4EGGA

Computationally designed self-assembling tetrahedron protein, t310
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
188
structure length
188
Chain Sequence
MTEKEKMLAEKWYDANFDQTLINERLRAKVICFALNHTNPVATMMRKVLIDALFQTTTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acetyltransferase SACOL2570
publication title Computational design of self-assembling protein nanomaterials with atomic level accuracy.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
total genus 73
structure length 188
sequence length 188
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.-:
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12464 Mac Maltose acetyltransferase
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4eggA00
3FSXA 3VNPA 2V0HA 1SSTA 1KQAA 3OTMA 2IU8A 4IHGA 1KK6A 4IHFA 1HM8A 3T57A 4E6TA 1MR7A 3DJ4A 3OU9A 5F42A 3R0SA 1QREA 2V0KA 3DK5A 3F1XA 3BRKX 3BSYA 4KNRA 2GGQA 1V67A 3VBLA 3ECTA 4M2AA 4MZUA 3TWDA 1TDTA 1YP2A 4AA7A 3VBMA 2OI6A 2OI5A 4AAWA 4E6UA 1KGQA 3MQHA 1G97A 2QIVX 4EA8A 3OUPA 2TDTA 3KWDA 4KQLA 3GOSA 3TDTA 4EA9A 2VD4A 4EABA 3R5DA 3I3AA 4H7OA 4EA7A 2RIJA 3VBKA 1QRFA 3EH0A 3FSCA 1QRGA 3GVDA 3HJJA 5DEPA 1KK5A 3SRTA 4EAAA 2XATA 3BSWA 3IXCA 5AFUV 2ICXA 1QRLA 4HZDA 2WLFA 4N6BA 1SSQA 4M9CA 5L6SA 3EG4A 1QRMA 1G95A 1YP3A 5ADXV 4HZCA 2QIAA 4M99A 2VHEA 3DHOA 1QQ0A 1YP4A 3CJ8A 3P1BA 2V0IA 4J09A 3P47A 4KPZA 3TIOA 5E3RA 2IC7A 3R1WA 3OW5A 3FTTA 3IGJA 4E1KA 3HSQA 4M2BA 3V4EA 3EEVA 3PMOA 1S80A 4HURA 1HM9A 5U2KA 3FS8A 2WLEA 5L6VA 1THJA 1XATA 3I3XA 4MFGA 3TV0A 2OEFA 2ICYA 4R7PA 4AC3A 4KNXA 2WLDA 1KK4A 1HV9A 3R8YA 4DCLA 1MR9A 2V0JA 3VBNA 3GUEA 3BXYA 3Q1XA 3R5AA 1OCXA 2W0VA 2I5KA 3ST8A 3BFPA 5AFUU 1MRLA 2AQ9A 3JQYA 2GGOA 2OEGA 4MYOA 1KHRA 5E3QA 5E3PA 1HM0A 2JF3A 3TISA 4N69A 3R5CA 3R5BA 5DEMA 4EQYA 4FCEA 3KWCA 3MC4A 1J2ZA 3FSYA 4M28A 3BSSA 4HCQA 3VBIA 4G3PA 2WLGA 3SPTA 1SSMA 3MQGA 4G87A 4KPXA 3FSBA 3R3RA 3FOQA 4E75A 2NPOA 1LXAA 3R2WA 4N27A 1XHDA 3C8VA 3R3IA 4K6RA 1KRUA 2IU9A 2Q4JA 2V0LA 1Z90A 3FWWA 4HUSA 3VBJA 1T3DA 1FXJA 1KGTA 2JF2A 4G3QA 3OTZA 4IHHA 4N6AA 3KWEA 4M98A 4R36A 4ISXA 5ADXU 2FKOA 3D8VA 3D98A 3VBPA 1V3WA 2W0WA 4E79A 2QKXA 3NZ2A 4G3SA 5DG3A 4EGGA 1FWYA 4J18A 4R37A 2IUAA 2P2OA 2WLCA 2OI7A 3TK8A 1KRRA 1KRVA
chains in the Genus database with same CATH superfamily
3FSXA 3VNPA 2V0HA 1SSTA 1KQAA 3OTMA 2IU8A 4IHGA 1KK6A 4IHFA 1HM8A 3T57A 4E6TA 1MR7A 3DJ4A 3OU9A 5F42A 3R0SA 1QREA 3OH4A 2V0KA 3DK5A 3F1XA 3BRKX 3BSYA 4KNRA 2GGQA 1V67A 3VBLA 3ECTA 1N4IA 4M2AA 4MZUA 3TWDA 1TDTA 3OH2A 1YP2A 4AA7A 3VBMA 2OI6A 2OI5A 4AAWA 4E6UA 1KGQA 3MQHA 1G97A 2QIVX 4EA8A 3OUPA 2TDTA 3OH0A 3KWDA 4KQLA 3GOSA 3TDTA 4EA9A 2VD4A 4EABA 3R5DA 3I3AA 4H7OA 4EA7A 2RIJA 3VBKA 1QRFA 3EH0A 3FSCA 1QRGA 3GVDA 3HJJA 5DEPA 1KK5A 3SRTA 1L0SA 2XATA 3BSWA 3IXCA 1Z2FA 2ICXA 1QRLA 5AFUV 4HZDA 2WLFA 4N6BA 1SSQA 4M9CA 5L6SA 3EG4A 1QRMA 1G95A 1YP3A 5ADXV 4HZCA 2QIAA 4M99A 2VHEA 3DHOA 1QQ0A 1YP4A 3CJ8A 3P1BA 2V0IA 4J09A 3P47A 4KPZA 3TIOA 5E3RA 2IC7A 3R1WA 3OW5A 3FTTA 3IGJA 4E1KA 3HSQA 4M2BA 3V4EA 3OGZA 3EEVA 3PMOA 1S80A 4HURA 1HM9A 5U2KA 3FS8A 2WLEA 5L6VA 1THJA 1XATA 3I3XA 4MFGA 3TV0A 2OEFA 3SUCA 2ICYA 4R7PA 4AC3A 4KNXA 2WLDA 1KK4A 1HV9A 3R8YA 4DCLA 1MR9A 2V0JA 3OH3A 3GUEA 3BXYA 3Q1XA 3R5AA 3VBNA 1OCXA 2W0VA 2I5KA 3ST8A 3BFPA 5AFUU 1MRLA 2AQ9A 3JQYA 2GGOA 2OEGA 4MYOA 1KHRA 5E3QA 5E3PA 1HM0A 2JF3A 3GQ8A 3TISA 4N69A 3R5CA 3R5BA 5DEMA 3OH1A 4EQYA 4FCEA 3KWCA 3MC4A 1J2ZA 3FSYA 3GQ9A 4M28A 3BSSA 4HCQA 3GQ7A 3VBIA 4G3PA 2WLGA 3SPTA 1SSMA 3MQGA 4G87A 4KPXA 3FSBA 3R3RA 3FOQA 3GQAA 2NPOA 4E75A 1LXAA 1M8NA 3R2WA 4N27A 1XHDA 3C8VA 3R3IA 4K6RA 1KRUA 2IU9A 2Q4JA 2V0LA 1Z90A 3FWWA 4HUSA 3VBJA 1T3DA 1FXJA 1KGTA 2JF2A 4G3QA 3OTZA 4IHHA 4N6AA 3KWEA 4M98A 4R36A 4ISXA 5ADXU 2FKOA 3D8VA 3D98A 3VBPA 1V3WA 2W0WA 4E79A 2QKXA 3NZ2A 4G3SA 5DG3A 4EGGA 1FWYA 4J18A 4R37A 4EAAA 2IUAA 2P2OA 2WLCA 2OI7A 3TK8A 1KRRA 1EWWA 1KRVA
chains in the Genus database with same CATH topology
3FSXA 3VNPA 2V0HA 1SSTA 1KQAA 3OTMA 2IU8A 4IHGA 1KK6A 4IHFA 1HM8A 3T57A 4E6TA 1MR7A 3DJ4A 3OU9A 5F42A 3R0SA 1QREA 2V0KA 3DK5A 3F1XA 3BRKX 3BSYA 4KNRA 2GGQA 1V67A 3VBLA 3ECTA 4M2AA 4MZUA 3TWDA 1TDTA 1YP2A 4AA7A 3VBMA 2OI6A 2OI5A 4AAWA 4E6UA 1KGQA 3MQHA 1G97A 2QIVX 4EA8A 3OUPA 2TDTA 3KWDA 4KQLA 3GOSA 3TDTA 4EA9A 2VD4A 4EABA 3R5DA 3I3AA 4H7OA 4EA7A 2RIJA 3VBKA 1QRFA 3EH0A 3FSCA 1QRGA 3GVDA 3HJJA 5DEPA 1KK5A 3SRTA 4EAAA 2XATA 3BSWA 3IXCA 5AFUV 2ICXA 1QRLA 4HZDA 2WLFA 4N6BA 1SSQA 4M9CA 5L6SA 3EG4A 1QRMA 1G95A 1YP3A 5ADXV 4HZCA 2QIAA 4M99A 2VHEA 3DHOA 1QQ0A 1YP4A 3CJ8A 3P1BA 2V0IA 4J09A 3P47A 4KPZA 3TIOA 5E3RA 2IC7A 3R1WA 3OW5A 3FTTA 3IGJA 4E1KA 3HSQA 4M2BA 3V4EA 3EEVA 3PMOA 1S80A 4HURA 1HM9A 5U2KA 3FS8A 2WLEA 5L6VA 1THJA 1XATA 3I3XA 4MFGA 3TV0A 2OEFA 2ICYA 4R7PA 4AC3A 4KNXA 2WLDA 1KK4A 1HV9A 3R8YA 4DCLA 1MR9A 2V0JA 3VBNA 3GUEA 3BXYA 3Q1XA 3R5AA 1OCXA 2W0VA 2I5KA 3ST8A 3BFPA 5AFUU 1MRLA 2AQ9A 3JQYA 2GGOA 2OEGA 4MYOA 1KHRA 5E3QA 5E3PA 1HM0A 2JF3A 3TISA 4N69A 3R5CA 3R5BA 5DEMA 4EQYA 4FCEA 3KWCA 3MC4A 1J2ZA 3FSYA 4M28A 3BSSA 4HCQA 3VBIA 4G3PA 2WLGA 3SPTA 1SSMA 3MQGA 4G87A 4KPXA 3FSBA 3R3RA 3FOQA 4E75A 2NPOA 1LXAA 3R2WA 4N27A 1XHDA 3C8VA 3R3IA 4K6RA 1KRUA 2IU9A 2Q4JA 2V0LA 1Z90A 3FWWA 4HUSA 3VBJA 1T3DA 1FXJA 1KGTA 2JF2A 4G3QA 3OTZA 4IHHA 4N6AA 3KWEA 4M98A 4R36A 4ISXA 5ADXU 2FKOA 3D8VA 3D98A 3VBPA 1V3WA 2W0WA 4E79A 2QKXA 3NZ2A 4G3SA 5DG3A 4EGGA 1FWYA 4J18A 4R37A 2IUAA 2P2OA 2WLCA 2OI7A 3TK8A 1KRRA 1KRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FSX A;  3VNP A;  2V0H A;  1SST A;  1KQA A;  3OTM A;  2IU8 A;  4IHG A;  1KK6 A;  4IHF A;  1HM8 A;  3T57 A;  4E6T A;  1MR7 A;  3DJ4 A;  3OU9 A;  5F42 A;  3R0S A;  1QRE A;  2V0K A;  3DK5 A;  3F1X A;  3BRK X;  3BSY A;  4KNR A;  2GGQ A;  1V67 A;  3VBL A;  3ECT A;  4M2A A;  4MZU A;  3TWD A;  1TDT A;  1YP2 A;  4AA7 A;  3VBM A;  2OI6 A;  2OI5 A;  4AAW A;  4E6U A;  1KGQ A;  3MQH A;  1G97 A;  2QIV X;  4EA8 A;  3OUP A;  2TDT A;  3KWD A;  4KQL A;  3GOS A;  3TDT A;  4EA9 A;  2VD4 A;  4EAB A;  3R5D A;  3I3A A;  4H7O A;  4EA7 A;  2RIJ A;  3VBK A;  1QRF A;  3EH0 A;  3FSC A;  1QRG A;  3GVD A;  3HJJ A;  5DEP A;  1KK5 A;  3SRT A;  4EAA A;  2XAT A;  3BSW A;  3IXC A;  5AFU V;  2ICX A;  1QRL A;  4HZD A;  2WLF A;  4N6B A;  1SSQ A;  4M9C A;  5L6S A;  3EG4 A;  1QRM A;  1G95 A;  1YP3 A;  5ADX V;  4HZC A;  2QIA A;  4M99 A;  2VHE A;  3DHO A;  1QQ0 A;  1YP4 A;  3CJ8 A;  3P1B A;  2V0I A;  4J09 A;  3P47 A;  4KPZ A;  3TIO A;  5E3R A;  2IC7 A;  3R1W A;  3OW5 A;  3FTT A;  3IGJ A;  4E1K A;  3HSQ A;  4M2B A;  3V4E A;  3EEV A;  3PMO A;  1S80 A;  4HUR A;  1HM9 A;  5U2K A;  3FS8 A;  2WLE A;  5L6V A;  1THJ A;  1XAT A;  3I3X A;  4MFG A;  3TV0 A;  2OEF A;  2ICY A;  4R7P A;  4AC3 A;  4KNX A;  2WLD A;  1KK4 A;  1HV9 A;  3R8Y A;  4DCL A;  1MR9 A;  2V0J A;  3VBN A;  3GUE A;  3BXY A;  3Q1X A;  3R5A A;  1OCX A;  2W0V A;  2I5K A;  3ST8 A;  3BFP A;  5AFU U;  1MRL A;  2AQ9 A;  3JQY A;  2GGO A;  2OEG A;  4MYO A;  1KHR A;  5E3Q A;  5E3P A;  1HM0 A;  2JF3 A;  3TIS A;  4N69 A;  3R5C A;  3R5B A;  5DEM A;  4EQY A;  4FCE A;  3KWC A;  3MC4 A;  1J2Z A;  3FSY A;  4M28 A;  3BSS A;  4HCQ A;  3VBI A;  4G3P A;  2WLG A;  3SPT A;  1SSM A;  3MQG A;  4G87 A;  4KPX A;  3FSB A;  3R3R A;  3FOQ A;  4E75 A;  2NPO A;  1LXA A;  3R2W A;  4N27 A;  1XHD A;  3C8V A;  3R3I A;  4K6R A;  1KRU A;  2IU9 A;  2Q4J A;  2V0L A;  1Z90 A;  3FWW A;  4HUS A;  3VBJ A;  1T3D A;  1FXJ A;  1KGT A;  2JF2 A;  4G3Q A;  3OTZ A;  4IHH A;  4N6A A;  3KWE A;  4M98 A;  4R36 A;  4ISX A;  5ADX U;  2FKO A;  3D8V A;  3D98 A;  3VBP A;  1V3W A;  2W0W A;  4E79 A;  2QKX A;  3NZ2 A;  4G3S A;  5DG3 A;  4EGG A;  1FWY A;  4J18 A;  4R37 A;  2IUA A;  2P2O A;  2WLC A;  2OI7 A;  3TK8 A;  1KRR A;  1KRV A; 
#chains in the Genus database with same CATH topology
 3FSX A;  3VNP A;  2V0H A;  1SST A;  1KQA A;  3OTM A;  2IU8 A;  4IHG A;  1KK6 A;  4IHF A;  1HM8 A;  3T57 A;  4E6T A;  1MR7 A;  3DJ4 A;  3OU9 A;  5F42 A;  3R0S A;  1QRE A;  3OH4 A;  2V0K A;  3DK5 A;  3F1X A;  3BRK X;  3BSY A;  4KNR A;  2GGQ A;  1V67 A;  3VBL A;  3ECT A;  1N4I A;  4M2A A;  4MZU A;  3TWD A;  1TDT A;  3OH2 A;  1YP2 A;  4AA7 A;  3VBM A;  2OI6 A;  2OI5 A;  4AAW A;  4E6U A;  1KGQ A;  3MQH A;  1G97 A;  2QIV X;  4EA8 A;  3OUP A;  2TDT A;  3OH0 A;  3KWD A;  4KQL A;  3GOS A;  3TDT A;  4EA9 A;  2VD4 A;  4EAB A;  3R5D A;  3I3A A;  4H7O A;  4EA7 A;  2RIJ A;  3VBK A;  1QRF A;  3EH0 A;  3FSC A;  1QRG A;  3GVD A;  3HJJ A;  5DEP A;  1KK5 A;  3SRT A;  1L0S A;  2XAT A;  3BSW A;  3IXC A;  1Z2F A;  2ICX A;  1QRL A;  5AFU V;  4HZD A;  2WLF A;  4N6B A;  1SSQ A;  4M9C A;  5L6S A;  3EG4 A;  1QRM A;  1G95 A;  1YP3 A;  5ADX V;  4HZC A;  2QIA A;  4M99 A;  2VHE A;  3DHO A;  1QQ0 A;  1YP4 A;  3CJ8 A;  3P1B A;  2V0I A;  4J09 A;  3P47 A;  4KPZ A;  3TIO A;  5E3R A;  2IC7 A;  3R1W A;  3OW5 A;  3FTT A;  3IGJ A;  4E1K A;  3HSQ A;  4M2B A;  3V4E A;  3OGZ A;  3EEV A;  3PMO A;  1S80 A;  4HUR A;  1HM9 A;  5U2K A;  3FS8 A;  2WLE A;  5L6V A;  1THJ A;  1XAT A;  3I3X A;  4MFG A;  3TV0 A;  2OEF A;  3SUC A;  2ICY A;  4R7P A;  4AC3 A;  4KNX A;  2WLD A;  1KK4 A;  1HV9 A;  3R8Y A;  4DCL A;  1MR9 A;  2V0J A;  3OH3 A;  3GUE A;  3BXY A;  3Q1X A;  3R5A A;  3VBN A;  1OCX A;  2W0V A;  2I5K A;  3ST8 A;  3BFP A;  5AFU U;  1MRL A;  2AQ9 A;  3JQY A;  2GGO A;  2OEG A;  4MYO A;  1KHR A;  5E3Q A;  5E3P A;  1HM0 A;  2JF3 A;  3GQ8 A;  3TIS A;  4N69 A;  3R5C A;  3R5B A;  5DEM A;  3OH1 A;  4EQY A;  4FCE A;  3KWC A;  3MC4 A;  1J2Z A;  3FSY A;  3GQ9 A;  4M28 A;  3BSS A;  4HCQ A;  3GQ7 A;  3VBI A;  4G3P A;  2WLG A;  3SPT A;  1SSM A;  3MQG A;  4G87 A;  4KPX A;  3FSB A;  3R3R A;  3FOQ A;  3GQA A;  2NPO A;  4E75 A;  1LXA A;  1M8N A;  3R2W A;  4N27 A;  1XHD A;  3C8V A;  3R3I A;  4K6R A;  1KRU A;  2IU9 A;  2Q4J A;  2V0L A;  1Z90 A;  3FWW A;  4HUS A;  3VBJ A;  1T3D A;  1FXJ A;  1KGT A;  2JF2 A;  4G3Q A;  3OTZ A;  4IHH A;  4N6A A;  3KWE A;  4M98 A;  4R36 A;  4ISX A;  5ADX U;  2FKO A;  3D8V A;  3D98 A;  3VBP A;  1V3W A;  2W0W A;  4E79 A;  2QKX A;  3NZ2 A;  4G3S A;  5DG3 A;  4EGG A;  1FWY A;  4J18 A;  4R37 A;  4EAA A;  2IUA A;  2P2O A;  2WLC A;  2OI7 A;  3TK8 A;  1KRR A;  1EWW A;  1KRV A; 
#chains in the Genus database with same CATH homology
 3FSX A;  3VNP A;  2V0H A;  1SST A;  1KQA A;  3OTM A;  2IU8 A;  4IHG A;  1KK6 A;  4IHF A;  1HM8 A;  3T57 A;  4E6T A;  1MR7 A;  3DJ4 A;  3OU9 A;  5F42 A;  3R0S A;  1QRE A;  2V0K A;  3DK5 A;  3F1X A;  3BRK X;  3BSY A;  4KNR A;  2GGQ A;  1V67 A;  3VBL A;  3ECT A;  4M2A A;  4MZU A;  3TWD A;  1TDT A;  1YP2 A;  4AA7 A;  3VBM A;  2OI6 A;  2OI5 A;  4AAW A;  4E6U A;  1KGQ A;  3MQH A;  1G97 A;  2QIV X;  4EA8 A;  3OUP A;  2TDT A;  3KWD A;  4KQL A;  3GOS A;  3TDT A;  4EA9 A;  2VD4 A;  4EAB A;  3R5D A;  3I3A A;  4H7O A;  4EA7 A;  2RIJ A;  3VBK A;  1QRF A;  3EH0 A;  3FSC A;  1QRG A;  3GVD A;  3HJJ A;  5DEP A;  1KK5 A;  3SRT A;  4EAA A;  2XAT A;  3BSW A;  3IXC A;  5AFU V;  2ICX A;  1QRL A;  4HZD A;  2WLF A;  4N6B A;  1SSQ A;  4M9C A;  5L6S A;  3EG4 A;  1QRM A;  1G95 A;  1YP3 A;  5ADX V;  4HZC A;  2QIA A;  4M99 A;  2VHE A;  3DHO A;  1QQ0 A;  1YP4 A;  3CJ8 A;  3P1B A;  2V0I A;  4J09 A;  3P47 A;  4KPZ A;  3TIO A;  5E3R A;  2IC7 A;  3R1W A;  3OW5 A;  3FTT A;  3IGJ A;  4E1K A;  3HSQ A;  4M2B A;  3V4E A;  3EEV A;  3PMO A;  1S80 A;  4HUR A;  1HM9 A;  5U2K A;  3FS8 A;  2WLE A;  5L6V A;  1THJ A;  1XAT A;  3I3X A;  4MFG A;  3TV0 A;  2OEF A;  2ICY A;  4R7P A;  4AC3 A;  4KNX A;  2WLD A;  1KK4 A;  1HV9 A;  3R8Y A;  4DCL A;  1MR9 A;  2V0J A;  3VBN A;  3GUE A;  3BXY A;  3Q1X A;  3R5A A;  1OCX A;  2W0V A;  2I5K A;  3ST8 A;  3BFP A;  5AFU U;  1MRL A;  2AQ9 A;  3JQY A;  2GGO A;  2OEG A;  4MYO A;  1KHR A;  5E3Q A;  5E3P A;  1HM0 A;  2JF3 A;  3TIS A;  4N69 A;  3R5C A;  3R5B A;  5DEM A;  4EQY A;  4FCE A;  3KWC A;  3MC4 A;  1J2Z A;  3FSY A;  4M28 A;  3BSS A;  4HCQ A;  3VBI A;  4G3P A;  2WLG A;  3SPT A;  1SSM A;  3MQG A;  4G87 A;  4KPX A;  3FSB A;  3R3R A;  3FOQ A;  4E75 A;  2NPO A;  1LXA A;  3R2W A;  4N27 A;  1XHD A;  3C8V A;  3R3I A;  4K6R A;  1KRU A;  2IU9 A;  2Q4J A;  2V0L A;  1Z90 A;  3FWW A;  4HUS A;  3VBJ A;  1T3D A;  1FXJ A;  1KGT A;  2JF2 A;  4G3Q A;  3OTZ A;  4IHH A;  4N6A A;  3KWE A;  4M98 A;  4R36 A;  4ISX A;  5ADX U;  2FKO A;  3D8V A;  3D98 A;  3VBP A;  1V3W A;  2W0W A;  4E79 A;  2QKX A;  3NZ2 A;  4G3S A;  5DG3 A;  4EGG A;  1FWY A;  4J18 A;  4R37 A;  2IUA A;  2P2O A;  2WLC A;  2OI7 A;  3TK8 A;  1KRR A;  1KRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...