA7 A;  2IHO A;  3CAH A;  3AH2 A;  3V0B B;  1YXW A;  1TP0 A;  3VT1 A;  4OEE A;  3EF2 A;  3AH4 A;  1MD6 A;  3RTI B;  1EVT A;  2AAI B;  3FJA A;  3O4B A;  2ZR1 B;  3TC2 A;  1BFG A;  4HA2 A;  3OJ2 A;  1JTC A;  3UD7 A;  4I1E A;  4QAL A;  1RG8 A;  3P6I A;  3WMV A;  4ZOT A;  1N4K A;  3V0B A;  3WIN C;  4IHZ A;  4GOV A;  1ONK B;  5BXS A;  2QYI B;  3AJ6 A;  3HSM A;  1WD4 A;  5D62 A;  2FGF A;  3WMU A;  3BRF A;  1E0O A;  4J2K A;  2KI6 B;  4ION A;  2RQ9 A;  1DFC A;  3FJC A;  3PUB A;  2D23 A;  5DZU A;  1Z4S A;  2X2S A;  3N7M A;  4X38 A;  1J0S A;  4GP0 A;  1DLL A;  2BEB A;  4DEP A;  3O4D A;  1ITB A;  1DQO A;  21BI A;  3BAO A;  4LO3 C;  2D7R A;  3FJ8 A;  3O4C A;  3Q7W A;  1G82 A;  3A07 A;  3R4S A;  3AZW A;  1S0L A;  2IWT B;  1IJT A;  3CRI A;  2GO2 A;  3I2X A;  3N7K A;  3LTQ A;  5I1B A;  3NBC A;  4QD2 B;  1T9F A;  1JLY A;  3FJD A;  1JT3 A;  1V6X A;  1XZZ A;  1T4Q A;  5BP5 C;  3ZXD A;  2NTD A;  3CA0 A;  3PHZ A;  4J2S A;  1TWE A;  1NUN A;  3BAD A;  4I3N A;  3UDA A;  1BLD A;  3N7L A;  2K4A B;  4H9W A;  5FZY A;  1HCE A;  1TTU A;  1HWO B;  1PUM B;  2YUG A;  3HBW A;  3KMV A;  4QKR A;  2J3P A;  3BTA A;  3P6J A;  1UPS A;  3O4A A;  2KI4 A;  3NBE A;  3VUO A;  7I1B A;  4EKX B;  2K8R A;  3CA5 A;  3AJ5 A;  4OW4 A;  3AKF A;  3FJB A;  1JT4 A;  1TOO A;  3A23 A;  3AKI A;  1S0C A;  2GZB A;  2WBC A;  4I6I A;  1G9A A;  2MIB A;  2D22 A;  1ISV A;  3R4U A;  3OBR A;  1XG6 A;  2NM1 A;  1G9B A;  2BEA A;  4KBB A;  4Z8S B;  3IM5 A;  2X2T A;  4END A;  2HWM A;  3CA1 A;  8I1B A;  3NJ5 A;  3QYD A;  4XKI A;  3FUO A;  3PME A;  4J2X A;  3B9U A;  3T8S A;  3BAU A;  2P23 A;  4HJJ A;  1XYF A;  5DSS B;  1BAR A;  2FFV A;  1M16 A;  4I4R A;  2D43 A;  4I2S A;  3AZV A;  1RZO B;  1K5V A;  3Q7Y A;  2DS0 A;  4LO0 A;  1CVS A;  4G9M A;  2D7I A;  2D20 A;  3BRG C;  1IRA X;  3FUQ A;  2L5X A;  3O49 A;  3CQA A;  1WD3 A;  5BXR A;  3N7J A;  1RML A;  1DIW A;  3HMY A;  4QD2 C;  4KEK A;  5F8Y A;  1QXM A;  2AFG A;  1Z0H A;  2DRZ A;  4LO8 B;  4EFP A;  1HWN B;  2M49 A;  2BFH A;  3VSZ A;  1HIB A;  1NZK A;  1P63 A;  5E24 E;  1FMM S;  1TWM A;  4GOY A;  4JP0 A;  1FWU A;  4ZLB B;  1G9D A;  4AN6 A;  4JQ0 A;  4OWK A;  2Y9F A;  3H6S E;  4F34 A;  1AF9 A;  4OUJ A;  4I8M A;  4G1R A;  4I96 A;  2QN4 A;  3JRR A;  4I37 A;  4JKX B;  3OGG A;  2RG9 B;  2I1B A;  2LIE A;  3BA5 A;  3WA1 A;  4OEF A;  4LO1 A;  3V0A B;  3FJI A;  4USO A;  3VWC A;  5JLV A;  4QO3 A;  4USP A;  4LO7 B;  4XFS A;  1CE7 B;  1IIL A;  4X3A A;  1BA7 A;  4JRA A;  4ZA3 B;  4D8H A;  4DCK C;  2F8X C;  4OWJ A;  2F2F A;  5HPZ A;  4R6U B;  3ZC8 A;  3V0A A;  5D63 A;  3ILA A;  5FZU A;  4LO0 C;  3NBN A;  4QBV A;  5EC5 A;  1V6V A;  4JPZ A;  3FGM A;  4G6M A;  1JT5 A;  3O3Q A;  2Z49 A;  4ZFY B;  4KC3 A;  1FGA A;  4JKQ A;  1ILR 1;  1II4 A;  1VCL A;  1Z2V A;  2MC2 A;  4YOL A;  3NBD A;  3C9Z A;  1JLX A; 
#chains in the Genus database with same CATH topology
 2NVH A;  2P39 A;  4ZFU B;  9ILB A;  2DRE A;  3N0K A;  1AVX B;  4I4X A;  4I4Y A;  3CA6 A;  3MPP G;  3ZX7 A;  5B2H A;  2RST A;  3W9T A;  4KEI A;  4ZFW B;  4J2Y A;  4UY4 A;  4FVV A;  2D1Z A;  1DZD A;  4J23 B;  4AN7 B;  1HKN A;  3A21 A;  5BVP I;  4I4Q A;  5JMC A;  4GAF A;  4ZGR B;  4ZKT B;  1BFF A;  4ISR A;  3I2A A;  3UD8 A;  2R9K B;  1F31 A;  4I7I A;  4ZBV B;  4LO1 C;  2Y9G A;  2K43 A;  2NP0 A;  1FMZ A;  4G9N A;  5BQU A;  4EB2 B;  3ZC9 A;  1ISW A;  1TFM B;  2LIQ A;  3VEQ A;  5BXP A;  1EYL A;  3OBT A;  3RTJ B;  1S0F A;  2KKI A;  4CJM A;  4P6A A;  1MC9 A;  1AVA C;  1A8D A;  1EPW A;  1SZ6 B;  2F2F C;  2DRY A;  2Q3N B;  1XHB A;  3POK A;  4JAW A;  4LO7 C;  1SR4 A;  1BFC A;  2VSA A;  3CRG A;  3JUT A;  1OQL B;  1S0G A;  2HW9 A;  4P0J A;  4XFU A;  3BAH A;  3OGF A;  3BB2 A;  3WO2 A;  3S8J A;  1TIE A;  3RSJ A;  1AXM A;  3FJ9 A;  1W3A A;  1I1B A;  3FJF A;  3K1X A;  4X37 A;  2D44 A;  1Q1U A;  4DEN A;  4Q9G A;  4IZX A;  3FJH A;  3UD9 A;  2Y9W C;  4I4O A;  3S8K A;  4IY8 A;  1PWA A;  4IYB A;  4XFT A;  2VUA A;  2HZ9 A;  1JT7 A;  1EV2 A;  4KEJ A;  2VSE A;  3F1R A;  4WBC A;  5GAQ A;  5BXT A;  3QR5 A;  3A22 A;  4I4S A;  1S0B A;  31BI A;  1JY0 A;  1M2T B;  2Z48 A;  4GP3 A;  4A7K A;  2E4M A;  1ISZ A;  1V6W A;  1W3G A;  4OEG A;  1L2H A;  1IHK A;  1QQK A;  3BAQ A;  3IIR A;  4I1B A;  2AQZ A;  1S0E A;  3BRD A;  1ISX A;  4OWL A;  5BOW A;  5BQU C;  2FFU A;  4H75 A;  4QC4 A;  4D0T A;  4ISQ A;  3IM7 A;  1FN0 A;  2VU9 A;  3WO4 A;  4IZE A;  3WO3 A;  3UJ4 A;  3CRH A;  3VT2 A;  3O44 A;  4EEE B;  1ABR B;  1Q03 A;  1V6U A;  1DZC A;  3IM6 A;  1HWM B;  1FWV A;  2Y9X E;  1FV3 A;  3FFZ A;  1BLA A;  4FGF A;  1ISY A;  1SR4 C;  1YF8 B;  3CU1 B;  3OJM A;  4L4H A;  1W3F A;  1WBA A;  4Z9W B;  5G00 A;  4I4V A;  3UJ0 A;  1S0D A;  4I4P A;  1GGP B;  1WBC A;  3HN1 A;  3H6R B;  2FO1 A;  1R8N A;  3HOM A;  3LLP A;  3MAL A;  1K5U A;  2VLC A;  4Q9P A;  1KNM A;  2VXR A;  3E8L C;  4LO2 C;  2WRY A;  4TLP A;  3OJV A;  5DUY A;  3H6R A;  3H6Q A;  3RMX A;  3AH1 A;  2ZQO A;  2ERM A;  1YTO A;  1DQG A;  3V79 C;  3SNV A;  5F8W A;  4QBC A;  1AFC A;  1D0H A;  4HR6 C;  2NYY A;  2E4M C;  4A7Z A;  2MLL B;  3BX1 C;  2D24 A;  4IY9 A;  4MZH A;  1AVW B;  1FV2 A;  1Q04 A;  1DFQ A;  3PG0 A;  1PZZ A;  2ET2 A;  3IAG C;  3BA4 A;  3O5W B;  4G6J A;  2VXT I;  3I29 B;  4QKS A;  1I1E A;  1AVU A;  5FNX A;  3WIN A;  4Q91 A;  4EFR A;  4I0Y A;  4F83 A;  3VT0 A;  2XOA A;  2ESU A;  2FDB M;  3P53 A;  1YYN A;  4GAI A;  1IOB A;  3FJJ A;  3AKH A;  3D7W B;  3HAL A;  2Q9X A;  3CA3 A;  4L4I A;  3VSF A;  5F8S A;  1YBI A;  1PC8 B;  3Q7X A;  2AXM A;  5D61 A;  5F90 A;  4I4U A;  3CA4 A;  3BAG A;  2NZ9 A;  3O4O A;  1G9C A;  1PUU B;  5EHA A;  1IT0 A;  1DJS B;  3RMY A;  4MZG B;  6I1B A;  4LO3 A;  1FQ9 A;  4IQP A;  3BAV A;  5EG6 C;  4LO2 A;  3ZXG A;  2KLL A;  4EFQ A;  2KH2 A;  1R8O A;  4II0 A;  4P0K A;  4D0Z A;  1HCD A;  4P0L A;  1BFB A;  3F62 B;  3FJK A;  4H04 A;  3AKG A;  3FJE A;  4X39 A;  1IRP A;  4A7Y A;  1RY7 A;  5FZZ A;  1JQZ A;  2UUS A;  5BP5 A;  1QQL A;  5DVH A;  4PC4 A;  2HWA A;  5FNW A;  1BAS A;  2ZQN A;  41BI A;  1HWP B;  3BA7 A;  2IHO A;  3CAH A;  3AH2 A;  3V0B B;  1YXW A;  1TP0 A;  3VT1 A;  4OEE A;  3EF2 A;  3AH4 A;  1MD6 A;  3RTI B;  1EVT A;  2AAI B;  3FJA A;  3O4B A;  2NS2 A;  2ZR1 B;  3TC2 A;  1BFG A;  4HA2 A;  3OJ2 A;  1JTC A;  3UD7 A;  4I1E A;  4QAL A;  1RG8 A;  3P6I A;  3WMV A;  4ZOT A;  1N4K A;  3V0B A;  3WIN C;  4IHZ A;  4GOV A;  1ONK B;  5BXS A;  2QYI B;  3AJ6 A;  3HSM A;  1WD4 A;  5D62 A;  2FGF A;  3WMU A;  3BRF A;  1E0O A;  4J2K A;  2KI6 B;  4ION A;  2RQ9 A;  1DFC A;  3FJC A;  3PUB A;  2D23 A;  5DZU A;  1Z4S A;  2X2S A;  3N7M A;  4X38 A;  1J0S A;  4GP0 A;  1DLL A;  2BEB A;  4DEP A;  3O4D A;  1ITB A;  1DQO A;  21BI A;  3BAO A;  4LO3 C;  2D7R A;  3FJ8 A;  3O4C A;  3Q7W A;  1G82 A;  3A07 A;  3R4S A;  3AZW A;  1S0L A;  2IWT B;  1IJT A;  3CRI A;  2GO2 A;  3I2X A;  3N7K A;  3LTQ A;  5I1B A;  3NBC A;  4QD2 B;  1T9F A;  1JLY A;  3FJD A;  1JT3 A;  1V6X A;  1XZZ A;  1T4Q A;  5BP5 C;  3ZXD A;  2NTD A;  3CA0 A;  3PHZ A;  4J2S A;  1TWE A;  1NUN A;  3BAD A;  4I3N A;  3UDA A;  1BLD A;  3N7L A;  2K4A B;  4H9W A;  5FZY A;  1HCE A;  1TTU A;  1HWO B;  1PUM B;  2YUG A;  3HBW A;  3KMV A;  4QKR A;  2J3P A;  3BTA A;  3P6J A;  1UPS A;  3O4A A;  2KI4 A;  3NBE A;  3VUO A;  7I1B A;  4EKX B;  2K8R A;  3CA5 A;  3AJ5 A;  4OW4 A;  3AKF A;  3FJB A;  1JT4 A;  1TOO A;  3A23 A;  3AKI A;  1S0C A;  2GZB A;  2WBC A;  4I6I A;  1G9A A;  2MIB A;  2D22 A;  1ISV A;  3R4U A;  3OBR A;  1XG6 A;  2NM1 A;  1G9B A;  2BEA A;  4KBB A;  4Z8S B;  3IM5 A;  2X2T A;  4END A;  2HWM A;  3CA1 A;  8I1B A;  3NJ5 A;  3QYD A;  4XKI A;  3FUO A;  3PME A;  4J2X A;  3B9U A;  3T8S A;  3BAU A;  2P23 A;  4HJJ A;  1XYF A;  5DSS B;  1BAR A;  2FFV A;  1M16 A;  4I4R A;  2D43 A;  4I2S A;  3AZV A;  4MZF B;  1RZO B;  1K5V A;  3Q7Y A;  2DS0 A;  4LO0 A;  1CVS A;  4G9M A;  2D7I A;  2D20 A;  3BRG C;  1IRA X;  3FUQ A;  2L5X A;  3O49 A;  3CQA A;  1WD3 A;  5BXR A;  3N7J A;  1RML A;  1DIW A;  3HMY A;  4QD2 C;  4KEK A;  5F8Y A;  1QXM A;  2AFG A;  1Z0H A;  2DRZ A;  4LO8 B;  4EFP A;  1HWN B;  2M49 A;  2BFH A;  3VSZ A;  1HIB A;  1NZK A;  1P63 A;  5E24 E;  1FMM S;  1TWM A;  4GOY A;  4JP0 A;  1FWU A;  4ZLB B;  1G9D A;  4AN6 A;  4JQ0 A;  4OWK A;  2Y9F A;  3H6S E;  4F34 A;  1AF9 A;  4OUJ A;  4I8M A;  4G1R A;  4I96 A;  2QN4 A;  3JRR A;  4I37 A;  4JKX B;  3OGG A;  2RG9 B;  2I1B A;  2LIE A;  3BA5 A;  3WA1 A;  4OEF A;  4LO1 A;  3V0A B;  3FJI A;  4USO A;  3VWC A;  5JLV A;  4QO3 A;  4USP A;  4LO7 B;  4XFS A;  1CE7 B;  1IIL A;  4X3A A;  1BA7 A;  4JRA A;  4ZA3 B;  4D8H A;  4DCK C;  2F8X C;  4OWJ A;  2F2F A;  5HPZ A;  4R6U B;  3ZC8 A;  3V0A A;  5D63 A;  3ILA A;  5FZU A;  4LO0 C;  3NBN A;  4QBV A;  5EC5 A;  1V6V A;  4JPZ A;  3FGM A;  4G6M A;  1JT5 A;  3O3Q A;  2Z49 A;  4ZFY B;  4KC3 A;  1FGA A;  4JKQ A;  1ILR 1;  1II4 A;  1VCL A;  1Z2V A;  2MC2 A;  4YOL A;  3NBD A;  3C9Z A;  1JLX A; 
#chains in the Genus database with same CATH homology
 2NVH A;  2P39 A;  4ZFU B;  9ILB A;  2DRE A;  3N0K A;  1AVX B;  4I4X A;  4I4Y A;  3CA6 A;  3MPP G;  3ZX7 A;  5B2H A;  2RST A;  3W9T A;  4KEI A;  4ZFW B;  4J2Y A;  4UY4 A;  4FVV A;  2D1Z A;  1DZD A;  4J23 B;  4AN7 B;  1HKN A;  3A21 A;  5BVP I;  4I4Q A;  5JMC A;  4GAF A;  4ZGR B;  4ZKT B;  1BFF A;  4ISR A;  3I2A A;  3UD8 A;  2R9K B;  1F31 A;  4I7I A;  4ZBV B;  4LO1 C;  2Y9G A;  2K43 A;  2NP0 A;  1FMZ A;  4G9N A;  5BQU A;  4EB2 B;  3ZC9 A;  1ISW A;  1TFM B;  2LIQ A;  3VEQ A;  5BXP A;  1EYL A;  3OBT A;  3RTJ B;  1S0F A;  2KKI A;  4CJM A;  4P6A A;  1MC9 A;  1AVA C;  1A8D A;  1EPW A;  1SZ6 B;  2F2F C;  2DRY A;  2Q3N B;  1XHB A;  3POK A;  4JAW A;  4LO7 C;  1SR4 A;  1BFC A;  2VSA A;  3CRG A;  3JUT A;  1OQL B;  1S0G A;  2HW9 A;  4P0J A;  4XFU A;  3BAH A;  3OGF A;  3BB2 A;  3WO2 A;  3S8J A;  1TIE A;  3RSJ A;  1AXM A;  3FJ9 A;  1W3A A;  1I1B A;  3FJF A;  3K1X A;  4X37 A;  2D44 A;  1Q1U A;  4DEN A;  4Q9G A;  4IZX A;  3FJH A;  3UD9 A;  2Y9W C;  4I4O A;  3S8K A;  4IY8 A;  1PWA A;  4IYB A;  4XFT A;  2VUA A;  2HZ9 A;  1JT7 A;  1EV2 A;  4KEJ A;  2VSE A;  3F1R A;  4WBC A;  5GAQ A;  5BXT A;  3QR5 A;  3A22 A;  4I4S A;  1S0B A;  31BI A;  1JY0 A;  1M2T B;  2Z48 A;  4GP3 A;  4A7K A;  2E4M A;  1ISZ A;  1V6W A;  1W3G A;  4OEG A;  1L2H A;  1IHK A;  1QQK A;  3BAQ A;  3IIR A;  4I1B A;  2AQZ A;  1S0E A;  3BRD A;  1ISX A;  4OWL A;  5BOW A;  5BQU C;  2FFU A;  4H75 A;  4QC4 A;  4D0T A;  4ISQ A;  3IM7 A;  1FN0 A;  2VU9 A;  3WO4 A;  4IZE A;  3WO3 A;  3UJ4 A;  3CRH A;  3VT2 A;  3O44 A;  4EEE B;  1ABR B;  1Q03 A;  1V6U A;  1DZC A;  3IM6 A;  1HWM B;  1FWV A;  2Y9X E;  1FV3 A;  3FFZ A;  1BLA A;  4FGF A;  1ISY A;  1SR4 C;  1YF8 B;  3CU1 B;  3OJM A;  4L4H A;  1W3F A;  1WBA A;  4Z9W B;  5G00 A;  4I4V A;  3UJ0 A;  1S0D A;  4I4P A;  1GGP B;  1WBC A;  3HN1 A;  3H6R B;  2FO1 A;  1R8N A;  3HOM A;  3LLP A;  3MAL A;  1K5U A;  2VLC A;  4Q9P A;  1KNM A;  2VXR A;  3E8L C;  4LO2 C;  2WRY A;  4TLP A;  3OJV A;  5DUY A;  3H6R A;  3H6Q A;  3RMX A;  3AH1 A;  2ZQO A;  2ERM A;  1YTO A;  1DQG A;  3V79 C;  3SNV A;  5F8W A;  4QBC A;  1AFC A;  1D0H A;  4HR6 C;  2NYY A;  2E4M C;  4A7Z A;  2MLL B;  3BX1 C;  2D24 A;  4IY9 A;  4MZH A;  1AVW B;  1FV2 A;  1Q04 A;  1DFQ A;  3PG0 A;  1PZZ A;  2ET2 A;  3IAG C;  3BA4 A;  3O5W B;  4G6J A;  2VXT I;  3I29 B;  4QKS A;  1I1E A;  1AVU A;  5FNX A;  3WIN A;  4Q91 A;  4EFR A;  4I0Y A;  4F83 A;  3VT0 A;  2XOA A;  2ESU A;  2FDB M;  3P53 A;  1YYN A;  4GAI A;  1IOB A;  3FJJ A;  3AKH A;  3D7W B;  3HAL A;  2Q9X A;  3CA3 A;  4L4I A;  3VSF A;  5F8S A;  1YBI A;  1PC8 B;  3Q7X A;  2AXM A;  5D61 A;  5F90 A;  4I4U A;  3CA4 A;  3BAG A;  2NZ9 A;  3O4O A;  1G9C A;  1PUU B;  5EHA A;  1IT0 A;  1DJS B;  3RMY A;  4MZG B;  6I1B A;  4LO3 A;  1FQ9 A;  4IQP A;  3BAV A;  5EG6 C;  4LO2 A;  3ZXG A;  2KLL A;  4EFQ A;  2KH2 A;  1R8O A;  4II0 A;  4P0K A;  4D0Z A;  1HCD A;  4P0L A;  1BFB A;  3F62 B;  3FJK A;  4H04 A;  3AKG A;  3FJE A;  4X39 A;  1IRP A;  4A7Y A;  1RY7 A;  5FZZ A;  1JQZ A;  2UUS A;  5BP5 A;  1QQL A;  5DVH A;  4PC4 A;  2HWA A;  5FNW A;  1BAS A;  2ZQN A;  41BI A;  1HWP B;  3BA7 A;  2IHO A;  3CAH A;  3AH2 A;  3V0B B;  1YXW A;  1TP0 A;  3VT1 A;  4OEE A;  3EF2 A;  3AH4 A;  1MD6 A;  3RTI B;  1EVT A;  2AAI B;  3FJA A;  3O4B A;  2NS2 A;  2ZR1 B;  3TC2 A;  1BFG A;  4HA2 A;  3OJ2 A;  1JTC A;  3UD7 A;  4I1E A;  4QAL A;  1RG8 A;  3P6I A;  3WMV A;  4ZOT A;  1N4K A;  3V0B A;  3WIN C;  4IHZ A;  4GOV A;  1ONK B;  5BXS A;  2QYI B;  3AJ6 A;  3HSM A;  1WD4 A;  5D62 A;  2FGF A;  3WMU A;  3BRF A;  1E0O A;  4J2K A;  2KI6 B;  4ION A;  2RQ9 A;  1DFC A;  3FJC A;  3PUB A;  2D23 A;  5DZU A;  1Z4S A;  2X2S A;  3N7M A;  4X38 A;  1J0S A;  4GP0 A;  1DLL A;  2BEB A;  4DEP A;  3O4D A;  1ITB A;  1DQO A;  21BI A;  3BAO A;  4LO3 C;  2D7R A;  3FJ8 A;  3O4C A;  3Q7W A;  1G82 A;  3A07 A;  3R4S A;  3AZW A;  1S0L A;  2IWT B;  1IJT A;  3CRI A;  2GO2 A;  3I2X A;  3N7K A;  3LTQ A;  5I1B A;  3NBC A;  4QD2 B;  1T9F A;  1JLY A;  3FJD A;  1JT3 A;  1V6X A;  1XZZ A;  1T4Q A;  5BP5 C;  3ZXD A;  2NTD A;  3CA0 A;  3PHZ A;  4J2S A;  1TWE A;  1NUN A;  3BAD A;  4I3N A;  3UDA A;  1BLD A;  3N7L A;  2K4A B;  4H9W A;  5FZY A;  1HCE A;  1TTU A;  1HWO B;  1PUM B;  2YUG A;  3HBW A;  3KMV A;  4QKR A;  2J3P A;  3BTA A;  3P6J A;  1UPS A;  3O4A A;  2KI4 A;  3NBE A;  3VUO A;  7I1B A;  4EKX B;  2K8R A;  3CA5 A;  3AJ5 A;  4OW4 A;  3AKF A;  3FJB A;  1JT4 A;  1TOO A;  3A23 A;  3AKI A;  1S0C A;  2GZB A;  2WBC A;  4I6I A;  1G9A A;  2MIB A;  2D22 A;  1ISV A;  3R4U A;  3OBR A;  1XG6 A;  2NM1 A;  1G9B A;  2BEA A;  4KBB A;  4Z8S B;  3IM5 A;  2X2T A;  4END A;  2HWM A;  3CA1 A;  8I1B A;  3NJ5 A;  3QYD A;  4XKI A;  3FUO A;  3PME A;  4J2X A;  3B9U A;  3T8S A;  3BAU A;  2P23 A;  4HJJ A;  1XYF A;  5DSS B;  1BAR A;  2FFV A;  1M16 A;  4I4R A;  2D43 A;  4I2S A;  3AZV A;  4MZF B;  1RZO B;  1K5V A;  3Q7Y A;  2DS0 A;  4LO0 A;  1CVS A;  4G9M A;  2D7I A;  2D20 A;  3BRG C;  1IRA X;  3FUQ A;  2L5X A;  3O49 A;  3CQA A;  1WD3 A;  5BXR A;  3N7J A;  1RML A;  1DIW A;  3HMY A;  4QD2 C;  4KEK A;  5F8Y A;  1QXM A;  2AFG A;  1Z0H A;  2DRZ A;  4LO8 B;  4EFP A;  1HWN B;  2M49 A;  2BFH A;  3VSZ A;  1HIB A;  1NZK A;  1P63 A;  5E24 E;  1FMM S;  1TWM A;  4GOY A;  4JP0 A;  1FWU A;  4ZLB B;  1G9D A;  4AN6 A;  4JQ0 A;  4OWK A;  2Y9F A;  3H6S E;  4F34 A;  1AF9 A;  4OUJ A;  4I8M A;  4G1R A;  4I96 A;  2QN4 A;  3JRR A;  4I37 A;  4JKX B;  3OGG A;  2RG9 B;  2I1B A;  2LIE A;  3BA5 A;  3WA1 A;  4OEF A;  4LO1 A;  3V0A B;  3FJI A;  4USO A;  3VWC A;  5JLV A;  4QO3 A;  4USP A;  4LO7 B;  4XFS A;  1CE7 B;  1IIL A;  4X3A A;  1BA7 A;  4JRA A;  4ZA3 B;  4D8H A;  4DCK C;  2F8X C;  4OWJ A;  2F2F A;  5HPZ A;  4R6U B;  3ZC8 A;  3V0A A;  5D63 A;  3ILA A;  5FZU A;  4LO0 C;  3NBN A;  4QBV A;  5EC5 A;  1V6V A;  4JPZ A;  3FGM A;  4G6M A;  1JT5 A;  3O3Q A;  2Z49 A;  4ZFY B;  4KC3 A;  1FGA A;  4JKQ A;  1ILR 1;  1II4 A;  1VCL A;  1Z2V A;  2MC2 A;  4YOL A;  3NBD A;  3C9Z A;  1JLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...