4EGGA

Computationally designed self-assembling tetrahedron protein, t310
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
188
structure length
188
Chain Sequence
b'MTEKEKMLAEKWYDANFDQTLINERLRAKVICFALNHTNPVATMMRKVLIDALFQTTTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acetyltransferase SACOL2570
publication title Computational design of self-assembling protein nanomaterials with atomic level accuracy.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
total genus 73
structure length 188
sequence length 188
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.-:
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12464 Mac Maltose acetyltransferase
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4eggA00
1KK5A 3MQGA 4ISXA 3GVDA 2FKOA 4K6RA 3FSYA 2V0LA 2ICXA 1KGQA 1G95A 1THJA 4IHGA 3SRTA 1QRGA 1KQAA 2V0JA 1YP4A 2OEGA 1HV9A 4G87A 1MRLA 2RIJA 1QRFA 4G3SA 3VBPA 5L6SA 3MQHA 3FOQA 4E1KA 3EEVA 4HURA 3DHOA 3GUEA 4EA9A 3D8VA 4KPXA 3TISA 3VBJA 3VBKA 3R3RA 1XATA 4R7PA 2JF3A 1KK4A 3BFPA 3CJ8A 3P1BA 2QIAA 4EAAA 4N69A 3R5CA 2ICYA 2WLFA 1QQ0A 1V67A 5F42A 1HM0A 3BXYA 4MZUA 3VNPA 2JF2A 2VHEA 2WLCA 1KHRA 2IU9A 3SPTA 1J2ZA 1KRUA 4HZDA 1FXJA 3R5AA 1HM8A 3BRKX 2P2OA 4M98A 5DEPA 2AQ9A 4N27A 4HZCA 4M28A 4M99A 2W0WA 2WLEA 1HM9A 3R3IA 4EGGA 4N6BA 1FWYA 3PMOA 2GGQA 3EG4A 4M9CA 3P47A 3ST8A 4E75A 3D98A 2V0IA 3EH0A 3C8VA 2TDTA 3F1XA 4H7OA 4E79A 4IHFA 5L6VA 3FSXA 5DG3A 2WLDA 1MR7A 3GOSA 3OTMA 3R8YA 4EQYA 3TV0A 3I3AA 1OCXA 1S80A 1XHDA 3OU9A 4KQLA 4N6AA 3IXCA 3ECTA 3MC4A 2WLGA 4IHHA 3IGJA 3TIOA 3R2WA 3R5BA 3FS8A 4HCQA 4J18A 2QIVX 4KNXA 5U2KA 4EA7A 2IC7A 2IUAA 3I3XA 5E3QA 2OI7A 3FWWA 3VBNA 2NPOA 3V4EA 3FSBA 5E3PA 3R0SA 4AC3A 3KWDA 3OUPA 1MR9A 4HUSA 3HSQA 3TK8A 5AFUU 3BSWA 2IU8A 1SSQA 2V0HA 4MYOA 3BSSA 1SSTA 5ADXV 3HJJA 3VBMA 4EABA 3DJ4A 4M2BA 3TDTA 2I5KA 2VD4A 4KNRA 3R5DA 1KRVA 3R1WA 2XATA 5E3RA 2Q4JA 4FCEA 4AAWA 2V0KA 4G3PA 5AFUV 2QKXA 3DK5A 1KGTA 4AA7A 1Z90A 2W0VA 3FTTA 3VBIA 1QRMA 2OI6A 3TWDA 3OW5A 4M2AA 1G97A 1T3DA 3NZ2A 1SSMA 4J09A 4EA8A 3JQYA 1QREA 5ADXU 3T57A 3BSYA 4KPZA 1YP3A 4E6TA 1V3WA 1LXAA 2OI5A 3KWEA 3KWCA 2OEFA 4R37A 4DCLA 3OTZA 4MFGA 1KRRA 3Q1XA 1YP2A 1KK6A 2GGOA 4E6UA 4G3QA 3FSCA 5DEMA 4R36A 1TDTA 1QRLA 3VBLA
chains in the Genus database with same CATH superfamily
1KK5A 3MQGA 4ISXA 3GVDA 2FKOA 4K6RA 3FSYA 2V0LA 2ICXA 1KGQA 1G95A 1THJA 4IHGA 3SRTA 1QRGA 1KQAA 2V0JA 1YP4A 2OEGA 1HV9A 4G87A 1MRLA 2RIJA 1QRFA 4G3SA 3VBPA 5L6SA 3MQHA 3FOQA 4E1KA 3EEVA 4HURA 3DHOA 3GUEA 4EA9A 3D8VA 4KPXA 3TISA 3VBJA 3VBKA 3R3RA 1XATA 4R7PA 2JF3A 1KK4A 3BFPA 3CJ8A 3P1BA 2QIAA 4EAAA 4N69A 3R5CA 2ICYA 2WLFA 1QQ0A 1N4IA 1V67A 5F42A 1HM0A 3BXYA 3GQ8A 4MZUA 3OH2A 3VNPA 2JF2A 3SUCA 2VHEA 1M8NA 1KHRA 2IU9A 2WLCA 1J2ZA 1KRUA 3SPTA 4HZDA 1FXJA 3R5AA 1HM8A 3BRKX 2P2OA 4M98A 5DEPA 2AQ9A 4N27A 4HZCA 4M28A 4M99A 2W0WA 2WLEA 1HM9A 3R3IA 4EGGA 4N6BA 1FWYA 3PMOA 2GGQA 3EG4A 4M9CA 3P47A 3ST8A 3OH3A 4E75A 3D98A 2V0IA 3EH0A 3C8VA 2TDTA 3F1XA 4H7OA 4E79A 4IHFA 5L6VA 3FSXA 5DG3A 2WLDA 1MR7A 3GOSA 3OTMA 3R8YA 4EQYA 3TV0A 3I3AA 1OCXA 1S80A 1XHDA 3OU9A 4KQLA 4N6AA 3IXCA 3ECTA 3MC4A 2WLGA 3OGZA 3IGJA 4IHHA 3TIOA 3R2WA 3R5BA 3FS8A 4HCQA 4J18A 2QIVX 4KNXA 5U2KA 4EA7A 2IC7A 2IUAA 3I3XA 5E3QA 2OI7A 3FWWA 3VBNA 2NPOA 3V4EA 3FSBA 3GQ7A 3R0SA 5E3PA 4AC3A 3KWDA 3OUPA 1MR9A 4HUSA 3HSQA 3TK8A 3OH0A 5AFUU 3BSWA 2IU8A 1SSQA 2V0HA 4MYOA 3BSSA 1SSTA 5ADXV 3HJJA 3VBMA 3OH4A 3DJ4A 4M2BA 1Z2FA 4EABA 3TDTA 2I5KA 2VD4A 4KNRA 3R5DA 1KRVA 3R1WA 2XATA 3GQAA 2Q4JA 4FCEA 5E3RA 4AAWA 2V0KA 4G3PA 5AFUV 2QKXA 3DK5A 1KGTA 4AA7A 1L0SA 1Z90A 2W0VA 3FTTA 3OH1A 1QRMA 2OI6A 3TWDA 3VBIA 3OW5A 4M2AA 1G97A 1T3DA 3NZ2A 1SSMA 4J09A 4EA8A 1EWWA 3JQYA 1QREA 5ADXU 3T57A 3BSYA 4KPZA 1YP3A 4E6TA 1V3WA 1LXAA 2OI5A 3KWEA 3KWCA 2OEFA 4R37A 4DCLA 3OTZA 4MFGA 1KRRA 3GQ9A 3Q1XA 1YP2A 1KK6A 2GGOA 4E6UA 4G3QA 3FSCA 5DEMA 4R36A 1TDTA 1QRLA 3VBLA
chains in the Genus database with same CATH topology
1KK5A 3MQGA 4ISXA 3GVDA 2FKOA 4K6RA 3FSYA 2V0LA 2ICXA 1KGQA 1G95A 1THJA 4IHGA 3SRTA 1QRGA 1KQAA 2V0JA 1YP4A 2OEGA 1HV9A 4G87A 1MRLA 2RIJA 1QRFA 4G3SA 3VBPA 5L6SA 3MQHA 3FOQA 4E1KA 3EEVA 4HURA 3DHOA 3GUEA 4EA9A 3D8VA 4KPXA 3TISA 3VBJA 3VBKA 3R3RA 1XATA 4R7PA 2JF3A 1KK4A 3BFPA 3CJ8A 3P1BA 2QIAA 4EAAA 4N69A 3R5CA 2ICYA 2WLFA 1QQ0A 1V67A 5F42A 1HM0A 3BXYA 4MZUA 3VNPA 2JF2A 2VHEA 2WLCA 1KHRA 2IU9A 3SPTA 1J2ZA 1KRUA 4HZDA 1FXJA 3R5AA 1HM8A 3BRKX 2P2OA 4M98A 5DEPA 2AQ9A 4N27A 4HZCA 4M28A 4M99A 2W0WA 2WLEA 1HM9A 3R3IA 4EGGA 4N6BA 1FWYA 3PMOA 2GGQA 3EG4A 4M9CA 3P47A 3ST8A 4E75A 3D98A 2V0IA 3EH0A 3C8VA 2TDTA 3F1XA 4H7OA 4E79A 4IHFA 5L6VA 3FSXA 5DG3A 2WLDA 1MR7A 3GOSA 3OTMA 3R8YA 4EQYA 3TV0A 3I3AA 1OCXA 1S80A 1XHDA 3OU9A 4KQLA 4N6AA 3IXCA 3ECTA 3MC4A 2WLGA 4IHHA 3IGJA 3TIOA 3R2WA 3R5BA 3FS8A 4HCQA 4J18A 2QIVX 4KNXA 5U2KA 4EA7A 2IC7A 2IUAA 3I3XA 5E3QA 2OI7A 3FWWA 3VBNA 2NPOA 3V4EA 3FSBA 5E3PA 3R0SA 4AC3A 3KWDA 3OUPA 1MR9A 4HUSA 3HSQA 3TK8A 5AFUU 3BSWA 2IU8A 1SSQA 2V0HA 4MYOA 3BSSA 1SSTA 5ADXV 3HJJA 3VBMA 4EABA 3DJ4A 4M2BA 3TDTA 2I5KA 2VD4A 4KNRA 3R5DA 1KRVA 3R1WA 2XATA 5E3RA 2Q4JA 4FCEA 4AAWA 2V0KA 4G3PA 5AFUV 2QKXA 3DK5A 1KGTA 4AA7A 1Z90A 2W0VA 3FTTA 3VBIA 1QRMA 2OI6A 3TWDA 3OW5A 4M2AA 1G97A 1T3DA 3NZ2A 1SSMA 4J09A 4EA8A 3JQYA 1QREA 5ADXU 3T57A 3BSYA 4KPZA 1YP3A 4E6TA 1V3WA 1LXAA 2OI5A 3KWEA 3KWCA 2OEFA 4R37A 4DCLA 3OTZA 4MFGA 1KRRA 3Q1XA 1YP2A 1KK6A 2GGOA 4E6UA 4G3QA 3FSCA 5DEMA 4R36A 1TDTA 1QRLA 3VBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KK5 A;  3MQG A;  4ISX A;  3GVD A;  2FKO A;  4K6R A;  3FSY A;  2V0L A;  2ICX A;  1KGQ A;  1G95 A;  1THJ A;  4IHG A;  3SRT A;  1QRG A;  1KQA A;  2V0J A;  1YP4 A;  2OEG A;  1HV9 A;  4G87 A;  1MRL A;  2RIJ A;  1QRF A;  4G3S A;  3VBP A;  5L6S A;  3MQH A;  3FOQ A;  4E1K A;  3EEV A;  4HUR A;  3DHO A;  3GUE A;  4EA9 A;  3D8V A;  4KPX A;  3TIS A;  3VBJ A;  3VBK A;  3R3R A;  1XAT A;  4R7P A;  2JF3 A;  1KK4 A;  3BFP A;  3CJ8 A;  3P1B A;  2QIA A;  4EAA A;  4N69 A;  3R5C A;  2ICY A;  2WLF A;  1QQ0 A;  1V67 A;  5F42 A;  1HM0 A;  3BXY A;  4MZU A;  3VNP A;  2JF2 A;  2VHE A;  2WLC A;  1KHR A;  2IU9 A;  3SPT A;  1J2Z A;  1KRU A;  4HZD A;  1FXJ A;  3R5A A;  1HM8 A;  3BRK X;  2P2O A;  4M98 A;  5DEP A;  2AQ9 A;  4N27 A;  4HZC A;  4M28 A;  4M99 A;  2W0W A;  2WLE A;  1HM9 A;  3R3I A;  4EGG A;  4N6B A;  1FWY A;  3PMO A;  2GGQ A;  3EG4 A;  4M9C A;  3P47 A;  3ST8 A;  4E75 A;  3D98 A;  2V0I A;  3EH0 A;  3C8V A;  2TDT A;  3F1X A;  4H7O A;  4E79 A;  4IHF A;  5L6V A;  3FSX A;  5DG3 A;  2WLD A;  1MR7 A;  3GOS A;  3OTM A;  3R8Y A;  4EQY A;  3TV0 A;  3I3A A;  1OCX A;  1S80 A;  1XHD A;  3OU9 A;  4KQL A;  4N6A A;  3IXC A;  3ECT A;  3MC4 A;  2WLG A;  4IHH A;  3IGJ A;  3TIO A;  3R2W A;  3R5B A;  3FS8 A;  4HCQ A;  4J18 A;  2QIV X;  4KNX A;  5U2K A;  4EA7 A;  2IC7 A;  2IUA A;  3I3X A;  5E3Q A;  2OI7 A;  3FWW A;  3VBN A;  2NPO A;  3V4E A;  3FSB A;  5E3P A;  3R0S A;  4AC3 A;  3KWD A;  3OUP A;  1MR9 A;  4HUS A;  3HSQ A;  3TK8 A;  5AFU U;  3BSW A;  2IU8 A;  1SSQ A;  2V0H A;  4MYO A;  3BSS A;  1SST A;  5ADX V;  3HJJ A;  3VBM A;  4EAB A;  3DJ4 A;  4M2B A;  3TDT A;  2I5K A;  2VD4 A;  4KNR A;  3R5D A;  1KRV A;  3R1W A;  2XAT A;  5E3R A;  2Q4J A;  4FCE A;  4AAW A;  2V0K A;  4G3P A;  5AFU V;  2QKX A;  3DK5 A;  1KGT A;  4AA7 A;  1Z90 A;  2W0V A;  3FTT A;  3VBI A;  1QRM A;  2OI6 A;  3TWD A;  3OW5 A;  4M2A A;  1G97 A;  1T3D A;  3NZ2 A;  1SSM A;  4J09 A;  4EA8 A;  3JQY A;  1QRE A;  5ADX U;  3T57 A;  3BSY A;  4KPZ A;  1YP3 A;  4E6T A;  1V3W A;  1LXA A;  2OI5 A;  3KWE A;  3KWC A;  2OEF A;  4R37 A;  4DCL A;  3OTZ A;  4MFG A;  1KRR A;  3Q1X A;  1YP2 A;  1KK6 A;  2GGO A;  4E6U A;  4G3Q A;  3FSC A;  5DEM A;  4R36 A;  1TDT A;  1QRL A;  3VBL A; 
#chains in the Genus database with same CATH topology
 1KK5 A;  3MQG A;  4ISX A;  3GVD A;  2FKO A;  4K6R A;  3FSY A;  2V0L A;  2ICX A;  1KGQ A;  1G95 A;  1THJ A;  4IHG A;  3SRT A;  1QRG A;  1KQA A;  2V0J A;  1YP4 A;  2OEG A;  1HV9 A;  4G87 A;  1MRL A;  2RIJ A;  1QRF A;  4G3S A;  3VBP A;  5L6S A;  3MQH A;  3FOQ A;  4E1K A;  3EEV A;  4HUR A;  3DHO A;  3GUE A;  4EA9 A;  3D8V A;  4KPX A;  3TIS A;  3VBJ A;  3VBK A;  3R3R A;  1XAT A;  4R7P A;  2JF3 A;  1KK4 A;  3BFP A;  3CJ8 A;  3P1B A;  2QIA A;  4EAA A;  4N69 A;  3R5C A;  2ICY A;  2WLF A;  1QQ0 A;  1N4I A;  1V67 A;  5F42 A;  1HM0 A;  3BXY A;  3GQ8 A;  4MZU A;  3OH2 A;  3VNP A;  2JF2 A;  3SUC A;  2VHE A;  1M8N A;  1KHR A;  2IU9 A;  2WLC A;  1J2Z A;  1KRU A;  3SPT A;  4HZD A;  1FXJ A;  3R5A A;  1HM8 A;  3BRK X;  2P2O A;  4M98 A;  5DEP A;  2AQ9 A;  4N27 A;  4HZC A;  4M28 A;  4M99 A;  2W0W A;  2WLE A;  1HM9 A;  3R3I A;  4EGG A;  4N6B A;  1FWY A;  3PMO A;  2GGQ A;  3EG4 A;  4M9C A;  3P47 A;  3ST8 A;  3OH3 A;  4E75 A;  3D98 A;  2V0I A;  3EH0 A;  3C8V A;  2TDT A;  3F1X A;  4H7O A;  4E79 A;  4IHF A;  5L6V A;  3FSX A;  5DG3 A;  2WLD A;  1MR7 A;  3GOS A;  3OTM A;  3R8Y A;  4EQY A;  3TV0 A;  3I3A A;  1OCX A;  1S80 A;  1XHD A;  3OU9 A;  4KQL A;  4N6A A;  3IXC A;  3ECT A;  3MC4 A;  2WLG A;  3OGZ A;  3IGJ A;  4IHH A;  3TIO A;  3R2W A;  3R5B A;  3FS8 A;  4HCQ A;  4J18 A;  2QIV X;  4KNX A;  5U2K A;  4EA7 A;  2IC7 A;  2IUA A;  3I3X A;  5E3Q A;  2OI7 A;  3FWW A;  3VBN A;  2NPO A;  3V4E A;  3FSB A;  3GQ7 A;  3R0S A;  5E3P A;  4AC3 A;  3KWD A;  3OUP A;  1MR9 A;  4HUS A;  3HSQ A;  3TK8 A;  3OH0 A;  5AFU U;  3BSW A;  2IU8 A;  1SSQ A;  2V0H A;  4MYO A;  3BSS A;  1SST A;  5ADX V;  3HJJ A;  3VBM A;  3OH4 A;  3DJ4 A;  4M2B A;  1Z2F A;  4EAB A;  3TDT A;  2I5K A;  2VD4 A;  4KNR A;  3R5D A;  1KRV A;  3R1W A;  2XAT A;  3GQA A;  2Q4J A;  4FCE A;  5E3R A;  4AAW A;  2V0K A;  4G3P A;  5AFU V;  2QKX A;  3DK5 A;  1KGT A;  4AA7 A;  1L0S A;  1Z90 A;  2W0V A;  3FTT A;  3OH1 A;  1QRM A;  2OI6 A;  3TWD A;  3VBI A;  3OW5 A;  4M2A A;  1G97 A;  1T3D A;  3NZ2 A;  1SSM A;  4J09 A;  4EA8 A;  1EWW A;  3JQY A;  1QRE A;  5ADX U;  3T57 A;  3BSY A;  4KPZ A;  1YP3 A;  4E6T A;  1V3W A;  1LXA A;  2OI5 A;  3KWE A;  3KWC A;  2OEF A;  4R37 A;  4DCL A;  3OTZ A;  4MFG A;  1KRR A;  3GQ9 A;  3Q1X A;  1YP2 A;  1KK6 A;  2GGO A;  4E6U A;  4G3Q A;  3FSC A;  5DEM A;  4R36 A;  1TDT A;  1QRL A;  3VBL A; 
#chains in the Genus database with same CATH homology
 1KK5 A;  3MQG A;  4ISX A;  3GVD A;  2FKO A;  4K6R A;  3FSY A;  2V0L A;  2ICX A;  1KGQ A;  1G95 A;  1THJ A;  4IHG A;  3SRT A;  1QRG A;  1KQA A;  2V0J A;  1YP4 A;  2OEG A;  1HV9 A;  4G87 A;  1MRL A;  2RIJ A;  1QRF A;  4G3S A;  3VBP A;  5L6S A;  3MQH A;  3FOQ A;  4E1K A;  3EEV A;  4HUR A;  3DHO A;  3GUE A;  4EA9 A;  3D8V A;  4KPX A;  3TIS A;  3VBJ A;  3VBK A;  3R3R A;  1XAT A;  4R7P A;  2JF3 A;  1KK4 A;  3BFP A;  3CJ8 A;  3P1B A;  2QIA A;  4EAA A;  4N69 A;  3R5C A;  2ICY A;  2WLF A;  1QQ0 A;  1V67 A;  5F42 A;  1HM0 A;  3BXY A;  4MZU A;  3VNP A;  2JF2 A;  2VHE A;  2WLC A;  1KHR A;  2IU9 A;  3SPT A;  1J2Z A;  1KRU A;  4HZD A;  1FXJ A;  3R5A A;  1HM8 A;  3BRK X;  2P2O A;  4M98 A;  5DEP A;  2AQ9 A;  4N27 A;  4HZC A;  4M28 A;  4M99 A;  2W0W A;  2WLE A;  1HM9 A;  3R3I A;  4EGG A;  4N6B A;  1FWY A;  3PMO A;  2GGQ A;  3EG4 A;  4M9C A;  3P47 A;  3ST8 A;  4E75 A;  3D98 A;  2V0I A;  3EH0 A;  3C8V A;  2TDT A;  3F1X A;  4H7O A;  4E79 A;  4IHF A;  5L6V A;  3FSX A;  5DG3 A;  2WLD A;  1MR7 A;  3GOS A;  3OTM A;  3R8Y A;  4EQY A;  3TV0 A;  3I3A A;  1OCX A;  1S80 A;  1XHD A;  3OU9 A;  4KQL A;  4N6A A;  3IXC A;  3ECT A;  3MC4 A;  2WLG A;  4IHH A;  3IGJ A;  3TIO A;  3R2W A;  3R5B A;  3FS8 A;  4HCQ A;  4J18 A;  2QIV X;  4KNX A;  5U2K A;  4EA7 A;  2IC7 A;  2IUA A;  3I3X A;  5E3Q A;  2OI7 A;  3FWW A;  3VBN A;  2NPO A;  3V4E A;  3FSB A;  5E3P A;  3R0S A;  4AC3 A;  3KWD A;  3OUP A;  1MR9 A;  4HUS A;  3HSQ A;  3TK8 A;  5AFU U;  3BSW A;  2IU8 A;  1SSQ A;  2V0H A;  4MYO A;  3BSS A;  1SST A;  5ADX V;  3HJJ A;  3VBM A;  4EAB A;  3DJ4 A;  4M2B A;  3TDT A;  2I5K A;  2VD4 A;  4KNR A;  3R5D A;  1KRV A;  3R1W A;  2XAT A;  5E3R A;  2Q4J A;  4FCE A;  4AAW A;  2V0K A;  4G3P A;  5AFU V;  2QKX A;  3DK5 A;  1KGT A;  4AA7 A;  1Z90 A;  2W0V A;  3FTT A;  3VBI A;  1QRM A;  2OI6 A;  3TWD A;  3OW5 A;  4M2A A;  1G97 A;  1T3D A;  3NZ2 A;  1SSM A;  4J09 A;  4EA8 A;  3JQY A;  1QRE A;  5ADX U;  3T57 A;  3BSY A;  4KPZ A;  1YP3 A;  4E6T A;  1V3W A;  1LXA A;  2OI5 A;  3KWE A;  3KWC A;  2OEF A;  4R37 A;  4DCL A;  3OTZ A;  4MFG A;  1KRR A;  3Q1X A;  1YP2 A;  1KK6 A;  2GGO A;  4E6U A;  4G3Q A;  3FSC A;  5DEM A;  4R36 A;  1TDT A;  1QRL A;  3VBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...