4EGCB

Crystal structure of mbp-fused human six1 bound to human eya2 eya domain
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
271
structure length
255
Chain Sequence
ERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGTPKRETWLQLRAELEALTDLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/hydrolase
molecule keywords Maltose-binding periplasmic protein, Homeobox protein SIX1 c
total genus 107
structure length 255
sequence length 271
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12350 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4egcB00
3GEBA 3HB0A 3HB1A 4EGCB
chains in the Genus database with same CATH superfamily
2CMKA 1X3LA 2DQKA 3GV0A 3H13A 4J0CA 5K0JA 2GA8A 4MVJM 5EP3A 1MPXA 3C4JA 1MJNA 2FWRA 3ENQA 4ZGWA 1E62A 1R6BX 2XXJA 3ZCSA 5KYNA 1KH2A 1XNQB 3TPZA 4NCNA 4ISBA 4BNDB 5B1EA 2HZ7A 4IIGA 2IHYA 3GFRA 3WK8A 4P3YA 1XROA 1EM8B 3PUWA 3EQ2A 4LISA 4EJSA 3AHFA 5LKRA 3OCUA 3HDQA 4HXGA 5LQUA 3L7KA 5EP1A 1TCVA 5I7WA 2C7PA 1XEFA 4MTLA 1CUJA 2NT4A 4WA8A 1A5ZA 3VO1A 3WNCA 1NNUA 4JOBA 1X94A 2NXCA 3EB9A 3II6X 4NZPA 2J3IA 1EGQA 1UMDB 4RV4A 4HXYA 3C5WP 1EB9A 4EG5A 1VL8A 3P20A 2NXEA 4WKBA 1PWHA 5BSMA 1EK6A 1N9GB 1NUSA 1XC7A 4N1AA 3UWPA 5JFGA 4H35A 1EE9A 3AUYA 1KSHA 3GAAA 1E6KA 3TI7A 5LXTA 3PUIA 2NUBA 2OR3A 1W5BA 5FORA 1IBLB 2P9FA 3L8EA 3FOCA 2EL7A 4QYIB 4CW7A 5A0VA 3D8TA 1DOZA 1Z83A 3D3JA 5LU9A 3OIVA 3RVJA 5CD9A 4CU2A 5KREA 5I48A 3BUSA 1M1YA 2PU7A 4F9EA 1TC1A 1G8MA 1SBZA 1JEOA 1JIQA 1ZM4A 1V8OA 2A3NA 2EW8A 1IHXA 2BKAA 3AK4A 3C85A 4QLAA 1SHZA 4WLOA 4A82A 2JLYA 2GZAA 3PHBE 5JCJD 4WBNA 3FJ1A 2O8EA 3GJ7A 1INLA 3CEHA 1VKRA 3JVEA 4M88A 1YSCA 2WLSA 5LCXA 2H1VA 4Q7LA 3M83A 1J00A 5SICE 4YUAA 5FI0B 4QXPA 1PL6A 4MI9A 3A4MA 2BGIA 3GDGA 3ILSA 4IG4A 3IEXA 1PS8A 1Z7EA 2PU5A 2R6ZA 4M8SA 4GKAA 4RESA 3TQSA 1CZKA 1K2WA 1XP8A 3E7XA 3FTNA 4M55A 1PCXA 4ZVRA 3W3AH 3GHHA 4DA7A 3RS4A 3D5TA 1N8KA 3VVMA 1WPXA 3QPDA 1EX7A 2QN6A 1JQEA 1PG2A 4TYWA 1LLDA 5DX8A 4O2RA 3A3YA 4QATA 5BRJA 5KQGA 3VSCA 4DR1B 1AKMA 3MW8A 1XLWA 2HZBA 1ZZEA 4QPPA 4LTMA 3N76A 3OMLA 5TDHA 1W4ZA 2WYHA 5KS2A 1U9IC 1W1UA 2BUBA 2Y9MB 4O2AB 3VI3B 3DOHA 5K0BA 3KQVA 1GLNA 1NPYA 4N8DA 1UAAA 1SMKA 2I76A 4FZ3A 2BGMA 4YRIA 1VLJA 3ENVA 4OSOA 3CEAA 2C29D 1YZNA 1QHNA 1SK8A 3CUUA 2I78A 3GPCA 3UBMA 1AU9A 4PAMA 3JD2A 4IRMA 4KQEA 1F0NA 2G1JA 1KI9A 4D44A 4R3WA 3OOEA 2AI2A 4EPWA 3DHNA 5FA5A 4UQLA 3BEOA 3U3MA 1IZ8A 2PZAA 2W6PA 5LQNA 1FTNA 2QTAA 1G38A 1M7GA 1C8KA 1Z74A 4ZGBA 3E0QA 3JALB 1RVDA 5L8VA 4CT0A 5CA1A 1JIVA 3QIAA 3FX2A 2CNDA 1AGRA 1RKBA 2QAGB 5LUBA 4GSKA 3RU3A 4B7ZA 2PBRA 1R0BA 2EGUA 3ZQ4A 3LMKA 5FWYA 3L1HA 1KI6B 2W4IA 3SX0A 2PT9A 2FG7C 4KYTA 4Z4CA 1NIPA 4NCKA 3ZI4A 1MUUA 4MKRA 1W88A 3H86A 3WIBA 1N1MA 4CM9A 3SM9A 3UWKA 4FW8A 4IWYA 3DVQX 2B7BA 1M6VA 4AW9A 2AW5A 1TJ3A 2PFKA 2GAIA 2V0CA 3WIDA 1UEIA 3GA5A 1A5SB 1UODA 5K8LA 2HCFA 3FWKA 3H16A 2CCJA 5JQGF 2CXRA 3V1KA 1U8FO 2XDQA 3JQ8B 4PPGA 4II3A 4B43A 1M3SA 1N0HA 1PYGA 1WW8A 3ZLTA 1U7XA 1JWAB 1AC5A 1VRCA 5FV7A 3V32A 2GJKA 1V43A 1E3JA 5F98A 1HKUA 1ZH6A 2XGSA 3DZCA 3HVIA 3JQQA 3WAGA 4F9TA 1KP2A 3Q7RA 4KQXA 1XR3A 3ETDA 4H77A 2ONJA 3MXTA 4KPEC 4PLVA 4CQJA 4NH0A 5CLHA 2XYRA 5JHHB 2YY5A 5D7NA 3AOEA 1U1GA 4N0QA 4O4IF 3C6BA 4ETMA 1WKBA 1JBQA 3GDWA 2FPGB 2XNJA 3C8MA 1Z37A 3U7HB 5FYQA 3GBPA 5LNK1 1TQ4A 2OXEA 3G2MA 1Z0UA 2VQDA 2OP0A 2IF2A 2D06A 5CU7A 3PQEA 1N33B 4H6WA 4E2ZA 4GH5A 2PGLA 3TQTA 5L40A 1AQNA 3NMUF 4H7HA 2FJUA 3MN1A 4LGVA 4MGIR 1ZUIA 1GL6A 3SCZA 5H0IA 3K05A 1NN5A 4YT4A 1FDTA 3GIDA 3RFVA 5BV0A 4JL6A 3FZQA 4UXJA 4HX5A 1XZPA 1RM3A 4KLRA 5E7JA 2ZYDA 5AXDA 4HATA 3MJDA 1SB8A 2ZQ5A 4LHWA 1UANA 4AJPA 2OV2A 3DC2A 3M3HA 1QYCA 4IRXA 3BWYA 1QIIA 4RLQA 2M9MA 5DFAA 2GAFA 1GT6A 2DPYA 1JL3A 3HCDA 4RVOA 5KIAA 1MOSA 2PL9A 5GOTA 1EB8A 3SE7A 3A05A 4NCHA 5ITZB 2RSLA 5FL7D 1V4VA 3QVTA 3HJRA 4ZIRA 5B6JA 5EE3A 1WBBA 2P2ZA 2WHPB 4MMYB 3FLAA 4PAWA 4C7MA 4E4RA 3C7DB 4XDYA 3REQA 4ZOEA 3U44A 1YVRA 2HDNB 1GYPA 4YA6A 4NBNA 4WI1A 1UJNA 3A1EA 4FU0A 3K8YA 4R2IA 3K0EA 2REQA 1NWHA 2AJDA 4CKWA 5LIRA 2H52A 4GP6A 3F73A 3AYZB 1SIUA 2XGJA 1L7EA 2UDPA 3V2IA 1MB9A 1ZNQO 3SDBA 1H4SA 4O8ZA 4ZYVA 1QQ6A 4K0RA 3AVYA 4X54A 2GDZA 2YMQA 4B3CA 4CMEC 3FNGA 1SU4A 2GM5A 3DOIA 4DBVO 4DJEC 2R96A 4YJ2F 1S6YA 2ET6A 2P2NA 5JSYA 4G1VA 2P9CA 2ZYIA 4EECA 4HDKB 2IYUA 2ZI6A 1CUYA 1SJ9A 2DWOA 3L18A 3Q9LA 4H1WA 1Q3TA 1UKEA 3E9RA 4RA9B 2AKEA 3GYBA 5FEMA 1W0JD 1XAIA 3PNOA 3H9CA 2JGAA 4FCWA 4L15A 3VU9A 4AKIA 1W49A 2HK7A 1ULZA 4EHDA 4UOEA 3BZUA 3JQDA 1D9XA 4P54A 3KEFA 5EUMA 2ZBRA 3EEQA 5EXPA 5KNLA 2G9ZA 3GEIA 1Z88A 4PC3A 4MZDA 2FFBA 3F3MA 2E2WA 2C99A 4V2IA 3QKSA 2YOFA 3I09A 4Z1MA 1U7ZA 2ZKIA 3KBOA 2F67A 1YO6A 3LPAA 5AM1A 5BQ5A 2Q5HA 4B1FA 5MDHA 3FVRA 2YS7A 3CNLA 2HA3A 3B3GA 2B94A 4JLOA 4JEUA 1TK3A 3N2GB 3N1UA 2ICAA 4G9BA 3W34A 1AXRA 3C3BA 4C5BA 4BX3A 4W82A 2KPOA 3Q8LA 4W5RA 1EP3B 1BFKA 5TQ0A 1DV1A 5F5XA 4EABA 2QVYX 1P3JA 1H1LA 3CF0A 2HF9A 2K7ZA 2RGNC 1U7HA 2WKPA 1HY3A 3EVGA 3P9SA 4UC0A 1CJKC 3L43A 2O8NA 3SZOA 3U7GA 2N42A 3FPAA 1XTZA 2ZM5A 2RGYA 3BBLA 4L95C 4P36A 4YJKA 1BXGB 5HS4A 4OLJA 1SEPA 3NT4A 4YXFA 1NE2A 4V1CA 2I6UA 4TTVA 3F5MA 2X40A 1XZJA 4LBYA 4QXOA 1ZJYA 4CMJA 5ESRA 2CJWA 3JQBC 3R09A 1T0PA 3WYGA 4ZQBA 1KWKA 5I7FA 3LQKA 3RK0A 5C5CA 4JHLA 4C88A 1UQRA 5CEFA 3K70C 5BYJA 3FYDA 4YCDA 5AUPB 3QTLA 1AHNA 1VPLA 4BN5A 4R1NA 1YUMA 2Q41A 1L9KA 2VOEA 5IVPA 2FEKA 1TDJA 3GRVA 1TYBE 1OHHD 4JD5A 3EYAA 3OE4A 4LK3A 3I04M 3HWRA 3STUA 1B74A 1NY6A 1Y4DE 2H17A 2JK1A 3NIWA 4IMRA 1DBSA 4OXNA 1WD7A 2BI7A 5DWDA 1B8VA 4LZJA 1AS2A 5BUCA 3WLFA 3BEDA 4N5HX 2O5CA 2AW3A 4CWAA 5ILGA 4J76A 2PUBA 2P7IA 2H48A 2Q5EA 2NZYA 1HE2A 4DOMA 4DDTA 3CLUC 1N2CE 1ZKMA 4JH0A 1AZLA 1CXZA 2QOEA 3K5WA 1PJLA 2GEVA 4H3HB 1YB5A 2HUNA 4X92A 1H9AA 3FVVA 3QLUC 2VZEA 2WTBA 3IVGA 4D6PA 4OD0A 3V4RA 3FFWA 1SKBA 2NGRA 2IOYA 4OAPA 4YCBA 1M2FA 4DLTA 5IZCA 5KYYA 4OAOA 1QP0A 1ORVA 2B2XA 2RH9B 2G25A 5AUNB 1B6GA 3T1VA 4UCQA 1YT5A 3KFLA 3MOIA 2AR9A 1THTA 1WUYA 2QJFA 2WIAA 2A67A 2PAAA 4OTZA 4DCOA 1DIHA 3EGOA 2ENWA 1M6VB 4CPDA 3TLXA 5DP1A 3EOBI 1NJ5A 3LGAA 2X86A 3TZCA 1QLJA 2VNSA 2B3DA 5G41A 1PR1A 1F9AA 4GPTA 1L6IA 3WLTA 1GYQA 3EGWA 2EIHA 1E7WA 5AFSA 1XRSB 4US1R 3OEHD 4R0MA 5IFKA 3NV7A 3Q0IA 1JRLA 4O4JA 5HUQA 3H83A 4BCDA 1UR5A 3ZDZB 1ABEA 3EF0A 2ZK7A 1B0AA 2H1WA 3KPJA 5K6TA 3WB2A 4BMSA 4LPKA 1EINA 2HRDA 3ABZA 2C7BA 4QRDA 1A9QA 1BIFA 2YY7A 1UC4B 2F3PA 3LT4A 2PUAA 2B37A 1NMZA 1DTWA 1KIMA 2WFLA 1LQUA 3EGXA 3ELWA 4IDCA 4I50A 1N2XA 5JDCC 5K2MA 2Q3DA 3EZ2A 3WADA 4JI6B 1G16A 1O77A 4M60A 4A2PA 3F4BA 4KQHA 2EF0A 3LBNA 4JA0A 1PJTA 3FLEA 2GYUA 4Y2SA 2O2HA 4R40A 1RZVA 4XJXA 4OUKX 2Y0CA 4MQFA 4WRRA 5JOQA 1IN4A 4J2TA 3FRIA 1II0A 1PWYE 2ZUBA 5AJVB 1SG6A 5CLFA 1JN0A 2OB1A 3QE2A 4H6PA 1Z13A 4ND1A 4B2LA 1IPEA 1OWOA 3GPDG 2AD5A 2F64A 4M1EA 3ZHRA 1K5HA 5TIIA 3LHIA 3FPHA 3NCHA 4O2AF 1YZGA 5JAMA 1MQAA 4UDOA 5L9AA 1GGMA 4O4JF 1OTYA 2JFUA 3JVVA 4HDNA 1SCUA 3C3CA 2V4UA 3KFXA 1R6VA 1Y3FE 2CVFA 4X6UA 3ZJTA 5FI1B 2DWPA 2Z57A 4O3FA 3BM5A 5I4BA 1JKMA 4K9QA 5JC1A 2X2OA 3EVCA 1OWLA 2JIBA 5H68A 3REQB 1TEHA 3OCJA 4HDCA 4B6QA 2AOTB 4FI3C 1N36B 2QZSA 3DLTA 4MAMA 3ETCA 3LBHA 2P9HA 2BL4A 3PQ6A 1N5OX 3KSZO 4OH7A 4R01A 4R2MA 2RHRA 3G79A 5ELMA 4QFMA 4PTLA 4B8ZA 1HG1A 4KBYA 2NVUA 3UH1A 2DR2A 5JD6A 4S1VA 3SZMA 3UCXA 1YVUA 2FF5A 3MSXA 1O6ZA 4OV6B 4TXJA 4G9EA 5TXGA 4DPMA 4K9KA 3JVUA 4B8YA 4YMHA 5B7GA 4URHA 5E1BA 1X8KA 3OOYA 3QOFA 3SN6A 1ODSA 3BD7A 3L0BA 2YXEA 4RAOA 3D7NA 3G9ZA 2QSJA 1YOBA 4MMXB 4TGLA 3TZLA 1YAJA 2J46A 1KL7A 1YI0A 3UFXB 2O2YA 2GLTA 4FZ5A 1OZFA 4FHFA 3P27A 2WZQA 4BNNA 1ZK1A 2ZKLA 3ZWNA 3H0EA 3S5UA 3VZRA 4IQ0A 2RJNA 2CZQA 2QQGA 1I4OA 1DRKA 1CTQA 2EP7A 4LHVA 1SBCA 5DEOA 1E6EA 2W0MA 3NP9A 5IN4A 4ZJPA 2JGLA 2JFQA 2YBEA 5G1OA 2FRVA 3LBIA 3DKRA 2YV3A 2DBQA 4P7KA 4B4OA 3R7BA 2YQZA 1YJQA 4F2WA 4PCAA 2NZ2A 5EI5A 1C1XB 4LXTA 3FZGA 5AVVA 1SKYB 3AFIA 3M5PA 4YROA 3MTIA 3MTJA 3W5VA 3LOQA 2CE2X 1JLSA 3AVOA 2QM7A 1VSTA 3BMQA 4QYSA 1GQQA 1QH1B 5SYAA 3WGYA 4U7JA 1JPUA 1XZLA 1QYWA 3REFA 3WQBA 4G37A 4JKOA 1O6BA 3MB5A 3ZHSA 4C4YA 3KKEA 4D96A 4HXEB 1Y7TA 4RHYA 5EIWA 5JWRA 2ANCA 4U9HS 3RU7A 2OO5A 3EZ7A 3FHCB 5CX1B 2BFCB 3L41A 1ENPA 1G3RA 2P9YA 3N74A 3KKQA 3WISA 4MV1A 4C2BA 3O9ZA 5KOJA 4HDMB 2NU8B 1FTWA 1H2ZA 1MJGA 2I3AA 3VYRB 2MSEB 3FB4A 4RUKA 4TS9A 5KWSA 2QRKA 1EM8A 4BNYA 4ESEA 1CR2A 1UQTA 3DG9A 5LP6F 1PGQA 5IC6A 1AZWA 4DMHA 1DQNA 5F1PA 5EQJB 1IN7A 2GXQA 2E6UX 2WP8J 4ZC1A 3OX4A 2BFWA 5TJ9A 4HNUA 1ZRSA 1XD8A 2VFAA 2YHIB 5DBEX 4K2AA 4R7GA 2GX6A 3DBIA 1XMIA 1JI0A 1P5JA 2J45A 1X19A 3E3MA 3EFOA 1LVGA 2ZJOA 5DHAA 5SZKB 3MRXA 2WDZA 1J0CA 3H18A 3N7AA 3EEYA 3LKVA 4AROA 4UXHA 1JAXA 4NICA 4Q0MA 4PG5A 3R44A 3ZE2B 3I42A 4R9VA 4AI6A 1TRHA 4XFJA 3HVUA 2JBHA 5CM9C 1VCMA 4M86A 4MQEA 3ZHZA 3WRVA 4ENUA 4BTEA 4PGMA 1SAYA 1ZJ5A 3ZLVA 3TIFA 1UFKA 2R85A 1P1HA 1VRVA 3BDVA 3JASA 3VR4A 3KXPA 1M6YA 2N75A 3EC1A 1EUCB 4JYBA 3W9UA 3ZXIA 1O97C 4YONB 2XBUA 4GYYA 2R5FA 1Q0RA 1ZOSA 1W4BA 3INNA 2XQFA 2FGKA 2JJQA 4PZAA 3DT8A 5ALLA 3SD7A 3LX8A 1TMGE 3AM3A 4PC7A 4LW8A 3WMRA 5L6MB 3QVUA 1QCDA 4A2QA 1QONA 1KE1A 1J5XA 2IIBA 1NLFA 1YFLA 2XECA 3NHKA 4P80A 2GS9A 3QTBA 2BR3A 4LZNA 1WO8A 3X1KA 2PKQP 3HNOA 3PLRA 5ALKA 5I7HA 2QF7A 4LQDA 1DELA 2OCYC 1HDCA 1K6JA 1CRQA 2IYZA 1XOIA 2HCJB 3KJQA 4JLBA 5EJAA 4PANA 1M74A 3CBGA 3T9AA 4BIIA 4KGDA 2HK9A 3S2UA 4CHTA 4NYIR 5GMOA 4BBAA 3PEVA 1USKA 1AKUA 4D4HA 3QEMA 1KJYA 1CR6A 1SCKA 4BNFA 2ZB2A 4LC1A 1JH8A 1RAAA 1SRRA 3PZBA 2WD9A 4UHDA 4EKGA 3EY9A 4W7SA 4X3PA 4GS5A 1S8AA 1U0RA 4MDEA 1LPNA 4MW6A 3ADOA 1SPXA 2JFVA 4IVPA 3VU0A 4LYDA 1JKJB 1WXDA 1MQ9A 2DT8A 4WSOA 2YVLA 3BREA 3O93A 1CIVA 2KHZA 4N65A 1I3CA 1WUJS 2EJVA 2VHCA 5EIOA 4DV3B 1RDFA 4GBED 1ZJ4A 4OU4A 1O08A 2CEAA 2FZVA 2P11A 4FEEA 1RYYA 4KDFA 3IDZA 2ZT8A 3TDNA 3T3OA 1E9EA 2IDMA 4PW0A 2QRZA 3L7DA 3LSYA 5I4IA 2OLEA 2W48A 4I50F 1IEVA 3B3QA 4QFBA 4BVJA 3FTEA 2XMPA 4X44A 2ZAOA 1S3FA 3L2OB 2P4QA 2DECA 4N3GA 4LZPA 1GG8A 3V4VB 2AZMA 1S1MA 3CXRA 2CSXA 1WZNA 3FNBA 3C3WA 4P0TA 2P9GA 4FE4A 4L5YA 2RK6A 3U1BA 2I34A 3CPEA 3QKRA 1GM5A 4TQ9A 1NBMA 1K5DA 1M2VB 4D9NA 1LA2A 4JWTA 3PE4A 5FF9A 1KHTA 3DCNA 5CJ2A 4UAUA 4CYMA 1ILEA 4G0QA 7REQB 2OM2A 3ZVLA 2QR5A 2VBGA 3IMGA 1IZYA 3CA8A 1FFEA 4MV0A 4POAA 1JG1A 1TUEA 2PS0A 3NEAA 2AG8A 1XYGA 3F46A 1M6HA 4OHUA 3BSSA 3U7IA 2OXCA 3B9PA 4ETWA 4AM8A 2ZJZA 5JU6A 4YT8A 2O7NA 2VPXA 4IVRA 1ZK4A 4TV9F 4Q19A 5KMGA 3WGIA 2R7LA 1CYDA 3G2PA 3NATA 2PGDA 2XE4A 4M38A 3RVKA 3KQKA 4Q7JB 3KXLA 4BUJA 1T1RA 1I5RA 4JLVA 3EQ9A 4UCWA 1K89A 1HSZA 4M0DA 4E2XA 2OOSA 4REOA 4EPXA 3CZRA 2QMHA 4EB3A 4JLAA 2V7EA 4GXNA 3CH4B 4K9PA 1GPMA 1KU0A 2ORIA 1GQSA 3C4VA 4E32A 4PLTA 1XPRA 3Q6IA 4Q7EA 4G41A 4QUBA 4UATA 3A32A 4AY3A 4DQVA 4XKJA 5L4LA 2CXUA 1E2NA 3Q4GA 3ZJYA 1YAHA 1UC5B 3DDSA 3JQ6A 4Q9NA 1JFFA 4GBGA 1Z06A 4AMUA 3OUZA 5CB4A 3BZWA 3E70C 5C1OA 3PRJA 4PIMA 1A82A 3CIOA 4RKQA 3ZIAA 4F1WA 1K7CA 1Y1SA 4KYIB 3CEPB 4MRVA 2V6GA 3M1IA 4QTTB 1U2QA 2G07A 4ZKEA 4MVWA 4DJJA 2IXDA 2OT3B 4A8JB 5A03A 5A5FA 1T91A 3C5EA 2D7DA 2ZOSA 5EWMB 4KKXB 1GHTA 1JU9A 4IHJF 4RLHA 1CU1A 3HDVA 4C5AA 3PWSA 4LK2A 1FJ2A 3AL2A 4EO9A 2QLBA 1G6OA 1N5RA 4F4IA 2IC5A 3DOFA 4WKOA 1RYNA 2X5NA 1U8EA 2O23A 4LHXA 5JI2E 2E1PA 3R75A 5I9SA 1YS7A 1PDOA 2ZYHA 3C3YA 5IKEA 2PCJA 1VL5A 3AHCA 4YBRA 1XA0A 2XMDA 3G6KA 1BVYF 1KE2A 3SX4A 4WNIA 3N8IA 1KOGA 3PYXA 1Z47A 3TW4A 3PX7A 4ESHA 3PEWA 1HFJA 1AK9A 2ZAMA 3D54D 3RVDA 3SC3A 9MHTA 3KLNA 1FYEA 2A5FA 3IJPA 3RFCA 3FZYA 3KG2A 2H5EA 1WXXA 4Q4JA 1Z6ZA 4FYYA 4QO7A 1X7XB 3WWYA 1QH0A 5K99A 5IAGA 2N9UA 3KUDA 4LE1A 4KQMA 2GMWA 1BD4A 4E6EA 4HGPA 1TQDA 5DCUA 4J0GA 1M5UA 1YZKA 1ZXBA 1BE1A 2WHQA 2ACWA 2NTEA 1I6WA 2WNSA 2G5GX 3FUWA 1DBRA 1HMPA 2WF6A 3G8CA 3MOGA 3ZDXB 3QVKA 3IUBA 4ISCA 5DK4A 2WHXA 2X3YA 1J5PA 4S1TA 1L7DA 4XVRA 1N8TA 3MCVA 2X0NA 4FLFA 5F3DA 1T2AA 1RC8A 3GMIA 3NNNA 3IMCA 2ZWAA 3KR2A 4U2CA 1K6XA 4FOSA 5GV8A 3LHSA 1FFWA 4B35A 3C1OA 4MWEA 4N7JA 1B1CA 3CJQA 3JATB 4TMVA 1H23A 2JI4A 4KO3S 2IIPA 3LP6A 3MCZA 3MMXA 4XWYA 1KAGA 1LPAB 1SURA 3KOOA 4I9GA 2HF2A 5T57A 4N3AA 1Y81A 2W6ZA 1FU4A 1RMQA 4RKEA 2KLBA 2O3RA 2ODBA 1JIJA 4MUKA 5CVTA 3V1UA 4FDTA 1M76A 4ZV4A 3DGEC 5K0SA 2UVQA 4CQNA 3VAYA 3R8CA 2ILVA 2IVFA 4D9GA 4CTOA 1MB0A 2TYSB 4Y6SA 2YWFA 1BXZA 3PHJA 3H3JA 2JBAB 4M0FA 4P92A 3WL7A 1DBVO 4BVLA 2V6JA 5LOVA 4DR3B 3HI6A 1S7CA 3DO8A 2Q49A 2ASVA 3SYTA 3KOMA 3PPYA 1X38A 4GPD1 3NPMA 4J2OA 4YT2A 4OUDB 3AIOA 4E11A 4BATA 1HWYA 3MLEA 2HYIC 1GAWA 2J6IA 3B7GA 1Z38A 1UDCA 4IGIA 1G6Q1 5FPSA 4NPAA 2GTHA 4RD6A 3CW9A 1O9HA 1M10A 5IVDA 4EY5A 5BNTA 5EJ4A 5ALFA 4WLVA 1EEHA 4RJJA 3ZGYA 4EI7A 2YJ3A 2RE8A 3L93A 5DYNA 1TVMA 3N8DA 3EFOB 4QPJC 4Q9HA 4Y2VA 3MOSA 1D09A 1XXHE 2GZDA 2IEAA 1Q6ZA 1WEHA 3PUZA 4NWIA 3OJ0A 1NZFA 4JUBA 4HQKA 5DLYA 3HBJA 3ROQA 4Y8VA 1U1EA 5HQ3A 5A4IS 5FHRA 4A9AA 2H0AA 2OILA 1EFTA 3GNTA 1CZNA 2HD4A 4OG2A 3FWNA 5ARBA 4JBYA 1J2YA 5EHNA 3E3LA 3B1XA 4MW4A 2CFRA 1NQOA 1W4LA 2Q6TA 1BWSA 1OASA 3FDXA 2G83A 1GNQA 3L49A 3M6WA 5J1SB 2O3QA 1ZLYA 3ETLA 5CBKA 4YMLA 4GM0A 2AJTA 1R6XA 3G7SA 1XQ9A 1A5BB 3U17A 1AZTA 4PWYA 2X1VA 4QRIA 4B5LA 3FYCA 4AQDA 4TWBA 1U1DA 3CPSA 2PX5A 3GFGA 3P45A 1BWQA 2VSXA 1TYAE 4HDQB 4X1YB 5CH5A 3FE2A 1G3MA 4D80A 1IM5A 1FTSA 4HO1X 2QT9A 1DCKA 4PC6A 1XZMA 5ELXA 1J33A 2VH1A 2ZB7A 4NMXB 4Q4AA 4YI5A 5FV4A 3PWZA 3QTTA 2HBZA 3UM9A 4AUMA 1TO6A 4S0XA 4FMPA 5K6RA 2VJYA 3FB1A 4UEJA 3WX0A 4EI9A 4V1CB 1DKUA 4ZQHA 4D9KA 3R5TA 4NHEA 1FP4A 4X8LA 1ZVMA 1N7IA 1YDWA 2YWJA 3H2YA 4QU5A 1AKRA 1ZHOA 1Q74A 3QELB 5E0KB 1ZHFA 1DEXA 3IDAA 4K40A 4WAUA 3WYEA 3TQRA 5ITWA 5TGZA 1YK0A 3BILA 4R84A 4WNAA 3CUEF 3SKXA 1NQXA 2PGXA 1P29A 1P60A 1EM6A 4FSXA 2VTBB 2MSCB 1COWD 1E8DA 2AFRA 2I66A 3X0DA 4KU4A 4PZZA 3G3EA 2Z09A 1NQAO 3BH6A 3OI7A 1YIDA 1YQWA 3CQ9A 4RTRA 4WGGA 1B6SA 4JP1A 2PANA 4A0FA 3HUFA 4BNLA 4GUAA 1SEVA 2FPMA 1H5NA 2HPAA 5HDQA 3BT7A 2GESA 2LCFA 2UXDB 2Z04A 2W4MA 1MAAA 2RONA 2YRFA 4NARA 1DTSA 1JLMA 1X7WB 1CS0B 3SSNA 4G5FA 1MOQA 1SCJA 1I9CA 1T5TA 2O50A 2XDQB 3JQ8A 3KNZA 4LBVA 4DR4B 4Q3OA 1QVAA 2ZPAA 2YVAA 3H3FA 4NRDA 5IJXA 3DULA 3G88A 3BK7A 3EIHA 4JK3A 2YIDA 1P2FA 2QQFA 3T41A 3CT6A 4GR5A 5K03A 1VLVA 1JTVA 4HGYA 5LZ7A 3E1SA 5JZBA 5JD5A 3F9RA 5F23A 1Z6YA 4PRYA 1Y9EA 2IEZA 2E4XA 3NUQA 4H0NA 4ZAXA 5IH3A 3ZWWA 4L50A 3RIMA 1USUA 2OM6A 1F8XA 1ZD9A 2QI9C 1ITZA 2FYTA 5EFOA 2IF0A 3QX7A 4QOEA 1F2TB 5KHAA 3UWMA 5F51A 3ZYZA 4BNTA 4HUTA 3F96A 2VA8A 4HS4A 2F4VB 4B2PA 3HNRA 3OP1A 1WCIB 4BQEA 4ARCA 4GPEA 2WFLB 4I50B 4COOA 4I08A 5BW6B 3GGPA 3KUUA 4TYPA 4BPBA 3ZCQA 2OXRA 2IA5A 4NONA 2IUSA 2WHPA 3OX3A 1YQDA 4Z9XA 4BS9A 1IOVA 2XWQA 2VJPA 4PVDA 1S9HA 3HEMA 2XNSA 1NBHA 2HPZA 4N3CA 1W1WA 1D0SA 1XXLA 2CCGA 4WL0A 1FOEB 5CJPA 3KUKA 4ZTBA 5K8UA 2WTUA 4GYWA 3EZGA 4R69A 2YNMC 4X45A 2ODQA 4LA4A 4OGGA 2O8FA 1KEWA 2HU7A 4EGCB 1YFJA 2JIRA 5JS6A 2WIKA 2NAFA 3QKTA 4DLZA 2HU2A 4ZRDA 1WP4A 2HFKA 3CR3C 4HEA6 1QUEA 2YN4A 4IY1A 5KJ6A 2IYYA 5EMMA 4E5UA 3AUJB 3NWJA 5HM8A 3LS2A 3LYAA 1MH9A 4IUYA 4PGAA 3VSEA 4EDFA 1O6CA 2NVBA 1DO2A 5BRNA 3C5HA 4B4WA 1DHRA 1H2AS 1NF9A 3VYTB 5HK9A 1T4CB 4WDQA 5A4JA 4YXWD 2D1TA 2V1XA 3A2LA 5JD3A 1IONA 4PRKA 2BEVA 2WF5A 4WZBE 4TKVA 1UH5A 5CT4A 1ABBA 5IAJA 5FLKA 1WZEA 4E15A 2VTBA 2CNWA 3R5KA 3VC1A 3OOSA 1I2CA 3WFZA 1CJMA 1E9CA 4L16A 2BE7A 2B78A 4U4AA 4UHBA 2NO6A 4BUZA 2JW5A 3EVAA 4KX5A 2WUVA 3HQ4O 3H5LA 3ZWPA 1AVTA 2IZOA 3L6UA 1DADA 2R1VA 1W9MA 3X1YA 1E64A 4QBHA 4QXQA 3RSOA 1EA7A 3AONB 5T8KC 1P2BA 2FPKA 3QMMA 1AQYA 4GU5A 1PDWA 4RGYA 1TI7A 1M1YB 3T94A 3LA6A 1L5MA 3KT0A 4UBIA 2RAVA 3AWDA 3LQ2A 4BN4A 1A8PA 1NKVA 5DM0A 3PI7A 1PK8A 5AHOA 2FEXA 1UM8A 2IZ6A 1HFEL 3UB2A 5LZ4A 4UBLA 2ZSDA 1NQUA 5ER6A 1O7JA 4Y7DA 1K63A 1EHCA 5LWQA 4MQEB 1IL0A 3DE1X 5DRTA 3SM3A 3OF5A 2FPXA 1O5TA 4C76A 4CLOA 1XGKA 2SBTA 5LJIA 2WAYA 4C7JA 2FTKE 3I5AA 2GPAA 4MV3A 4CCYA 3FKSA 2PT5A 3BCSA 5LYJB 1ZR4A 4LOKA 4C06A 1R4ZA 1GKKA 1MT0A 3SMQA 4A03A 1VGVA 1N8SA 2PGOA 2FY8A 1JXOA 4G3XA 5TQ2B 3TXXA 4AIIA 4BNVA 3IOYA 3CSSA 4GLJA 4NOJA 2AOVA 1GO2A 3CX3A 1HEYA 4AAYA 3V5NA 3PXAA 4LX8A 4M1WA 5IAAA 2PD6A 1MF7A 1XTRA 2PT6A 1J56A 4Q7MB 4C3VA 3KK0A 2DLDA 2JFBA 5F52A 3HU2A 1E3WB 4UFNA 1W46A 2P5UA 1BS1A 3WNZA 1MN6A 2NUTB 4EY4A 1XYVA 1XDUA 3WIVA 4JI1B 2OQ2A 3VDQA 1R37A 2LD4A 3RAJA 5AICA 1G5FA 3U4GA 2VHWA 1C0PA 4F5WA 5IJZA 3N2EA 3DV9A 3C3MA 5GADl 1FJGB 1VIMA 1P2DA 2Q5CA 3V42A 4TS3A 3FOFC 1BTOA 2QD5A 3BXEA 2PYDA 4HQNA 1H5UA 1ZBQA 1Y8ZA 4G84A 1I0ZA 1AS3A 1WDMA 4DHEA 1M7HA 2WHYA 1JJBA 1X1EA 3HJAA 4HBGA 4R2JA 1PJZA 2ZIUB 2CV1A 1KBOA 3COSA 3R3YA 5JNRA 4YV0A 5ESWA 1AKQA 6GPBA 3IE1A 1MCZA 4X1IA 3AB7A 1NATA 3DEAA 1GQFA 5FL3A 5BVGA 1FP7A 4YIHA 2X19A 1FDIA 1A2KC 3M6MD 2W83A 3KVYA 3ICOA 3FROA 3IIEA 5DNCA 3B6IA 4C08A 5LMNB 5BNZA 4QTYA 3CWCA 3OCCA 4QBGB 1RM4A 5D3MA 3COYA 2Q3CA 3MF4A 4YMUA 2EVWX 4WUTA 9ATCA 4Q1EA 5K8CA 1BWRA 4XX0A 2N3ZA 1LDBA 1E4VA 3GRPA 1Q2UA 3GGDA 3UENA 1TYCA 5FJIA 1SCQA 4G97A 5K1ZA 3SR4A 4KNWA 2I2CA 1FMJA 2FE4A 1L8XA 1RE1A 1QGZA 3MTEA 2D0DA 1NR5A 1Y4AE 3A6PC 2I2XB 3H5TA 3R3HA 2VXBA 3F47A 4XARA 4BNWA 4E12A 4ZOQI 3G49A 4EQZA 4OMCA 1TKBA 2DF8A 3HSSA 3RRJA 1OJ7A 3IT0A 4G26A 2RGGA 2ZJFA 3UYKA 1D4AA 1G4UR 2XA1A 4W1QA 3VPFA 4Q1BA 4A7PA 3RO7A 1RP1A 4KMMA 4A5OA 5KVVA 3NRJA 3MUEA 1AK1A 3PC8C 3R0VA 4K9DA 1OFIA 3FMPB 4XUEA 5HDBB 2IS2A 1XNJA 3NWBA 4PYOA 5JNLA 4HVTA 4C2TA 3EARA 3SU8A 5EWMA 1TYDE 3L7CA 1E92A 3PTZA 2JG3A 4D3DA 1U2ZA 2H5IA 3GFQA 3T35A 3V8NA 2X4IA 3M3PA 1RLMA 3VKWA 3WKDA 1Z0IA 3PFKA 4CI9A 4CEJA 4U2DA 2L0XA 2WVHA 2IYLD 2RJOA 3EAQA 3AX6A 4HFMA 4V03A 2UYQA 4DG5A 1DUSA 4DXAA 3R0QA 4ASUA 4ZEVA 1OAOA 1I1OA 1LWOA 2HDOA 2G9QA 2A86A 2ORYA 3ELDA 3ELUA 4V0MA 4HT3B 1E59A 3TR5A 1P7WA 4AMVA 2ZSUA 4ITVA 3F71A 4KXMA 4RJLA 3CF4G 1QFSA 3S2SA 1P19A 2AG0A 1QZZA 4BJ5A 4I1IA 1JFVA 3VJLA 5K5EA 4ZQEA 3SXUA 1SXJD 3MMZA 5EGSA 3GFOA 4IUCS 3L8YA 3BIFA 4OQ4A 3VR1A 3LK6A 5E9AA 2OGWA 4JROA 2ZJAA 3O8RA 2CLIB 3QFTA 3SG0A 4PGHA 4EFMA 1E69A 2WYUA 1OX4A 2ZE7A 2J9ZB 3MWFA 3EN0A 4X62B 3QLVA 4LV8B 4DIEA 3GGCA 3TUZC 2AXPA 3N07A 5THQA 5F4ZA 3SIXA 3HKCA 3UJ3X 4WXPA 4OGLA 1GG9A 1DDOA 2YHSA 3OQMA 4F71A 3NBYC 3NBKA 2G08A 4WCVA 4DABA 3VR5A 4CM3A 4IR7A 5C46F 4HAWA 4CKBA 3EMBA 2EZ8A 3C8UA 4A1OA 4Y2UA 2E4ZA 1NVAA 2LDBA 3RYIB 4TYQA 3FFTA 4WVLA 3TDKA 4BASA 3LXRA 4ZQCB 1HZZC 1VB5A 2AZ4A 3K5PA 4E5DA 4YYZA 2FZGA 4GZ5A 3HVJA 3PUJA 4QUHA 4TLCA 4JB2A 2HBYA 2FFRA 3G1WA 1B73A 1K86A 1L5SA 1JGTA 1R5JA 4B87A 1SCAA 1Y6RA 1CF2O 1X9HA 4ZVLA 3EG9B 3VXKA 4ZYUA 5JCZA 1OB2A 2MR5A 4B0PA 4IIYA 4YVFA 1CDEA 3HH8A 2BTQB 3RAFC 1LJLA 2LDXA 2PSFA 3JVDA 4RVHA 3R0ZA 4WNYA 4EKNB 2QGZA 4IUDS 2QBYB 3LPDA 3HJGA 3RDPA 3WLSA 2OK8A 5E9JA 1PR2A 2D2IA 1S2OA 3H0CA 3AG5A 4BEWA 5AVRA 4RTNA 1X8JA 3CHYA 1GPH1 1UEJA 2IZ5A 4LVNA 3OIYA 3UUWA 5BV7A 3NGXA 1W5TA 3WHKA 1BROA 1ENOA 4MDFA 5HILA 2ZYSA 3AHIA 4GC5A 1CIPA 2AXEA 3LW8A 1OI4A 2HBRA 4H31A 4PHCA 4DIDA 3R8FA 1Q77A 4RV9A 2MU1A 1GAQA 4BJ1A 2CJWB 3H42B 2H11A 2OBLA 2XVYA 1T9BA 3JYPA 1VBFA 1P7ZA 2HF7A 6NULA 2C2HA 1NI4B 4RK4A 4EDHA 3L7NA 3VDNB 2A9PA 3G17A 2WD7A 2YZ2A 1DAIA 2W37A 2UV8A 1AB5A 1KBZA 3LI2A 3F7TA 4LG1A 3J7AC 4AP9A 5AK6A 1L7OA 2E89A 3ADBA 5CH3A 1ZITA 1V9LA 1ZJ6A 2GPTA 4P7FA 5F7ZA 3KLBA 4EIWA 2JAPA 1X2EA 4BO2A 3L0CA 3E3NA 4MA4A 2IEDA 4DDVA 4FC6A 3OZBA 3CLSC 2HIAA 3IOCA 5DCLA 1DC4A 4YRZA 2CN1A 2HSZA 1P7PA 1CRLA 3LUAA 3BWEA 4GE0A 1N2SA 3CX7A 4LHYA 4Q47A 5FNVA 2HA4A 1ILWA 2PD3A 4YAGA 5BNWA 2VT6A 4FR2A 4C7XA 1XELA 1MEJA 3ZY6A 4RPIA 2B2CA 2NU9A 3QBTA 2WQZA 2Z1MA 4GOLD 3DO6A 1PD1A 4FFSA 2EFCB 1XVUA 3DHYA 5EJ7A 3PQ4A 1QHSA 2FZKA 2K6GA 1HYHA 1A69A 4PLHA 3VI4B 4C43A 2JLUA 3EF1A 1C8BA 5ADVA 1T10A 2AQ8A 1LTHR 1WPGA 4NZ9A 2PL1A 4RE5A 5G53C 1K4MA 2OTCA 5AW0A 4R16A 1GD1O 2QSUA 3NQ41 1GRVA 4JVMA 1ZC3A 4CIWA 4GNRA 1O94A 3L6EA 1MXHA 1EJ0A 1VSQA 2FKAA 5B1SA 2Z5GA 2RGNA 2WMYA 1N4AA 3U40A 4Z1MD 3PA6A 1JLKA 1NJ2A 2PGIA 5LP6A 2I65A 1O87A 2W8ZA 4GI2A 4HRVA 4OA8A 1NXSA 1YZLA 3AV0B 1QSGA 3C41J 3LF1A 4FEYA 4L85A 1AHPA 4KCGA 3ZUPA 4D5GA 2V7QA 1Y1KE 3PC2A 5F1OA 5KTRA 1EMDA 4UQPA 2Y92A 3A2MA 4CZ2A 1O6GA 1KI6A 2A6PA 3DZ8A 3IO5A 3LHKA 4J1NA 4MWSA 5HWSA 5JXHA 2YOGA 3CZCA 1R3UA 5L7WA 3D6JA 3IXLA 2IS6A 1YB1A 1YXMA 1E3EA 2BOVA 1AKNA 3A9UA 4GKBA 3VKFA 1UT5A 4Z7OB 3P9XA 3KTAB 3OQPA 2XMSA 5CA1B 3LQYA 3N5CA 2B83A 3ZU5A 1B6RA 4YQEA 1Y4SA 1I7QB 2YS6A 3HO8A 3M5CA 1YRLA 1O95A 1PHRA 5EKXA 3C24A 1QE3A 4QTZA 3F5QA 1CJTC 5E4JA 4H6VA 2HWXA 4TZ0A 2D59A 5EIXA 4OM8A 3H1TA 3INGA 3JRNA 4RETA 5AW3A 4PVCA 1YA4A 4GOJA 2X4LA 3AIIA 4HH3C 3TOCA 5JMWA 3NHFA 5DWVA 2ATIA 3U3XA 4AZ0A 3GJ0A 1E3MA 2A5YB 5EIEA 1IBSA 3F90A 4F4HA 4Z7JA 3DBLB 4HD8A 4HNQA 4D57A 1XMSA 4EL5A 2WF7A 3LUCA 4JMPA 4AKHA 1ISFA 1WQ4A 1G20B 1VHLA 5TGTA 3D7RA 5AOBA 3DSRA 3I83A 2FDCA 1AURA 2XTAA 2RB5A 4RKWA 1UKBA 4EFDA 2QD4A 1T0BA 3MK31 5LP6C 1Y8AA 2EIXA 2Q7XA 5FOQA 1JEDA 3F1LA 1DTWB 2HQOA 3QUCA 5AJUA 3MG9A 3NYIA 4B3HA 2LR0A 3JQ7A 2HMVA 4J0JA 3LIIA 4G4JA 4UPDA 4DNOA 2P9EA 4IDPA 1LC0A 3C74A 1E2DA 1U3TA 1E3IA 1X7WA 2OY0A 5CW2A 3UHJA 4M7OA 4A8TA 2C2YA 4Y9DA 5DLQC 4W63A 1FLAA 4IJUA 4YRJA 4BZPA 3D6UA 1XQ6A 2FPRA 3UAWA 5EC8A 2QVXX 3I6ZA 2FSHA 4S1PA 3ZXSA 5JRZA 4B6RA 1C0KA 2W6JA 2H1OA 3C1UA 1CQPA 2YZKA 3ZLBA 1RQ2A 1VZ3A 4Y2HA 2V96A 3GRRA 3MUFA 3BMNB 2QJWA 2O4CA 1FP1D 2ROQA 3ETJA 1UCFA 5IJ0A 1ORIA 3CVOA 4Q18A 1OBCA 1QBKC 4YAUA 3WRXC 4Z4EA 1Y6ZA 4RPGA 2F7SA 4DARA 4PBRA 4TTTS 1QU3A 3TMYA 5HZMA 4KPFC 4LN1A 1TLTA 1SZCA 5F5NA 1Y5IA 4L4SA 4BV9A 4WFQA 2C9MA 1IVSA 1CSEE 3UJAA 5KNCH 2R66A 1A5TA 2QTGA 4IDNA 3UZUA 3MBIA 3KSAC 4GVXA 4IQFA 5F1YA 2IKSA 4IGEA 1ZXLA 1UZLA 2XF8A 3DPUA 3JARA 1OYVA 5T67A 2RK4A 2CF6A 3FPCA 1AQLA 4YP7A 5L3RA 3F5DA 4TL8A 2C97A 5DMHA 3AFHA 1THZA 3K15A 1L5GB 4MOWA 1YACA 3OJOA 4IIUA 4DS3A 4BO1A 3GLUA 5LWHA 1ML4A 3Q0EA 3I34X 4FI3F 3VPSA 2O2EA 3FHOA 5AI0A 1Z8FA 1EGAA 2DM6A 3B7WA 2PJRA 1J7JA 4GRIA 1T29A 1Q1EA 2R6JA 3A58B 1V25A 4KLCA 2M98A 4NNJA 3P2YA 4CM8B 1QGUB 4NTZA 3RRNA 5FT9A 1N2ZA 4Y3UA 2G09A 2QPLA 5IK2D 5B36A 3LWZA 5C31A 1K8QA 3I9LA 5LBIA 1RADA 1Z82A 2ZU0C 1N77A 1T3SA 2PRJA 3PJDA 1IIBA 4F4UA 1TU3A 3B78A 4YCCA 1QOPB 1QGAA 3FBGA 4B73A 3ITKA 1A0OA 1CE8B 3QXSA 2V59A 4MUAA 1LW7A 1DQZA 2EZ4A 2WAOA 4OF4A 3V4ZA 3ZWDA 1C4XA 3CLRC 4FHZA 4MI3A 5A1JA 4LXHA 4PFQA 1DFGA 1L1FA 4MW5A 1YDEA 4CXMA 2VAPA 3FCXA 5EUQB 2QW0X 4JBLA 2EW2A 4PLYA 1WXGA 4RGVA 4YMIA 1X13A 1DQPA 3IVRA 1PFQA 4NZYA 1PU2A 4C3UA 1GCOA 4ADSG 1BMDA 4J9UE 3WMFA 2MR6A 4QUAA 2RBGA 2Z08A 3HVRA 2X9GA 4FR0A 3NEPX 5I9BA 4CLXA 2OLKA 2QMQA 4XUGB 1XZIA 4Q9LA 1JJVA 2C88A 2F43A 3F6BX 4WQMA 2B21A 3UMRA 4M7RA 1H0RA 1IXYA 3DZJA 1MJ5A 3T4UA 2FLKA 4HLNA 2HHCA 3KQQA 3T5AA 4LDPA 2YMMA 2OD9A 4ZKDA 3Q3IA 1SNYA 3Q41A 3GGOA 4FYVA 4DIFA 1OZ0A 4KITB 2NZUG 4ZA2A 3QYFA 1DJMA 2J08A 4KR7A 4M46A 1SCNE 3R8XA 3UGJA 1QQBA 5C4MA 3ECCA 3P8ZA 4KE6A 1XZQA 1ZD2P 4TQAA 4ZO6A 5KZMB 5E95A 1LX6A 1TM7E 4IEEA 4CKBB 5JVDB 1M34B 4MVJD 2Y9PB 2H8KA 2BMWA 4J1SA 4WVFA 5F2KA 5B58T 5L4SA 4GG1A 4LEIA 3VHQA 1GCAA 3TW0A 2MMGA 1FBTA 1WQ3A 4LYEA 3I4CA 2BMJA 2O3SA 3CTMA 5E6UB 4XM0A 3CX4A 2OGZA 4RLSA 5E4YA 4P82A 3TK1A 3BB3A 4RKRA 3DBLA 2VPZA 3JR7A 2XAAA 1JFLA 3NB0A 4PTYA 4QREA 5DBHX 4R1QA 4PLCA 2BGLA 1MGPA 2VJCA 4KC0A 5F5LA 2F8TA 3I6IA 1NYQA 1HC7A 4MUEA 4RMIA 4YUVA 5HKOA 1SN7A 5FLYA 1ZG3A 1NTRA 4I4TB 3WZLA 2OK7A 5JD4A 2NSLA 2TSYB 1LB1B 2OCLA 3JV7A 1V8BA 4L6AA 4DLKA 5L4NA 5CXXA 4RTJA 2HRQA 2EWMA 3BB4A 3U9LA 3TQCA 2BKUA 1HT3A 1FC0A 1J0DA 3SZUA 3ZV7A 1JR2A 3BVPA 4XCVA 3IDOA 1WMAA 5AM0A 4HZIA 1YJAA 4INPA 1YMVA 4K6KA 4XD7D 3PFBA 2Q1YA 3E9NA 3KL2A 3VH4A 5CDUA 1Y7PA 4QG3A 1IJBA 4RTOA 3PLNA 1N7HA 1J20A 1M1NB 5BP7A 2ZTSA 4OI0A 2HQSA 4IZOA 4B4KA 4DWJA 2ERYA 4TTQA 3IUMA 1OGIA 1FLNA 3ESQA 2OB2A 2N0SA 2NTVA 1JXAA 3HLTA 3OPNA 4QXMA 4X71A 2G04A 1GZDA 2QJOA 4N8SA 4AYWA 3AF2A 4WCFC 1JNXX 2VDPB 3GMSA 4QG7A 4V0LA 3SQXA 2QTMA 1U2GA 3WGTA 5FBRB 1PJ8A 1ATZA 5EYPB 5J5CA 2JFZA 4NHOA 4AZTA 4G8BA 2QYSA 4IP0A 1K88A 2WZBA 1XAGA 5K20A 2UYCA 4LF7B 3HSKA 4A23A 1W36D 3MT0A 1G19A 1KXJA 2WKQA 4FXPA 4ALKA 5HFJA 2DY0A 1DDGA 1RWKA 1L4MA 5BVGB 2CJFA 3OQ6A 1TIBA 4OLAA 1ZJWA 4NC9A 1ULAA 2G63A 2WTEA 3L0SA 1NBAA 1OPRA 2RCNA 4JQSA 4FOOA 3SKYA 4EVIA 4I6GA 2WG2A 3OZRA 4ARZA 1NAHA 1T9HA 4KTVE 1D2GA 1NT2A 2HPHA 8ADHA 3THXB 3LZDA 5ALYA 1ZSYA 3PX3A 5TQ0B 2VG8A 3B8EA 4ALJA 3HCEA 3IP8A 3JSAA 1ESNA 1Q95A 2X8JA 3U5TA 5JAHA 1RT9A 1U3DA 4FCVA 4OL0A 5ALGA 3COJA 2H2DA 1G55A 5G3YA 5EHXA 3NM6B 4I46A 3L01A 3RTCA 1KRXA 2BGJA 2IDZA 4FNMA 3HMKA 4C4RA 1W36B 2BEVB 4ABTA 3EVFA 4OKNA 4IGAA 2ZI4A 3IMKA 3DTTA 3W5HA 1H65A 1TKRA 3X1JA 1NV9A 1E2FA 1ZWKA 5G4KA 3IAFA 2X13A 4R68A 1ZOOA 2J33A 1G98A 4I4NA 1T9DA 2V9CA 3MFQA 4IDQA 3T1OA 3TR0A 2EJCA 3WY9A 4G5YA 3UK7A 3U81A 3G0CA 1DCTA 2PZ8A 3UC9A 3D8UA 2W6OA 1GPNA 3A6FA 1VPTA 1X7HA 3I9V6 4MQ6A 2XW6A 4EHIA 5ALHA 5AQEA 1M6NA 1P61B 4MIKA 2QMEA 4G1CA 3A9WA 4M49A 1T5SA 2P5TB 3HGMA 1PWXA 1VECA 4DLUA 3UF0A 2IU3A 3ILHA 3OQVA 4RZHA 4C1BA 4QOSA 3KEOA 2YTZA 3NHMA 3PX2A 3C15C 4DNPA 4FUQA 1NOIA 2QX8A 1K1EA 4JSYA 3FKSD 3PRKE 1KORA 1DE0A 3TSAA 4CKWB 2PNJA 1UKVY 5FWXB 1RS0A 3IUQA 4KLZA 2PUJA 3IUNA 5AI6A 2J6BA 4EHLA 2HSEA 4WINA 1MAUA 1BHQ1 5FJJA 1DOAA 3W0LB 3STYA 3U44B 4EG3A 1NXWA 4WBXC 1W35A 1ONBA 4G4IA 1M0WA 3CZ9A 2BSQA 1PKXA 1T3HA 1W5SA 3I72A 3LLMA 4KI7A 4Q3BA 4PQRA 5JC8A 3HKDB 1PEDA 1TAQA 1V3QE 5CFRA 2EFEB 2B25A 4L7QA 2I2FA 3KV1A 3R6LA 1SU7A 1KK0A 4Q4LA 3O1LA 4RNCA 5AJWA 4DG9A 1P4RA 5J4KA 1MNQA 1NP6A 1K7FB 4P7BA 5G40A 5BY2A 1IOWA 2FUG1 2ID4A 2ILTA 4PY2A 3R0IA 3C6YA 3CINA 4YJGB 3UV7A 4ER3A 5EXEA 3CS3A 3BDAA 3EFHA 2JPDA 2Q5OA 5CNMA 1XB2A 3FOAA 3T9FA 4ZI7F 1W47A 3ND7A 1BW9B 1PQYA 4MWBA 1QH8A 1WMBA 4IDFA 2XXBA 3E9DA 1JHYA 2G80A 2ETVA 2PYZA 3AZOA 1M1ZA 3JWJA 4YR9A 4DLAA 4HDSB 1PVVA 3CVJA 5KKAA 3OLZA 4C30A 3BERA 3FCUB 1WEKA 4M7PA 5DKFA 5JATA 3KXIA 2DTEA 1AN0A 1JBEA 2L82A 3EMVA 3AM4A 3IH5A 4GR4A 3UY4A 1BDIA 2AMVA 1KY2A 5FQOA 4EOGA 3HABA 3PL1A 1XTBA 3UXYA 2VP3A 1YZFA 4IS3A 4K6FA 4D99A 3O91A 2HOQA 4NV3A 5AIBA 1QK3A 5EJ5A 2HXGA 2IFTA 3K9WA 1V3TA 2B8NA 3ZBQA 3KSRA 4UM9D 4C4ZA 1X1DA 3EIUA 3GROA 3AT1A 3H9JA 1B23P 1ZLXA 4LMBA 4RIEA 3RVLA 1ZN7A 3TPCA 1YDFA 2HSJA 2OCXA 3JY6A 1QRSA 2ZSKA 2IXGA 3GCZA 4G9GA 4E31A 2B34A 1VLQA 2Y68A 4D43A 3UMVA 1TW3A 5KTMA 4EMSA 3QUBA 4BFCA 1EWQA 4KXNA 1W9HA 1P2SA 2QDXA 2QRVA 3I64A 2O06A 3C48A 3R6GA 4WN3A 1A9TA 1C1YA 1JU4A 2N1MA 3TI9A 2AV6A 3CUSA 4D4GA 1TT5B 1WCV1 3LY9A 2AOTA 2NU6A 4NU6A 3EWSA 1ZP6A 4QYIA 4FX2A 1GEGA 4CM7A 1Q2XA 3G0DA 3K1ZA 3RVSA 5J63A 5ITVA 1TF7A 1TW2A 2XSZD 3BORA 3FDZA 1I5EA 3FR8A 3FPSA 4RF2A 4ACAA 4Q7QA 3CW2A 1FX1A 3A31A 2VDVE 3ZWMA 1I2ZA 3O73A 4NBKA 2G70A 2WVAA 2BCEA 3MS2A 4Q6WA 3LP5A 4LDQA 1ZCBA 3FWYA 4GI5A 1EUYA 1ZMXA 421PA 3OIUA 2OHXA 4KQ9A 4M76B 5FKJA 1PTJC 4ESOA 1ZUD1 4E5PA 2HLHA 2OXFA 3GRAA 4UZEA 4BQOA 3VO8A 4WXMA 4C21A 1QJCA 1T5LA 3WP0A 1T0JB 3ZNQA 2CWDA 3GZNB 3NUGA 3BK2A 5H70A 4B6GA 4BC0A 4YV1A 3LO5A 1PLLA 5DXJA 4BZXA 2ZJBA 1PZGA 2ISSD 3QPAA 4IQ4A 2AWOA 3QI7A 4L0MA 6ABPA 4TLLB 2WWTA 2YV2A 4ZOAA 1VBNA 3SNKA 1OYOA 1I51A 2J4DA 3H1BA 4W7IA 1ZC4A 3VKVA 1CUXA 1F6BA 3OZTA 2C9OA 4HWSA 3RYIA 1QV6A 1SIOA 4P8RA 1RLIA 2QMYA 2R5NA 3B6MA 4LNUA 1WUKS 4JT9A 4K46A 4LRXA 4NBTA 3VNRA 4WACA 3WWDA 3SS8A 1I30A 3AHGA 4P58A 5AKHA 3TQHA 1A4RA 4KVFA 3GLHB 1T4DA 3AO0B 1XZNA 2R8ZA 3C14C 4JR2A 3T7EA 1YK1A 4RIGA 5AJXA 4B79A 5IULC 3UG7A 3V8RA 5K09A 2AC7A 4GBMA 2R8RA 3V4PB 4EZEA 5A5DA 2FZ4A 2JIQA 2X2FA 1PFKA 2RIPA 2YL2A 2XHZA 2FPIB 1J21A 2QN9A 4M8IA 4OA5A 5A7FA 4NU8X 2ZJYA 4OYHA 3FUVA 1LBEA 4RMHA 4WOJA 2O8CA 1NBME 4C4OA 3B12A 1EVKA 4YAEA 1VDZA 4P35A 4BYGA 1AGNA 1YS9A 1M1YE 4DV2B 3G8AA 4PONA 2FEWB 2C8JA 1ULSA 4JV5B 3PHGA 4LNHA 2JKYA 3DT9A 3A6ZA 3F97A 3CG4A 3ZE7A 3PR1A 4Z4QA 1DC3A 2VPWA 1ISMA 4OMFG 5LM3A 4A8JC 1R0LA 1RVV1 4MV8A 1ZY2A 3QNMA 4WNAB 2DUNA 3B6JA 2XVMA 4E51A 2C2OA 3PNKA 3QBVA 3JAWA 5ES3A 5J9FA 1XZKA 4J2HA 5AUQA 4E1BA 3WLIA 5KVSA 3V8BA 5AK3A 3G9XA 3KZXA 2XUIA 1ZIYA 3W1WA 2RKOA 5KNDA 2J5QA 3UT5A 5CYPA 1RD4A 2GZHA 3I1FA 4AY2A 4CLEA 1SC6A 5AW2A 4I5EA 4D9IA 1N1GA 3SWWA 4IICA 5B3JA 3SIWA 5ARCA 3IP1A 1EVIA 3W79A 2IQIA 4U6QA 4QYXA 5AXAA 3TQQA 2ZE6A 5TJHA 3ZQKA 1VG8A 2BEWA 5DYTA 1XZHA 4H18A 4OATA 4UNSA 4PSDA 3C39A 3PHHA 1VJRA 4I4TF 5G0UA 3T5GA 5CPFA 2OD7A 2GZ1A 2IZ1A 4LE2A 5ALPA 3C0KA 1R4NB 1BMFD 3CZ5A 4IJMA 3AESB 1PSDA 3DKVA 3OFJA 4U39A 3DZBA 2QRJA 3ZCTA 2ZZKA 1EJBA 2IXEA 2MSLA 1GA4A 3NJRA 1CP3A 1SBNE 1ULUA 3M1LA 4DGQA 1DAPA 4BO3A 2OYRA 4V0OA 2FW6A 4O29A 1ZESA 2NO7A 3K94A 5KHOC 3OEYA 4C20A 3AOGA 10MHA 2WEKA 4N5LA 4B7XA 1I4LD 4QYWA 1GUZA 1UXKA 3I4FA 3OQIA 2W58A 1M2NA 5E6UA 4TUYA 1AY0A 5DYYA 2V7XA 5FOSA 4US2R 5HKKA 1P4SA 4LYGA 3DXXA 1ZD1A 4PAQA 5E38A 4ZANA 4EG6A 1Q1BA 1E4EB 1Q0HA 4AWBA 1P1KA 5FPYA 3MTAA 1SXGA 3IVMA 4P4GA 1EPUA 4Z3DA 1XQXA 1JAIA 3P97A 1I33A 2FLWA 3FPEA 1XLTA 2BI4A 5DTJA 1OFHA 4AL4A 1PQ4A 2I3BA 4BU1A 4ZI7A 1M83A 4KQGA 5IG2A 4RHXA 3IAS6 4B17A 2FPOA 3GVCA 4OX9B 5FB3A 3AINA 1UPFA 4TV8F 2IUEA 3ZDBA 2CV2A 3DL4A 2P79A 2I6FA 3VU3A 2YICA 3UJ7A 3EDMA 1RMTA 1HQYE 2I6XA 5BR7A 2CSUA 3B2NA 2BH2A 2WABA 3H19A 1JX6A 2R7NA 5IEBA 1RPAA 5HMLA 2WUGA 3BJZA 1PJQA 1L9XA 4R7ZA 1TLFA 4I4IA 4IO0A 2YDYA 1A76A 1ZM7A 1PR3A 3QG5A 3ERCA 4TUYF 4DR7B 4DCGA 3F6CA 4JQZA 1Y7LA 3OWHA 1GNPA 4XJSA 3OC0A 2A0FA 3I2FA 1J2UA 1CY1A 1FFCA 1M34E 3FFAA 2Q0SA 2ZIAA 4ZREA 1QHXA 1GJRA 5GIPE 2E87A 3Q7TA 1M66A 3T9DA 2VLBA 3KDPA 1C4KA 7REQA 1Y4ZA 1MEEA 2HJVA 1PGPA 2QZZA 2HHJA 3PDUA 4FYWA 4RZ3A 3UMSA 4L9WA 1XD2A 1SA0A 1SFRA 1TF2A 5LC1A 4Y9SA 3I05A 3VJRA 3W5CA 4MW2A 1QYXA 1N0IA 2GJ8A 3VO9A 3RBXA 1H8HA 1SHJA 2X41A 3RTEA 4PR0A 4C7BA 4G5XA 1P75A 2I7CA 4N40A 4NYIQ 1MZPA 2XT6A 1GCUA 1WMDA 1V8PA 4MSUA 3E82A 1W5AA 3NOQA 5IXSA 4OHKA 5C4IA 3I2IA 2VSOA 1COZA 3ASZA 1TZ2A 3FGOA 3JRWA 3RRBA 4EJ0A 2YN0A 1NKTA 2ACKA 2FSSA 2OBMA 3HMQA 3ODPA 1E32A 3JSXA 1FNCA 4AN0A 4L6IA 3H9EO 3MINA 1FY2A 3ND6A 4JYPA 3CRRA 3IT3A 1IY9A 1XTPA 3G02A 3DLBA 4JT2A 1T9CA 4L8GA 1NJFA 1CQWA 2CLSA 2FZWA 2OYSA 1CZLA 1Z0DA 4MQ4A 2QAGC 3EA0A 3UUGA 2JGRA 2PYIA 4MYSA 1V9CA 2GEJA 2VSQA 1PNOA 1CZOA 3N2KA 3OCWA 4ZQGA 2IYQA 2AMLA 5AP9A 1LSJA 2BKXA 5BN3A 2QP9X 1UPXA 3BFKA 3DEHA 1E1RD 4HFNA 2YVKA 3W8EA 5EHZA 3R7LA 2BLNA 4BFXA 3H2JA 1WTAA 2YCBA 4RFSB 4M98A 4A0HA 3WICA 5K8IA 4QC2A 2RHOA 2DETA 3K9LA 1AXEA 2QTFA 3IUJA 4LECA 4OPMA 4F06A 2PMKA 4JUFA 4B3JA 3OQHA 5EL0A 1G7TA 3MWDB 1PS0A 2ZB4A 5CUQA 3GUVA 2ZCVA 4QPDA 3DZHA 4QDTA 2B1GA 3B1ZA 1S2GA 1O96A 1Z2OX 2CLHB 5JE8A 4E1VA 4Z9AA 1YB7A 4QDKA 1Y98A 4R2KA 2WJVA 2P30A 2QR2A 1C5KA 4Q34A 1SOUA 1VE1A 4G09A 2RHCA 4AJEA 2VJMA 4DTIA 1JBKA 5SY9A 3DMNA 1A4UA 1EFDN 2SKDA 2WWXA 1YMUA 2YWGA 3GC6A 3L82B 4LV5B 3V33A 3ZHTA 2WQ6A 2XI4A 1VFNA 1H1TA 2BONA 4AULA 3CGGA 2AF3C 3PL5A 4JC8A 5HP4A 2SICE 4DY6A 2WM8A 4Q4HA 2TMYA 4WK2B 2AE1A 1NKSA 4HNRA 4N12A 4PO1A 1XQYA 4K6GA 4UTNA 1KJNA 2QMOA 3PIIA 3PUKA 3R6TA 4WUVA 3RGGA 4AX4A 1R27A 1GCGA 2BZGA 2Y67A 2EEPA 3FCYA 4FK8A 4KQKA 2Y1OA 3KJEA 1OXUA 2ZB8A 3I32A 3LC0A 3O3CA 4TROA 2Y1GA 2OBYA 3BTSA 4G5GA 3Q8MA 1E6MA 1X8XA 3G89A 4UE3S 3OCXA 3LKBA 2JI8A 4YAFA 3RHFA 3VMMA 4C3ZA 5AW4A 5JO9A 2V3CC 2HT1A 2DKFA 4B3RB 2GCEA 4CKEB 3Q9NA 3EVZA 2FE1A 4HYEA 3TW8A 5I45A 3N8HA 1SKAA 4MRPA 1O94D 1DAKA 1NBWB 5ALIA 4RMJA 1QF7A 1I3NA 2H18A 4JUIA 4KFUA 5KCZA 4D26A 2WA1A 2BMEA 1LI7A 2O05A 3FA2A 3HY4A 4UHEA 3RUAA 1Q0QA 3ZE8A 4B75A 1GTZA 3QKRB 4XLLA 3N7TA 1IBKB 2GF0A 2C1EA 1VMKA 5CDSA 5BVHA 1U5AA 2A33A 2XMGA 5FBZA 2GT1A 1U3GA 2AQHA 4RDHA 4M0MA 1E77A 1G8GA 1ZI6A 2LIVA 3EULA 3F5SA 1BD3A 4Q24A 3SC2A 1U2SA 3NDBB 2VJAA 1ZN8A 1IN6A 2Q6VA 5B4UA 3OC6A 5CA0F 2FSVA 4F46A 3HRIA 1V5WA 4EKYA 1I10A 4A8HA 3AEYA 5G3ZA 2D0IA 3P9CA 1JG7A 2WKSA 3VPAA 2J0VA 4RK0A 4H7IA 2GVNA 3WB9A 5KCMA 1PLKA 5LQRA 1W34A 4DA4A 2J67A 1XKLA 3ILXA 4LPSA 5AVQA 3ZX5A 4P4TA 1LRKA 4L28A 1C1XA 4EW2A 1DBIA 3H7IA 2J87A 1FXWA 1EGHA 4DGSA 1QWOA 3ENKA 3EEFA 3K5HA 4L5JA 3S2ZA 3WNBA 3DE2X 3PDWA 3RIYA 5KNDH 3OT4A 4POOA 1ZU5A 2NNLD 4CRWB 4BNHA 4AN1A 1DAFA 3D2CA 1WV0A 4X6XA 4OJYA 3U56A 3FFXA 4PNZA 2R1VB 4Z53A 2DKOA 1OIXA 1PYOA 2OECA 2QORA 2QX7A 4BVBA 3EA5A 5CFOA 1QZ3A 4D8TA 4QJ4A 5ICGA 1G2IA 1MX9A 3E8MA 1F7UA 2X6RA 1IAQA 5LZ5A 5IHPA 1IXKA 4WJKB 2ZAGA 2P2SA 3D5QA 4HMQA 3OM1A 1MO5A 4KUGA 4NV1A 1N9ZA 2H1IA 2JLBA 5EJEA 1SELA 3AUKA 4ZICA 5G02A 1OUMA 3LA8A 4QDZA 2FW9A 3OF3A 4KODA 4X97A 3RC9A 4EITA 3GFTA 3KVRA 4NG4A 4KB5A 2VRCA 1JFRA 3HBMA 1W4AA 4Q21A 4YRKA 3MBOA 2I4MA 4I9FA 5AI4A 2YXLA 4AX8A 3I2JA 4XTCS 2AEJA 5HKBA 5GGXA 1QQTA 1FLVA 1WVIA 5I9MA 3PFNA 1DKOA 1HE3A 3CSDA 2X76A 3ZH9B 4YUZA 2VBFA 4XWGA 1K7EB 4KRFA 1NM5A 1VA4A 3DHWC 4QJBA 3WGZA 2H08A 1FNBA 2AK2A 2YXNA 1JEQA 4FMCB 5CGQB 1GRCA 5BR1A 2J3DA 3A6HA 4QT0A 3KETA 3ACDA 4MV4A 1BA2A 1XAHA 2DQSA 3A6KA 1OGYA 3GEBA 3TM4A 2WJYA 3C6KA 4FQ5A 4OYYA 3VYSB 4NAVA 4U63A 3KU1A 1JKFA 2VH2A 1IHDA 2AR7A 3CB2A 3X1WA 2YWRA 1RKUA 3H9BA 4HPWA 5JIBA 1UXIA 4C78A 2PTHA 2RD2A 2C4NA 2I6SA 1KSJA 1CD5A 2VDOB 3HBLA 5EPEA 3WE7A 4K8RB 2GN9A 2IJGX 1FFSA 1VG1A 2ZR7A 3QBDA 2B7CA 2QW8A 3D7LA 4TZTA 1ORTA 3MTDA 1K06A 3LKDA 1AQJA 3MEQA 3DO5A 4K5QA 1K5PA 1UOQA 3FLMA 4FJ1A 3AHEA 4EUKA 5BT8A 3V4FA 1TVKB 4WEQA 1XZDA 2O6HA 4HK4A 5JS8A 1OKKA 2BZ1A 2TS1A 1BS2A 3DPSA 4L07A 4KFCA 3ENNA 3TNJA 3BE8A 5IH7A 4XXHA 3I2KA 1WXFA 1UFRA 2C9YA 1BU5A 2RG7A 4D5EA 2ZIZA 3CCCA 1Y3BE 4OQPA 3L05A 4B34A 3D0RA 4PR3A 1Z7WA 4EYQA 4CG1A 4RH1A 2Y4NA 1OU4A 4KQWA 4V0RA 2RKWA 4XIYA 5D2CA 3RRZA 4TXNA 1XCLA 3E8SA 3OZDA 1GU0A 4QJIA 4GMFA 1XPJA 4IHAA 2Q8QA 1ULBA 3BRWD 3MMSA 4NDAA 4NL4H 4HYTA 5AVKA 4ZZ1A 4BXOB 4G23A 2UYGA 2RGEA 4JIGA 3TJZA 2VS1A 4LXUA 1O9BA 1ZGGA 3NAZA 5B1DA 4BQIA 1HZJA 1P0FA 3VZCA 1XUOA 4DSZA 4C2UA 2NO0A 3A37A 4Z6KA 4I2VA 5DWQA 3Q7EA 4U2KA 1ULTA 1XMPA 1J06A 2GEKA 3I1YA 5M2QA 2XB6A 1R10A 2AHOA 4WH0A 2PSDA 2CDAA 4ZVTA 3LC7O 5I9TA 3GB9A 4O02B 4HH4A 1G7RA 3AEZA 1A96A 1G1MA 2PM8A 4RIHA 5K01A 2W2LA 5CVJA 4D0SA 2JRCA 3KVVA 3NJ8A 4MPJA 1K92A 1DG9A 3UOAB 2ODPA 4W6ZA 3DM5A 1NJ6A 4B3SB 1KS9A 5I7SA 4OXXA 3SHQA 1WB5A 2NPOA 1KYQA 1TPZA 2PAFA 3JQAB 3NDJA 1ZO8A 2VSYA 5F4BA 4CETA 3ISTA 4OSEA 4O33A 3OM9A 2R79A 1MFPA 1X1RA 3QU7A 1Z08A 4OLHA 2C7VA 3N05A 4PEVA 5JW6A 3W2IA 1L7XA 1ZK0A 1RWQA 5HXAA 2H51A 2XGGA 4G5QA 1QG4A 3OTHA 1JR3E 4JELA 2OZLB 4AK9A 4KLNA 1NUAA 1ETUA 3DCYA 3CO0S 2OORA 3K6KA 2NSYA 1K68A 4E7OA 3M49A 2OA0A 3WYDA 4HX2A 3DOJA 2A1TR 5K0CA 4AUKA 4XGQA 4D4LA 1TCUA 2JI9A 3HN2A 4LYYA 1J2TA 3WQSB 4RTSA 2XVXA 4CN8A 2QNRA 3UICA 1DAEA 3V7FA 2QSYA 2ONZA 2JFOA 4Q00A 3G7UA 1A9ZA 5U9CA 5TMDA 4R5HA 1GA6A 1B14A 1UJBA 4F1JA 4MUMA 1MOPA 5BUQA 3IDFA 2GXUA 3TAXA 1R0KA 2J6HA 1KDZA 1P62B 2RGUA 3OJEA 3WKEA 3ACBA 5C8YB 1Z2DA 1Z6TA 4TWIA 2P2DA 1YJBA 4UM5A 1NVVR 2DWCA 4TSFD 3V4LA 2HWWA 3W4JA 2YZMA 8OHMA 5AKGA 4CF7A 4EARA 4FDAA 4LFBB 4BE7B 4QGAA 4JSRA 3DXYA 5BYAA 4IV0A 3WA7A 3AUXA 1QX3A 1QK5A 2I80A 3FTCA 4F6CA 1L2TA 2HQRA 4RLFA 2GNOA 3JQGB 3N2GA 4WZAB 4OHZA 4B76A 1RQRA 2GYYA 2PIDA 1GZHB 1RRVA 2ZAIA 2B1RA 1DINA 4Q6BA 1E0DA 3ZVKA 3OU2A 5DYWA 2A9OA 3DZIA 2VDNB 5P21A 1E9RA 1LBHA 4PO3X 1HTTA 2QTLA 2WFAA 2VWHA 4QULA 3TG2A 4TMYA 2HW8A 5DCYA 3GHYA 4H6XA 4CM9D 3NTRA 3B8HA 3SQNA 1JAZA 1XKTA 2L19A 3QNWA 3IVAA 3P96A 4MI1A 1VJDA 2IH5A 4P0QB 3GAZA 1BKDR 4QVKA 1XO1A 3DVRX 3FHJA 4Q4CA 1PHPA 1E61A 2GM3A 1GL3A 5MN6A 4C5CA 1JSCA 4NJMA 1NJSA 3AY6A 4I99A 4EQ6A 2ZEJA 5HCIA 3Q10A 1CVLA 1G20A 1NNLA 2Z0MA 3EBPA 5EZQA 2LWIA 3N2YA 3V8VA 3ZD8A 4JDUA 4YMGA 1Z7BA 2E85A 2FWJA 2GN4A 2GXSA 1HDOA 3AHJA 1A7UA 1P9NA 2ODEA 4KXUA 1XV5A 4Y30A 2XR1A 3OD5A 1CZRA 1P4HA 3BSYA 3DJYA 3OJXA 2VSNA 1DSSG 3SLRA 3TWOA 3M5DA 5DGHA 3B51X 1QNFA 2BFDA 5H4HA 2OUIA 3GNQA 4GYKA 3PEUA 2O2IA 2W22A 2XCUA 3HYCA 3MLBA 4JZYA 1SIBE 1Y8QA 3WGMA 4IJWA 1GTSA 2PGNA 5DGIA 3N58A 5AOVA 1K8RA 3B52X 2J3EA 4C7VA 1C0EA 2XNHA 5CLQA 1QGDA 1LEHA 2A4MA 4JEMA 1THMA 3UB3A 5IDXA 3LNCA 2DG2A 5AVSA 2J59A 2OCAA 1NN0A 4EHKA 5KINB 3HL4A 1FNMA 1M2HA 2C8LA 1B8UA 4L75A 4RJTA 3OQOA 3G1UA 1DAHA 3M4XA 3OQIB 2PH3A 5B1HA 2W11A 3GJ6A 5CD1A 1KTVA 5FADA 4D9MA 3B82A 4CTNA 4KXVA 3HFSA 2Q9AA 1H1LB 2JIZD 4FKZA 4Z0NA 2EX1A 3ZUGA 3FTQA 4CIDA 3GOQA 5AHKA 1DX6A 5J2UA 4UDYX 4QQ8A 1K8ZB 5TC4A 4BJHB 5LDDC 2ISQA 1LPBB 1T2UA 2AFHA 2J5RA 2NV0A 2ERCA 1NLYA 1JJIA 1CDDA 3LX6A 1T15A 2XOKD 4IOJA 4AG6A 2MOKA 2QTVA 4L22A 2J30A 4D92A 3HRKA 3S2GA 3ZIDA 4ALNA 1CZUA 4UU7A 2XCOA 4KSYA 4CHGA 1K0UA 5KC8A 4XSVA 2YJNA 1ISPA 4YH1A 3X3HA 4KR6A 3CKLA 1X9IA 3MCTA 1TQ8A 4C29A 3NTLA 2PUWA 5BUZA 4AKTA 2JS7A 3PNQA 2TRSB 4I4TA 5ADWA 1YRWA 3ACCA 3IA2A 4RANA 4XUDA 4JYZA 2R6CA 1CJCA 4EUNA 1QJ4A 3JQPA 4EVRA 3QNUA 4MO9A 4DMFA 1T9ZA 3JQEA 3GPIA 2AYZA 3F74A 1J8YF 5GONF 4WNCA 3WSWA 3ZWQA 4DWVA 4LYHA 2P78A 2QJTA 1FS4A 4JFRA 5T41A 3KCNA 1FFGA 1NSYA 1W88B 5ED4A 1FFHA 2UKDA 3R3SA 4FCCA 3ZJ5A 1F8FA 1RE0A 2BM9A 4HEHA 4D9EA 4PFSA 3QKSB 1UBCA 1VPDA 4L7VA 3DAPA 1JQJC 1YI8A 4JDPA 1Z2EA 3RYHB 3DKPA 4XSGA 1BVUA 1DRWA 1OKKD 2UVPB 3JZFA 3WYCA 7MDHA 5AW1A 3SEAA 3OO1A 2XUKA 3OQ1A 5HA5A 3TLEA 4ZO8A 3W6OA 3ADDA 2GZRA 4EAQA 3I9JA 2GF9A 1XMJA 1ZOPA 5DHFA 5D84A 3D7KA 1FX0A 3MYYA 1U8YA 2WY2D 3NDIA 4RPCA 3EZLA 2ZYUX 2FW7A 2ZI5A 3W4IA 1LWNA 2EX0A 4RZSA 1RM0A 3FUCA 1UBSB 3OF2A 5EEHA 1XCGB 1ZW6A 5KMGB 2HV9A 1HT2E 2ZVDA 3L6RA 3IR7A 4HMOA 4HYQA 5EQFA 5BN1A 5K4HA 4QVIA 2EQ5A 1X77A 2HGSA 1R4MA 3QU4A 4MA0A 2VZLA 1N2HA 3EGIA 2I2BA 3PE3A 4NH4A 4FMCF 3ZZ0A 2PKQO 5K3CA 3D1JA 3QF7A 4EEKA 1NHGA 3HJUA 1U5BA 3LUDA 2WG0A 3MT7A 4LJYA 1D1TA 1DKQA 2FOXA 1M9NA 1T0HB 2RFLA 3OLXA 2EX4A 4UUPA 4I3HA 2W6NA 1SGWA 2ZFUA 3IOEA 4FILA 4PZEA 3WLKX 1JAYA 3NBAA 4MW9A 5ALQA 4IZHA 3HJFA 2C4MA 2X15A 4P1ZA 5EJMA 1FTQA 2RG1A 2YW9A 2JLQA 4J4TA 1FYXA 2UVPA 2QLTA 1NGSA 5CJJA 2XMQA 3KB6A 5JBNA 2Z8YA 3O7WA 2BZSA 1VCHA 1U7WA 1C30A 3A1NA 2FFHA 2QRVB 1ISIA 2GVDC 4LCJA 4EX7A 1ZIOA 3D3EA 1NMYA 4GLOA 4IDGA 1J70A 4YCMA 3IIIA 4LC9A 3ASUA 5DT2A 1AN9A 3A1SA 3N6VA 4IDDA 3KHTA 5IJ9B 4A10A 2PRYA 1UJCA 1WNFA 1QH1A 4TTIA 1JEQB 1JB1A 5F3WB 3PUVA 3O8BA 4DUYB 4BN0A 4G86A 1YUNA 1VLZA 3UKOA 1RWWA 1U2PA 4OB8A 1S3IA 3KPWA 4W99A 2JDIA 3E61A 1YJ5A 3GZJA 3VOBA 1RXIA 2X0FA 3DTNA 4XFDA 5COAA 1AMNA 1EHYA 1SBYA 1U7UA 3UHOA 3MJTA 5MFPA 3GEMA 3GD7A 1T24A 1NA5A 2Z9DA 1A8UA 1UIRA 2V45A 3ABQB 3IMEA 3RVMA 2ADMA 3AVXA 2NO9A 1QIFA 2Q2WA 3V4OA 4RCYA 1J2RA 4KBGA 3S28A 2UAGA 3H2KA 1NX6A 2GK3A 3TRJA 4LSZA 1LCIA 1I01A 3QVMA 3A1TA 4CR7A 4W8HA 4QM7A 1WBDA 2MTBA 4NE7A 3UNXA 1U4OA 2ZI3A 2BGWA 1D1PA 1UZAA 1QO0D 3GCDA 1A4IA 2WBLC 3GCXA 4F2PA 1GITA 4KO8A 4GDFA 1GT91 4U9UA 3O92A 3AETB 2O1XA 3N8GA 2B1IA 5AH0A 2P3SA 5CYGA 5DX0A 5IWAB 1PR9A 2Q28A 3L7MA 4CIXA 5ERXA 3A6DA 2QD3A 6PFKA 3IKJA 3KKZA 4GPZA 2HLNA 4LBZA 4OFXA 5A06A 4CIAA 5LR6A 5AR1A 4YP6A 1OB5A 1NFRA 1PLJA 2Q5IA 1GAXA 4FLEA 2HADA 2I67A 3HCOA 3GLRA 5JASA 1WUIS 1TUBA 4RHUA 1LBSA 1R15A 3RAPR 4EY6A 821PA 2X77A 1AQ6A 3NCTA 4W9MC 4G0WA 1EQ2A 4GO1A 2P1DA 1L4FA 3U7FB 4GGOA 1HYEA 5F2OA 5LYJF 3RSSA 4D74A 1P9LA 2O2DA 3CCFA 5C2JB 3KYJB 3VGPA 1VDMA 2V7PA 1I2DA 4CUJA 1Y6GA 3O75A 2IYWA 1YGYA 2XF2A 2G4VA 3AJAA 3KEQA 1D6NA 4HMPA 3WRWA 5BWCA 1L8OA 1NRJB 3TDMA 3KEGA 3GJZA 4YQFA 5KQSA 3IKLA 3DNFA 3Q3VA 4XX0B 4MDYA 4XUCA 4HBZA 4P6VF 1TQHA 3TLYA 3V80A 3AF5A 2QAGA 3CT4A 4IMJB 5J2UB 2VHVA 4ER7A 1MJGM 2RHBA 3Q1KA 3UJPA 1XTUA 2DSTA 1KI4A 2P4HX 2QVLA 4BMOB 4ZHSA 2LW7A 1VIAA 5EP2A 2NSJA 1KK2A 1TZCA 3T4EA 1XRJA 3WWOA 4U0KA 4HDRA 3SGLA 4EO7A 3IQDB 1C0IA 3KKMA 2G8NA 3KJGA 4YCSA 2GKSA 5DXAA 3QI2A 4JX8A 1YNSA 4J43A 3TW8B 3JPWA 1VL6A 1UWCA 2G06A 3LVFO 4OI2A 2HCBA 4ILKA 4LF5B 4AZ3B 3OLWA 4O4JB 3B5IA 1LDGA 4H0FA 1CLUA 1A8HA 1SHUX 3D8NA 4OXKA 3E58A 2LCQA 3VM6A 2M32A 1ONPA 2FMIA 5D7BA 1Z63A 2N1BA 2R2AA 1G20E 5AKKA 4MGEA 3PJGA 2Q1UA 3R6DA 3WMEA 1L5RA 1ZHHA 5HEKA 2G5CA 4EMUA 4BECA 1VHQA 1WF6A 1DO0A 4EKDA 4F3YA 5DN9A 3ONDA 1S3SA 3MGCA 4HNGA 5FPQA 1GTVA 4NJMB 2JA2A 1RMYA 1I4WA 1KWGA 3CM0A 2OHHA 3NJ4A 2GEFA 1L8QA 1OYYA 5BW5A 3LRTA 1USIA 4CGZA 3QHPA 4ZVQA 3PE6A 5C7OO 4G01B 2WP0A 4RQTA 5AM3A 3EX7C 1QZTA 2J3LA 2KM1A 3A10A 1FMFA 1MBZA 3GEHA 4RY8A 4AMBA 1OBVA 3A14A 2R84A 1ZIDA 3VVCA 3OQBA 1S7GA 4WV3A 4ZU6X 3VHLB 5TNXA 3NW9A 2QL5A 4C6SA 2G5PA 4HY3A 4O1MA 4E5VA 3FZNA 1TEVA 1PJSA 3GN2A 1UPAA 2FJ0A 2O2XA 5IYZB 3GDHA 4XWAA 1UT8A 2PG3A 2QPAA 4INAA 4N3NA 1ZMOA 4PYMA 1ZL0A 2AXQA 1SQ5A 2IYNA 5CHYA 4EKIA 3N3AC 1O58A 3TLMA 3ECSA 3TE6A 4WBNB 1VPVA 4G8DA 1KEKA 4F3TA 5CNIA 1LNZA 1GPLA 4FKBA 4E5NA 5KOIA 2ZVQX 1C81A 4G81A 4X1KB 5FBLB 5DZSA 3AEKA 3NHRA 2ZDGA 4JJAA 3V3KA 4AUNA 4CLOB 5BV1A 1JA9A 2VZ0A 1QKJA 3MJEA 4F3KA 1LUAA 4MR9A 4DIKA 3QLEA 2C20A 3ZOKA 4FB4A 1AUPA 3G8BA 1K4KA 4K9RA 3NHPA 3HP4A 5E7IA 5IABA 4LQCA 1E0AA 2X7HA 2JC3A 4A3SA 1KO8A 1NPTO 3FIJA 4HAYA 4FXOA 2P68A 3O8QA 3SOPA 1H0HA 4RQAA 1F1BA 1XCJA 2A7QA 4ZYWA 1TQ6A 2EP5A 1S89A 3TCKA 4CNQA 2OKCA 1Q91A 1RPJA 2O57A 3CO5A 4UU8A 1MB3A 3BCUA 3EUWA 5ENVA 2ZIEA 5KYUB 3H2IA 3SJUA 1ZGAA 4X65B 2VKTA 1P1IA 4F7DA 1JDBC 4MAFA 5LZ9A 2V7TA 3W9YA 2GJSA 1E96A 2YINC 4PV7A 1KEUA 4WBSA 3A9VA 2C84A 5HS6A 1FVFA 2FZCA 3HSYA 4ND2A 2Q62A 3M6LA 1N2CA 4MQMA 5EE0A 4OMDA 2GHRA 3L8MA 3IPLA 1IVYA 4N5NA 4R2HA 5IZCC 2XT9A 3AF6A 1KR5A 4BP9A 1WU7A 5AW8A 5EJ8A 1VP3A 1QO9A 4MS3A 2H2HA 4RE6A 2H0RA 3P52A 2O8CB 4P3XA 3ABRB 4MV6A 4DSAA 4BVKA 2RHHA 5J4YA 4XD2A 4J8PA 1U3UA 3LO8A 5CCBA 1OFGA 3QEOA 4JGIA 3K0CA 1FXSA 2ECKA 3H1PA 4DYVA 1WHTB 2RI1A 3P26A 4IL5A 1JR6A 2FPUA 3H5OA 3N6XA 1IUOA 4R1TA 5KAMA 2ZXUA 3O3MB 1HM5A 3WL3A 2FV8A 2L17A 4WKGA 2CL0X 2AVNA 2Z95A 2PBLA 3VR2A 1HRDA 1ZW1A 3UJNA 4Q9IA 1LY1A 5F33A 3T0GA 4BE4A 1T2CA 1YL5A 2YC4C 2J3QA 3LCUA 3PFHA 3CEMA 4CR8A 3ETNA