4EFSA

Human mmp12 in complex with l-glutamate motif inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
159
structure length
159
Chain Sequence
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Simple pseudo-dipeptides with a P2' glutamate: a novel inhibitor family of matrix metalloproteases and other metzincins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 43
structure length 159
sequence length 159
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4efsA00
1C8TA 3F16A 3AYKA 5I0LA 2OXZA 5I12A 4PKQA 5D1SA 1JK3A 1GE7A 1IAEA 4I03A 1UMSA 2Y6DA 3LK8A 2DW0A 1SMPA 1SU3A 4HMAA 3EDIA 1A86A 4GWMA 1IABA 1JJ9A 4XM7A 4JPAA 1B8YA 3N2VA 2TCLA 1ZXCA 1MMQA 1XFXA 2O3EA 2OY2A 2YIGA 1OM6A 1ASTA 3DWBA 2MZHA 1BIWA 4WF6A 5B5PA 1CGEA 1MMPA 3V96B 3KWVC 1HV5A 1BKCI 1XUCA 4IN9A 1DTHA 3Q2HA 2E2DA 3LJTA 1ZXVA 4WKIA 4ILWD 2X3BA 4HX3A 1Y0VA 4FXQA 3B8ZA 2QPJA 2Y6CA 2E3XA 1HFCA 3HDAP 4PKRA 4ZR5A 3EWJA 2OVXA 3OHLA 5H8XA 4JIJA 5CUHA 3LILA 1KUFA 3L0VA 1H71P 3EHYA 3TSKA 4I35A 1QICA 4XCTA 1BQQM 2FV9A 2SRTA 4ON1A 1CGFA 1Z3JA 4WZVA 1YOUA 3BA0A 3B2ZA 3KRYA 3RTSA 1O0TA 4G9LA 3F15A 4DF9A 2DDFA 2W12A 4H2EA 1BM6A 3LQBA 5BOTA 1RM8A 2HU6A 1Y8JA 1ATLA 1IADA 1IAAA 4AXQA 2WO9A 4PKUA 4GR8A 2X7MA 1ZTQA 4AYKA 5D1UA 5D3CA 1PWVA 1EAKA 1XFUA 3GBOA 4H84A 1JAOA 2W0DA 3EDZA 4PKSA 4JQGA 1OO9A 1USNA 2MZIA 1BQOA 2MLSA 2V4BA 3HBUP 4PKTA 1QJJA 4L6TA 1D7XA 5D2BA 2J83A 1D8FA 2WO8A 1K7GA 1A85A 3EHXA 2L0RA 4XBHA 3O2XA 1C7KA 4GF1A 2J0TA 3AYUA 3HB2P 3KMEA 3LMCA 1XUDA 2PJTA 3HY9A 3LJGA 1EB6A 1G49A 1JIZA 3LIRA 1KUIA 4H1QA 1AYKA 3NX7A 2OI0A 4GUYA 1OM8A 3LKAA 2DDYA 3G42A 1K7IA 1KUKA 1CAQA 3ELMA 3LUMA 5D7WA 1OS2A 1JKYA 3P1VA 1UEAA 1YP1A 4GWNA 5L7FA 4WK7A 1G05A 1QIAA 1Q3AA 1KUGA 3LQ0A 3Q2GA 5L79A 1C3IA 2MLRA 2D1NA 1PWUA 2EROA 3OHOA 3ZVSA 3KMCA 3DL1A 2JSDA 1CXVA 1G4KA 1IAGA 1FBLA 3DNGA 1BSWA 4WKEA 5I3MA 5I43A 4IUWA 4PKWA 4H49A 4L63A 3DPFA 4L19A 1GE6A 4EFSA 1CIZA 1G12A 4FU4A 4AIGA 1WNIA 1GO8P 5CXAA 3WV1A 1BUDA 1I76A 3K7NA 1BKCE 1OS9A 1G9KA 1K7QA 3O64A 4A7BA 1XURA 2FV5A 1AKLA 456CA 3ZUKA 1KAPP 2KRJA 4QKZA 1RMZA 4JA1A 3KEJA 4XM8A 2OW2A 2W15A 1OM7A 3DSLA 1S4BP 1BKCA 4XM6A 1MMBA 1D8MA 3F1AA 2OW9A 3K7LA 4IJOA 3N2UA 2JNPA 1JH1A 2AYKA 1BZSA 1PWPA 4GR3A 4AUOA 3USNA 2OW0A 5BOYA 3VI1A 2W13A 2JT5A 4DD8A 5D1TA 2DW2A 2I47A 3LGPA 1HOVA 3CKIA 5BPAA 1R1IA 1QJIA 3TS4A 1UMTA 1R55A 1UTZA 3ZXHA 3F17A 2X3AA 3HBVP 3SHIA 2RJQA 3LUNA 2K9CA 966CA 1XFYA 1GKDA 1YQYA 1MMRA 1HFSA 1ZS0A 2K2GA 1XFVA 2AIGP 3LEAA 1XFWA 4FVLA 3KECA 2O36A 1R1JA 3L0TA 2POJA 3I7IA 1R54A 2RJPA 4A3WA 1HTDA 2CKIA 1ZVXA 2Z2DA 3EDGA 1GXDA 2JT6A 1SATA 3RTTA 4G0DA 3KHIA 4GR0A 1PWWA 3U1RA 1ROSA 3HDBA 1OMJA 3AIGA 2JIHA 1B3DA 1R1HA 1KUHA 3UVCA 3I7GA 3HYGA 1EUBA 1SLMA 4DV8A 1QIBA 2OXWA 4H30A 2W14A 4H82A 2OY4A 1I1IP 3TT4A 1MNCA 2DW1A 3LIKA 4H76A 1HY7A 1CQRA 4H3XA 2USNA 2OZRA 1O0QA 4GQLA 5B5OA 1GO7P 2D1OA 1KBCA 2XS4A 4J4MA 3P24A 2X3CA 1JANA 3HY7A 1SRPA 3WV3A 2ERQA 1PWQA 830CA 3TVCA 1ND1A 1FM1A 2XS3A 5I4OA 1BUVM 3F19A 5LABA 2OXUA 1XFZA 2ERPA 1I73A 1JAPA 2YB9A 3DPEA 3B92A 1GKCA 3LE9A 1ZP5A 2WOAA 1AF0A 1SLNA 1FLSA 1GE5A 2CLTA 4PKVA 4JP4A 3G5CA 1YCMA 5I2ZA 5JMYA 5CZMA 4FXYP 4CTHA 2MZEA 3VTGA 1UTTA 1CGLA 1Y93A 3F18A 1L6JA 3KEKA 1D5JA 3MA2A 1CK7A 4Q1LA 1DMTA 3EDHA 2N8RA 2OW1A 3LJZA 3E8RA 4R3VA 1QUAA 2OVZA 1JIWP 1JAQA 3WV2A 4DPEA 2A8HA 1J7NA 1IACA
chains in the Genus database with same CATH superfamily
1C8TA 3F16A 3AYKA 5I0LA 2OXZA 5I12A 4PKQA 5D1SA 1JK3A 1GE7A 1IAEA 4I03A 1UMSA 2Y6DA 3LK8A 2DW0A 1SMPA 1SU3A 4HMAA 3EDIA 1A86A 4GWMA 1IABA 1JJ9A 4XM7A 4JPAA 1B8YA 3N2VA 2TCLA 1ZXCA 1MMQA 1XFXA 2O3EA 2OY2A 2YIGA 1OM6A 1ASTA 3DWBA 2MZHA 1BIWA 4WF6A 5B5PA 1CGEA 1MMPA 3V96B 3KWVC 1HV5A 1BKCI 1XUCA 4IN9A 1DTHA 3Q2HA 2E2DA 3LJTA 1ZXVA 4WKIA 4ILWD 2X3BA 4HX3A 1Y0VA 4FXQA 3B8ZA 2QPJA 2Y6CA 2E3XA 1HFCA 3HDAP 4PKRA 4ZR5A 3EWJA 2OVXA 3OHLA 5H8XA 4JIJA 5CUHA 3LILA 1KUFA 3L0VA 1H71P 3EHYA 3TSKA 4I35A 1QICA 4XCTA 1BQQM 2FV9A 2SRTA 4ON1A 1CGFA 1Z3JA 4WZVA 1YOUA 3BA0A 3B2ZA 3KRYA 3RTSA 1O0TA 4G9LA 3F15A 4DF9A 2DDFA 2W12A 4H2EA 1BM6A 3LQBA 5BOTA 1RM8A 2HU6A 1Y8JA 1ATLA 1IADA 1IAAA 4AXQA 2WO9A 4PKUA 4GR8A 2X7MA 1ZTQA 4AYKA 5D1UA 2YUFA 5D3CA 1PWVA 1EAKA 1XFUA 3GBOA 4H84A 1JAOA 2W0DA 3EDZA 4PKSA 4JQGA 1OO9A 1USNA 2MZIA 1BQOA 2MLSA 2V4BA 3HBUP 4PKTA 1QJJA 4L6TA 1D7XA 5D2BA 2J83A 1D8FA 2WO8A 1K7GA 1A85A 3EHXA 2L0RA 4XBHA 3O2XA 1C7KA 4GF1A 2J0TA 3AYUA 3HB2P 3KMEA 3LMCA 1XUDA 2PJTA 3HY9A 3LJGA 1EB6A 1G49A 1JIZA 3LIRA 1KUIA 4H1QA 1AYKA 3NX7A 2OI0A 4GUYA 1OM8A 3LKAA 2DDYA 3G42A 1K7IA 1KUKA 1CAQA 3ELMA 3LUMA 5D7WA 1OZ9A 1OS2A 1JKYA 3P1VA 1UEAA 1YP1A 4GWNA 5L7FA 4WK7A 1G05A 1QIAA 1Q3AA 1KUGA 3LQ0A 3Q2GA 5L79A 1C3IA 2MLRA 2D1NA 1PWUA 2EROA 3OHOA 3ZVSA 3KMCA 3DL1A 2JSDA 1CXVA 1G4KA 1IAGA 1FBLA 3DNGA 1BSWA 4WKEA 5I3MA 5I43A 4IUWA 4PKWA 4H49A 4L63A 3DPFA 4L19A 1GE6A 4EFSA 1CIZA 1G12A 4FU4A 4AIGA 1WNIA 1GO8P 5CXAA 3WV1A 1BUDA 1I76A 3K7NA 1BKCE 1OS9A 1G9KA 1K7QA 3O64A 4A7BA 1XURA 2FV5A 1AKLA 456CA 3ZUKA 1KAPP 2KRJA 4QKZA 1RMZA 3DTKA 3KEJA 4JA1A 4XM8A 2OW2A 2W15A 1OM7A 3DSLA 1S4BP 1BKCA 4XM6A 1MMBA 1D8MA 3F1AA 2OW9A 3K7LA 4IJOA 3N2UA 2JNPA 1JH1A 2AYKA 1BZSA 1PWPA 1XM5A 4GR3A 4AUOA 3USNA 2OW0A 5BOYA 3VI1A 2W13A 2JT5A 4DD8A 5D1TA 2DW2A 2I47A 3LGPA 1HOVA 3CKIA 5BPAA 1R1IA 1QJIA 3TS4A 1UMTA 1R55A 1UTZA 3ZXHA 3F17A 2X3AA 3HBVP 3SHIA 2RJQA 3LUNA 2K9CA 966CA 1XFYA 1GKDA 1YQYA 1MMRA 1HFSA 1ZS0A 2K2GA 1XFVA 2AIGP 3LEAA 1XFWA 4FVLA 3KECA 2O36A 1R1JA 3L0TA 2POJA 3I7IA 1R54A 2RJPA 4A3WA 1HTDA 2CKIA 1ZVXA 2Z2DA 3EDGA 1GXDA 2JT6A 1SATA 3RTTA 4G0DA 3KHIA 4GR0A 1PWWA 3U1RA 1ROSA 3HDBA 1OMJA 3AIGA 4L7AA 2JIHA 1B3DA 1R1HA 1KUHA 3UVCA 3I7GA 3HYGA 1EUBA 1SLMA 4DV8A 1QIBA 2OXWA 1TVIA 4H30A 2W14A 4H82A 2OY4A 1I1IP 3TT4A 1MNCA 3DTEA 2DW1A 3LIKA 4H76A 3DTIA 1HY7A 1CQRA 4H3XA 2USNA 2OZRA 1O0QA 4GQLA 5B5OA 1GO7P 2D1OA 1KBCA 2XS4A 4J4MA 3P24A 2X3CA 1JANA 3HY7A 1SRPA 3WV3A 2ERQA 1PWQA 830CA 3TVCA 1ND1A 1FM1A 2XS3A 5I4OA 1BUVM 3F19A 5LABA 2OXUA 1XFZA 2ERPA 1I73A 1JAPA 2YB9A 3DPEA 3B92A 1GKCA 3LE9A 1ZP5A 2WOAA 1AF0A 1SLNA 1FLSA 1GE5A 2CLTA 4PKVA 4JP4A 3G5CA 1YCMA 5I2ZA 5JMYA 5CZMA 4FXYP 4CTHA 2MZEA 3VTGA 1UTTA 1CGLA 1Y93A 3F18A 1L6JA 3KEKA 1D5JA 3MA2A 1CK7A 4Q1LA 1DMTA 3EDHA 2N8RA 2OW1A 3LJZA 3E8RA 4R3VA 1QUAA 2OVZA 1XAXA 1JIWP 1JAQA 3WV2A 4DPEA 2A8HA 1J7NA 1IACA
chains in the Genus database with same CATH topology
1C8TA 3F16A 3AYKA 5I0LA 2OXZA 5I12A 4PKQA 5D1SA 1JK3A 1GE7A 1IAEA 4I03A 1UMSA 2Y6DA 3LK8A 2DW0A 1SMPA 1SU3A 4HMAA 3EDIA 1A86A 4GWMA 1IABA 1JJ9A 4XM7A 4JPAA 1B8YA 3N2VA 2TCLA 1ZXCA 1MMQA 1XFXA 2O3EA 2OY2A 2YIGA 1OM6A 1ASTA 3DWBA 2MZHA 1BIWA 4WF6A 5B5PA 1CGEA 1MMPA 3V96B 3KWVC 1HV5A 1BKCI 1XUCA 4IN9A 1DTHA 3Q2HA 2E2DA 3LJTA 1ZXVA 4WKIA 4ILWD 2X3BA 4HX3A 1Y0VA 4FXQA 3B8ZA 2QPJA 2Y6CA 2E3XA 1HFCA 3HDAP 4PKRA 4ZR5A 3EWJA 2OVXA 3OHLA 5H8XA 4JIJA 5CUHA 3LILA 1KUFA 3L0VA 1H71P 3EHYA 3TSKA 4I35A 1QICA 4XCTA 1BQQM 2FV9A 2SRTA 4ON1A 1CGFA 1Z3JA 4WZVA 1YOUA 3BA0A 3B2ZA 3KRYA 3RTSA 1O0TA 4G9LA 3F15A 4DF9A 2DDFA 2W12A 4H2EA 1BM6A 3LQBA 5BOTA 1RM8A 2HU6A 1Y8JA 1ATLA 1IADA 1IAAA 4AXQA 2WO9A 4PKUA 4GR8A 2X7MA 1ZTQA 4AYKA 5D1UA 2YUFA 5D3CA 1PWVA 1EAKA 1XFUA 3GBOA 4H84A 1JAOA 2W0DA 3EDZA 4PKSA 4JQGA 1OO9A 1USNA 2MZIA 1BQOA 2MLSA 2V4BA 3HBUP 4PKTA 1QJJA 4L6TA 1D7XA 5D2BA 2J83A 1D8FA 2WO8A 1K7GA 1A85A 3EHXA 2L0RA 4XBHA 3O2XA 1C7KA 4GF1A 2J0TA 3AYUA 3HB2P 3KMEA 3LMCA 1XUDA 2PJTA 3HY9A 3LJGA 1EB6A 1G49A 1JIZA 3LIRA 1KUIA 4H1QA 1AYKA 3NX7A 2OI0A 4GUYA 1OM8A 3LKAA 2DDYA 3G42A 1K7IA 1KUKA 1CAQA 3ELMA 3LUMA 5D7WA 1OS2A 1JKYA 3P1VA 1UEAA 1YP1A 4GWNA 5L7FA 4WK7A 1G05A 1QIAA 1Q3AA 1KUGA 3LQ0A 3Q2GA 5L79A 1C3IA 2MLRA 2D1NA 1PWUA 2EROA 3OHOA 3ZVSA 3KMCA 3DL1A 2JSDA 1CXVA 1G4KA 1IAGA 1FBLA 3DNGA 1BSWA 4WKEA 5I3MA 5I43A 4IUWA 4PKWA 4H49A 4L63A 3DPFA 4L19A 1GE6A 4EFSA 1CIZA 1G12A 4FU4A 4AIGA 1WNIA 1GO8P 5CXAA 3WV1A 1BUDA 1I76A 3K7NA 1BKCE 1OS9A 1G9KA 1K7QA 3O64A 4A7BA 1XURA 2FV5A 1AKLA 456CA 3ZUKA 1KAPP 2KRJA 4QKZA 1RMZA 3DTKA 3KEJA 4JA1A 4XM8A 2OW2A 2W15A 1OM7A 3DSLA 1S4BP 1BKCA 4XM6A 1MMBA 1D8MA 3F1AA 2OW9A 3K7LA 4IJOA 3N2UA 2JNPA 1JH1A 2AYKA 1BZSA 1PWPA 4GR3A 4AUOA 3USNA 2OW0A 5BOYA 3VI1A 2W13A 2JT5A 4DD8A 5D1TA 2DW2A 2I47A 3LGPA 1HOVA 3CKIA 5BPAA 1R1IA 1QJIA 3TS4A 1UMTA 1R55A 1UTZA 3ZXHA 3F17A 2X3AA 3HBVP 3SHIA 2RJQA 3LUNA 2K9CA 966CA 1XFYA 1GKDA 1YQYA 1MMRA 1HFSA 1ZS0A 2K2GA 1XFVA 2AIGP 3LEAA 1XFWA 4FVLA 3KECA 2O36A 1R1JA 3L0TA 2POJA 3I7IA 1R54A 2RJPA 4A3WA 1HTDA 2CKIA 1ZVXA 2Z2DA 3EDGA 1GXDA 2JT6A 1SATA 3RTTA 4G0DA 3KHIA 4GR0A 1PWWA 3U1RA 1ROSA 3HDBA 1OMJA 3AIGA 4L7AA 2JIHA 1B3DA 1R1HA 1KUHA 3UVCA 3I7GA 3HYGA 1EUBA 1SLMA 4DV8A 1QIBA 2OXWA 4H30A 2W14A 4H82A 2OY4A 1I1IP 3TT4A 1MNCA 3DTEA 2DW1A 3LIKA 4H76A 3DTIA 1HY7A 1CQRA 4H3XA 2USNA 2OZRA 1O0QA 4GQLA 5B5OA 1GO7P 2D1OA 1KBCA 2XS4A 4J4MA 3P24A 2X3CA 1JANA 3HY7A 1SRPA 3WV3A 2ERQA 1PWQA 830CA 3TVCA 1ND1A 1FM1A 2XS3A 5I4OA 1BUVM 3F19A 5LABA 2OXUA 1XFZA 2ERPA 1I73A 1JAPA 2YB9A 3DPEA 3B92A 1GKCA 3LE9A 1ZP5A 2WOAA 1AF0A 1SLNA 1FLSA 1GE5A 2CLTA 4PKVA 4JP4A 3G5CA 1YCMA 5I2ZA 5JMYA 5CZMA 4FXYP 4CTHA 2MZEA 3VTGA 1UTTA 1CGLA 1Y93A 3F18A 1L6JA 3KEKA 1D5JA 3MA2A 1CK7A 4Q1LA 1DMTA 3EDHA 2N8RA 2OW1A 3LJZA 3E8RA 4R3VA 1QUAA 2OVZA 1JIWP 1JAQA 3WV2A 4DPEA 2A8HA 1J7NA 1IACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C8T A;  3F16 A;  3AYK A;  5I0L A;  2OXZ A;  5I12 A;  4PKQ A;  5D1S A;  1JK3 A;  1GE7 A;  1IAE A;  4I03 A;  1UMS A;  2Y6D A;  3LK8 A;  2DW0 A;  1SMP A;  1SU3 A;  4HMA A;  3EDI A;  1A86 A;  4GWM A;  1IAB A;  1JJ9 A;  4XM7 A;  4JPA A;  1B8Y A;  3N2V A;  2TCL A;  1ZXC A;  1MMQ A;  1XFX A;  2O3E A;  2OY2 A;  2YIG A;  1OM6 A;  1AST A;  3DWB A;  2MZH A;  1BIW A;  4WF6 A;  5B5P A;  1CGE A;  1MMP A;  3V96 B;  3KWV C;  1HV5 A;  1BKC I;  1XUC A;  4IN9 A;  1DTH A;  3Q2H A;  2E2D A;  3LJT A;  1ZXV A;  4WKI A;  4ILW D;  2X3B A;  4HX3 A;  1Y0V A;  4FXQ A;  3B8Z A;  2QPJ A;  2Y6C A;  2E3X A;  1HFC A;  3HDA P;  4PKR A;  4ZR5 A;  3EWJ A;  2OVX A;  3OHL A;  5H8X A;  4JIJ A;  5CUH A;  3LIL A;  1KUF A;  3L0V A;  1H71 P;  3EHY A;  3TSK A;  4I35 A;  1QIC A;  4XCT A;  1BQQ M;  2FV9 A;  2SRT A;  4ON1 A;  1CGF A;  1Z3J A;  4WZV A;  1YOU A;  3BA0 A;  3B2Z A;  3KRY A;  3RTS A;  1O0T A;  4G9L A;  3F15 A;  4DF9 A;  2DDF A;  2W12 A;  4H2E A;  1BM6 A;  3LQB A;  5BOT A;  1RM8 A;  2HU6 A;  1Y8J A;  1ATL A;  1IAD A;  1IAA A;  4AXQ A;  2WO9 A;  4PKU A;  4GR8 A;  2X7M A;  1ZTQ A;  4AYK A;  5D1U A;  5D3C A;  1PWV A;  1EAK A;  1XFU A;  3GBO A;  4H84 A;  1JAO A;  2W0D A;  3EDZ A;  4PKS A;  4JQG A;  1OO9 A;  1USN A;  2MZI A;  1BQO A;  2MLS A;  2V4B A;  3HBU P;  4PKT A;  1QJJ A;  4L6T A;  1D7X A;  5D2B A;  2J83 A;  1D8F A;  2WO8 A;  1K7G A;  1A85 A;  3EHX A;  2L0R A;  4XBH A;  3O2X A;  1C7K A;  4GF1 A;  2J0T A;  3AYU A;  3HB2 P;  3KME A;  3LMC A;  1XUD A;  2PJT A;  3HY9 A;  3LJG A;  1EB6 A;  1G49 A;  1JIZ A;  3LIR A;  1KUI A;  4H1Q A;  1AYK A;  3NX7 A;  2OI0 A;  4GUY A;  1OM8 A;  3LKA A;  2DDY A;  3G42 A;  1K7I A;  1KUK A;  1CAQ A;  3ELM A;  3LUM A;  5D7W A;  1OS2 A;  1JKY A;  3P1V A;  1UEA A;  1YP1 A;  4GWN A;  5L7F A;  4WK7 A;  1G05 A;  1QIA A;  1Q3A A;  1KUG A;  3LQ0 A;  3Q2G A;  5L79 A;  1C3I A;  2MLR A;  2D1N A;  1PWU A;  2ERO A;  3OHO A;  3ZVS A;  3KMC A;  3DL1 A;  2JSD A;  1CXV A;  1G4K A;  1IAG A;  1FBL A;  3DNG A;  1BSW A;  4WKE A;  5I3M A;  5I43 A;  4IUW A;  4PKW A;  4H49 A;  4L63 A;  3DPF A;  4L19 A;  1GE6 A;  4EFS A;  1CIZ A;  1G12 A;  4FU4 A;  4AIG A;  1WNI A;  1GO8 P;  5CXA A;  3WV1 A;  1BUD A;  1I76 A;  3K7N A;  1BKC E;  1OS9 A;  1G9K A;  1K7Q A;  3O64 A;  4A7B A;  1XUR A;  2FV5 A;  1AKL A;  456C A;  3ZUK A;  1KAP P;  2KRJ A;  4QKZ A;  1RMZ A;  4JA1 A;  3KEJ A;  4XM8 A;  2OW2 A;  2W15 A;  1OM7 A;  3DSL A;  1S4B P;  1BKC A;  4XM6 A;  1MMB A;  1D8M A;  3F1A A;  2OW9 A;  3K7L A;  4IJO A;  3N2U A;  2JNP A;  1JH1 A;  2AYK A;  1BZS A;  1PWP A;  4GR3 A;  4AUO A;  3USN A;  2OW0 A;  5BOY A;  3VI1 A;  2W13 A;  2JT5 A;  4DD8 A;  5D1T A;  2DW2 A;  2I47 A;  3LGP A;  1HOV A;  3CKI A;  5BPA A;  1R1I A;  1QJI A;  3TS4 A;  1UMT A;  1R55 A;  1UTZ A;  3ZXH A;  3F17 A;  2X3A A;  3HBV P;  3SHI A;  2RJQ A;  3LUN A;  2K9C A;  966C A;  1XFY A;  1GKD A;  1YQY A;  1MMR A;  1HFS A;  1ZS0 A;  2K2G A;  1XFV A;  2AIG P;  3LEA A;  1XFW A;  4FVL A;  3KEC A;  2O36 A;  1R1J A;  3L0T A;  2POJ A;  3I7I A;  1R54 A;  2RJP A;  4A3W A;  1HTD A;  2CKI A;  1ZVX A;  2Z2D A;  3EDG A;  1GXD A;  2JT6 A;  1SAT A;  3RTT A;  4G0D A;  3KHI A;  4GR0 A;  1PWW A;  3U1R A;  1ROS A;  3HDB A;  1OMJ A;  3AIG A;  2JIH A;  1B3D A;  1R1H A;  1KUH A;  3UVC A;  3I7G A;  3HYG A;  1EUB A;  1SLM A;  4DV8 A;  1QIB A;  2OXW A;  4H30 A;  2W14 A;  4H82 A;  2OY4 A;  1I1I P;  3TT4 A;  1MNC A;  2DW1 A;  3LIK A;  4H76 A;  1HY7 A;  1CQR A;  4H3X A;  2USN A;  2OZR A;  1O0Q A;  4GQL A;  5B5O A;  1GO7 P;  2D1O A;  1KBC A;  2XS4 A;  4J4M A;  3P24 A;  2X3C A;  1JAN A;  3HY7 A;  1SRP A;  3WV3 A;  2ERQ A;  1PWQ A;  830C A;  3TVC A;  1ND1 A;  1FM1 A;  2XS3 A;  5I4O A;  1BUV M;  3F19 A;  5LAB A;  2OXU A;  1XFZ A;  2ERP A;  1I73 A;  1JAP A;  2YB9 A;  3DPE A;  3B92 A;  1GKC A;  3LE9 A;  1ZP5 A;  2WOA A;  1AF0 A;  1SLN A;  1FLS A;  1GE5 A;  2CLT A;  4PKV A;  4JP4 A;  3G5C A;  1YCM A;  5I2Z A;  5JMY A;  5CZM A;  4FXY P;  4CTH A;  2MZE A;  3VTG A;  1UTT A;  1CGL A;  1Y93 A;  3F18 A;  1L6J A;  3KEK A;  1D5J A;  3MA2 A;  1CK7 A;  4Q1L A;  1DMT A;  3EDH A;  2N8R A;  2OW1 A;  3LJZ A;  3E8R A;  4R3V A;  1QUA A;  2OVZ A;  1JIW P;  1JAQ A;  3WV2 A;  4DPE A;  2A8H A;  1J7N A;  1IAC A; 
#chains in the Genus database with same CATH topology
 1C8T A;  3F16 A;  3AYK A;  5I0L A;  2OXZ A;  5I12 A;  4PKQ A;  5D1S A;  1JK3 A;  1GE7 A;  1IAE A;  4I03 A;  1UMS A;  2Y6D A;  3LK8 A;  2DW0 A;  1SMP A;  1SU3 A;  4HMA A;  3EDI A;  1A86 A;  4GWM A;  1IAB A;  1JJ9 A;  4XM7 A;  4JPA A;  1B8Y A;  3N2V A;  2TCL A;  1ZXC A;  1MMQ A;  1XFX A;  2O3E A;  2OY2 A;  2YIG A;  1OM6 A;  1AST A;  3DWB A;  2MZH A;  1BIW A;  4WF6 A;  5B5P A;  1CGE A;  1MMP A;  3V96 B;  3KWV C;  1HV5 A;  1BKC I;  1XUC A;  4IN9 A;  1DTH A;  3Q2H A;  2E2D A;  3LJT A;  1ZXV A;  4WKI A;  4ILW D;  2X3B A;  4HX3 A;  1Y0V A;  4FXQ A;  3B8Z A;  2QPJ A;  2Y6C A;  2E3X A;  1HFC A;  3HDA P;  4PKR A;  4ZR5 A;  3EWJ A;  2OVX A;  3OHL A;  5H8X A;  4JIJ A;  5CUH A;  3LIL A;  1KUF A;  3L0V A;  1H71 P;  3EHY A;  3TSK A;  4I35 A;  1QIC A;  4XCT A;  1BQQ M;  2FV9 A;  2SRT A;  4ON1 A;  1CGF A;  1Z3J A;  4WZV A;  1YOU A;  3BA0 A;  3B2Z A;  3KRY A;  3RTS A;  1O0T A;  4G9L A;  3F15 A;  4DF9 A;  2DDF A;  2W12 A;  4H2E A;  1BM6 A;  3LQB A;  5BOT A;  1RM8 A;  2HU6 A;  1Y8J A;  1ATL A;  1IAD A;  1IAA A;  4AXQ A;  2WO9 A;  4PKU A;  4GR8 A;  2X7M A;  1ZTQ A;  4AYK A;  5D1U A;  2YUF A;  5D3C A;  1PWV A;  1EAK A;  1XFU A;  3GBO A;  4H84 A;  1JAO A;  2W0D A;  3EDZ A;  4PKS A;  4JQG A;  1OO9 A;  1USN A;  2MZI A;  1BQO A;  2MLS A;  2V4B A;  3HBU P;  4PKT A;  1QJJ A;  4L6T A;  1D7X A;  5D2B A;  2J83 A;  1D8F A;  2WO8 A;  1K7G A;  1A85 A;  3EHX A;  2L0R A;  4XBH A;  3O2X A;  1C7K A;  4GF1 A;  2J0T A;  3AYU A;  3HB2 P;  3KME A;  3LMC A;  1XUD A;  2PJT A;  3HY9 A;  3LJG A;  1EB6 A;  1G49 A;  1JIZ A;  3LIR A;  1KUI A;  4H1Q A;  1AYK A;  3NX7 A;  2OI0 A;  4GUY A;  1OM8 A;  3LKA A;  2DDY A;  3G42 A;  1K7I A;  1KUK A;  1CAQ A;  3ELM A;  3LUM A;  5D7W A;  1OZ9 A;  1OS2 A;  1JKY A;  3P1V A;  1UEA A;  1YP1 A;  4GWN A;  5L7F A;  4WK7 A;  1G05 A;  1QIA A;  1Q3A A;  1KUG A;  3LQ0 A;  3Q2G A;  5L79 A;  1C3I A;  2MLR A;  2D1N A;  1PWU A;  2ERO A;  3OHO A;  3ZVS A;  3KMC A;  3DL1 A;  2JSD A;  1CXV A;  1G4K A;  1IAG A;  1FBL A;  3DNG A;  1BSW A;  4WKE A;  5I3M A;  5I43 A;  4IUW A;  4PKW A;  4H49 A;  4L63 A;  3DPF A;  4L19 A;  1GE6 A;  4EFS A;  1CIZ A;  1G12 A;  4FU4 A;  4AIG A;  1WNI A;  1GO8 P;  5CXA A;  3WV1 A;  1BUD A;  1I76 A;  3K7N A;  1BKC E;  1OS9 A;  1G9K A;  1K7Q A;  3O64 A;  4A7B A;  1XUR A;  2FV5 A;  1AKL A;  456C A;  3ZUK A;  1KAP P;  2KRJ A;  4QKZ A;  1RMZ A;  3DTK A;  3KEJ A;  4JA1 A;  4XM8 A;  2OW2 A;  2W15 A;  1OM7 A;  3DSL A;  1S4B P;  1BKC A;  4XM6 A;  1MMB A;  1D8M A;  3F1A A;  2OW9 A;  3K7L A;  4IJO A;  3N2U A;  2JNP A;  1JH1 A;  2AYK A;  1BZS A;  1PWP A;  1XM5 A;  4GR3 A;  4AUO A;  3USN A;  2OW0 A;  5BOY A;  3VI1 A;  2W13 A;  2JT5 A;  4DD8 A;  5D1T A;  2DW2 A;  2I47 A;  3LGP A;  1HOV A;  3CKI A;  5BPA A;  1R1I A;  1QJI A;  3TS4 A;  1UMT A;  1R55 A;  1UTZ A;  3ZXH A;  3F17 A;  2X3A A;  3HBV P;  3SHI A;  2RJQ A;  3LUN A;  2K9C A;  966C A;  1XFY A;  1GKD A;  1YQY A;  1MMR A;  1HFS A;  1ZS0 A;  2K2G A;  1XFV A;  2AIG P;  3LEA A;  1XFW A;  4FVL A;  3KEC A;  2O36 A;  1R1J A;  3L0T A;  2POJ A;  3I7I A;  1R54 A;  2RJP A;  4A3W A;  1HTD A;  2CKI A;  1ZVX A;  2Z2D A;  3EDG A;  1GXD A;  2JT6 A;  1SAT A;  3RTT A;  4G0D A;  3KHI A;  4GR0 A;  1PWW A;  3U1R A;  1ROS A;  3HDB A;  1OMJ A;  3AIG A;  4L7A A;  2JIH A;  1B3D A;  1R1H A;  1KUH A;  3UVC A;  3I7G A;  3HYG A;  1EUB A;  1SLM A;  4DV8 A;  1QIB A;  2OXW A;  1TVI A;  4H30 A;  2W14 A;  4H82 A;  2OY4 A;  1I1I P;  3TT4 A;  1MNC A;  3DTE A;  2DW1 A;  3LIK A;  4H76 A;  3DTI A;  1HY7 A;  1CQR A;  4H3X A;  2USN A;  2OZR A;  1O0Q A;  4GQL A;  5B5O A;  1GO7 P;  2D1O A;  1KBC A;  2XS4 A;  4J4M A;  3P24 A;  2X3C A;  1JAN A;  3HY7 A;  1SRP A;  3WV3 A;  2ERQ A;  1PWQ A;  830C A;  3TVC A;  1ND1 A;  1FM1 A;  2XS3 A;  5I4O A;  1BUV M;  3F19 A;  5LAB A;  2OXU A;  1XFZ A;  2ERP A;  1I73 A;  1JAP A;  2YB9 A;  3DPE A;  3B92 A;  1GKC A;  3LE9 A;  1ZP5 A;  2WOA A;  1AF0 A;  1SLN A;  1FLS A;  1GE5 A;  2CLT A;  4PKV A;  4JP4 A;  3G5C A;  1YCM A;  5I2Z A;  5JMY A;  5CZM A;  4FXY P;  4CTH A;  2MZE A;  3VTG A;  1UTT A;  1CGL A;  1Y93 A;  3F18 A;  1L6J A;  3KEK A;  1D5J A;  3MA2 A;  1CK7 A;  4Q1L A;  1DMT A;  3EDH A;  2N8R A;  2OW1 A;  3LJZ A;  3E8R A;  4R3V A;  1QUA A;  2OVZ A;  1XAX A;  1JIW P;  1JAQ A;  3WV2 A;  4DPE A;  2A8H A;  1J7N A;  1IAC A; 
#chains in the Genus database with same CATH homology
 1C8T A;  3F16 A;  3AYK A;  5I0L A;  2OXZ A;  5I12 A;  4PKQ A;  5D1S A;  1JK3 A;  1GE7 A;  1IAE A;  4I03 A;  1UMS A;  2Y6D A;  3LK8 A;  2DW0 A;  1SMP A;  1SU3 A;  4HMA A;  3EDI A;  1A86 A;  4GWM A;  1IAB A;  1JJ9 A;  4XM7 A;  4JPA A;  1B8Y A;  3N2V A;  2TCL A;  1ZXC A;  1MMQ A;  1XFX A;  2O3E A;  2OY2 A;  2YIG A;  1OM6 A;  1AST A;  3DWB A;  2MZH A;  1BIW A;  4WF6 A;  5B5P A;  1CGE A;  1MMP A;  3V96 B;  3KWV C;  1HV5 A;  1BKC I;  1XUC A;  4IN9 A;  1DTH A;  3Q2H A;  2E2D A;  3LJT A;  1ZXV A;  4WKI A;  4ILW D;  2X3B A;  4HX3 A;  1Y0V A;  4FXQ A;  3B8Z A;  2QPJ A;  2Y6C A;  2E3X A;  1HFC A;  3HDA P;  4PKR A;  4ZR5 A;  3EWJ A;  2OVX A;  3OHL A;  5H8X A;  4JIJ A;  5CUH A;  3LIL A;  1KUF A;  3L0V A;  1H71 P;  3EHY A;  3TSK A;  4I35 A;  1QIC A;  4XCT A;  1BQQ M;  2FV9 A;  2SRT A;  4ON1 A;  1CGF A;  1Z3J A;  4WZV A;  1YOU A;  3BA0 A;  3B2Z A;  3KRY A;  3RTS A;  1O0T A;  4G9L A;  3F15 A;  4DF9 A;  2DDF A;  2W12 A;  4H2E A;  1BM6 A;  3LQB A;  5BOT A;  1RM8 A;  2HU6 A;  1Y8J A;  1ATL A;  1IAD A;  1IAA A;  4AXQ A;  2WO9 A;  4PKU A;  4GR8 A;  2X7M A;  1ZTQ A;  4AYK A;  5D1U A;  2YUF A;  5D3C A;  1PWV A;  1EAK A;  1XFU A;  3GBO A;  4H84 A;  1JAO A;  2W0D A;  3EDZ A;  4PKS A;  4JQG A;  1OO9 A;  1USN A;  2MZI A;  1BQO A;  2MLS A;  2V4B A;  3HBU P;  4PKT A;  1QJJ A;  4L6T A;  1D7X A;  5D2B A;  2J83 A;  1D8F A;  2WO8 A;  1K7G A;  1A85 A;  3EHX A;  2L0R A;  4XBH A;  3O2X A;  1C7K A;  4GF1 A;  2J0T A;  3AYU A;  3HB2 P;  3KME A;  3LMC A;  1XUD A;  2PJT A;  3HY9 A;  3LJG A;  1EB6 A;  1G49 A;  1JIZ A;  3LIR A;  1KUI A;  4H1Q A;  1AYK A;  3NX7 A;  2OI0 A;  4GUY A;  1OM8 A;  3LKA A;  2DDY A;  3G42 A;  1K7I A;  1KUK A;  1CAQ A;  3ELM A;  3LUM A;  5D7W A;  1OS2 A;  1JKY A;  3P1V A;  1UEA A;  1YP1 A;  4GWN A;  5L7F A;  4WK7 A;  1G05 A;  1QIA A;  1Q3A A;  1KUG A;  3LQ0 A;  3Q2G A;  5L79 A;  1C3I A;  2MLR A;  2D1N A;  1PWU A;  2ERO A;  3OHO A;  3ZVS A;  3KMC A;  3DL1 A;  2JSD A;  1CXV A;  1G4K A;  1IAG A;  1FBL A;  3DNG A;  1BSW A;  4WKE A;  5I3M A;  5I43 A;  4IUW A;  4PKW A;  4H49 A;  4L63 A;  3DPF A;  4L19 A;  1GE6 A;  4EFS A;  1CIZ A;  1G12 A;  4FU4 A;  4AIG A;  1WNI A;  1GO8 P;  5CXA A;  3WV1 A;  1BUD A;  1I76 A;  3K7N A;  1BKC E;  1OS9 A;  1G9K A;  1K7Q A;  3O64 A;  4A7B A;  1XUR A;  2FV5 A;  1AKL A;  456C A;  3ZUK A;  1KAP P;  2KRJ A;  4QKZ A;  1RMZ A;  3DTK A;  3KEJ A;  4JA1 A;  4XM8 A;  2OW2 A;  2W15 A;  1OM7 A;  3DSL A;  1S4B P;  1BKC A;  4XM6 A;  1MMB A;  1D8M A;  3F1A A;  2OW9 A;  3K7L A;  4IJO A;  3N2U A;  2JNP A;  1JH1 A;  2AYK A;  1BZS A;  1PWP A;  4GR3 A;  4AUO A;  3USN A;  2OW0 A;  5BOY A;  3VI1 A;  2W13 A;  2JT5 A;  4DD8 A;  5D1T A;  2DW2 A;  2I47 A;  3LGP A;  1HOV A;  3CKI A;  5BPA A;  1R1I A;  1QJI A;  3TS4 A;  1UMT A;  1R55 A;  1UTZ A;  3ZXH A;  3F17 A;  2X3A A;  3HBV P;  3SHI A;  2RJQ A;  3LUN A;  2K9C A;  966C A;  1XFY A;  1GKD A;  1YQY A;  1MMR A;  1HFS A;  1ZS0 A;  2K2G A;  1XFV A;  2AIG P;  3LEA A;  1XFW A;  4FVL A;  3KEC A;  2O36 A;  1R1J A;  3L0T A;  2POJ A;  3I7I A;  1R54 A;  2RJP A;  4A3W A;  1HTD A;  2CKI A;  1ZVX A;  2Z2D A;  3EDG A;  1GXD A;  2JT6 A;  1SAT A;  3RTT A;  4G0D A;  3KHI A;  4GR0 A;  1PWW A;  3U1R A;  1ROS A;  3HDB A;  1OMJ A;  3AIG A;  4L7A A;  2JIH A;  1B3D A;  1R1H A;  1KUH A;  3UVC A;  3I7G A;  3HYG A;  1EUB A;  1SLM A;  4DV8 A;  1QIB A;  2OXW A;  4H30 A;  2W14 A;  4H82 A;  2OY4 A;  1I1I P;  3TT4 A;  1MNC A;  3DTE A;  2DW1 A;  3LIK A;  4H76 A;  3DTI A;  1HY7 A;  1CQR A;  4H3X A;  2USN A;  2OZR A;  1O0Q A;  4GQL A;  5B5O A;  1GO7 P;  2D1O A;  1KBC A;  2XS4 A;  4J4M A;  3P24 A;  2X3C A;  1JAN A;  3HY7 A;  1SRP A;  3WV3 A;  2ERQ A;  1PWQ A;  830C A;  3TVC A;  1ND1 A;  1FM1 A;  2XS3 A;  5I4O A;  1BUV M;  3F19 A;  5LAB A;  2OXU A;  1XFZ A;  2ERP A;  1I73 A;  1JAP A;  2YB9 A;  3DPE A;  3B92 A;  1GKC A;  3LE9 A;  1ZP5 A;  2WOA A;  1AF0 A;  1SLN A;  1FLS A;  1GE5 A;  2CLT A;  4PKV A;  4JP4 A;  3G5C A;  1YCM A;  5I2Z A;  5JMY A;  5CZM A;  4FXY P;  4CTH A;  2MZE A;  3VTG A;  1UTT A;  1CGL A;  1Y93 A;  3F18 A;  1L6J A;  3KEK A;  1D5J A;  3MA2 A;  1CK7 A;  4Q1L A;  1DMT A;  3EDH A;  2N8R A;  2OW1 A;  3LJZ A;  3E8R A;  4R3V A;  1QUA A;  2OVZ A;  1JIW P;  1JAQ A;  3WV2 A;  4DPE A;  2A8H A;  1J7N A;  1IAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...