4EGYA

Crystal structure of arar(dbd) in complex with operator ora1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
81
structure length
81
Chain Sequence
b'LEVLFQGPLGSEFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLLYSVQGGGTFVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arabinose metabolism transcriptional repressor
publication title Spacing between core recognition motifs determines relative orientation of AraR monomers on bipartite operators.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
total genus 24
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4egyA00
3TKYA 2HQRA 3FWEA 2EFNA 4YFKF 1E17A 2W85A 4PCQA 1WQ2A 1HXDA 5L3CA 3E6BA 3PFIA 2HTJA 2Q2EA 3WU1B 4KA4A 2GA2A 3U2RA 1EH7A 5FLXK 2A5YB 4RB3C 5D4SA 2YX7A 4IPAA 2WC2A 2OZ6A 1ZARA 2XAGA 2NNNA 4G6QA 1TNTA 4N9HA 3VFZA 1S29A 3I71A 4R8HA 5FD5A 3ULQB 3HSEA 1S7OA 5FGMA 5HDGA 1B9MA 3O6BB 4KT5C 3ZPLA 4ZZLA 4GCVA 1U78A 4BNCA 1SAXA 2FOKA 5DD4A 2MLKA 3WGIA 2XRNA 2L02A 1IZ1A 2PEXA 1G6NA 1Z91A 1I27A 5LGNA 4U0VA 1K6OA 5ICCA 3FM3A 1PP8F 3K1NA 3FF5A 4EJOA 3ZMTA 3SFZA 5HOOA 4N9IA 2COMA 2QLZA 1K78A 4M6YA 1RZ4A 1Z9CA 2TDXA 3JTHA 1FYKA 1T0FA 4FT8A 1F4KA 4ETSA 1GHCA 2MH2A 1G3WA 1FSHA 4XRFA 4KMUX 1P4XA 1XSDA 2MC3A 5JHUA 4GXOA 3JAMZ 5ERIA 4IVNA 3KZZA 4Q4ZF 2ZFWA 5E1WA 4H0EA 3N4MA 1TBXA 2IW5A 2STTA 5D8LB 1W5SA 1H9TA 3BJAA 3DPTA 4LGWA 3ZMDA 1LJ9A 3WTYC 2GQQA 1W4MA 1LDDA 3EUHA 2PN6A 3RDIA 2DI3A 4R79A 1OYIA 2BGCA 2DK5A 4AD9A 1D5VA 3DF8A 1LQ1A 3DXJF 6PAXA 2YU3A 1R5HA 4HF0A 3DKWA 3QP5A 1P4AA 1YW8A 2XKPA 3HUGA 2UWMA 4KMFA 1T38A 2DW4A 4EJVA 4MEXF 4WCGA 2NNYA 4CXFA 2EFWA 3TOBA 2QQAA 4UVBA 2GIVA 3BJOA 2GZWA 3G73A 2V1XA 1ON1A 3KLNA 1T6SA 3B73A 3SHFA 1KQ9A 3F8BA 3GWZA 3WTSC 1IUYA 1FBUA 4LK1F 2EFQA 5BPIA 5DV5A 4XSZF 3HRMA 4FHTA 4RGSA 3ELKA 2GWRA 3IWFA 3BJ6A 4LJZF 5HDKA 4MNUA 1W7PD 3N97A 1TQPA 2X4HA 5BOXA 3QP6A 4BQAA 1IN7A 1IXSB 4HOBA 1QBJA 2A6HF 5BS6A 5E18F 5L3BA 2JSCA 3ROUA 4EV0A 3SZTA 1PUEE 4F7ZA 4O6JA 1FOKA 5H20A 3GFIA 3EDPA 3U1DA 2PMUA 2CFXA 2M8EA 1CF7A 2W84A 2P5VA 2QVOA 5EEHA 1TNSA 1ZH5A 4N0BA 4EVIA 2K86A 2CGPA 2UXNA 3F8CA 2HZTA 3KP4A 4HX4A 2MH9A 5CVVA 2EV6A 4OIRF 5LRRA 2EFOA 1BI0A 2FA5A 3WODF 3IC7A 2ZMEB 3ISPA 3GUDA 4JQFA 3TDZC 3BPXA 1OPCA 2QENA 3NRVA 4WXCA 5F6FA 1FYLA 2QBYA 5AIPA 5DEQA 3VB2A 3GF2A 3I0TA 3WGGA 5HLGA 1QPMA 1FBQA 2E7XA 4LFUA 1BC7C 2ZKZA 1U6GA 5CVRA 3L2CA 2L01A 1FWZA 4HLYA 1GVJA 3L00A 3TGNA 3GLXA 4WF2A 4ON0A 3RKWA 5L3FA 3F6VA 1P6RA 3BP8A 4HF2A 2V9VA 1BI1A 1REPC 1U5TC 3D5LA 1FZPB 4AIJA 3VEPA 1ZRDA 4RB0A 4RGUA 4Y15A 3RPUA 4HAMA 5K5QA 2FQ3A 2PMHA 4L9VA 4EJWA 3E6CC 1U5TB 2JRTA 2YX4A 2XROA 3WTTC 3FMSA 2XKOA 3LA7A 2UZKA 3T5XA 3R60A 2D2WA 4ENKA 1S8NA 3T8RA 3R0JA 5H6QA 1V3FA 2HKXA 2GXGA 3WG9A 1HKSA 3W6JB 4IF4A 5CVIA 2VE8A 3T1BA 1Z6TA 4YFXF 2VT3A 3HRSA 1XGNA 2O6GE 4M72A 5F64A 3ABUA 3FMRA 2FMLA 3TO7A 3FZVA 4NB5A 2KIUA 1QO0D 2FE3A 3V8KA 1K7AA 2VXZA 2YPRA 3BY6A 3CUOA 4EGZA 5E8GA 1ZG1A 2IT0A 1I5ZA 3F72A 3FX3A 3V8LA 3HOSA 4P9FA 5L3GA 2CYYA 3K69A 3GXOA 2V79A 3F8MA 2EA2A 4ESBA 2VONA 1BI3A 3B02A 2RDPA 1R00A 2RV8A 4OMZA 5DDGA 4FX0A 2Y75A 3HIFA 2FMYA 4RAZA 4HV5A 2E1CA 2PLYA 3SZPA 1IN4A 3HTUA 1KQ8A 2Z5UA 1UFMA 4P5OA 4GYGA 4WWCA 3J80K 1XSXA 4A5NA 1AOYA 4S04A 1IW7F 3GZ6A 2HKOA 4ZYEA 3KE2A 4LLNA 2DBBA 2IA0A 4Z2YA 1DPUA 3ZMSA 3KP6A 1SFXA 4K2EA 3V7SA 5J8CA 4KUMA 2BYVE 2WWYA 4Q47A 4RB1A 3QPHA 5A2QZ 4HZFA 4U0WA 2IA2A 2MBFA 1ODDA 1WWXA 1I1SA 1KYZA 4DQ2A 4L9JA 3EYIA 1SD6A 3CLOA 5IT9K 3RPQA 1IRFA 2VC0A 3I54A 2KKOA 3CUQA 1D3YA 1B59A 2A61A 2LKPA 3ZN1A 2LDUA 2ISZA 2NRAC 1XD7A 2DLLA 1XGMA 2ADUA 3LQRA 3CJNA 4MQVA 2HQNA 1LDKB 5CLSA 4MQ9F 3KEOA 4KDPA 3QAHA 2HOEA 5DUIA 3F6OA 2NAZA 1R1UA 2V1UA 1PP7U 2O03A 3I59B 2DK8A 1KU2A 2KJCA 2BV6A 4HX7A 4U7BA 1FY7A 1G3YA 4UV9A 2F5EA 1IXCA 4OU0A 5DCMA 5LEKA 2PFBA 1A04A 3SQNA 2X0LA 3LWFA 4HW0A 4YG2F 3IRQA 3E5UA 4U88A 1J75A 4L0ZB 4M6XA 1B9NA 3BROA 4HYEA 1IF1A 2RGVA 1YIOA 1XN7A 1MJ9A 2G7UA 4B09A 1IN6A 2D45A 3NEUA 4ESJA 3GFLA 1B1BA 3REOA 3DPLC 2OU2A 3J80Z 5TJJA 4ENNA 2FU4A 3WTVC 1YS7A 2E1NA 4IHTA 3M8EA 2KIFA 3HYIA 4M73A 4CYDA 2P6SA 4MTEA 1TQMA 2G9WA 3WE2A 1MDMB 2HEOA 4G7ZF 1TW2A 2E7WA 5HS9A 1J0RA 4IRGA 2STWA 1R36A 2XGXA 1ZG3A 4ZYHA 3LFKA 1R7JA 1DUXC 2IPQX 2RKHA 3GX4X 5FB2A 5HDNA 2L4AA 3Q9VA 3QPTA 1HW5A 3HHHA 2XAQA 1XB4A 1FLIA 1QQIA 4UHTA 4PZJA 2JZYA 2ZMEA 2JTVA 1YS6A 4HLXA 2XASA 2MA3A 3IRRA 2L54A 4IHSA 1O3TA 2IVMA 3S2WA 4MTDA 2VBXA 1HSJA 2F2EA 3V8JA 1ZLJA 2CQKA 3PQKA 1W5TA 1FP1D 3E6MA 1JGSA 4HDVA 1KQ0A 5ED4A 2A68F 4I0AA 3HRUA 1ZGAA 2QWWA 5DUKA 3KZYA 5ILSA 1LEBA 4D0PA 4A6EA 1F1ZA 1IAWA 4MEYF 3JSPA 2PJPA 3E6DA 5FLXZ 4HQEA 1TW3A 4EJUA 2A69F 4Y13A 1MZBA 3R6SA 3K9TA 4ZYGA 1HQCA 4YIFA 4IXAA 2BBYA 3R4KA 2DAOA 1E2XA 1YFHA 5HLIA 3KP5A 4EM0B 1KA8A 1MJAA 3RKYA 1JE8A 3LAJA 1LB2A 3QU6A 2RN7A 1R22A 5BMZA 2Q8KA 3K1MA 2P4WA 5AONA 1P2FA 4U0YA 3TQNA 4I0BA 3ZN0A 3MCZA 5JFRA 4QLCU 4UVCA 3M1EA 2EV5A 2PQ8A 3F8NA 3HHGA 3ZMZA 4UXNA 1XGOA 5L3DA 3L09A 4P55A 3AAFA 5IT3A 3LAPA 3C1DA 1G4DA 1KU3A 3DV8A 1RI7A 2B0LA 3K1PA 3ECHA 2HWVA 3P7NA 2HFHA 4NQWA 2PBIA 3VOEA 4OMYA 1B6AA 3WTUC 1EV7A 4A0XA 4R1HA 1KU7A 1FNNA 2G7HA 4EGYA 1USSA 4GGGA 1FP2A 3MFKA 2F5DA 4KNYA 3CDHA 1J59A 4JBAA 1XMAA 4CHUA 1MJBA 2OD5A 3C18A 3LQQA 1YLFA 1LNWA 3EQLF 2DPDA 2KRFA 2XV4S 2VODA 4OIOF 3G3ZA 5J6XA 1FT9A 1GXQA 2DQLA 1R5GA 3JTGA 3DEUA 3WTWC 3OV8A 3NQOA 2EFPA 2DT5A 4ASNA 1UB9A 1U8RA 3BWGA 5DD8A 1O3QA 3R0AA 2WTEA 5AIQA 3GVAA 2ISYA 1ZHFA 4IJAA 4TV7A 3FM5A 2AS5F 1Z7UA 2RQPA 5L3EA 5D6FA 4ENJA 3KFWX 4LLGF 1XSVA 1SFEA 1LDJA 4RB2C 3RJPA 4BYYA 1F5TA 1W7PA 4UV8A 1PDNC 1U3EM 1T39A 2XVCA 5J8FA 2OQGA 4CZZA 1EH6A 3IKTA 2ETHA 2H94A 1RUNA 5ILUA 4OINF 2QUFA 2OBPA 3DP7A 5E17F 3I59A 4QWQA 3V4GA 3VODA 2IRFG 2VN2A 2HGCA 2Z33A 3I5UA 3QRFF 4EM1A 2GA1A 1YTYA 1DDNA 2F5CA 3MZYA 2P7VB 4Q48A 1HBXG 1USTA 3W6KB 2ELHA 2M1BA 2VT2A 3O2PE 2QM3A 2VBWA 3WGHA 1Z6RA 3QU3A 1V4RA 3T8TA 2RNJA 4AWXB 2FNPA 3H3UA 2ESHA 5F1RA 2XIGA 4A6DA 3DQVC 1KYWA 1Z1DA 1ZN2A 3I64A 2CO5A 2HDCA 3CO6C 2JT1A 4OIQF 2FEZA 5TRDA 2LSOA 1TLHB 2OA4A 4LB5A 3KLOA 5JI6A 3H92A 2FBKA 1XCVA 4HDUA 2UXXA 1FX7A 1TQIA 1J5YA 3I53A 4I09A 4XLPF 5ICEA 4PGGA 2W25A 4WXHA 2ZO4A 2V1DA 3KP3A 2C6YA 5FFZA 4G9YA 5LHHA 5DYMA 2QBYB 3JSOA 1R1TA 4WK8F 4U7DA 4NHJA 4I01A 4GYIA 3OOPA 1FPQA 1RNLA 3ZQ7A 1L0OC 3EYYA 2ZNZA 5KK1A 3ZP5A 2OAZA 1I6XA 2CG4A 4I02A 3BOQA 3FHZA 1SD5A 3GZ5A 2V6CA 3J7AO 1UCRA 5D8KB 3GFMA 3M9AA 2NYXA 1XGSA 2J5PA 2O8XA 2OZUA 4HA8A 1J7KA 2LF8A 2GAUA 1O7LA 1T98A 1UHMA 2EA4A 4BHBA 1KU9A 1YG2A 2QZ8A 1HKTA 1HSTA 3V7CA 4L9TA 3HTSB 2VOOA 3JAMK 1ZGJA 2ZCWA 4XBFA 3I58A 1BOAA 1BM9A 4M9XA 3E5QA 2EK5A 4HQMA 2ESNA 1MD0A 3J81K 2VC1A 2K4BA 5K5RA 4O5VA 2HS5A 1TTYA 5FD6A 4PDKA 4S05A 2QYOA 5K5OA 1FYMA 3TO9A 4OIPF 4G8XA 1BIAA 4UVAA 4YFNF 2R3SA 2DTRA 2IA1A 1Z05A 3RI4A 3ZMVA 4I7HA 4P96A 3F21A 1ZG5A 3SXYA 3RYPA 3P9KA 2CW0F 1R1VA 1P4WA 2FNAA 5LHGA 3RKXA 3E97A 4A2UA 4BXUA 5BQTA 1IXRC 1YW7A 1U2WA 4P9UA 2P7CB 3O3KA 4KN7X 3M8FA 4LG0B 1XMKA 2EWNA 2EJRA 1YW9A 4O3MA 5FO5A 4IRIA 3T0YA 4A0ZA 4HX8A 2HYFA 1O57A 1DP7P 1WI9A 3FXRA 4M71A 2FSWA 3F22A 2XAJA 1OYWA 2Y48A 5ICFA 4CDGA 4ZZDA 3BZ6A 2FBIA 2M87A 4LD5A 3TDUC 4ZYDA 1FBSA 2CSOA 4L5JA 4PGHA 4UNOA 1Y0UA 2DFIA 1S3JA 2M5WA 1YO5C 3GYHX 1QZZA 1T2KA 1NHAA 3MZHA 5LGUA 4AIKA 3IHUA 3P9CA 4UUVA 3LSTA 4A5MA 4KIBA 1J9IA 2BE5F 5IT9Z 2IP2A 3P9IA 1ON2A 4DNCA 1BI2A 1YQAA 3CUQC 5CVJA 2VOPA 5E1XA 3QOPA 4L0YB 2A07F 1HW1A 3CUQB 2XAHA 4KN4X 2XAFA 3KETA 4EQQA 1ZRFA 5FFXA 2CWEA 3ML6A 3RTRA 1OMIA 2DPUA 1MKMA 2P8TA 3J81Z 1ZREA 3ABTA 1SMYF 3C7JA 1QNTA 4RGXA 2NS0A 3RIRA 4RS8A 2DQRA 1GXPA 1SD7A 1D8KA 4WXDA 1H9GA 4AVPA 2DO7A 4B8XA 2D1VA 3K0LA 4JK1X 5HLHA 3GEZA 3E3VA 3Q5FA 1JHFA 1QZYA 4I98B 3KP7A 2VBZA 1U5TA 3IKVA 4M9SA 3C3WA 2ZJ2A 1D8JA 1X3UA 2JPCA 1ZRCA 5HS8A 4LLLA 5DCMB 2HYGD 1P92A 2RC4A 2K7LA 4KIGA 4AIHA 4M74A 3MAJA 1XDUA 5CJ9A 2Z3YA 1BJAA 1EH8A 2K4JA 5E20A 2MD5A 1XDSA 2Q0OA 4L5IA 5D5VB 2P6TA 1IN5A 4E70A 1K79A 1J2XA 3WTXC 1JXSA 4I2OA 1Q1HA 3K2ZA 4MGRA 2R7DA 3U9GA 3F8FA 3MQ0A 3ZMUA 4KIFA 2J5OA 1RUOA 2ZBKA 2HTSA 4Q5SF 1ZAOA 2QQBA 2H27A 2O3FA 3CTAA 3R61A 3FXQA 1FC3A 2D1HA 4RGRA 2Z99A 2KIMA 5E1ZB 4HF1A 1K78B 3F3XA 3MWMA 1OR7A 2PG4A 4L9NA 2F5FA 1IN8A 2H6BA 4HV6A 2P5KA 4G7OF 3HOTA 4OOIA 4RAYA 1SFUA 1B4AA 2K02A 4L18B 2XHKA 3E5XA 3I4PA 3WE3A 2ZXJA 3H3ZA 4G7HF 5LHIA 4ESFA 3HSFA 2BEOA 5LLQA 1KGSA 1OKRA 3L7WA 2AXLA 2M30A 4XLNF 4YIIA 4XSXF 1ONVA 1R58A 2Z9OA 3FXUA 3IWZA 4WX9A 5KVRA 3TOAA 3LA3A 2OQRA 4LMYA 1YYVA 1BBYA 2IJLA 2A6EF 1JHHA 2EB7A 5BPDA 4CICA 2W24A 5A2QK 1XCBA 1HW2A 4KFCA 2ZNYA 5LRSA 4CO8A 2ACJA 4BHCA 2GXBA 2R7FA 2K27A 5D4RA 2O0YA 4BH9A 5ILVA 2P5LC 5D6EA 1WRJA 1DPRA 5HVQC 4ZH4F 2VBYA 4G94A 3D0SA 3DFGA 1O3RA 1MGTA 5LGTA 1LVAA 2MLGA 1STZA 3BDDA 4CGZA 4LK0F 4KICA 3V7RA 1WKMA 3PQJA 5DCFA 1ULYA 3KP2A 1OYYA 3COAC 5HS7A 2L3DA 4Y17A 5JR3A 2LNBA 1BN5A 3KCCA 3WU0A 3GO5A 3ERED 4G6DA 5K1YA 3HRTA 4EMSA 2H6CA 1SD4A 2RVCA 5H6RA 1G3SA 2FXAA 3EETA 1BC8C 1S7AA 1AWCA 3IL2A 5D5XB 1S6LA 3WTZA 4EJTA 1L3LA 1CF7B 4MHGA 4LG0A 4HBLA 5D5WB 3GW2A 3BPVA 4FX4A 3KEQA 1HKQA 2FF4A 4IRHA 5E8IA 1FSEA 2YSRA 1G3TA 3Q9SA 3CO7C 5LEJA 5JVTA 2M45A 3MEXA 2DU9A 3FMQA 2QQ9A 1LEAA 2HR3A 4ENMA 4EM2A 1MDMA 1CGPA 1O7FA 2VE9A 3ECOA 1H0MA 4GO1A 2JPBA 2Y0MA 2WV0A 3HSRA 2H09A 3TO6A 3JW4A 1R23A 1C0WA 1F9NA 1SMTA 2FRHA 2L4MA 2PI0A 3F23A 2O61A 4M9ZA 1WSUA 5LBQA 4A0YA 5D5UB 3M7GA 3RYRA 2A3SA 4A12A 1QGPA 3GFJA 1VTNC 2LF7A 5CVUA 5CYVA 1BIBA 2FBHA 1I1GA 1RIOH 5ICGA 1IRGA 1ZLKA 2XUBA 2YR2A 4KYWA 4BAYA 3LA2A 3L9FA 5EEGA 2EV0A 2KJBA 2W57A 1O3SA 1UHWA 1W7PB 4BHPA 4LB6B 1ZYRF
chains in the Genus database with same CATH superfamily
2WB1A 3TKYA 2HQRA 2HOTA 2XPVA 2LR8A 4AC0A 2E35A 3CMEI 2LRDA 3FWEA 2NVQJ 2JJ7A 2EFNA 5GPAA 1S9HA 4YFKF 1E17A 3G1OA 2W85A 4IZZA 4PCQA 5HLTA 4PFPA 1WQ2A 4AM3A 1HXDA 5L3CA 3LL7A 3E6BA 3PFIA 3KYLA 2HTJA 2Q2EA 4KITB 5EG0B 3WU1B 1RC9A 4HNUA 1I6HJ 1Z67A 1PJRA 3RQIA 3X2QH 1ETXA 4Z6YA 3K70C 1X1CA 4KA4A 1VQ7I 2GA2A 3U2RA 1VFCA 2X51A 3IH3A 3DWLE 1EH7A 5FLXK 3G1MA 2A5YB 1FIAA 4RB3C 5D4SA 4XKWA 2YX7A 4C2TA 2VUMJ 4IPAA 2WC2A 2ECCA 2OZ6A 2XF7A 1ZARA 1MNEA 2XAGA 1H89C 3AL0C 2DDBA 3TW6A 3DPUA 4CYCB 2NNNA 3FXOA 3PNYA 4G6QA 1JKPC 2ELJA 2M0MA 4DYCA 1BA5A 1TNTA 3HDDA 4N9HA 2M9HA 2DOFA 1WJFA 3IH4A 3VFZA 4QTRA 1S29A 5FLVA 1FTTA 3G6EI 3I71A 2W7NA 3DU5A 3AL0B 4R8HA 5FD5A 4IO9F 3ULQB 3HSEA 3C2HA 4IEJA 1S7OA 2IEKA 5FGMA 2DT6A 5HDGA 4B43A 5IY5H 1B9MA 1X2NA 4BKXA 2MC4A 3O6BB 4KT5C 3JRGA 1IJWC 2HYJA 3ZPLA 4ZZLA 1T33A 3OYDA 4XRMA 3CCMI 4DIQA 4GCVA 1U78A 2I10A 1SAXA 2FOKA 4BNCA 1XX5A 2R5YB 5DD4A 2WAFA 2MLKA 3WGIA 2R5ZA 2XRNA 1OCPA 2WBMA 2EZKA 4XL9A 2HU9A 3S93A 4UUSA 4E7JA 3K7AJ 2L02A 2F48A 1IZ1A 4A3BJ 2PEXA 1G6NA 1OCTC 5B3SH 1Z91A 1I27A 2DOAA 5LGNA 4IOAF 3E1SA 4U0VA 3W2WA 1TWFJ 3CF5F 1SFOJ 1XTAA 1K6OA 1U0JA 4JYKA 5ICCA 2EZHA 3BR0A 3FM3A 4G6TB 1OJLA 1ZELA 3K1NA 1PP8F 2IS1A 3FF5A 3BG9A 4XR6A 1R5ID 1IUFA 1FTZA 2AHQA 4AU7A 4EJOA 3ZMTA 3SFZA 1B72B 2BHZA 5HOOA 4N9IA 2COMA 3ABMH 2QLZA 1K78A 1SVLA 4M6YA 4HNTA 5J4VA 1RZ4A 1Z9CA 2Y30A 2TDXA 1ZK8A 3JTHA 2R7QA 3TP3A 1ITYA 1FYKA 1Y6IA 2KHMA 1YHQI 5F0CA 1T0FA 4FT8A 2DYRH 1F4KA 3WU2C 2EIJH 4ETSA 2W82A 1GHCA 2MH2A 1G3WA 1FSHA 3SDGA 4XRFA 4KMUX 4BBSJ 1OCZH 1P4XA 1XSDA 5EGOA 3W6VA 2MC3A 1AU7A 5JHUA 2HQ5A 4GXOA 2KRHA 3L1PA 3JAMZ 5ERIA 4IVNA 3KZZA 2WAEA 2NS7A 2VKVA 2ZFWA 4Q4ZF 5E1WA 4H0EA 1FEXA 1TP4A 2L2OA 4PJMA 5GTIC 3N4MA 1TBXA 1Y56A 2IW5A 2STTA 4RLFA 5D8LB 1W5SA 1H9TA 3BJAA 3DPTA 4LGWA 3ZMDA 1O4XA 1LJ9A 3WTYC 2V7FA 4W1UA 3EUKL 3BR6A 4S0HB 3W3CA 3S3OA 2GQQA 3BZCA 3QQAA 1W4MA 5HNHA 1LDDA 2ZSIB 3EUHA 2PN6A 4OAYA 4A3DJ 3RDIA 1P7JA 4HG2A 1EA3A 2XB5A 2R7UA 2JA5J 1VQLI 2ZC2A 2DI3A 2CUZA 2X9DA 3ESWB 4H4KC 3FHNA 2W00A 4R79A 4C30A 1ETKA 4M3FA 1OYIA 2BGCA 2DK5A 4AD9A 3S1QJ 1D5VA 2R7ZJ 3DF8A 1LQ1A 3DXJF 1E3OC 1VQMI 6PAXA 3I4MJ 1EJ9A 3JR9A 2L9SA 2Y0SA 5HODA 2YU3A 1R5HA 4HF0A 1V5EA 2LTPA 3DKWA 3QP5A 1P4AA 2F6CA 2Z2SB 2ME6A 1YW8A 2XKPA 3HUGA 4IX7A 2UWMA 1GT0C 3L2UA 4KMFA 1T38A 2DW4A 4EJVA 4MEXF 4WCGA 2NNYA 1LFBA 4L5EA 5B66C 4CXFA 3HXLA 3ABKH 2EFWA 3TOBA 2QQAA 3M8JA 4UVBA 2GIVA 3BJOA 2OF7A 4XNFA 2GZWA 2V26A 4AVZA 1YI2I 3G73A 2V1XA 1ON1A 2FQ4A 2CS3A 3KLNA 4F91B 2FOWA 1T6SA 3A0BC 4X6AJ 3FIWA 3B73A 3SHFA 1KQ9A 1EKEA 3F8BA 3H5RA 2NVXJ 3GWZA 1PVEA 2VJ5A 3WTSC 1IUYA 4YELA 1FBUA 4LK1F 2EFQA 5BPIA 5DV5A 4XSZF 1FMWA 2DOEA 3ZXSA 4C3JJ 1QZEA 3HRMA 1R49A 2HOSA 4FHTA 3WHBA 2L7ZA 4BL0B 4XOTA 4RGSA 1WZ2A 1DGWY 2QA4I 3ELKA 2GWRA 3IWFA 3BJ6A 4LJZF 1HF0A 5HDKA 4MNUA 1G59A 1W7PD 1I50J 1W5CC 1TQPA 3N97A 3OIQA 2WADA 3H36A 2X4HA 5BOXA 3QP6A 4BQAA 3ZR8X 1IN7A 1IXSB 2AQEA 4HOBA 1AKHA 1N78A 1QBJA 2A6HF 1BL0A 5E3LA 4A3LJ 5GAHJ 2ZXWH 3FKIJ 3M1CA 4D7MA 5BS6A 2A6TA 5E18F 5L3BA 4IQ4A 4IL6C 2JSCA 5JLXA 2K9SA 1D0XA 3ROUA 4EV0A 3D5SC 3SZTA 4BE0A 1PUEE 2IGOA 4F7ZA 4O6JA 1FOKA 1E0EA 2K9NA 2PMUA 3EDPA 3JCUC 5H20A 3U1DA 2CFXA 3GFIA 2M8EA 1U9OA 3CDLA 2ZXIA 1J09A 1CF7A 2W84A 1V54H 2P5VA 3VSLA 2QVOA 5EEHA 1TNSA 1ZH5A 1MNDA 4N0BA 1SEUA 4EVIA 2K86A 2CGPA 1E3HA 2UXNA 3F8CA 5EZHA 3I3LA 1IDZA 2NVUB 4BE1A 3CJRB 3AG1H 1BW6A 2HZTA 2JMWA 3KP4A 4HX4A 3K70D 2MH9A 5CVVA 4BEHA 3FISA 2EV6A 3QPSA 5EZGA 4OIRF 4NC8A 1QVUA 1MH4A 1YITI 2ELKA 5LRRA 3DU6A 4C3IJ 1PUFA 2EFOA 2LMDA 1BI0A 5E3MA 2FA5A 5J3LA 2XC7A 4BACA 3WODF 1RKWA 3IC7A 2ZMEB 3M07A 2X6WA 3ISPA 3GUDA 4JQFA 3TDZC 3IH2A 3BPXA 1OPCA 5LD2C 5FKMA 2FX0A 1V55H 1R4NB 2O7OA 4XLAA 2QENA 3NRVA 4WXCA 3NARA 4A3JJ 4XKCA 1VQ4I 5F6FA 1FYLA 1MSEC 2QBYA 3KIOA 2W4SA 2LBFA 2Y31A 5AIPA 1Z21A 5DEQA 3VB2A 2L9VA 2IBDA 2KISA 3FBIB 2ZFUA 3GF2A 3I0TA 3WGGA 2CW7A 5HLGA 3S16J 2ZXHA 1QPMA 1FBQA 2E7XA 4LFUA 1BC7C 2ZKZA 1U6GA 2JUGA 1I3QJ 2L7MP 2V6EA 2HDDA 2I8DA 5CVRA 3MVPA 1QPIA 2LC2A 3OR1C 2RQQA 2JSPA 5FKNA 3L2CA 3HOZJ 2HDWA 1FWZA 1GVJA 2L01A 3L00A 2JRMA 4DZPA 4HLYA 3TGNA 5GADJ 4IHWA 3GLXA 4WF2A 4ON0A 1QRYA 4BJ5C 3DKYA 3RKWA 5L3FA 5KCMA 2G0EA 3F6VA 1P6RA 2Z16A 3BP8A 4HF2A 2EZIA 5GAGJ 2V9VA 1BI1A 3BG7A 1FJLA 3PIOF 1U5TC 1REPC 3D5LA 1ORKA 1OCOH 4PJJA 1FZPB 4AIJA 3VEPA 4NNJA 3FK6A 1ZRDA 4RB0A 4RGUA 4Y15A 3RPUA 1OLTA 4HAMA 1SFKA 3S1NJ 4RDUA 2COBA 5K5QA 2FQ3A 3M3YJ 3QYFA 2PMHA 4L9VA 4EJWA 4D1QA 4HNVA 1U5TB 2JRTA 2YX4A 3D1NI 3E6CC 4B3XA 1U8BA 2XROA 3WTTC 1RPWA 3FMSA 2LREA 5IP9J 2XKOA 1OQYA 3LA7A 1XC5A 2W1OA 2CQNA 3T5XA 2UZKA 4A93J 4D5CA 2M0CA 3A02A 2D2WA 3R60A 4ENKA 3TMOA 1S8NA 5J40A 3T8RA 3R0JA 5B1AH 5H6QA 1V3FA 2HKXA 2GXGA 3ZQHA 1MBEA 3WG9A 3BG6A 3OYJA 1HKSA 3W6JB 3K4CA 2EIKH 4IF4A 3S3MA 4QIWN 5CVIA 2VE8A 3T1BA 4M3EA 4XM3A 4V2GA 5KHDA 1Z6TA 4YFXF 2VT3A 1K4TA 3GTOJ 3HRSA 1VQNI 1XGNA 2O6GE 2H8WA 4M72A 5EJCA 5F64A 1JGGA 3ABUA 3ZQQA 3FMRA 4DBRA 2FMLA 3TO7A 1VQOI 2TCTA 3FZVA 4NB5A 2KIUA 1Y39A 1QO0D 2FE3A 3V8KA 1K7AA 1Y1VJ 2VXZA 2YPRA 3BY6A 4ZJZA 3TW7A 3CUOA 4BS9A 4EGZA 5E8GA 2MYSA 1ZG1A 2K85A 1MMDA 1VF9A 4NQWB 3A1YA 1WH5A 1JJ8C 3N05A 2IT0A 5FRMA 1I5ZA 2K3FA 9ANTA 1MSFC 2F5VA 3F72A 3JREA 2LFBA 5GPCA 3PO3J 3FX3A 3V8LA 3HOSA 3LSMA 1FOWA 4P9FA 5L3GA 3OYMA 2CYYA 1OR7C 3K69A 3GXOA 4DW6A 2V79A 3F8MA 1N25A 2EA2A 4ESBA 2VONA 2LK2A 2VXDA 2BW3B 1BI3A 2DTZA 3RZOJ 3B02A 2RDPA 1R00A 2RV8A 1JJ6C 4OMZA 5DDGA 5C44J 1DP3A 3OOUA 2Y75A 4FX0A 3F0CA 3HIFA 5FLMJ 3OS1A 2FMYA 4RAZA 5J1YA 2QKMB 2AO9A 4XN3A 3CJTB 4HV5A 2CW8A 2AQFA 2E1CA 1A35A 3SZPA 1IN4A 3HTUA 2PLYA 4CCOA 3HOUJ 3HG9A 1KQ8A 3NWSA 4C9YA 2Z5UA 3K2AA 1K4SA 1UFMA 4P5OA 3S17J 4GYGA 4WWCA 1PYVA 3V42A 3J80K 3O8GA 1JTYA 1FMVA 3VSKA 1XSXA 2KDZA 4A5NA 1AOYA 2CU7A 2CRGA 5F27A 4S04A 1IW7F 2Y2ZA 2HKOA 3GZ6A 2R7RA 3SEZA 4ZYEA 3KE2A 3CDIA 4F52A 3ZQLA 4LLNA 1B8IB 2DBBA 2IA0A 3TBIA 2E2IJ 2XPWA 2FJ1A 4Z2YA 4C2MJ 3BTIA 2GOMA 1DPUA 3ZMSA 2BVMA 3KP6A 1SFXA 4K2EA 3V7SA 5J8CA 1B72A 4KUMA 3CCRI 2BYVE 3ZQFA 1WVRA 2ICWG 3LSIA 1W0UA 2WWYA 4Q47A 4AUXA 4RB1A 3QPHA 5B1BH 5A2QZ 4HZFA 4U0WA 2P81A 2HXOA 2IA2A 4FE4A 2MBFA 2CV0A 2HVRA 1ODDA 4DBQA 1WWXA 1I1SA 1Y8QB 3EUAA 3VYTB 1KYZA 3HPGA 1Y1WJ 4BDZA 4DQ2A 5FROA 4L9JA 3EYIA 1SD6A 3IAM2 3CLOA 1Y0NA 5IT9K 2FD5A 1RKTA 1IRFA 2VC0A 3RPQA 3I54A 4IQJA 2KKOA 1X3ZB 3CC2I 1FOXA 4F92B 1DU0A 3RZDJ 2R0QC 3CUQA 1SAUA 3OR2C 1D3YA 5M5XJ 1B59A 2A61A 2DA4A 2LKPA 4RA2A 1LPQA 1LE8B 3MKLA 2DJIA 4UB8C 2ZJPF 3ZN1A 2LDUA 1AA7A 2ISZA 2NRAC 1XD7A 2DLLA 2JK3A 3DTIA 2PMZN 1XGMA 2ADUA 1WH7A 3DTEA 3LQRA 1A36A 3UKGA 3CJNA 3RKQA 3LSJA 4MQVA 2HQNA 4JX5A 1LDKB 5CLSA 4MQ9F 3U21A 3KEOA 5TISC 4KDPA 3QAHA 2HOEA 5DUIA 3DTKA 1HC8A 3F6OA 1K6YA 2NAZA 3AFHA 1MBJA 1R1UA 2VASA 5KNLA 2OTLI 4ZDLA 2QGUA 2K3PA 2V1UA 1R9TJ 1T8IA 1X1BA 2O03A 1PP7U 1NK2P 3PFYA 2DA2A 3I59B 2DK8A 1KU2A 5CQEA 3CZ6A 1Z7LA 4MLOA 2KJCA 2R7SA 2Y9YA 2E60A 3DKXA 2OV7A 2BV6A 3Q0VA 2ZB9A 4ITVA 4HX7A 5FKKA 4U7BA 2IS4A 1FY7A 3BCBA 1M1EB 3S3NA 2E2HJ 1G3YA 3ZRGA 4UV9A 2F5EA 5C4XJ 2X85A 1IXCA 4OU0A 1IO2A 5DCMA 3K4KA 1NTCA 1QVTA 4DOZA 5LEKA 2PFBA 1A04A 4W97A 3KYDB 3PUFA 4HSRA 1QA6A 3SQNA 3B6AA 2CUFA 1S7EA 2QCOA 2X0LA 2R92J 1I3AA 3LWFA 3BG5A 4HW0A 1S5LC 4DGWB 1GLNA 4YG2F 3IRQA 3E5UA 4U88A 1J75A 4L0ZB 4M6XA 5DTDA 3VYSB 2M3AA 1LKXA 1MMGA 1NH3A 1B9NA 4C3HJ 3BROA 4Y7NJ 4HYEA 1IF1A 2RGVA 1YIOA 1IRZA 1XN7A 1MJ9A 2G7UA 3FKJA 3CP2A 4B09A 3KEYA 1MNMC 5F0FA 1IN6A 3Q3SA 4BQOA 2D45A 5HNFA 4N4OB 4LIUA 3NEUA 4JX6A 4ESJA 1ZR2A 3GFLA 1B1BA 2DJNA 1MBFA 3REOA 3DPLC 1IGNA 3CCUI 5GAEJ 2L5QA 2OU2A 2AXTC 3J80Z 5TJJA 2X6OA 4ENNA 4PK4A 2FU4A 3MN2A 2LOOA 3WTVC 1YS7A 2E1NA 4IHTA 1ETYA 3M8EA 2KIFA 3HYIA 4M73A 4CYDA 2P6SA 2MW8A 4MTEA 1TQMA 2G9WA 2DA6A 3ASNH 4BXXJ 3U1KA 2JWTA 3WE2A 4BGDA 1MDMB 2HEOA 4G7ZF 2R93J 2BVLA 3C2BA 1TW2A 3K4LA 5F1JA 2E7WA 5HS9A 1Z77A 2JA6J 5H2FC 4XRSG 1J0RA 4IRGA 2B7EA 2CFOA 2STWA 4JOMA 1R36A 2XGXA 1ZG3A 3LFKA 4ZYHA 1R7JA 2DA7A 4NDLA 1DUXC 2IPQX 2RKHA 5DM7F 3GX4X 1MW7A 5FB2A 1BR2A 5HDNA 3CMYA 2L4AA 3Q9VA 3QPTA 1HW5A 1MBKA 3OSFA 2NS8A 2M7AA 1E3PA 2VJIA 3HHHA 3H5NA 2Z1DA 5EDNA 2XAQA 1XB4A 1FLIA 1QQIA 4UHTA 4PZJA 2DN0A 3ZOBA 2JZYA 4RAFA 1YX3A 2ZMEA 2JTVA 2E2JJ 1YS6A 4HLXA 4ZYAA 2XASA 2MA3A 3IRRA 2L54A 3CCLI 4IHSA 1O3TA 2IVMA 3S2WA 4MTDA 3O8HA 4CCNA 4RAGA 2VBXA 4KT6A 5M5WJ 3PSIA 1HSJA 1X1AA 2F2EA 2VKEA 4BQQA 3S8PA 3V8JA 1NG7A 3PIPF 5FRNA 1GDTA 1ZLJA 2CQKA 3GMEA 2R7VA 3MMYB 1XPXA 3PQKA 4MFEA 3ZQGA 2H1KA 3H3VK 1W5TA 1FP1D 3E6MA 1JGSA 4HDVA 1KQ0A 5ED4A 1ETOA 2A68F 3FXJA 2NXNB 3HRUA 4I0AA 2WA0A 1ZGAA 3HOVJ 3QOEA 1HCRA 2HI3A 2QWWA 3OYEA 5DUKA 4E6KG 3KZYA 5ILSA 3I55I 1YJNI 1LEBA 2R7WA 4EATA 4XONA 3BT9A 3KZIC 4A6EA 4D0PA 2OTJI 1F1ZA 1IAWA 3BZKA 4FASD 4MEYF 3JSPA 2WAQN 2PJPA 1ETWA 3E6DA 5FLXZ 4HQEA 1TW3A 4EJUA 2QF7A 3CMMA 2A69F 3GTPJ 4Y13A 1MZBA 1LVKA 2Q2EB 3BQYA 2ZJRF 1WFXA 3K9TA 3R6SA 3H9GA 4ZYGA 3ABLH 4RMNA 3OYCA 1HQCA 3DBLB 1D1AA 4A3MJ 4YIFA 4IXAA 2BBYA 3R4KA 2DAOA 1E2XA 1YFHA 1GVDA 2R4GA 5HLIA 3KP5A 3QYEA 3LSRA 1V5GA 4EM0B 1KA8A 1MJAA 3RKYA 1JE8A 2NVYJ 4IHYA 2RAEA 2VQGA 1TWCJ 1RETA 3LAJA 1LB2A 4XLEA 4DYRA 4BQNA 2GIZA 3QU6A 2RN7A 2VI6A 2VJ4A 3UNGC 1R22A 1FIPA 5BMZA 2Q8KA 2H1LA 3H9JA 3K1MA 2P4WA 3OYFA 5AONA 1P2FA 4U0YA 3TQNA 4I0BA 4A3IJ 3ZN0A 1F36A 2VB6A 2TRTA 3MCZA 5JFRA 1JT0A 4QLCU 3B6CA 4KJZA 4UVCA 3M1EA 2EV5A 2PQ8A 4CUGA 3F8NA 3HHGA 3ZMZA 3W2AA 1X3WB 3OYLA 4UXNA 1XGOA 4IHVA 1WGXA 4JP0A 5L3DA 2XGDA 3L09A 3JRBA 4P55A 1WJAA 1UAAA 2R5ZB 3AAFA 2CQXA 3OIPA 5IT3A 3LAPA 3C1DA 1G4DA 1KU3A 4V19K 1BJZA 1JKRC 3DV8A 1RI7A 2B0LA 3K1PA 3FDYA 3ECHA 4XMYA 4XOPA 4UUSB 2HWVA 2PMZA 3P7NA 2DDAA 2WY7Q 2HFHA 2L9NA 2PBIA 4NQWA 3VOEA 3FXMA 4XLCA 2B9SA 5M3FJ 4OMYA 1B6AA 2HQAA 3WTUC 2LH9A 3KPHA 5CKTA 3HB9A 1EV7A 2LY9A 4R1HA 3SZGA 4A0XA 5B5EC 5LFAA 3MKWB 5FJ8J 1WJ5A 3QPLA 1KU7A 2BW3A 1RESA 1FNNA 2G7HA 4EGYA 1USSA 3GTMJ 4GGGA 1FP2A 3MFKA 2BY3A 2F5DA 2VQLA 4HEA2 4KNYA 1T0FC 3HGYA 4I99C 3CDHA 2WB1N 2L0KA 2F4MB 1J59A 4JBAA 2EILH 4X1EA 2PJRA 1XMAA 3HOWJ 4MFDA 4CHUA 1MJBA 2OD5A 3C18A 1JKOC 2EBIA 3LQQA 1UJ8A 3E0JB 3S1RJ 1ETVA 1YLFA 3I9V2 1LNWA 2O5RA 3EQLF 2DPDA 2KRFA 1OISA 2XV4S 1W0TA 1X4OA 1R6RA 2VODA 4OIOF 1YE9A 3GTLJ 3G3ZA 5J6XA 1FT9A 1GXQA 2DQLA 5EGOB 2DXIA 4RM2A 1R5GA 3JTGA 2MG4A 1JTXA 2DFFA 3GCMA 2LY1A 1DGRM 3DEUA 3WTWC 4PSXA 3OV8A 3NQOA 2EFPA 3EUHC 2DT5A 4PUSA 4ASNA 3ZGKA 2JVGA 1UB9A 1U8RA 1JUMA 3BWGA 5DD8A 2CJJA 3GTJJ 4A3KJ 1O3QA 1LUJB 2BY2A 2WTEA 3R0AA 5AIQA 1HLVA 3GVAA 2JA2A 2ISYA 1ZHFA 2VJJA 2HVQA 3MD2A 5F04A 2M4KA 4IJAA 4TV7A 4UB6C 3FM5A 1YJ9I 2AS5F 5M3MJ 1A6IA 4IKFA 1Z7UA 2VPLA 2RQPA 3OYAA 2JA8J 4HSTA 1IV8A 5L3EA 5D6FA 4ENJA 3KFWX 1LE8A 4IHXA 4LLGF 1XSVA 1SFEA 2UUZA 2VIXA 1RR8C 1G2HA 1YOVB 3HC7A 2JQ7A 2XF5A 4DZJA 1LDJA 4RB2C 2BZTA 3RJPA 5IYDJ 2VQHA 4BYYA 1F5TA 1W7PA 3QWLA 4UV8A 1PDNC 2IGMA 4NC7A 1X2MA 5GP9A 2R7XA 1OCCH 3RSNA 4UUTA 1EF4A 1U3EM 1MH3A 2XVCA 5DM6F 1T39A 5J8FA 2OQGA 1A31A 4CZZA 1EH6A 2E1OA 2HPMA 3IKTA 2IS6A 1AHDP 2ETHA 1XG1A 2H94A 3H5AA 1RUNA 5ILUA 4OINF 2LG4A 4PJLA 2KZVA 2QUFA 2OBPA 5FKOA 5EG0A 3HL2A 3DP7A 5E17F 3I59A 1ENHA 4QWQA 1HDDC 3V4GA 2M7BA 3VODA 2IRFG 1VNDA 2VN2A 2K9LA 2CUEA 2HGCA 2Z33A 3I5UA 3QRFF 4EM1A 2GA1A 1Z3YA 4I6ZA 1YTYA 1DDNA 3GTGJ 2F5CA 4J19A 5EYRA 3MZYA 2P7VB 2P0WA 3CCVI 2IAIA 1WPKA 4Q48A 1HBXG 1USTA 4II2A 2CUJA 2HZDA 3W6KB 2ELHA 2M1BA 2VT2A 5GTHC 1IG7A 4CYCA 3O2PE 2Y9ZA 3NWTA 4BJTA 2QM3A 2VBWA 3H0GJ 3WGHA 1Z6RA 3QU3A 1AKHB 1V4RA 3T8TA 2RNJA 3BCAA 4QPQA 2FNPA 3H3UA 4AWXB 4NUBA 3OYBA 2ESHA 2M4GA 5F1RA 2XIGA 4A6DA 5CQGA 1X58A 3CCYA 3DQVC 1KYWA 1Z1DA 1ZN2A 3I64A 2CO5A 3KYCB 2DODA 2HDCA 3CO6C 2BY0A 3G4SI 2V9PA 2KMUA 2XSDC 2B63J 2JT1A 1RR7A 4OIQF 2KP6A 2FEZA 5TRDA 2LSOA 2YUSA 4QSHA 3D5RC 1TLHB 3FBNB 4HRIA 1R4MB 2OA4A 3G2BA 4BE2A 4LB5A 2R5YA 1YRNB 3KLOA 5JI6A 3I4NJ 1TWHJ 3BLYA 3H92A 2FBKA 4B44A 1XCVA 4HDUA 2UXXA 1WJCA 1OCRH 1FX7A 1TQIA 1J5YA 3OIOA 2EH3A 1HDPA 4A3CJ 2Y0SN 3M4OJ 1HOMA 3I53A 4JX4A 4XLHA 1PUFB 4I09A 3QYBA 4F3QA 4FTHA 2OCCH 4ANJA 5ICEA 4XLPF 4PGGA 2W25A 4WXHA 2ID3A 2QSHX 3E7LA 3IV5A 2X1EA 2ZO4A 2LVSA 4LOCA 4PJNA 2V1DA 3KP3A 2C6YA 4MIMA 3PM1A 2DMPA 5FFZA 4XLFA 4G9YA 5LHHA 4II3A 5DYMA 3ZQIA 2QBYB 3K4JA 3JSOA 1R1TA 4WK8F 1T56A 4U7DA 3CLQA 3JRFA 4NHJA 4I01A 1D5YA 4GYIA 4OAZA 3OOPA 1FPQA 3PNTA 1RNLA 3DBHB 3ZQ7A 4AYBN 3Q0UA 1L0OC 2VQCA 2ZNZA 3EYYA 5KK1A 4ABZA 4CCLA 1IV6A 1H8AC 2VLAA 3ZP5A 1D0YA 2NVTJ 1A6QA 2OAZA 4N4NB 4LIVA 4CH7A 1I6XA 2CG4A 3IUOA 4I02A 5KAFC 3AG4H 4BJ6C 5CPRB 3BOQA 3FHZA 1JT6A 1SD5A 3GZ5A 3L2QA 2V6CA 3J7AO 1UCRA 5D8KB 3GFMA 3LOCA 3K6GA 4DJAA 3M9AA 2NYXA 1XGSA 2J5PA 2O8XA 2OZUA 4HA8A 4A3GJ 2RREA 2E5ZA 2N8GA 1J7KA 2LF8A 2GAUA 1O7LA 1T98A 1UHMA 2EA4A 4BXFA 4BHBA 1KU9A 1I39A 1K83J 1YG2A 3SDBA 2XDVA 2QZ8A 1HKTA 1HSTA 3IAS2 3OYHA 3V7CA 4L9TA 3HTSB 2VL8A 2VOOA 1MMSA 3QODA 2R7TA 3JAMK 1ZGJA 2ZCWA 3HZJA 4XBFA 2DFEA 3I58A 1BOAA 1BM9A 4M9XA 3E5QA 2EK5A 2LY2A 4HQMA 2ESNA 1MD0A 2L7KA 1WI3A 3J81K 2GM4A 2VC1A 2K4BA 3S15J 2DT7B 5K5RA 4O5VA 1JUPA 2HNHA 3WG7H 2HS5A 1W1WE 2CH0A 2LYCA 4Y4RA 1TTYA 5FD6A 1X4PA 4PDKA 2MGQA 4S05A 2QYOA 5K5OA 1FYMA 3TO9A 4OIPF 1APLC 4G8XA 2ZSHB 4CA0A 2E36A 3I56I 1BIAA 4UVAA 4YFNF 2R3SA 2A05A 4M6VA 3EPZA 2EIMH 2DTRA 2IA1A 1Z05A 2BHYA 1VQ6I 3RI4A 3GZNB 3ZMVA 4I7HA 5JLWA 4P96A 3F21A 2K40A 1ZG5A 3SXYA 1MBGA 3VPRA 4BU2A 3RYPA 3P9KA 3K4NA 1IDYA 1KONA 4YEJA 2CW0F 2KL4A 1R1VA 1P4WA 2FNAA 2PX9A 4V2FA 4XQFA 3TEDA 4A3FJ 2JVHA 3RKXA 3E97A 5LHGA 4D9JA 4A2UA 4BXUA 4F93B 2L9RA 2VKHA 1YX5A 3BTJA 5BQTA 1IXRC 1YW7A 3RQ4A 2DFHA 4FETA 1U2WA 4P9UA 2DMUA 2P7CB 3O3KA 5C4JJ 1UG0A 4GRIA 3HOYJ 3OYGA 2WY8Q 4KN7X 3M8FA 4LG0B 5M5YJ 1XMKA 2EWNA 2IXSA 2EJRA 1G8XA 4E7ZA 1UHSA 1YW9A 3GTQJ 4G12A 2HOAA 2I5UA 5FO5A 4O3MA 2DCEA 4IRIA 3T0YA 4A0ZA 1DQUA 4X0GA 4HX8A 3H1CA 3CMAI 4M3BA 1ZGWA 2JA7J 3S14J 3S2DJ 3DCFA 2HYFA 1O57A 1DP7P 1WI9A 4AIDA 3AKZA 3VYUB 3FXRA 4PJ0C 2NOGA 1Z0XA 2OCEA 4M71A 2FSWA 4J01A 2R7OA 3F22A 2XAJA 4B1RA 3IP4B 3BTCA 1OYWA 2RNGA 2Y48A 5JHFA 5ICFA 4CDGA 4ZZDA 3BZ6A 4A3EJ 5IPAA 4I76A 2VPRA 1IC8A 2FBIA 4IOCF 3SJMA 4E4HA 2M87A 4LD5A 3TDUC 4ZYDA 1FBSA 1SVMA 2IGNA 2CSOA 4L5JA 4BY7J 2FUG2 4PGHA 2DYSH 3A01B 2A5WA 5J4YA 1D0ZA 4UNOA 2ME0A 1CQTA 1Y0UA 2E5NA 1N75A 2E71A 2DFIA 4OWRB 1S3JA 2M5WA 1YO5C 3GYHX 1VQPI 2X48A 1LFUP 1QZZA 5E3NA 3OS0A 1T2KA 1NHAA 3MZHA 5LGUA 4AIKA 1BR4A 3IHUA 4XRSA 3P9CA 1A5JA 2KPMA 3LSGA 3OL4A 5IP6A 2JN6A 4UUVA 3LSTA 4A5MA 4KIBA 4RBOA 2BE5F 3Q0WA 4RM3A 5IT9Z 1J9IA 5KAIC 2IP2A 2OJED 3W2VA 1SANA 3LNQA 2LKSA 2X6XA 4RLQA 2DMNA 3P9IA 1ON2A 4DNCA 4FISA 1BI2A 1WHUA 1YQAA 3CUQC 3VWBA 4CSWA 1ZR4A 2XRLA 1GUUA 5CVJA 5EEAA 2VOPA 1POGA 4E7IA 5E1XA 4DYQA 3QOPA 4L0YB 1Q1VA 1RRJA 2V4JC 3S32A 3K10A 2A07F 3ASOH 2W48A 2QQ8A 1ERDA 5K7FA 1HW1A 3CUQB 2XAHA 1X1DA 4KN4X 3RCOA 2ID6A 2KDOA 2XAFA 2IGKA 2DMTA 3HKZN 3KETA 4EQQA 1ZRFA 5FFXA 4Y33A 2CWEA 3ML6A 3RTRA 1OMIA 2DPUA 1MKMA 2P8TA 5J1RA 3J81Z 1ZREA 3ABTA 2V9KA 1SMYF 2GOXB 2QSGX 2F4IA 3C7JA 1QNTA 2LP0A 3VYRB 1VQ9I 2GLOA 2CQQA 1D1BA 1QU3A 4RGXA 1TWAJ 3H35A 5K7ZA 2NS0A 3RIRA 4B3AA 4XIDA 3SYTA 1T08B 4RS8A 4U87A 2DQRA 3FXLA 3KX2A 1SD7A 1D8KA 2F4OB 3BR1A 1GXPA 1ZQ3P 2O8KA 4WXDA 1H9GA 3OS2A 3TL4X 4YRVA 3FXKA 4AVPA 3BR5A 2H8RA 3CESA 2DO7A 4B8XA 1VQ8I 1MBHA 2D1VA 5J1UA 3K0LA 4JK1X 3NAUA 3LSHA 3A2KA 1WJDA 5HLHA 3GEZA 3E3VA 5F08A 4ZTJA 3Q5FA 3ZCOA 1WJEA 1JHFA 1QZYA 3OWTA 4I98B 4M3GA 3KP7A 3H0DA 3HEFA 2VBZA 2WV1A 1U5TA 1LFPA 3IKVA 3LMMA 4M9SA 2GXAA 3C3WA 5C3EJ 2ZJ2A 1D8JA 5J47A 1W36C 1X3UA 2JPCA 1ZRCA 2E19A 5HS8A 4LLLA 5K7HA 3CCQI 1S72I 2NOJB 5DCMB 2HYGD 2M2EA 1X19A 4XKVA 4HPQA 1P92A 2RC4A 2K7LA 4AYBA 4KIGA 4AIHA 3MKYB 2MFZA 4M74A 3CF2A 3MAJA 1XDUA 5CJ9A 2Z3YA 1BJAA 1EH8A 2K4JA 5E20A 2MD5A 1XDSA 4D5FA 1MIJA 2Q0OA 4B48A 4L5IA 1VQ5I 2YS9A 2P6TA 5D5VB 1JI8A 1IN5A 1QHGA 1N77A 3BR3A 3ZQCA 1FOYA 1ETQA 2E1MC 4E70A 3BR2A 1K79A 3RPUD 1J2XA 3WTXC 1JXSA 4I2OA 1Q1HA 3K2ZA 4MGRA 2R7DA 3U9GA 3CQZJ 2EPFA 4XK4A 2KT0A 2OC6A 3F8FA 3MQ0A 3ZMUA 4KIFA 2J5OA 1RUOA 2ZBKA 2E1MB 2HTSA 1TL8A 4LG3A 4Q5SF 1ZAOA 2IS2A 2YU9J 3MKZA 3OSGA 3PL8A 2QQBA 2H27A 3A0HC 4CZCA 2DA3A 5E79C 1QHHD 2O3FA 1K61A 3CTAA 4XN0A 3S1MJ 1TT0A 3HOXJ 3R61A 3FXQA 1FC3A 2D1HA 4RGRA 2Z99A 4M3DA 2KIMA 2EQRA 5E1ZB 4HF1A 3CC4I 3H9QA 2CMPA 2OUMA 1K78B 1GV2A 3AG3H 3F3XA 3MWMA 1OR7A 5E3OA 2PG4A 1UG2A 4L9NA 2F5FA 1IN8A 2H6BA 1SVOA 1YRNA 1TWGJ 4HV6A 2P5KA 4G7OF 3HOTA 2KZGA 2V1NA 4OOIA 4P1WA 2ZMEC 4RAYA 1Y8RB 2MABA 1B4AA 1SFUA 1BW5A 2K02A 4L18B 1NG6A 2XHKA 2LD5A 3E5XA 3I4PA 3WE3A 2ZXJA 3H3ZA 2GBYA 3WHCA 4G7HF 5LHIA 3LFUA 2XF6A 4ESFA 2VKDA 1KZHA 3ERMA 3HSFA 3J7ZI 2L7FP 3DEEA 1B8IA 2BEOA 5LLQA 2X1DA 4BBRJ 1KGSA 2DA1A 4ZDOA 1OKRA 2ECBA 3L7WA 1U9NA 1VI0A 2AXLA 3HJEA 2M30A 4XLNF 1GV5A 4YIIA 1TC3C 4XSXF 1ONVA 1R58A 4CCMA 2Z9OA 3FXUA 4PFOA 5FKLA 3IWZA 4WX9A 3HGGA 5KVRA 3TOAA 1V5FA 3LA3A 3G71I 2OQRA 1HA8A 4LMYA 1YYVA 1BBYA 2IJLA 4J00A 2A6EF 1WJBA 2EZLA 2X1CA 1JHHA 4KISA 2X6YA 3BTLA 5F0HA 2EB7A 2BY1A 5BPDA 3SFIA 3FK7A 3CCSI 3S2HJ 4CICA 3OY9A 2W24A 5A2QK 1XCBA 1HW2A 3GLLA 4XICA 3CC7I 4KFCA 2ZNYA 2QKLB 5LRSA 1JUSA 3TP0A 4CO8A 2ACJA 4BHCA 4CCKA 2GXBA 1ZTRA 2R7FA 4A69C 3DBRB 1T95A 5IOZA 1IRXA 2K27A 5D4RA 1BR1A 4FQGA 3DEWA 2O0YA 1TZLA 4BH9A 5ILVA 2P5LC 5IOYA 3HUGB 5D6EA 1Z3XA 1WRJA 1VZ0A 1X1PA 4YIRX 1DPRA 3L2VA 3PO2J 4G94A 4ZH4F 2Q1ZB 2VBYA 5HVQC 1VQKI 3D0SA 3DFGA 4GDFA 2KQRA 2O9LA 1O3RA 5TGTA 2QEXI 1XMXA 1MGTA 3OYIA 5LGTA 2QSFX 3PSFA 2OPTA 2BOLA 2KIQA 5BNGA 1LVAA 2MLGA 1F43A 2XGEA 1DU6A 1STZA 3BDDA 4CGZA 4LK0F 4MO7A 3BC8A 4Y52J 3HM5A 4KICA 3V7RA 1WKMA 3PNVA 3PQJA 5DCFA 1ULYA 4F55A 3KP2A 1P9QC 3HPHA 3JRDA 1SC7A 1OYYA 3COAC 5HS7A 2L3DA 4Y17A 2CV2A 2MD0A 5JR3A 3ONQA 2DA5A 2LNBA 1BN5A 3K4MA 1UELB 3CJQB 1WCMJ 3KCCA 3WU0A 4XKBA 5IP7J 5EF6A 3P5JA 4BY1J 3GO5A 3JRHA 3ERED 3BG3A 4G6DA 3CD6I 3GTKJ 5K1YA 3HRTA 4EMSA 2H6CA 1SD4A 2RVCA 3JRCA 5H6RA 1G3SA 2FXAA 1BOBA 1NK3P 3HKZA 3EETA 3JRAA 3UR3C 3PJRA 4BUPA 1BC8C 1S7AA 4BDYA 3JRIA 3IL2A 5D5XB 1S6LA 3VDXA 1AWCA 3WTZA 2KRCA 2KLOA 4EJTA 3DLLF 4PSWA 2K9MA 1L3LA 1CF7B 4MHGA 4LG0A 4XORA 2XB0X 1ZKGA 2XPUA 2XAUA 2DMQA 1MMAA 4E7LA 1YIJI 3DLAA 2UV1A 4HBLA 4NBQA 5D5WB 1YJWI 3GW2A 3L2RA 2WAQA 5JVGF 3BPVA 3G1LA 4FX4A 2HVSA 3KEQA 1HKQA 5IYCJ 1R71A 2FF4A 4FE7A 4E7HA 2EINH 2BXZA 2MSYA 4IRHA 4BEHB 5E8IA 1FSEA 3BQZA 2YSRA 2BXYA 1P7IA 1H88C 3HBLA 1G3TA 3Q9SA 3CO7C 3CCJI 2HPIA 4UY8I 5LEJA 5JVTA 2M45A 1W36D 4CCJA 3MEXA 2PJRB 2DU9A 3FMQA 2CQ7A 2QQ9A 3AG2H 3K4BA 1LEAA 3GBGA 2D5VA 2HR3A 4ENMA 1JKQC 2LKXA 4EM2A 1MDMA 4ZTFA 3OYKA 1CGPA 3A01A 3A03A 1O7FA 4ZC3A 4Y3OA 2VE9A 3ECOA 3PUBA 4C2UA 1ACIA 2LBFB 4EEFG 2M34A 1H0MA 2CV1A 2K9QA 4GO1A 2JPBA 2Y0MA 3CCEI 2WV0A 1D1CA 3HSRA 4ZDPA 2H09A 2M8GX 3OMYA 3TO6A 3JW4A 3LSPA 3A4CA 1R23A 1C0WA 4E7KA 1F9NA 2LLKA 3OL3A 1SMTA 3SEQA 2E34A 2FRHA 2L4MA 2PI0A 3F23A 2O61A 4M9ZA 4NC6A 2JUCA 1WSUA 5LBQA 4B47A 1UZCA 3F9KA 1XS9A 3MZ8A 2HXIA 3L2WA 4A0YA 3LSKA 5D5UB 3J7YJ 3M7GA 3RYRA 2KFDA 2A3SA 4A12A 1QGPA 3GFJA 1MMNA 3OYNA 2LF7A 4LITA 4FCYA 5CVUA 3CP8A 1VTNC 4B4CA 5CYVA 1BIBA 2FBHA 1I1GA 1RIOH 4D7NA 3C2GA 5ICGA 1IRGA 1ZLKA 2XUBA 4GFBA 1OFCX 2YR2A 2ZJQF 4QPOA 4E7SA 4KYWA 1TT5B 4BAYA 3LA2A 1UMQA 3L9FA 5EEGA 2XSJC 2EV0A 2KJBA 2XGCA 2W57A 1O3SA 5IYBJ 2Y69H 3J7AY 2K5CA 1UHWA 1W7PB 4BHPA 5DS9A 4LB6B 1ZYRF
chains in the Genus database with same CATH topology
3TKYA 2HQRA 3FWEA 2EFNA 4YFKF 1E17A 2W85A 4PCQA 1WQ2A 1HXDA 5L3CA 3E6BA 3PFIA 2HTJA 2Q2EA 3WU1B 4KA4A 2GA2A 3U2RA 1EH7A 5FLXK 2A5YB 4RB3C 5D4SA 2YX7A 4IPAA 2WC2A 2OZ6A 1ZARA 2XAGA 2NNNA 4G6QA 1TNTA 4N9HA 3VFZA 1S29A 3I71A 4R8HA 5FD5A 3ULQB 3HSEA 1S7OA 5FGMA 5HDGA 1B9MA 3O6BB 4KT5C 3ZPLA 4ZZLA 4GCVA 1U78A 4BNCA 1SAXA 2FOKA 5DD4A 2MLKA 3WGIA 2XRNA 2L02A 1IZ1A 2PEXA 1G6NA 1Z91A 1I27A 5LGNA 4U0VA 1K6OA 5ICCA 3FM3A 1PP8F 3K1NA 3FF5A 4EJOA 3ZMTA 3SFZA 5HOOA 4N9IA 2COMA 2QLZA 1K78A 4M6YA 1RZ4A 1Z9CA 2TDXA 3JTHA 1FYKA 1T0FA 4FT8A 1F4KA 4ETSA 1GHCA 2MH2A 1G3WA 1FSHA 4XRFA 4KMUX 1P4XA 1XSDA 2MC3A 5JHUA 4GXOA 3JAMZ 5ERIA 4IVNA 3KZZA 4Q4ZF 2ZFWA 5E1WA 4H0EA 3N4MA 1TBXA 2IW5A 2STTA 5D8LB 1W5SA 1H9TA 3BJAA 3DPTA 4LGWA 3ZMDA 1LJ9A 3WTYC 2GQQA 1W4MA 1LDDA 3EUHA 2PN6A 3RDIA 2DI3A 4R79A 1OYIA 2BGCA 2DK5A 4AD9A 1D5VA 3DF8A 1LQ1A 3DXJF 6PAXA 2YU3A 1R5HA 4HF0A 3DKWA 3QP5A 1P4AA 1YW8A 2XKPA 3HUGA 2UWMA 4KMFA 1T38A 2DW4A 4EJVA 4MEXF 4WCGA 2NNYA 4CXFA 2EFWA 3TOBA 2QQAA 4UVBA 2GIVA 3BJOA 2GZWA 3G73A 2V1XA 1ON1A 3KLNA 1T6SA 3B73A 3SHFA 1KQ9A 3F8BA 3GWZA 3WTSC 1IUYA 1FBUA 4LK1F 2EFQA 5BPIA 5DV5A 4XSZF 3HRMA 4FHTA 4RGSA 3ELKA 2GWRA 3IWFA 3BJ6A 4LJZF 5HDKA 4MNUA 1W7PD 3N97A 1TQPA 2X4HA 5BOXA 3QP6A 4BQAA 1IN7A 1IXSB 4HOBA 1QBJA 2A6HF 5BS6A 5E18F 5L3BA 2JSCA 3ROUA 4EV0A 3SZTA 1PUEE 4F7ZA 4O6JA 1FOKA 5H20A 3GFIA 3EDPA 3U1DA 2PMUA 2CFXA 2M8EA 1CF7A 2W84A 2P5VA 2QVOA 5EEHA 1TNSA 1ZH5A 4N0BA 4EVIA 2K86A 2CGPA 2UXNA 3F8CA 2HZTA 3KP4A 4HX4A 2MH9A 5CVVA 2EV6A 4OIRF 5LRRA 2EFOA 1BI0A 2FA5A 3WODF 3IC7A 2ZMEB 3ISPA 3GUDA 4JQFA 3TDZC 3BPXA 1OPCA 2QENA 3NRVA 4WXCA 5F6FA 1FYLA 2QBYA 5AIPA 5DEQA 3VB2A 3GF2A 3I0TA 3WGGA 5HLGA 1QPMA 1FBQA 2E7XA 4LFUA 1BC7C 2ZKZA 1U6GA 5CVRA 3L2CA 2L01A 1FWZA 4HLYA 1GVJA 3L00A 3TGNA 3GLXA 4WF2A 4ON0A 3RKWA 5L3FA 3F6VA 1P6RA 3BP8A 4HF2A 2V9VA 1BI1A 1REPC 1U5TC 3D5LA 1FZPB 4AIJA 3VEPA 1ZRDA 4RB0A 4RGUA 4Y15A 3RPUA 4HAMA 5K5QA 2FQ3A 2PMHA 4L9VA 4EJWA 3E6CC 1U5TB 2JRTA 2YX4A 2XROA 3WTTC 3FMSA 2XKOA 3LA7A 2UZKA 3T5XA 3R60A 2D2WA 4ENKA 1S8NA 3T8RA 3R0JA 5H6QA 1V3FA 2HKXA 2GXGA 3WG9A 1HKSA 3W6JB 4IF4A 5CVIA 2VE8A 3T1BA 1Z6TA 4YFXF 2VT3A 3HRSA 1XGNA 2O6GE 4M72A 5F64A 3ABUA 3FMRA 2FMLA 3TO7A 3FZVA 4NB5A 2KIUA 1QO0D 2FE3A 3V8KA 1K7AA 2VXZA 2YPRA 3BY6A 3CUOA 4EGZA 5E8GA 1ZG1A 2IT0A 1I5ZA 3F72A 3FX3A 3V8LA 3HOSA 4P9FA 5L3GA 2CYYA 3K69A 3GXOA 2V79A 3F8MA 2EA2A 4ESBA 2VONA 1BI3A 3B02A 2RDPA 1R00A 2RV8A 4OMZA 5DDGA 4FX0A 2Y75A 3HIFA 2FMYA 4RAZA 4HV5A 2E1CA 2PLYA 3SZPA 1IN4A 3HTUA 1KQ8A 2Z5UA 1UFMA 4P5OA 4GYGA 4WWCA 3J80K 1XSXA 4A5NA 1AOYA 4S04A 1IW7F 3GZ6A 2HKOA 4ZYEA 3KE2A 4LLNA 2DBBA 2IA0A 4Z2YA 1DPUA 3ZMSA 3KP6A 1SFXA 4K2EA 3V7SA 5J8CA 4KUMA 2BYVE 2WWYA 4Q47A 4RB1A 3QPHA 5A2QZ 4HZFA 4U0WA 2IA2A 2MBFA 1ODDA 1WWXA 1I1SA 1KYZA 4DQ2A 4L9JA 3EYIA 1SD6A 3CLOA 5IT9K 3RPQA 1IRFA 2VC0A 3I54A 2KKOA 3CUQA 1D3YA 1B59A 2A61A 2LKPA 3ZN1A 2LDUA 2ISZA 2NRAC 1XD7A 2DLLA 1XGMA 2ADUA 3LQRA 3CJNA 4MQVA 2HQNA 1LDKB 5CLSA 4MQ9F 3KEOA 4KDPA 3QAHA 2HOEA 5DUIA 3F6OA 2NAZA 1R1UA 2V1UA 1PP7U 2O03A 3I59B 2DK8A 1KU2A 2KJCA 2BV6A 4HX7A 4U7BA 1FY7A 1G3YA 4UV9A 2F5EA 1IXCA 4OU0A 5DCMA 5LEKA 2PFBA 1A04A 3SQNA 2X0LA 3LWFA 4HW0A 4YG2F 3IRQA 3E5UA 4U88A 1J75A 4L0ZB 4M6XA 1B9NA 3BROA 4HYEA 1IF1A 2RGVA 1YIOA 1XN7A 1MJ9A 2G7UA 4B09A 1IN6A 2D45A 3NEUA 4ESJA 3GFLA 1B1BA 3REOA 3DPLC 2OU2A 3J80Z 5TJJA 4ENNA 2FU4A 3WTVC 1YS7A 2E1NA 4IHTA 3M8EA 2KIFA 3HYIA 4M73A 4CYDA 2P6SA 4MTEA 1TQMA 2G9WA 3WE2A 1MDMB 2HEOA 4G7ZF 1TW2A 2E7WA 5HS9A 1J0RA 4IRGA 2STWA 1R36A 2XGXA 1ZG3A 4ZYHA 3LFKA 1R7JA 1DUXC 2IPQX 2RKHA 3GX4X 5FB2A 5HDNA 2L4AA 3Q9VA 3QPTA 1HW5A 3HHHA 2XAQA 1XB4A 1FLIA 1QQIA 4UHTA 4PZJA 2JZYA 2ZMEA 2JTVA 1YS6A 4HLXA 2XASA 2MA3A 3IRRA 2L54A 4IHSA 1O3TA 2IVMA 3S2WA 4MTDA 2VBXA 1HSJA 2F2EA 3V8JA 1ZLJA 2CQKA 3PQKA 1W5TA 1FP1D 3E6MA 1JGSA 4HDVA 1KQ0A 5ED4A 2A68F 4I0AA 3HRUA 1ZGAA 2QWWA 5DUKA 3KZYA 5ILSA 1LEBA 4D0PA 4A6EA 1F1ZA 1IAWA 4MEYF 3JSPA 2PJPA 3E6DA 5FLXZ 4HQEA 1TW3A 4EJUA 2A69F 4Y13A 1MZBA 3R6SA 3K9TA 4ZYGA 1HQCA 4YIFA 4IXAA 2BBYA 3R4KA 2DAOA 1E2XA 1YFHA 5HLIA 3KP5A 4EM0B 1KA8A 1MJAA 3RKYA 1JE8A 3LAJA 1LB2A 3QU6A 2RN7A 1R22A 5BMZA 2Q8KA 3K1MA 2P4WA 5AONA 1P2FA 4U0YA 3TQNA 4I0BA 3ZN0A 3MCZA 5JFRA 4QLCU 4UVCA 3M1EA 2EV5A 2PQ8A 3F8NA 3HHGA 3ZMZA 4UXNA 1XGOA 5L3DA 3L09A 4P55A 3AAFA 5IT3A 3LAPA 3C1DA 1G4DA 1KU3A 3DV8A 1RI7A 2B0LA 3K1PA 3ECHA 2HWVA 3P7NA 2HFHA 4NQWA 2PBIA 3VOEA 4OMYA 1B6AA 3WTUC 1EV7A 4A0XA 4R1HA 1KU7A 1FNNA 2G7HA 4EGYA 1USSA 4GGGA 1FP2A 3MFKA 2F5DA 4KNYA 3CDHA 1J59A 4JBAA 1XMAA 4CHUA 1MJBA 2OD5A 3C18A 3LQQA 1YLFA 1LNWA 3EQLF 2DPDA 2KRFA 2XV4S 2VODA 4OIOF 3G3ZA 5J6XA 1FT9A 1GXQA 2DQLA 1R5GA 3JTGA 3DEUA 3WTWC 3OV8A 3NQOA 2EFPA 2DT5A 4ASNA 1UB9A 1U8RA 3BWGA 5DD8A 1O3QA 3R0AA 2WTEA 5AIQA 3GVAA 2ISYA 1ZHFA 4IJAA 4TV7A 3FM5A 2AS5F 1Z7UA 2RQPA 5L3EA 5D6FA 4ENJA 3KFWX 4LLGF 1XSVA 1SFEA 1LDJA 4RB2C 3RJPA 4BYYA 1F5TA 1W7PA 4UV8A 1PDNC 1U3EM 1T39A 2XVCA 5J8FA 2OQGA 4CZZA 1EH6A 3IKTA 2ETHA 2H94A 1RUNA 5ILUA 4OINF 2QUFA 2OBPA 3DP7A 5E17F 3I59A 4QWQA 3V4GA 3VODA 2IRFG 2VN2A 2HGCA 2Z33A 3I5UA 3QRFF 4EM1A 2GA1A 1YTYA 1DDNA 2F5CA 3MZYA 2P7VB 4Q48A 1HBXG 1USTA 3W6KB 2ELHA 2M1BA 2VT2A 3O2PE 2QM3A 2VBWA 3WGHA 1Z6RA 3QU3A 1V4RA 3T8TA 2RNJA 4AWXB 2FNPA 3H3UA 2ESHA 5F1RA 2XIGA 4A6DA 3DQVC 1KYWA 1Z1DA 1ZN2A 3I64A 2CO5A 2HDCA 3CO6C 2JT1A 4OIQF 2FEZA 5TRDA 2LSOA 1TLHB 2OA4A 4LB5A 3KLOA 5JI6A 3H92A 2FBKA 1XCVA 4HDUA 2UXXA 1FX7A 1TQIA 1J5YA 3I53A 4I09A 4XLPF 5ICEA 4PGGA 2W25A 4WXHA 2ZO4A 2V1DA 3KP3A 2C6YA 5FFZA 4G9YA 5LHHA 5DYMA 2QBYB 3JSOA 1R1TA 4WK8F 4U7DA 4NHJA 4I01A 4GYIA 3OOPA 1FPQA 1RNLA 3ZQ7A 1L0OC 3EYYA 2ZNZA 5KK1A 3ZP5A 2OAZA 1I6XA 2CG4A 4I02A 3BOQA 3FHZA 1SD5A 3GZ5A 2V6CA 3J7AO 1UCRA 5D8KB 3GFMA 3M9AA 2NYXA 1XGSA 2J5PA 2O8XA 2OZUA 4HA8A 1J7KA 2LF8A 2GAUA 1O7LA 1T98A 1UHMA 2EA4A 4BHBA 1KU9A 1YG2A 2QZ8A 1HKTA 1HSTA 3V7CA 4L9TA 3HTSB 2VOOA 3JAMK 1ZGJA 2ZCWA 4XBFA 3I58A 1BOAA 1BM9A 4M9XA 3E5QA 2EK5A 4HQMA 2ESNA 1MD0A 3J81K 2VC1A 2K4BA 5K5RA 4O5VA 2HS5A 1TTYA 5FD6A 4PDKA 4S05A 2QYOA 5K5OA 1FYMA 3TO9A 4OIPF 4G8XA 1BIAA 4UVAA 4YFNF 2R3SA 2DTRA 2IA1A 1Z05A 3RI4A 3ZMVA 4I7HA 4P96A 3F21A 1ZG5A 3SXYA 3RYPA 3P9KA 2CW0F 1R1VA 1P4WA 2FNAA 5LHGA 3RKXA 3E97A 4A2UA 4BXUA 5BQTA 1IXRC 1YW7A 1U2WA 4P9UA 2P7CB 3O3KA 4KN7X 3M8FA 4LG0B 1XMKA 2EWNA 2EJRA 1YW9A 4O3MA 5FO5A 4IRIA 3T0YA 4A0ZA 4HX8A 2HYFA 1O57A 1DP7P 1WI9A 3FXRA 4M71A 2FSWA 3F22A 2XAJA 1OYWA 2Y48A 5ICFA 4CDGA 4ZZDA 3BZ6A 2FBIA 2M87A 4LD5A 3TDUC 4ZYDA 1FBSA 2CSOA 4L5JA 4PGHA 4UNOA 1Y0UA 2DFIA 1S3JA 2M5WA 1YO5C 3GYHX 1QZZA 1T2KA 1NHAA 3MZHA 5LGUA 4AIKA 3IHUA 3P9CA 4UUVA 3LSTA 4A5MA 4KIBA 1J9IA 2BE5F 5IT9Z 2IP2A 3P9IA 1ON2A 4DNCA 1BI2A 1YQAA 3CUQC 5CVJA 2VOPA 5E1XA 3QOPA 4L0YB 2A07F 1HW1A 3CUQB 2XAHA 4KN4X 2XAFA 3KETA 4EQQA 1ZRFA 5FFXA 2CWEA 3ML6A 3RTRA 1OMIA 2DPUA 1MKMA 2P8TA 3J81Z 1ZREA 3ABTA 1SMYF 3C7JA 1QNTA 4RGXA 2NS0A 3RIRA 4RS8A 2DQRA 1GXPA 1SD7A 1D8KA 4WXDA 1H9GA 4AVPA 2DO7A 4B8XA 2D1VA 3K0LA 4JK1X 5HLHA 3GEZA 3E3VA 3Q5FA 1JHFA 1QZYA 4I98B 3KP7A 2VBZA 1U5TA 3IKVA 4M9SA 3C3WA 2ZJ2A 1D8JA 1X3UA 2JPCA 1ZRCA 5HS8A 4LLLA 5DCMB 2HYGD 1P92A 2RC4A 2K7LA 4KIGA 4AIHA 4M74A 3MAJA 1XDUA 5CJ9A 2Z3YA 1BJAA 1EH8A 2K4JA 5E20A 2MD5A 1XDSA 2Q0OA 4L5IA 5D5VB 2P6TA 1IN5A 4E70A 1K79A 1J2XA 3WTXC 1JXSA 4I2OA 1Q1HA 3K2ZA 4MGRA 2R7DA 3U9GA 3F8FA 3MQ0A 3ZMUA 4KIFA 2J5OA 1RUOA 2ZBKA 2HTSA 4Q5SF 1ZAOA 2QQBA 2H27A 2O3FA 3CTAA 3R61A 3FXQA 1FC3A 2D1HA 4RGRA 2Z99A 2KIMA 5E1ZB 4HF1A 1K78B 3F3XA 3MWMA 1OR7A 2PG4A 4L9NA 2F5FA 1IN8A 2H6BA 4HV6A 2P5KA 4G7OF 3HOTA 4OOIA 4RAYA 1SFUA 1B4AA 2K02A 4L18B 2XHKA 3E5XA 3I4PA 3WE3A 2ZXJA 3H3ZA 4G7HF 5LHIA 4ESFA 3HSFA 2BEOA 5LLQA 1KGSA 1OKRA 3L7WA 2AXLA 2M30A 4XLNF 4YIIA 4XSXF 1ONVA 1R58A 2Z9OA 3FXUA 3IWZA 4WX9A 5KVRA 3TOAA 3LA3A 2OQRA 4LMYA 1YYVA 1BBYA 2IJLA 2A6EF 1JHHA 2EB7A 5BPDA 4CICA 2W24A 5A2QK 1XCBA 1HW2A 4KFCA 2ZNYA 5LRSA 4CO8A 2ACJA 4BHCA 2GXBA 2R7FA 2K27A 5D4RA 2O0YA 4BH9A 5ILVA 2P5LC 5D6EA 1WRJA 1DPRA 5HVQC 4ZH4F 2VBYA 4G94A 3D0SA 3DFGA 1O3RA 1MGTA 5LGTA 1LVAA 2MLGA 1STZA 3BDDA 4CGZA 4LK0F 4KICA 3V7RA 1WKMA 3PQJA 5DCFA 1ULYA 3KP2A 1OYYA 3COAC 5HS7A 2L3DA 4Y17A 5JR3A 2LNBA 1BN5A 3KCCA 3WU0A 3GO5A 3ERED 4G6DA 5K1YA 3HRTA 4EMSA 2H6CA 1SD4A 2RVCA 5H6RA 1G3SA 2FXAA 3EETA 1BC8C 1S7AA 1AWCA 3IL2A 5D5XB 1S6LA 3WTZA 4EJTA 1L3LA 1CF7B 4MHGA 4LG0A 4HBLA 5D5WB 3GW2A 3BPVA 4FX4A 3KEQA 1HKQA 2FF4A 4IRHA 5E8IA 1FSEA 2YSRA 1G3TA 3Q9SA 3CO7C 5LEJA 5JVTA 2M45A 3MEXA 2DU9A 3FMQA 2QQ9A 1LEAA 2HR3A 4ENMA 4EM2A 1MDMA 1CGPA 1O7FA 2VE9A 3ECOA 1H0MA 4GO1A 2JPBA 2Y0MA 2WV0A 3HSRA 2H09A 3TO6A 3JW4A 1R23A 1C0WA 1F9NA 1SMTA 2FRHA 2L4MA 2PI0A 3F23A 2O61A 4M9ZA 1WSUA 5LBQA 4A0YA 5D5UB 3M7GA 3RYRA 2A3SA 4A12A 1QGPA 3GFJA 1VTNC 2LF7A 5CVUA 5CYVA 1BIBA 2FBHA 1I1GA 1RIOH 5ICGA 1IRGA 1ZLKA 2XUBA 2YR2A 4KYWA 4BAYA 3LA2A 3L9FA 5EEGA 2EV0A 2KJBA 2W57A 1O3SA 1UHWA 1W7PB 4BHPA 4LB6B 1ZYRF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TKY A;  2HQR A;  3FWE A;  2EFN A;  4YFK F;  1E17 A;  2W85 A;  4PCQ A;  1WQ2 A;  1HXD A;  5L3C A;  3E6B A;  3PFI A;  2HTJ A;  2Q2E A;  3WU1 B;  4KA4 A;  2GA2 A;  3U2R A;  1EH7 A;  5FLX K;  2A5Y B;  4RB3 C;  5D4S A;  2YX7 A;  4IPA A;  2WC2 A;  2OZ6 A;  1ZAR A;  2XAG A;  2NNN A;  4G6Q A;  1TNT A;  4N9H A;  3VFZ A;  1S29 A;  3I71 A;  4R8H A;  5FD5 A;  3ULQ B;  3HSE A;  1S7O A;  5FGM A;  5HDG A;  1B9M A;  3O6B B;  4KT5 C;  3ZPL A;  4ZZL A;  4GCV A;  1U78 A;  4BNC A;  1SAX A;  2FOK A;  5DD4 A;  2MLK A;  3WGI A;  2XRN A;  2L02 A;  1IZ1 A;  2PEX A;  1G6N A;  1Z91 A;  1I27 A;  5LGN A;  4U0V A;  1K6O A;  5ICC A;  3FM3 A;  1PP8 F;  3K1N A;  3FF5 A;  4EJO A;  3ZMT A;  3SFZ A;  5HOO A;  4N9I A;  2COM A;  2QLZ A;  1K78 A;  4M6Y A;  1RZ4 A;  1Z9C A;  2TDX A;  3JTH A;  1FYK A;  1T0F A;  4FT8 A;  1F4K A;  4ETS A;  1GHC A;  2MH2 A;  1G3W A;  1FSH A;  4XRF A;  4KMU X;  1P4X A;  1XSD A;  2MC3 A;  5JHU A;  4GXO A;  3JAM Z;  5ERI A;  4IVN A;  3KZZ A;  4Q4Z F;  2ZFW A;  5E1W A;  4H0E A;  3N4M A;  1TBX A;  2IW5 A;  2STT A;  5D8L B;  1W5S A;  1H9T A;  3BJA A;  3DPT A;  4LGW A;  3ZMD A;  1LJ9 A;  3WTY C;  2GQQ A;  1W4M A;  1LDD A;  3EUH A;  2PN6 A;  3RDI A;  2DI3 A;  4R79 A;  1OYI A;  2BGC A;  2DK5 A;  4AD9 A;  1D5V A;  3DF8 A;  1LQ1 A;  3DXJ F;  6PAX A;  2YU3 A;  1R5H A;  4HF0 A;  3DKW A;  3QP5 A;  1P4A A;  1YW8 A;  2XKP A;  3HUG A;  2UWM A;  4KMF A;  1T38 A;  2DW4 A;  4EJV A;  4MEX F;  4WCG A;  2NNY A;  4CXF A;  2EFW A;  3TOB A;  2QQA A;  4UVB A;  2GIV A;  3BJO A;  2GZW A;  3G73 A;  2V1X A;  1ON1 A;  3KLN A;  1T6S A;  3B73 A;  3SHF A;  1KQ9 A;  3F8B A;  3GWZ A;  3WTS C;  1IUY A;  1FBU A;  4LK1 F;  2EFQ A;  5BPI A;  5DV5 A;  4XSZ F;  3HRM A;  4FHT A;  4RGS A;  3ELK A;  2GWR A;  3IWF A;  3BJ6 A;  4LJZ F;  5HDK A;  4MNU A;  1W7P D;  3N97 A;  1TQP A;  2X4H A;  5BOX A;  3QP6 A;  4BQA A;  1IN7 A;  1IXS B;  4HOB A;  1QBJ A;  2A6H F;  5BS6 A;  5E18 F;  5L3B A;  2JSC A;  3ROU A;  4EV0 A;  3SZT A;  1PUE E;  4F7Z A;  4O6J A;  1FOK A;  5H20 A;  3GFI A;  3EDP A;  3U1D A;  2PMU A;  2CFX A;  2M8E A;  1CF7 A;  2W84 A;  2P5V A;  2QVO A;  5EEH A;  1TNS A;  1ZH5 A;  4N0B A;  4EVI A;  2K86 A;  2CGP A;  2UXN A;  3F8C A;  2HZT A;  3KP4 A;  4HX4 A;  2MH9 A;  5CVV A;  2EV6 A;  4OIR F;  5LRR A;  2EFO A;  1BI0 A;  2FA5 A;  3WOD F;  3IC7 A;  2ZME B;  3ISP A;  3GUD A;  4JQF A;  3TDZ C;  3BPX A;  1OPC A;  2QEN A;  3NRV A;  4WXC A;  5F6F A;  1FYL A;  2QBY A;  5AIP A;  5DEQ A;  3VB2 A;  3GF2 A;  3I0T A;  3WGG A;  5HLG A;  1QPM A;  1FBQ A;  2E7X A;  4LFU A;  1BC7 C;  2ZKZ A;  1U6G A;  5CVR A;  3L2C A;  2L01 A;  1FWZ A;  4HLY A;  1GVJ A;  3L00 A;  3TGN A;  3GLX A;  4WF2 A;  4ON0 A;  3RKW A;  5L3F A;  3F6V A;  1P6R A;  3BP8 A;  4HF2 A;  2V9V A;  1BI1 A;  1REP C;  1U5T C;  3D5L A;  1FZP B;  4AIJ A;  3VEP A;  1ZRD A;  4RB0 A;  4RGU A;  4Y15 A;  3RPU A;  4HAM A;  5K5Q A;  2FQ3 A;  2PMH A;  4L9V A;  4EJW A;  3E6C C;  1U5T B;  2JRT A;  2YX4 A;  2XRO A;  3WTT C;  3FMS A;  2XKO A;  3LA7 A;  2UZK A;  3T5X A;  3R60 A;  2D2W A;  4ENK A;  1S8N A;  3T8R A;  3R0J A;  5H6Q A;  1V3F A;  2HKX A;  2GXG A;  3WG9 A;  1HKS A;  3W6J B;  4IF4 A;  5CVI A;  2VE8 A;  3T1B A;  1Z6T A;  4YFX F;  2VT3 A;  3HRS A;  1XGN A;  2O6G E;  4M72 A;  5F64 A;  3ABU A;  3FMR A;  2FML A;  3TO7 A;  3FZV A;  4NB5 A;  2KIU A;  1QO0 D;  2FE3 A;  3V8K A;  1K7A A;  2VXZ A;  2YPR A;  3BY6 A;  3CUO A;  4EGZ A;  5E8G A;  1ZG1 A;  2IT0 A;  1I5Z A;  3F72 A;  3FX3 A;  3V8L A;  3HOS A;  4P9F A;  5L3G A;  2CYY A;  3K69 A;  3GXO A;  2V79 A;  3F8M A;  2EA2 A;  4ESB A;  2VON A;  1BI3 A;  3B02 A;  2RDP A;  1R00 A;  2RV8 A;  4OMZ A;  5DDG A;  4FX0 A;  2Y75 A;  3HIF A;  2FMY A;  4RAZ A;  4HV5 A;  2E1C A;  2PLY A;  3SZP A;  1IN4 A;  3HTU A;  1KQ8 A;  2Z5U A;  1UFM A;  4P5O A;  4GYG A;  4WWC A;  3J80 K;  1XSX A;  4A5N A;  1AOY A;  4S04 A;  1IW7 F;  3GZ6 A;  2HKO A;  4ZYE A;  3KE2 A;  4LLN A;  2DBB A;  2IA0 A;  4Z2Y A;  1DPU A;  3ZMS A;  3KP6 A;  1SFX A;  4K2E A;  3V7S A;  5J8C A;  4KUM A;  2BYV E;  2WWY A;  4Q47 A;  4RB1 A;  3QPH A;  5A2Q Z;  4HZF A;  4U0W A;  2IA2 A;  2MBF A;  1ODD A;  1WWX A;  1I1S A;  1KYZ A;  4DQ2 A;  4L9J A;  3EYI A;  1SD6 A;  3CLO A;  5IT9 K;  3RPQ A;  1IRF A;  2VC0 A;  3I54 A;  2KKO A;  3CUQ A;  1D3Y A;  1B59 A;  2A61 A;  2LKP A;  3ZN1 A;  2LDU A;  2ISZ A;  2NRA C;  1XD7 A;  2DLL A;  1XGM A;  2ADU A;  3LQR A;  3CJN A;  4MQV A;  2HQN A;  1LDK B;  5CLS A;  4MQ9 F;  3KEO A;  4KDP A;  3QAH A;  2HOE A;  5DUI A;  3F6O A;  2NAZ A;  1R1U A;  2V1U A;  1PP7 U;  2O03 A;  3I59 B;  2DK8 A;  1KU2 A;  2KJC A;  2BV6 A;  4HX7 A;  4U7B A;  1FY7 A;  1G3Y A;  4UV9 A;  2F5E A;  1IXC A;  4OU0 A;  5DCM A;  5LEK A;  2PFB A;  1A04 A;  3SQN A;  2X0L A;  3LWF A;  4HW0 A;  4YG2 F;  3IRQ A;  3E5U A;  4U88 A;  1J75 A;  4L0Z B;  4M6X A;  1B9N A;  3BRO A;  4HYE A;  1IF1 A;  2RGV A;  1YIO A;  1XN7 A;  1MJ9 A;  2G7U A;  4B09 A;  1IN6 A;  2D45 A;  3NEU A;  4ESJ A;  3GFL A;  1B1B A;  3REO A;  3DPL C;  2OU2 A;  3J80 Z;  5TJJ A;  4ENN A;  2FU4 A;  3WTV C;  1YS7 A;  2E1N A;  4IHT A;  3M8E A;  2KIF A;  3HYI A;  4M73 A;  4CYD A;  2P6S A;  4MTE A;  1TQM A;  2G9W A;  3WE2 A;  1MDM B;  2HEO A;  4G7Z F;  1TW2 A;  2E7W A;  5HS9 A;  1J0R A;  4IRG A;  2STW A;  1R36 A;  2XGX A;  1ZG3 A;  4ZYH A;  3LFK A;  1R7J A;  1DUX C;  2IPQ X;  2RKH A;  3GX4 X;  5FB2 A;  5HDN A;  2L4A A;  3Q9V A;  3QPT A;  1HW5 A;  3HHH A;  2XAQ A;  1XB4 A;  1FLI A;  1QQI A;  4UHT A;  4PZJ A;  2JZY A;  2ZME A;  2JTV A;  1YS6 A;  4HLX A;  2XAS A;  2MA3 A;  3IRR A;  2L54 A;  4IHS A;  1O3T A;  2IVM A;  3S2W A;  4MTD A;  2VBX A;  1HSJ A;  2F2E A;  3V8J A;  1ZLJ A;  2CQK A;  3PQK A;  1W5T A;  1FP1 D;  3E6M A;  1JGS A;  4HDV A;  1KQ0 A;  5ED4 A;  2A68 F;  4I0A A;  3HRU A;  1ZGA A;  2QWW A;  5DUK A;  3KZY A;  5ILS A;  1LEB A;  4D0P A;  4A6E A;  1F1Z A;  1IAW A;  4MEY F;  3JSP A;  2PJP A;  3E6D A;  5FLX Z;  4HQE A;  1TW3 A;  4EJU A;  2A69 F;  4Y13 A;  1MZB A;  3R6S A;  3K9T A;  4ZYG A;  1HQC A;  4YIF A;  4IXA A;  2BBY A;  3R4K A;  2DAO A;  1E2X A;  1YFH A;  5HLI A;  3KP5 A;  4EM0 B;  1KA8 A;  1MJA A;  3RKY A;  1JE8 A;  3LAJ A;  1LB2 A;  3QU6 A;  2RN7 A;  1R22 A;  5BMZ A;  2Q8K A;  3K1M A;  2P4W A;  5AON A;  1P2F A;  4U0Y A;  3TQN A;  4I0B A;  3ZN0 A;  3MCZ A;  5JFR A;  4QLC U;  4UVC A;  3M1E A;  2EV5 A;  2PQ8 A;  3F8N A;  3HHG A;  3ZMZ A;  4UXN A;  1XGO A;  5L3D A;  3L09 A;  4P55 A;  3AAF A;  5IT3 A;  3LAP A;  3C1D A;  1G4D A;  1KU3 A;  3DV8 A;  1RI7 A;  2B0L A;  3K1P A;  3ECH A;  2HWV A;  3P7N A;  2HFH A;  4NQW A;  2PBI A;  3VOE A;  4OMY A;  1B6A A;  3WTU C;  1EV7 A;  4A0X A;  4R1H A;  1KU7 A;  1FNN A;  2G7H A;  4EGY A;  1USS A;  4GGG A;  1FP2 A;  3MFK A;  2F5D A;  4KNY A;  3CDH A;  1J59 A;  4JBA A;  1XMA A;  4CHU A;  1MJB A;  2OD5 A;  3C18 A;  3LQQ A;  1YLF A;  1LNW A;  3EQL F;  2DPD A;  2KRF A;  2XV4 S;  2VOD A;  4OIO F;  3G3Z A;  5J6X A;  1FT9 A;  1GXQ A;  2DQL A;  1R5G A;  3JTG A;  3DEU A;  3WTW C;  3OV8 A;  3NQO A;  2EFP A;  2DT5 A;  4ASN A;  1UB9 A;  1U8R A;  3BWG A;  5DD8 A;  1O3Q A;  3R0A A;  2WTE A;  5AIQ A;  3GVA A;  2ISY A;  1ZHF A;  4IJA A;  4TV7 A;  3FM5 A;  2AS5 F;  1Z7U A;  2RQP A;  5L3E A;  5D6F A;  4ENJ A;  3KFW X;  4LLG F;  1XSV A;  1SFE A;  1LDJ A;  4RB2 C;  3RJP A;  4BYY A;  1F5T A;  1W7P A;  4UV8 A;  1PDN C;  1U3E M;  1T39 A;  2XVC A;  5J8F A;  2OQG A;  4CZZ A;  1EH6 A;  3IKT A;  2ETH A;  2H94 A;  1RUN A;  5ILU A;  4OIN F;  2QUF A;  2OBP A;  3DP7 A;  5E17 F;  3I59 A;  4QWQ A;  3V4G A;  3VOD A;  2IRF G;  2VN2 A;  2HGC A;  2Z33 A;  3I5U A;  3QRF F;  4EM1 A;  2GA1 A;  1YTY A;  1DDN A;  2F5C A;  3MZY A;  2P7V B;  4Q48 A;  1HBX G;  1UST A;  3W6K B;  2ELH A;  2M1B A;  2VT2 A;  3O2P E;  2QM3 A;  2VBW A;  3WGH A;  1Z6R A;  3QU3 A;  1V4R A;  3T8T A;  2RNJ A;  4AWX B;  2FNP A;  3H3U A;  2ESH A;  5F1R A;  2XIG A;  4A6D A;  3DQV C;  1KYW A;  1Z1D A;  1ZN2 A;  3I64 A;  2CO5 A;  2HDC A;  3CO6 C;  2JT1 A;  4OIQ F;  2FEZ A;  5TRD A;  2LSO A;  1TLH B;  2OA4 A;  4LB5 A;  3KLO A;  5JI6 A;  3H92 A;  2FBK A;  1XCV A;  4HDU A;  2UXX A;  1FX7 A;  1TQI A;  1J5Y A;  3I53 A;  4I09 A;  4XLP F;  5ICE A;  4PGG A;  2W25 A;  4WXH A;  2ZO4 A;  2V1D A;  3KP3 A;  2C6Y A;  5FFZ A;  4G9Y A;  5LHH A;  5DYM A;  2QBY B;  3JSO A;  1R1T A;  4WK8 F;  4U7D A;  4NHJ A;  4I01 A;  4GYI A;  3OOP A;  1FPQ A;  1RNL A;  3ZQ7 A;  1L0O C;  3EYY A;  2ZNZ A;  5KK1 A;  3ZP5 A;  2OAZ A;  1I6X A;  2CG4 A;  4I02 A;  3BOQ A;  3FHZ A;  1SD5 A;  3GZ5 A;  2V6C A;  3J7A O;  1UCR A;  5D8K B;  3GFM A;  3M9A A;  2NYX A;  1XGS A;  2J5P A;  2O8X A;  2OZU A;  4HA8 A;  1J7K A;  2LF8 A;  2GAU A;  1O7L A;  1T98 A;  1UHM A;  2EA4 A;  4BHB A;  1KU9 A;  1YG2 A;  2QZ8 A;  1HKT A;  1HST A;  3V7C A;  4L9T A;  3HTS B;  2VOO A;  3JAM K;  1ZGJ A;  2ZCW A;  4XBF A;  3I58 A;  1BOA A;  1BM9 A;  4M9X A;  3E5Q A;  2EK5 A;  4HQM A;  2ESN A;  1MD0 A;  3J81 K;  2VC1 A;  2K4B A;  5K5R A;  4O5V A;  2HS5 A;  1TTY A;  5FD6 A;  4PDK A;  4S05 A;  2QYO A;  5K5O A;  1FYM A;  3TO9 A;  4OIP F;  4G8X A;  1BIA A;  4UVA A;  4YFN F;  2R3S A;  2DTR A;  2IA1 A;  1Z05 A;  3RI4 A;  3ZMV A;  4I7H A;  4P96 A;  3F21 A;  1ZG5 A;  3SXY A;  3RYP A;  3P9K A;  2CW0 F;  1R1V A;  1P4W A;  2FNA A;  5LHG A;  3RKX A;  3E97 A;  4A2U A;  4BXU A;  5BQT A;  1IXR C;  1YW7 A;  1U2W A;  4P9U A;  2P7C B;  3O3K A;  4KN7 X;  3M8F A;  4LG0 B;  1XMK A;  2EWN A;  2EJR A;  1YW9 A;  4O3M A;  5FO5 A;  4IRI A;  3T0Y A;  4A0Z A;  4HX8 A;  2HYF A;  1O57 A;  1DP7 P;  1WI9 A;  3FXR A;  4M71 A;  2FSW A;  3F22 A;  2XAJ A;  1OYW A;  2Y48 A;  5ICF A;  4CDG A;  4ZZD A;  3BZ6 A;  2FBI A;  2M87 A;  4LD5 A;  3TDU C;  4ZYD A;  1FBS A;  2CSO A;  4L5J A;  4PGH A;  4UNO A;  1Y0U A;  2DFI A;  1S3J A;  2M5W A;  1YO5 C;  3GYH X;  1QZZ A;  1T2K A;  1NHA A;  3MZH A;  5LGU A;  4AIK A;  3IHU A;  3P9C A;  4UUV A;  3LST A;  4A5M A;  4KIB A;  1J9I A;  2BE5 F;  5IT9 Z;  2IP2 A;  3P9I A;  1ON2 A;  4DNC A;  1BI2 A;  1YQA A;  3CUQ C;  5CVJ A;  2VOP A;  5E1X A;  3QOP A;  4L0Y B;  2A07 F;  1HW1 A;  3CUQ B;  2XAH A;  4KN4 X;  2XAF A;  3KET A;  4EQQ A;  1ZRF A;  5FFX A;  2CWE A;  3ML6 A;  3RTR A;  1OMI A;  2DPU A;  1MKM A;  2P8T A;  3J81 Z;  1ZRE A;  3ABT A;  1SMY F;  3C7J A;  1QNT A;  4RGX A;  2NS0 A;  3RIR A;  4RS8 A;  2DQR A;  1GXP A;  1SD7 A;  1D8K A;  4WXD A;  1H9G A;  4AVP A;  2DO7 A;  4B8X A;  2D1V A;  3K0L A;  4JK1 X;  5HLH A;  3GEZ A;  3E3V A;  3Q5F A;  1JHF A;  1QZY A;  4I98 B;  3KP7 A;  2VBZ A;  1U5T A;  3IKV A;  4M9S A;  3C3W A;  2ZJ2 A;  1D8J A;  1X3U A;  2JPC A;  1ZRC A;  5HS8 A;  4LLL A;  5DCM B;  2HYG D;  1P92 A;  2RC4 A;  2K7L A;  4KIG A;  4AIH A;  4M74 A;  3MAJ A;  1XDU A;  5CJ9 A;  2Z3Y A;  1BJA A;  1EH8 A;  2K4J A;  5E20 A;  2MD5 A;  1XDS A;  2Q0O A;  4L5I A;  5D5V B;  2P6T A;  1IN5 A;  4E70 A;  1K79 A;  1J2X A;  3WTX C;  1JXS A;  4I2O A;  1Q1H A;  3K2Z A;  4MGR A;  2R7D A;  3U9G A;  3F8F A;  3MQ0 A;  3ZMU A;  4KIF A;  2J5O A;  1RUO A;  2ZBK A;  2HTS A;  4Q5S F;  1ZAO A;  2QQB A;  2H27 A;  2O3F A;  3CTA A;  3R61 A;  3FXQ A;  1FC3 A;  2D1H A;  4RGR A;  2Z99 A;  2KIM A;  5E1Z B;  4HF1 A;  1K78 B;  3F3X A;  3MWM A;  1OR7 A;  2PG4 A;  4L9N A;  2F5F A;  1IN8 A;  2H6B A;  4HV6 A;  2P5K A;  4G7O F;  3HOT A;  4OOI A;  4RAY A;  1SFU A;  1B4A A;  2K02 A;  4L18 B;  2XHK A;  3E5X A;  3I4P A;  3WE3 A;  2ZXJ A;  3H3Z A;  4G7H F;  5LHI A;  4ESF A;  3HSF A;  2BEO A;  5LLQ A;  1KGS A;  1OKR A;  3L7W A;  2AXL A;  2M30 A;  4XLN F;  4YII A;  4XSX F;  1ONV A;  1R58 A;  2Z9O A;  3FXU A;  3IWZ A;  4WX9 A;  5KVR A;  3TOA A;  3LA3 A;  2OQR A;  4LMY A;  1YYV A;  1BBY A;  2IJL A;  2A6E F;  1JHH A;  2EB7 A;  5BPD A;  4CIC A;  2W24 A;  5A2Q K;  1XCB A;  1HW2 A;  4KFC A;  2ZNY A;  5LRS A;  4CO8 A;  2ACJ A;  4BHC A;  2GXB A;  2R7F A;  2K27 A;  5D4R A;  2O0Y A;  4BH9 A;  5ILV A;  2P5L C;  5D6E A;  1WRJ A;  1DPR A;  5HVQ C;  4ZH4 F;  2VBY A;  4G94 A;  3D0S A;  3DFG A;  1O3R A;  1MGT A;  5LGT A;  1LVA A;  2MLG A;  1STZ A;  3BDD A;  4CGZ A;  4LK0 F;  4KIC A;  3V7R A;  1WKM A;  3PQJ A;  5DCF A;  1ULY A;  3KP2 A;  1OYY A;  3COA C;  5HS7 A;  2L3D A;  4Y17 A;  5JR3 A;  2LNB A;  1BN5 A;  3KCC A;  3WU0 A;  3GO5 A;  3ERE D;  4G6D A;  5K1Y A;  3HRT A;  4EMS A;  2H6C A;  1SD4 A;  2RVC A;  5H6R A;  1G3S A;  2FXA A;  3EET A;  1BC8 C;  1S7A A;  1AWC A;  3IL2 A;  5D5X B;  1S6L A;  3WTZ A;  4EJT A;  1L3L A;  1CF7 B;  4MHG A;  4LG0 A;  4HBL A;  5D5W B;  3GW2 A;  3BPV A;  4FX4 A;  3KEQ A;  1HKQ A;  2FF4 A;  4IRH A;  5E8I A;  1FSE A;  2YSR A;  1G3T A;  3Q9S A;  3CO7 C;  5LEJ A;  5JVT A;  2M45 A;  3MEX A;  2DU9 A;  3FMQ A;  2QQ9 A;  1LEA A;  2HR3 A;  4ENM A;  4EM2 A;  1MDM A;  1CGP A;  1O7F A;  2VE9 A;  3ECO A;  1H0M A;  4GO1 A;  2JPB A;  2Y0M A;  2WV0 A;  3HSR A;  2H09 A;  3TO6 A;  3JW4 A;  1R23 A;  1C0W A;  1F9N A;  1SMT A;  2FRH A;  2L4M A;  2PI0 A;  3F23 A;  2O61 A;  4M9Z A;  1WSU A;  5LBQ A;  4A0Y A;  5D5U B;  3M7G A;  3RYR A;  2A3S A;  4A12 A;  1QGP A;  3GFJ A;  1VTN C;  2LF7 A;  5CVU A;  5CYV A;  1BIB A;  2FBH A;  1I1G A;  1RIO H;  5ICG A;  1IRG A;  1ZLK A;  2XUB A;  2YR2 A;  4KYW A;  4BAY A;  3LA2 A;  3L9F A;  5EEG A;  2EV0 A;  2KJB A;  2W57 A;  1O3S A;  1UHW A;  1W7P B;  4BHP A;  4LB6 B;  1ZYR F; 
#chains in the Genus database with same CATH topology
 2WB1 A;  3TKY A;  2HQR A;  2HOT A;  2XPV A;  2LR8 A;  4AC0 A;  2E35 A;  3CME I;  2LRD A;  3FWE A;  2NVQ J;  2JJ7 A;  2EFN A;  5GPA A;  1S9H A;  4YFK F;  1E17 A;  3G1O A;  2W85 A;  4IZZ A;  4PCQ A;  5HLT A;  4PFP A;  1WQ2 A;  4AM3 A;  1HXD A;  5L3C A;  3LL7 A;  3E6B A;  3PFI A;  3KYL A;  2HTJ A;  2Q2E A;  4KIT B;  5EG0 B;  3WU1 B;  1RC9 A;  4HNU A;  1I6H J;  1Z67 A;  1PJR A;  3RQI A;  3X2Q H;  1ETX A;  4Z6Y A;  3K70 C;  1X1C A;  4KA4 A;  1VQ7 I;  2GA2 A;  3U2R A;  1VFC A;  2X51 A;  3IH3 A;  3DWL E;  1EH7 A;  5FLX K;  3G1M A;  2A5Y B;  1FIA A;  4RB3 C;  5D4S A;  4XKW A;  2YX7 A;  4C2T A;  2VUM J;  4IPA A;  2WC2 A;  2ECC A;  2OZ6 A;  2XF7 A;  1ZAR A;  1MNE A;  2XAG A;  1H89 C;  3AL0 C;  2DDB A;  3TW6 A;  3DPU A;  4CYC B;  2NNN A;  3FXO A;  3PNY A;  4G6Q A;  1JKP C;  2ELJ A;  2M0M A;  4DYC A;  1BA5 A;  1TNT A;  3HDD A;  4N9H A;  2M9H A;  2DOF A;  1WJF A;  3IH4 A;  3VFZ A;  4QTR A;  1S29 A;  5FLV A;  1FTT A;  3G6E I;  3I71 A;  2W7N A;  3DU5 A;  3AL0 B;  4R8H A;  5FD5 A;  4IO9 F;  3ULQ B;  3HSE A;  3C2H A;  4IEJ A;  1S7O A;  2IEK A;  5FGM A;  2DT6 A;  5HDG A;  4B43 A;  5IY5 H;  1B9M A;  1X2N A;  4BKX A;  2MC4 A;  3O6B B;  4KT5 C;  3JRG A;  1IJW C;  2HYJ A;  3ZPL A;  4ZZL A;  1T33 A;  3OYD A;  4XRM A;  3CCM I;  4DIQ A;  4GCV A;  1U78 A;  2I10 A;  1SAX A;  2FOK A;  4BNC A;  1XX5 A;  2R5Y B;  5DD4 A;  2WAF A;  2MLK A;  3WGI A;  2R5Z A;  2XRN A;  1OCP A;  2WBM A;  2EZK A;  4XL9 A;  2HU9 A;  3S93 A;  4UUS A;  4E7J A;  3K7A J;  2L02 A;  2F48 A;  1IZ1 A;  4A3B J;  2PEX A;  1G6N A;  1OCT C;  5B3S H;  1Z91 A;  1I27 A;  2DOA A;  5LGN A;  4IOA F;  3E1S A;  4U0V A;  3W2W A;  1TWF J;  3CF5 F;  1SFO J;  1XTA A;  1K6O A;  1U0J A;  4JYK A;  5ICC A;  2EZH A;  3BR0 A;  3FM3 A;  4G6T B;  1OJL A;  1ZEL A;  3K1N A;  1PP8 F;  2IS1 A;  3FF5 A;  3BG9 A;  4XR6 A;  1R5I D;  1IUF A;  1FTZ A;  2AHQ A;  4AU7 A;  4EJO A;  3ZMT A;  3SFZ A;  1B72 B;  2BHZ A;  5HOO A;  4N9I A;  2COM A;  3ABM H;  2QLZ A;  1K78 A;  1SVL A;  4M6Y A;  4HNT A;  5J4V A;  1RZ4 A;  1Z9C A;  2Y30 A;  2TDX A;  1ZK8 A;  3JTH A;  2R7Q A;  3TP3 A;  1ITY A;  1FYK A;  1Y6I A;  2KHM A;  1YHQ I;  5F0C A;  1T0F A;  4FT8 A;  2DYR H;  1F4K A;  3WU2 C;  2EIJ H;  4ETS A;  2W82 A;  1GHC A;  2MH2 A;  1G3W A;  1FSH A;  3SDG A;  4XRF A;  4KMU X;  4BBS J;  1OCZ H;  1P4X A;  1XSD A;  5EGO A;  3W6V A;  2MC3 A;  1AU7 A;  5JHU A;  2HQ5 A;  4GXO A;  2KRH A;  3L1P A;  3JAM Z;  5ERI A;  4IVN A;  3KZZ A;  2WAE A;  2NS7 A;  2VKV A;  2ZFW A;  4Q4Z F;  5E1W A;  4H0E A;  1FEX A;  1TP4 A;  2L2O A;  4PJM A;  5GTI C;  3N4M A;  1TBX A;  1Y56 A;  2IW5 A;  2STT A;  4RLF A;  5D8L B;  1W5S A;  1H9T A;  3BJA A;  3DPT A;  4LGW A;  3ZMD A;  1O4X A;  1LJ9 A;  3WTY C;  2V7F A;  4W1U A;  3EUK L;  3BR6 A;  4S0H B;  3W3C A;  3S3O A;  2GQQ A;  3BZC A;  3QQA A;  1W4M A;  5HNH A;  1LDD A;  2ZSI B;  3EUH A;  2PN6 A;  4OAY A;  4A3D J;  3RDI A;  1P7J A;  4HG2 A;  1EA3 A;  2XB5 A;  2R7U A;  2JA5 J;  1VQL I;  2ZC2 A;  2DI3 A;  2CUZ A;  2X9D A;  3ESW B;  4H4K C;  3FHN A;  2W00 A;  4R79 A;  4C30 A;  1ETK A;  4M3F A;  1OYI A;  2BGC A;  2DK5 A;  4AD9 A;  3S1Q J;  1D5V A;  2R7Z J;  3DF8 A;  1LQ1 A;  3DXJ F;  1E3O C;  1VQM I;  6PAX A;  3I4M J;  1EJ9 A;  3JR9 A;  2L9S A;  2Y0S A;  5HOD A;  2YU3 A;  1R5H A;  4HF0 A;  1V5E A;  2LTP A;  3DKW A;  3QP5 A;  1P4A A;  2F6C A;  2Z2S B;  2ME6 A;  1YW8 A;  2XKP A;  3HUG A;  4IX7 A;  2UWM A;  1GT0 C;  3L2U A;  4KMF A;  1T38 A;  2DW4 A;  4EJV A;  4MEX F;  4WCG A;  2NNY A;  1LFB A;  4L5E A;  5B66 C;  4CXF A;  3HXL A;  3ABK H;  2EFW A;  3TOB A;  2QQA A;  3M8J A;  4UVB A;  2GIV A;  3BJO A;  2OF7 A;  4XNF A;  2GZW A;  2V26 A;  4AVZ A;  1YI2 I;  3G73 A;  2V1X A;  1ON1 A;  2FQ4 A;  2CS3 A;  3KLN A;  4F91 B;  2FOW A;  1T6S A;  3A0B C;  4X6A J;  3FIW A;  3B73 A;  3SHF A;  1KQ9 A;  1EKE A;  3F8B A;  3H5R A;  2NVX J;  3GWZ A;  1PVE A;  2VJ5 A;  3WTS C;  1IUY A;  4YEL A;  1FBU A;  4LK1 F;  2EFQ A;  5BPI A;  5DV5 A;  4XSZ F;  1FMW A;  2DOE A;  3ZXS A;  4C3J J;  1QZE A;  3HRM A;  1R49 A;  2HOS A;  4FHT A;  3WHB A;  2L7Z A;  4BL0 B;  4XOT A;  4RGS A;  1WZ2 A;  1DGW Y;  2QA4 I;  3ELK A;  2GWR A;  3IWF A;  3BJ6 A;  4LJZ F;  1HF0 A;  5HDK A;  4MNU A;  1G59 A;  1W7P D;  1I50 J;  1W5C C;  1TQP A;  3N97 A;  3OIQ A;  2WAD A;  3H36 A;  2X4H A;  5BOX A;  3QP6 A;  4BQA A;  3ZR8 X;  1IN7 A;  1IXS B;  2AQE A;  4HOB A;  1AKH A;  1N78 A;  1QBJ A;  2A6H F;  1BL0 A;  5E3L A;  4A3L J;  5GAH J;  2ZXW H;  3FKI J;  3M1C A;  4D7M A;  5BS6 A;  2A6T A;  5E18 F;  5L3B A;  4IQ4 A;  4IL6 C;  2JSC A;  5JLX A;  2K9S A;  1D0X A;  3ROU A;  4EV0 A;  3D5S C;  3SZT A;  4BE0 A;  1PUE E;  2IGO A;  4F7Z A;  4O6J A;  1FOK A;  1E0E A;  2K9N A;  2PMU A;  3EDP A;  3JCU C;  5H20 A;  3U1D A;  2CFX A;  3GFI A;  2M8E A;  1U9O A;  3CDL A;  2ZXI A;  1J09 A;  1CF7 A;  2W84 A;  1V54 H;  2P5V A;  3VSL A;  2QVO A;  5EEH A;  1TNS A;  1ZH5 A;  1MND A;  4N0B A;  1SEU A;  4EVI A;  2K86 A;  2CGP A;  1E3H A;  2UXN A;  3F8C A;  5EZH A;  3I3L A;  1IDZ A;  2NVU B;  4BE1 A;  3CJR B;  3AG1 H;  1BW6 A;  2HZT A;  2JMW A;  3KP4 A;  4HX4 A;  3K70 D;  2MH9 A;  5CVV A;  4BEH A;  3FIS A;  2EV6 A;  3QPS A;  5EZG A;  4OIR F;  4NC8 A;  1QVU A;  1MH4 A;  1YIT I;  2ELK A;  5LRR A;  3DU6 A;  4C3I J;  1PUF A;  2EFO A;  2LMD A;  1BI0 A;  5E3M A;  2FA5 A;  5J3L A;  2XC7 A;  4BAC A;  3WOD F;  1RKW A;  3IC7 A;  2ZME B;  3M07 A;  2X6W A;  3ISP A;  3GUD A;  4JQF A;  3TDZ C;  3IH2 A;  3BPX A;  1OPC A;  5LD2 C;  5FKM A;  2FX0 A;  1V55 H;  1R4N B;  2O7O A;  4XLA A;  2QEN A;  3NRV A;  4WXC A;  3NAR A;  4A3J J;  4XKC A;  1VQ4 I;  5F6F A;  1FYL A;  1MSE C;  2QBY A;  3KIO A;  2W4S A;  2LBF A;  2Y31 A;  5AIP A;  1Z21 A;  5DEQ A;  3VB2 A;  2L9V A;  2IBD A;  2KIS A;  3FBI B;  2ZFU A;  3GF2 A;  3I0T A;  3WGG A;  2CW7 A;  5HLG A;  3S16 J;  2ZXH A;  1QPM A;  1FBQ A;  2E7X A;  4LFU A;  1BC7 C;  2ZKZ A;  1U6G A;  2JUG A;  1I3Q J;  2L7M P;  2V6E A;  2HDD A;  2I8D A;  5CVR A;  3MVP A;  1QPI A;  2LC2 A;  3OR1 C;  2RQQ A;  2JSP A;  5FKN A;  3L2C A;  3HOZ J;  2HDW A;  1FWZ A;  1GVJ A;  2L01 A;  3L00 A;  2JRM A;  4DZP A;  4HLY A;  3TGN A;  5GAD J;  4IHW A;  3GLX A;  4WF2 A;  4ON0 A;  1QRY A;  4BJ5 C;  3DKY A;  3RKW A;  5L3F A;  5KCM A;  2G0E A;  3F6V A;  1P6R A;  2Z16 A;  3BP8 A;  4HF2 A;  2EZI A;  5GAG J;  2V9V A;  1BI1 A;  3BG7 A;  1FJL A;  3PIO F;  1U5T C;  1REP C;  3D5L A;  1ORK A;  1OCO H;  4PJJ A;  1FZP B;  4AIJ A;  3VEP A;  4NNJ A;  3FK6 A;  1ZRD A;  4RB0 A;  4RGU A;  4Y15 A;  3RPU A;  1OLT A;  4HAM A;  1SFK A;  3S1N J;  4RDU A;  2COB A;  5K5Q A;  2FQ3 A;  3M3Y J;  3QYF A;  2PMH A;  4L9V A;  4EJW A;  4D1Q A;  4HNV A;  1U5T B;  2JRT A;  2YX4 A;  3D1N I;  3E6C C;  4B3X A;  1U8B A;  2XRO A;  3WTT C;  1RPW A;  3FMS A;  2LRE A;  5IP9 J;  2XKO A;  1OQY A;  3LA7 A;  1XC5 A;  2W1O A;  2CQN A;  3T5X A;  2UZK A;  4A93 J;  4D5C A;  2M0C A;  3A02 A;  2D2W A;  3R60 A;  4ENK A;  3TMO A;  1S8N A;  5J40 A;  3T8R A;  3R0J A;  5B1A H;  5H6Q A;  1V3F A;  2HKX A;  2GXG A;  3ZQH A;  1MBE A;  3WG9 A;  3BG6 A;  3OYJ A;  1HKS A;  3W6J B;  3K4C A;  2EIK H;  4IF4 A;  3S3M A;  4QIW N;  5CVI A;  2VE8 A;  3T1B A;  4M3E A;  4XM3 A;  4V2G A;  5KHD A;  1Z6T A;  4YFX F;  2VT3 A;  1K4T A;  3GTO J;  3HRS A;  1VQN I;  1XGN A;  2O6G E;  2H8W A;  4M72 A;  5EJC A;  5F64 A;  1JGG A;  3ABU A;  3ZQQ A;  3FMR A;  4DBR A;  2FML A;  3TO7 A;  1VQO I;  2TCT A;  3FZV A;  4NB5 A;  2KIU A;  1Y39 A;  1QO0 D;  2FE3 A;  3V8K A;  1K7A A;  1Y1V J;  2VXZ A;  2YPR A;  3BY6 A;  4ZJZ A;  3TW7 A;  3CUO A;  4BS9 A;  4EGZ A;  5E8G A;  2MYS A;  1ZG1 A;  2K85 A;  1MMD A;  1VF9 A;  4NQW B;  3A1Y A;  1WH5 A;  1JJ8 C;  3N05 A;  2IT0 A;  5FRM A;  1I5Z A;  2K3F A;  9ANT A;  1MSF C;  2F5V A;  3F72 A;  3JRE A;  2LFB A;  5GPC A;  3PO3 J;  3FX3 A;  3V8L A;  3HOS A;  3LSM A;  1FOW A;  4P9F A;  5L3G A;  3OYM A;  2CYY A;  1OR7 C;  3K69 A;  3GXO A;  4DW6 A;  2V79 A;  3F8M A;  1N25 A;  2EA2 A;  4ESB A;  2VON A;  2LK2 A;  2VXD A;  2BW3 B;  1BI3 A;  2DTZ A;  3RZO J;  3B02 A;  2RDP A;  1R00 A;  2RV8 A;  1JJ6 C;  4OMZ A;  5DDG A;  5C44 J;  1DP3 A;  3OOU A;  2Y75 A;  4FX0 A;  3F0C A;  3HIF A;  5FLM J;  3OS1 A;  2FMY A;  4RAZ A;  5J1Y A;  2QKM B;  2AO9 A;  4XN3 A;  3CJT B;  4HV5 A;  2CW8 A;  2AQF A;  2E1C A;  1A35 A;  3SZP A;  1IN4 A;  3HTU A;  2PLY A;  4CCO A;  3HOU J;  3HG9 A;  1KQ8 A;  3NWS A;  4C9Y A;  2Z5U A;  3K2A A;  1K4S A;  1UFM A;  4P5O A;  3S17 J;  4GYG A;  4WWC A;  1PYV A;  3V42 A;  3J80 K;  3O8G A;  1JTY A;  1FMV A;  3VSK A;  1XSX A;  2KDZ A;  4A5N A;  1AOY A;  2CU7 A;  2CRG A;  5F27 A;  4S04 A;  1IW7 F;  2Y2Z A;  2HKO A;  3GZ6 A;  2R7R A;  3SEZ A;  4ZYE A;  3KE2 A;  3CDI A;  4F52 A;  3ZQL A;  4LLN A;  1B8I B;  2DBB A;  2IA0 A;  3TBI A;  2E2I J;  2XPW A;  2FJ1 A;  4Z2Y A;  4C2M J;  3BTI A;  2GOM A;  1DPU A;  3ZMS A;  2BVM A;  3KP6 A;  1SFX A;  4K2E A;  3V7S A;  5J8C A;  1B72 A;  4KUM A;  3CCR I;  2BYV E;  3ZQF A;  1WVR A;  2ICW G;  3LSI A;  1W0U A;  2WWY A;  4Q47 A;  4AUX A;  4RB1 A;  3QPH A;  5B1B H;  5A2Q Z;  4HZF A;  4U0W A;  2P81 A;  2HXO A;  2IA2 A;  4FE4 A;  2MBF A;  2CV0 A;  2HVR A;  1ODD A;  4DBQ A;  1WWX A;  1I1S A;  1Y8Q B;  3EUA A;  3VYT B;  1KYZ A;  3HPG A;  1Y1W J;  4BDZ A;  4DQ2 A;  5FRO A;  4L9J A;  3EYI A;  1SD6 A;  3IAM 2;  3CLO A;  1Y0N A;  5IT9 K;  2FD5 A;  1RKT A;  1IRF A;  2VC0 A;  3RPQ A;  3I54 A;  4IQJ A;  2KKO A;  1X3Z B;  3CC2 I;  1FOX A;  4F92 B;  1DU0 A;  3RZD J;  2R0Q C;  3CUQ A;  1SAU A;  3OR2 C;  1D3Y A;  5M5X J;  1B59 A;  2A61 A;  2DA4 A;  2LKP A;  4RA2 A;  1LPQ A;  1LE8 B;  3MKL A;  2DJI A;  4UB8 C;  2ZJP F;  3ZN1 A;  2LDU A;  1AA7 A;  2ISZ A;  2NRA C;  1XD7 A;  2DLL A;  2JK3 A;  3DTI A;  2PMZ N;  1XGM A;  2ADU A;  1WH7 A;  3DTE A;  3LQR A;  1A36 A;  3UKG A;  3CJN A;  3RKQ A;  3LSJ A;  4MQV A;  2HQN A;  4JX5 A;  1LDK B;  5CLS A;  4MQ9 F;  3U21 A;  3KEO A;  5TIS C;  4KDP A;  3QAH A;  2HOE A;  5DUI A;  3DTK A;  1HC8 A;  3F6O A;  1K6Y A;  2NAZ A;  3AFH A;  1MBJ A;  1R1U A;  2VAS A;  5KNL A;  2OTL I;  4ZDL A;  2QGU A;  2K3P A;  2V1U A;  1R9T J;  1T8I A;  1X1B A;  2O03 A;  1PP7 U;  1NK2 P;  3PFY A;  2DA2 A;  3I59 B;  2DK8 A;  1KU2 A;  5CQE A;  3CZ6 A;  1Z7L A;  4MLO A;  2KJC A;  2R7S A;  2Y9Y A;  2E60 A;  3DKX A;  2OV7 A;  2BV6 A;  3Q0V A;  2ZB9 A;  4ITV A;  4HX7 A;  5FKK A;  4U7B A;  2IS4 A;  1FY7 A;  3BCB A;  1M1E B;  3S3N A;  2E2H J;  1G3Y A;  3ZRG A;  4UV9 A;  2F5E A;  5C4X J;  2X85 A;  1IXC A;  4OU0 A;  1IO2 A;  5DCM A;  3K4K A;  1NTC A;  1QVT A;  4DOZ A;  5LEK A;  2PFB A;  1A04 A;  4W97 A;  3KYD B;  3PUF A;  4HSR A;  1QA6 A;  3SQN A;  3B6A A;  2CUF A;  1S7E A;  2QCO A;  2X0L A;  2R92 J;  1I3A A;  3LWF A;  3BG5 A;  4HW0 A;  1S5L C;  4DGW B;  1GLN A;  4YG2 F;  3IRQ A;  3E5U A;  4U88 A;  1J75 A;  4L0Z B;  4M6X A;  5DTD A;  3VYS B;  2M3A A;  1LKX A;  1MMG A;  1NH3 A;  1B9N A;  4C3H J;  3BRO A;  4Y7N J;  4HYE A;  1IF1 A;  2RGV A;  1YIO A;  1IRZ A;  1XN7 A;  1MJ9 A;  2G7U A;  3FKJ A;  3CP2 A;  4B09 A;  3KEY A;  1MNM C;  5F0F A;  1IN6 A;  3Q3S A;  4BQO A;  2D45 A;  5HNF A;  4N4O B;  4LIU A;  3NEU A;  4JX6 A;  4ESJ A;  1ZR2 A;  3GFL A;  1B1B A;  2DJN A;  1MBF A;  3REO A;  3DPL C;  1IGN A;  3CCU I;  5GAE J;  2L5Q A;  2OU2 A;  2AXT C;  3J80 Z;  5TJJ A;  2X6O A;  4ENN A;  4PK4 A;  2FU4 A;  3MN2 A;  2LOO A;  3WTV C;  1YS7 A;  2E1N A;  4IHT A;  1ETY A;  3M8E A;  2KIF A;  3HYI A;  4M73 A;  4CYD A;  2P6S A;  2MW8 A;  4MTE A;  1TQM A;  2G9W A;  2DA6 A;  3ASN H;  4BXX J;  3U1K A;  2JWT A;  3WE2 A;  4BGD A;  1MDM B;  2HEO A;  4G7Z F;  2R93 J;  2BVL A;  3C2B A;  1TW2 A;  3K4L A;  5F1J A;  2E7W A;  5HS9 A;  1Z77 A;  2JA6 J;  5H2F C;  4XRS G;  1J0R A;  4IRG A;  2B7E A;  2CFO A;  2STW A;  4JOM A;  1R36 A;  2XGX A;  1ZG3 A;  3LFK A;  4ZYH A;  1R7J A;  2DA7 A;  4NDL A;  1DUX C;  2IPQ X;  2RKH A;  5DM7 F;  3GX4 X;  1MW7 A;  5FB2 A;  1BR2 A;  5HDN A;  3CMY A;  2L4A A;  3Q9V A;  3QPT A;  1HW5 A;  1MBK A;  3OSF A;  2NS8 A;  2M7A A;  1E3P A;  2VJI A;  3HHH A;  3H5N A;  2Z1D A;  5EDN A;  2XAQ A;  1XB4 A;  1FLI A;  1QQI A;  4UHT A;  4PZJ A;  2DN0 A;  3ZOB A;  2JZY A;  4RAF A;  1YX3 A;  2ZME A;  2JTV A;  2E2J J;  1YS6 A;  4HLX A;  4ZYA A;  2XAS A;  2MA3 A;  3IRR A;  2L54 A;  3CCL I;  4IHS A;  1O3T A;  2IVM A;  3S2W A;  4MTD A;  3O8H A;  4CCN A;  4RAG A;  2VBX A;  4KT6 A;  5M5W J;  3PSI A;  1HSJ A;  1X1A A;  2F2E A;  2VKE A;  4BQQ A;  3S8P A;  3V8J A;  1NG7 A;  3PIP F;  5FRN A;  1GDT A;  1ZLJ A;  2CQK A;  3GME A;  2R7V A;  3MMY B;  1XPX A;  3PQK A;  4MFE A;  3ZQG A;  2H1K A;  3H3V K;  1W5T A;  1FP1 D;  3E6M A;  1JGS A;  4HDV A;  1KQ0 A;  5ED4 A;  1ETO A;  2A68 F;  3FXJ A;  2NXN B;  3HRU A;  4I0A A;  2WA0 A;  1ZGA A;  3HOV J;  3QOE A;  1HCR A;  2HI3 A;  2QWW A;  3OYE A;  5DUK A;  4E6K G;  3KZY A;  5ILS A;  3I55 I;  1YJN I;  1LEB A;  2R7W A;  4EAT A;  4XON A;  3BT9 A;  3KZI C;  4A6E A;  4D0P A;  2OTJ I;  1F1Z A;  1IAW A;  3BZK A;  4FAS D;  4MEY F;  3JSP A;  2WAQ N;  2PJP A;  1ETW A;  3E6D A;  5FLX Z;  4HQE A;  1TW3 A;  4EJU A;  2QF7 A;  3CMM A;  2A69 F;  3GTP J;  4Y13 A;  1MZB A;  1LVK A;  2Q2E B;  3BQY A;  2ZJR F;  1WFX A;  3K9T A;  3R6S A;  3H9G A;  4ZYG A;  3ABL H;  4RMN A;  3OYC A;  1HQC A;  3DBL B;  1D1A A;  4A3M J;  4YIF A;  4IXA A;  2BBY A;  3R4K A;  2DAO A;  1E2X A;  1YFH A;  1GVD A;  2R4G A;  5HLI A;  3KP5 A;  3QYE A;  3LSR A;  1V5G A;  4EM0 B;  1KA8 A;  1MJA A;  3RKY A;  1JE8 A;  2NVY J;  4IHY A;  2RAE A;  2VQG A;  1TWC J;  1RET A;  3LAJ A;  1LB2 A;  4XLE A;  4DYR A;  4BQN A;  2GIZ A;  3QU6 A;  2RN7 A;  2VI6 A;  2VJ4 A;  3UNG C;  1R22 A;  1FIP A;  5BMZ A;  2Q8K A;  2H1L A;  3H9J A;  3K1M A;  2P4W A;  3OYF A;  5AON A;  1P2F A;  4U0Y A;  3TQN A;  4I0B A;  4A3I J;  3ZN0 A;  1F36 A;  2VB6 A;  2TRT A;  3MCZ A;  5JFR A;  1JT0 A;  4QLC U;  3B6C A;  4KJZ A;  4UVC A;  3M1E A;  2EV5 A;  2PQ8 A;  4CUG A;  3F8N A;  3HHG A;  3ZMZ A;  3W2A A;  1X3W B;  3OYL A;  4UXN A;  1XGO A;  4IHV A;  1WGX A;  4JP0 A;  5L3D A;  2XGD A;  3L09 A;  3JRB A;  4P55 A;  1WJA A;  1UAA A;  2R5Z B;  3AAF A;  2CQX A;  3OIP A;  5IT3 A;  3LAP A;  3C1D A;  1G4D A;  1KU3 A;  4V19 K;  1BJZ A;  1JKR C;  3DV8 A;  1RI7 A;  2B0L A;  3K1P A;  3FDY A;  3ECH A;  4XMY A;  4XOP A;  4UUS B;  2HWV A;  2PMZ A;  3P7N A;  2DDA A;  2WY7 Q;  2HFH A;  2L9N A;  2PBI A;  4NQW A;  3VOE A;  3FXM A;  4XLC A;  2B9S A;  5M3F J;  4OMY A;  1B6A A;  2HQA A;  3WTU C;  2LH9 A;  3KPH A;  5CKT A;  3HB9 A;  1EV7 A;  2LY9 A;  4R1H A;  3SZG A;  4A0X A;  5B5E C;  5LFA A;  3MKW B;  5FJ8 J;  1WJ5 A;  3QPL A;  1KU7 A;  2BW3 A;  1RES A;  1FNN A;  2G7H A;  4EGY A;  1USS A;  3GTM J;  4GGG A;  1FP2 A;  3MFK A;  2BY3 A;  2F5D A;  2VQL A;  4HEA 2;  4KNY A;  1T0F C;  3HGY A;  4I99 C;  3CDH A;  2WB1 N;  2L0K A;  2F4M B;  1J59 A;  4JBA A;  2EIL H;  4X1E A;  2PJR A;  1XMA A;  3HOW J;  4MFD A;  4CHU A;  1MJB A;  2OD5 A;  3C18 A;  1JKO C;  2EBI A;  3LQQ A;  1UJ8 A;  3E0J B;  3S1R J;  1ETV A;  1YLF A;  3I9V 2;  1LNW A;  2O5R A;  3EQL F;  2DPD A;  2KRF A;  1OIS A;  2XV4 S;  1W0T A;  1X4O A;  1R6R A;  2VOD A;  4OIO F;  1YE9 A;  3GTL J;  3G3Z A;  5J6X A;  1FT9 A;  1GXQ A;  2DQL A;  5EGO B;  2DXI A;  4RM2 A;  1R5G A;  3JTG A;  2MG4 A;  1JTX A;  2DFF A;  3GCM A;  2LY1 A;  1DGR M;  3DEU A;  3WTW C;  4PSX A;  3OV8 A;  3NQO A;  2EFP A;  3EUH C;  2DT5 A;  4PUS A;  4ASN A;  3ZGK A;  2JVG A;  1UB9 A;  1U8R A;  1JUM A;  3BWG A;  5DD8 A;  2CJJ A;  3GTJ J;  4A3K J;  1O3Q A;  1LUJ B;  2BY2 A;  2WTE A;  3R0A A;  5AIQ A;  1HLV A;  3GVA A;  2JA2 A;  2ISY A;  1ZHF A;  2VJJ A;  2HVQ A;  3MD2 A;  5F04 A;  2M4K A;  4IJA A;  4TV7 A;  4UB6 C;  3FM5 A;  1YJ9 I;  2AS5 F;  5M3M J;  1A6I A;  4IKF A;  1Z7U A;  2VPL A;  2RQP A;  3OYA A;  2JA8 J;  4HST A;  1IV8 A;  5L3E A;  5D6F A;  4ENJ A;  3KFW X;  1LE8 A;  4IHX A;  4LLG F;  1XSV A;  1SFE A;  2UUZ A;  2VIX A;  1RR8 C;  1G2H A;  1YOV B;  3HC7 A;  2JQ7 A;  2XF5 A;  4DZJ A;  1LDJ A;  4RB2 C;  2BZT A;  3RJP A;  5IYD J;  2VQH A;  4BYY A;  1F5T A;  1W7P A;  3QWL A;  4UV8 A;  1PDN C;  2IGM A;  4NC7 A;  1X2M A;  5GP9 A;  2R7X A;  1OCC H;  3RSN A;  4UUT A;  1EF4 A;  1U3E M;  1MH3 A;  2XVC A;  5DM6 F;  1T39 A;  5J8F A;  2OQG A;  1A31 A;  4CZZ A;  1EH6 A;  2E1O A;  2HPM A;  3IKT A;  2IS6 A;  1AHD P;  2ETH A;  1XG1 A;  2H94 A;  3H5A A;  1RUN A;  5ILU A;  4OIN F;  2LG4 A;  4PJL A;  2KZV A;  2QUF A;  2OBP A;  5FKO A;  5EG0 A;  3HL2 A;  3DP7 A;  5E17 F;  3I59 A;  1ENH A;  4QWQ A;  1HDD C;  3V4G A;  2M7B A;  3VOD A;  2IRF G;  1VND A;  2VN2 A;  2K9L A;  2CUE A;  2HGC A;  2Z33 A;  3I5U A;  3QRF F;  4EM1 A;  2GA1 A;  1Z3Y A;  4I6Z A;  1YTY A;  1DDN A;  3GTG J;  2F5C A;  4J19 A;  5EYR A;  3MZY A;  2P7V B;  2P0W A;  3CCV I;  2IAI A;  1WPK A;  4Q48 A;  1HBX G;  1UST A;  4II2 A;  2CUJ A;  2HZD A;  3W6K B;  2ELH A;  2M1B A;  2VT2 A;  5GTH C;  1IG7 A;  4CYC A;  3O2P E;  2Y9Z A;  3NWT A;  4BJT A;  2QM3 A;  2VBW A;  3H0G J;  3WGH A;  1Z6R A;  3QU3 A;  1AKH B;  1V4R A;  3T8T A;  2RNJ A;  3BCA A;  4QPQ A;  2FNP A;  3H3U A;  4AWX B;  4NUB A;  3OYB A;  2ESH A;  2M4G A;  5F1R A;  2XIG A;  4A6D A;  5CQG A;  1X58 A;  3CCY A;  3DQV C;  1KYW A;  1Z1D A;  1ZN2 A;  3I64 A;  2CO5 A;  3KYC B;  2DOD A;  2HDC A;  3CO6 C;  2BY0 A;  3G4S I;  2V9P A;  2KMU A;  2XSD C;  2B63 J;  2JT1 A;  1RR7 A;  4OIQ F;  2KP6 A;  2FEZ A;  5TRD A;  2LSO A;  2YUS A;  4QSH A;  3D5R C;  1TLH B;  3FBN B;  4HRI A;  1R4M B;  2OA4 A;  3G2B A;  4BE2 A;  4LB5 A;  2R5Y A;  1YRN B;  3KLO A;  5JI6 A;  3I4N J;  1TWH J;  3BLY A;  3H92 A;  2FBK A;  4B44 A;  1XCV A;  4HDU A;  2UXX A;  1WJC A;  1OCR H;  1FX7 A;  1TQI A;  1J5Y A;  3OIO A;  2EH3 A;  1HDP A;  4A3C J;  2Y0S N;  3M4O J;  1HOM A;  3I53 A;  4JX4 A;  4XLH A;  1PUF B;  4I09 A;  3QYB A;  4F3Q A;  4FTH A;  2OCC H;  4ANJ A;  5ICE A;  4XLP F;  4PGG A;  2W25 A;  4WXH A;  2ID3 A;  2QSH X;  3E7L A;  3IV5 A;  2X1E A;  2ZO4 A;  2LVS A;  4LOC A;  4PJN A;  2V1D A;  3KP3 A;  2C6Y A;  4MIM A;  3PM1 A;  2DMP A;  5FFZ A;  4XLF A;  4G9Y A;  5LHH A;  4II3 A;  5DYM A;  3ZQI A;  2QBY B;  3K4J A;  3JSO A;  1R1T A;  4WK8 F;  1T56 A;  4U7D A;  3CLQ A;  3JRF A;  4NHJ A;  4I01 A;  1D5Y A;  4GYI A;  4OAZ A;  3OOP A;  1FPQ A;  3PNT A;  1RNL A;  3DBH B;  3ZQ7 A;  4AYB N;  3Q0U A;  1L0O C;  2VQC A;  2ZNZ A;  3EYY A;  5KK1 A;  4ABZ A;  4CCL A;  1IV6 A;  1H8A C;  2VLA A;  3ZP5 A;  1D0Y A;  2NVT J;  1A6Q A;  2OAZ A;  4N4N B;  4LIV A;  4CH7 A;  1I6X A;  2CG4 A;  3IUO A;  4I02 A;  5KAF C;  3AG4 H;  4BJ6 C;  5CPR B;  3BOQ A;  3FHZ A;  1JT6 A;  1SD5 A;  3GZ5 A;  3L2Q A;  2V6C A;  3J7A O;  1UCR A;  5D8K B;  3GFM A;  3LOC A;  3K6G A;  4DJA A;  3M9A A;  2NYX A;  1XGS A;  2J5P A;  2O8X A;  2OZU A;  4HA8 A;  4A3G J;  2RRE A;  2E5Z A;  2N8G A;  1J7K A;  2LF8 A;  2GAU A;  1O7L A;  1T98 A;  1UHM A;  2EA4 A;  4BXF A;  4BHB A;  1KU9 A;  1I39 A;  1K83 J;  1YG2 A;  3SDB A;  2XDV A;  2QZ8 A;  1HKT A;  1HST A;  3IAS 2;  3OYH A;  3V7C A;  4L9T A;  3HTS B;  2VL8 A;  2VOO A;  1MMS A;  3QOD A;  2R7T A;  3JAM K;  1ZGJ A;  2ZCW A;  3HZJ A;  4XBF A;  2DFE A;  3I58 A;  1BOA A;  1BM9 A;  4M9X A;  3E5Q A;  2EK5 A;  2LY2 A;  4HQM A;  2ESN A;  1MD0 A;  2L7K A;  1WI3 A;  3J81 K;  2GM4 A;  2VC1 A;  2K4B A;  3S15 J;  2DT7 B;  5K5R A;  4O5V A;  1JUP A;  2HNH A;  3WG7 H;  2HS5 A;  1W1W E;  2CH0 A;  2LYC A;  4Y4R A;  1TTY A;  5FD6 A;  1X4P A;  4PDK A;  2MGQ A;  4S05 A;  2QYO A;  5K5O A;  1FYM A;  3TO9 A;  4OIP F;  1APL C;  4G8X A;  2ZSH B;  4CA0 A;  2E36 A;  3I56 I;  1BIA A;  4UVA A;  4YFN F;  2R3S A;  2A05 A;  4M6V A;  3EPZ A;  2EIM H;  2DTR A;  2IA1 A;  1Z05 A;  2BHY A;  1VQ6 I;  3RI4 A;  3GZN B;  3ZMV A;  4I7H A;  5JLW A;  4P96 A;  3F21 A;  2K40 A;  1ZG5 A;  3SXY A;  1MBG A;  3VPR A;  4BU2 A;  3RYP A;  3P9K A;  3K4N A;  1IDY A;  1KON A;  4YEJ A;  2CW0 F;  2KL4 A;  1R1V A;  1P4W A;  2FNA A;  2PX9 A;  4V2F A;  4XQF A;  3TED A;  4A3F J;  2JVH A;  3RKX A;  3E97 A;  5LHG A;  4D9J A;  4A2U A;  4BXU A;  4F93 B;  2L9R A;  2VKH A;  1YX5 A;  3BTJ A;  5BQT A;  1IXR C;  1YW7 A;  3RQ4 A;  2DFH A;  4FET A;  1U2W A;  4P9U A;  2DMU A;  2P7C B;  3O3K A;  5C4J J;  1UG0 A;  4GRI A;  3HOY J;  3OYG A;  2WY8 Q;  4KN7 X;  3M8F A;  4LG0 B;  5M5Y J;  1XMK A;  2EWN A;  2IXS A;  2EJR A;  1G8X A;  4E7Z A;  1UHS A;  1YW9 A;  3GTQ J;  4G12 A;  2HOA A;  2I5U A;  5FO5 A;  4O3M A;  2DCE A;  4IRI A;  3T0Y A;  4A0Z A;  1DQU A;  4X0G A;  4HX8 A;  3H1C A;  3CMA I;  4M3B A;  1ZGW A;  2JA7 J;  3S14 J;  3S2D J;  3DCF A;  2HYF A;  1O57 A;  1DP7 P;  1WI9 A;  4AID A;  3AKZ A;  3VYU B;  3FXR A;  4PJ0 C;  2NOG A;  1Z0X A;  2OCE A;  4M71 A;  2FSW A;  4J01 A;  2R7O A;  3F22 A;  2XAJ A;  4B1R A;  3IP4 B;  3BTC A;  1OYW A;  2RNG A;  2Y48 A;  5JHF A;  5ICF A;  4CDG A;  4ZZD A;  3BZ6 A;  4A3E J;  5IPA A;  4I76 A;  2VPR A;  1IC8 A;  2FBI A;  4IOC F;  3SJM A;  4E4H A;  2M87 A;  4LD5 A;  3TDU C;  4ZYD A;  1FBS A;  1SVM A;  2IGN A;  2CSO A;  4L5J A;  4BY7 J;  2FUG 2;  4PGH A;  2DYS H;  3A01 B;  2A5W A;  5J4Y A;  1D0Z A;  4UNO A;  2ME0 A;  1CQT A;  1Y0U A;  2E5N A;  1N75 A;  2E71 A;  2DFI A;  4OWR B;  1S3J A;  2M5W A;  1YO5 C;  3GYH X;  1VQP I;  2X48 A;  1LFU P;  1QZZ A;  5E3N A;  3OS0 A;  1T2K A;  1NHA A;  3MZH A;  5LGU A;  4AIK A;  1BR4 A;  3IHU A;  4XRS A;  3P9C A;  1A5J A;  2KPM A;  3LSG A;  3OL4 A;  5IP6 A;  2JN6 A;  4UUV A;  3LST A;  4A5M A;  4KIB A;  4RBO A;  2BE5 F;  3Q0W A;  4RM3 A;  5IT9 Z;  1J9I A;  5KAI C;  2IP2 A;  2OJE D;  3W2V A;  1SAN A;  3LNQ A;  2LKS A;  2X6X A;  4RLQ A;  2DMN A;  3P9I A;  1ON2 A;  4DNC A;  4FIS A;  1BI2 A;  1WHU A;  1YQA A;  3CUQ C;  3VWB A;  4CSW A;  1ZR4 A;  2XRL A;  1GUU A;  5CVJ A;  5EEA A;  2VOP A;  1POG A;  4E7I A;  5E1X A;  4DYQ A;  3QOP A;  4L0Y B;  1Q1V A;  1RRJ A;  2V4J C;  3S32 A;  3K10 A;  2A07 F;  3ASO H;  2W48 A;  2QQ8 A;  1ERD A;  5K7F A;  1HW1 A;  3CUQ B;  2XAH A;  1X1D A;  4KN4 X;  3RCO A;  2ID6 A;  2KDO A;  2XAF A;  2IGK A;  2DMT A;  3HKZ N;  3KET A;  4EQQ A;  1ZRF A;  5FFX A;  4Y33 A;  2CWE A;  3ML6 A;  3RTR A;  1OMI A;  2DPU A;  1MKM A;  2P8T A;  5J1R A;  3J81 Z;  1ZRE A;  3ABT A;  2V9K A;  1SMY F;  2GOX B;  2QSG X;  2F4I A;  3C7J A;  1QNT A;  2LP0 A;  3VYR B;  1VQ9 I;  2GLO A;  2CQQ A;  1D1B A;  1QU3 A;  4RGX A;  1TWA J;  3H35 A;  5K7Z A;  2NS0 A;  3RIR A;  4B3A A;  4XID A;  3SYT A;  1T08 B;  4RS8 A;  4U87 A;  2DQR A;  3FXL A;  3KX2 A;  1SD7 A;  1D8K A;  2F4O B;  3BR1 A;  1GXP A;  1ZQ3 P;  2O8K A;  4WXD A;  1H9G A;  3OS2 A;  3TL4 X;  4YRV A;  3FXK A;  4AVP A;  3BR5 A;  2H8R A;  3CES A;  2DO7 A;  4B8X A;  1VQ8 I;  1MBH A;  2D1V A;  5J1U A;  3K0L A;  4JK1 X;  3NAU A;  3LSH A;  3A2K A;  1WJD A;  5HLH A;  3GEZ A;  3E3V A;  5F08 A;  4ZTJ A;  3Q5F A;  3ZCO A;  1WJE A;  1JHF A;  1QZY A;  3OWT A;  4I98 B;  4M3G A;  3KP7 A;  3H0D A;  3HEF A;  2VBZ A;  2WV1 A;  1U5T A;  1LFP A;  3IKV A;  3LMM A;  4M9S A;  2GXA A;  3C3W A;  5C3E J;  2ZJ2 A;  1D8J A;  5J47 A;  1W36 C;  1X3U A;  2JPC A;  1ZRC A;  2E19 A;  5HS8 A;  4LLL A;  5K7H A;  3CCQ I;  1S72 I;  2NOJ B;  5DCM B;  2HYG D;  2M2E A;  1X19 A;  4XKV A;  4HPQ A;  1P92 A;  2RC4 A;  2K7L A;  4AYB A;  4KIG A;  4AIH A;  3MKY B;  2MFZ A;  4M74 A;  3CF2 A;  3MAJ A;  1XDU A;  5CJ9 A;  2Z3Y A;  1BJA A;  1EH8 A;  2K4J A;  5E20 A;  2MD5 A;  1XDS A;  4D5F A;  1MIJ A;  2Q0O A;  4B48 A;  4L5I A;  1VQ5 I;  2YS9 A;  2P6T A;  5D5V B;  1JI8 A;  1IN5 A;  1QHG A;  1N77 A;  3BR3 A;  3ZQC A;  1FOY A;  1ETQ A;  2E1M C;  4E70 A;  3BR2 A;  1K79 A;  3RPU D;  1J2X A;  3WTX C;  1JXS A;  4I2O A;  1Q1H A;  3K2Z A;  4MGR A;  2R7D A;  3U9G A;  3CQZ J;  2EPF A;  4XK4 A;  2KT0 A;  2OC6 A;  3F8F A;  3MQ0 A;  3ZMU A;  4KIF A;  2J5O A;  1RUO A;  2ZBK A;  2E1M B;  2HTS A;  1TL8 A;  4LG3 A;  4Q5S F;  1ZAO A;  2IS2 A;  2YU9 J;  3MKZ A;  3OSG A;  3PL8 A;  2QQB A;  2H27 A;  3A0H C;  4CZC A;  2DA3 A;  5E79 C;  1QHH D;  2O3F A;  1K61 A;  3CTA A;  4XN0 A;  3S1M J;  1TT0 A;  3HOX J;  3R61 A;  3FXQ A;  1FC3 A;  2D1H A;  4RGR A;  2Z99 A;  4M3D A;  2KIM A;  2EQR A;  5E1Z B;  4HF1 A;  3CC4 I;  3H9Q A;  2CMP A;  2OUM A;  1K78 B;  1GV2 A;  3AG3 H;  3F3X A;  3MWM A;  1OR7 A;  5E3O A;  2PG4 A;  1UG2 A;  4L9N A;  2F5F A;  1IN8 A;  2H6B A;  1SVO A;  1YRN A;  1TWG J;  4HV6 A;  2P5K A;  4G7O F;  3HOT A;  2KZG A;  2V1N A;  4OOI A;  4P1W A;  2ZME C;  4RAY A;  1Y8R B;  2MAB A;  1B4A A;  1SFU A;  1BW5 A;  2K02 A;  4L18 B;  1NG6 A;  2XHK A;  2LD5 A;  3E5X A;  3I4P A;  3WE3 A;  2ZXJ A;  3H3Z A;  2GBY A;  3WHC A;  4G7H F;  5LHI A;  3LFU A;  2XF6 A;  4ESF A;  2VKD A;  1KZH A;  3ERM A;  3HSF A;  3J7Z I;  2L7F P;  3DEE A;  1B8I A;  2BEO A;  5LLQ A;  2X1D A;  4BBR J;  1KGS A;  2DA1 A;  4ZDO A;  1OKR A;  2ECB A;  3L7W A;  1U9N A;  1VI0 A;  2AXL A;  3HJE A;  2M30 A;  4XLN F;  1GV5 A;  4YII A;  1TC3 C;  4XSX F;  1ONV A;  1R58 A;  4CCM A;  2Z9O A;  3FXU A;  4PFO A;  5FKL A;  3IWZ A;  4WX9 A;  3HGG A;  5KVR A;  3TOA A;  1V5F A;  3LA3 A;  3G71 I;  2OQR A;  1HA8 A;  4LMY A;  1YYV A;  1BBY A;  2IJL A;  4J00 A;  2A6E F;  1WJB A;  2EZL A;  2X1C A;  1JHH A;  4KIS A;  2X6Y A;  3BTL A;  5F0H A;  2EB7 A;  2BY1 A;  5BPD A;  3SFI A;  3FK7 A;  3CCS I;  3S2H J;  4CIC A;  3OY9 A;  2W24 A;  5A2Q K;  1XCB A;  1HW2 A;  3GLL A;  4XIC A;  3CC7 I;  4KFC A;  2ZNY A;  2QKL B;  5LRS A;  1JUS A;  3TP0 A;  4CO8 A;  2ACJ A;  4BHC A;  4CCK A;  2GXB A;  1ZTR A;  2R7F A;  4A69 C;  3DBR B;  1T95 A;  5IOZ A;  1IRX A;  2K27 A;  5D4R A;  1BR1 A;  4FQG A;  3DEW A;  2O0Y A;  1TZL A;  4BH9 A;  5ILV A;  2P5L C;  5IOY A;  3HUG B;  5D6E A;  1Z3X A;  1WRJ A;  1VZ0 A;  1X1P A;  4YIR X;  1DPR A;  3L2V A;  3PO2 J;  4G94 A;  4ZH4 F;  2Q1Z B;  2VBY A;  5HVQ C;  1VQK I;  3D0S A;  3DFG A;  4GDF A;  2KQR A;  2O9L A;  1O3R A;  5TGT A;  2QEX I;  1XMX A;  1MGT A;  3OYI A;  5LGT A;  2QSF X;  3PSF A;  2OPT A;  2BOL A;  2KIQ A;  5BNG A;  1LVA A;  2MLG A;  1F43 A;  2XGE A;  1DU6 A;  1STZ A;  3BDD A;  4CGZ A;  4LK0 F;  4MO7 A;  3BC8 A;  4Y52 J;  3HM5 A;  4KIC A;  3V7R A;  1WKM A;  3PNV A;  3PQJ A;  5DCF A;  1ULY A;  4F55 A;  3KP2 A;  1P9Q C;  3HPH A;  3JRD A;  1SC7 A;  1OYY A;  3COA C;  5HS7 A;  2L3D A;  4Y17 A;  2CV2 A;  2MD0 A;  5JR3 A;  3ONQ A;  2DA5 A;  2LNB A;  1BN5 A;  3K4M A;  1UEL B;  3CJQ B;  1WCM J;  3KCC A;  3WU0 A;  4XKB A;  5IP7 J;  5EF6 A;  3P5J A;  4BY1 J;  3GO5 A;  3JRH A;  3ERE D;  3BG3 A;  4G6D A;  3CD6 I;  3GTK J;  5K1Y A;  3HRT A;  4EMS A;  2H6C A;  1SD4 A;  2RVC A;  3JRC A;  5H6R A;  1G3S A;  2FXA A;  1BOB A;  1NK3 P;  3HKZ A;  3EET A;  3JRA A;  3UR3 C;  3PJR A;  4BUP A;  1BC8 C;  1S7A A;  4BDY A;  3JRI A;  3IL2 A;  5D5X B;  1S6L A;  3VDX A;  1AWC A;  3WTZ A;  2KRC A;  2KLO A;  4EJT A;  3DLL F;  4PSW A;  2K9M A;  1L3L A;  1CF7 B;  4MHG A;  4LG0 A;  4XOR A;  2XB0 X;  1ZKG A;  2XPU A;  2XAU A;  2DMQ A;  1MMA A;  4E7L A;  1YIJ I;  3DLA A;  2UV1 A;  4HBL A;  4NBQ A;  5D5W B;  1YJW I;  3GW2 A;  3L2R A;  2WAQ A;  5JVG F;  3BPV A;  3G1L A;  4FX4 A;  2HVS A;  3KEQ A;  1HKQ A;  5IYC J;  1R71 A;  2FF4 A;  4FE7 A;  4E7H A;  2EIN H;  2BXZ A;  2MSY A;  4IRH A;  4BEH B;  5E8I A;  1FSE A;  3BQZ A;  2YSR A;  2BXY A;  1P7I A;  1H88 C;  3HBL A;  1G3T A;  3Q9S A;  3CO7 C;  3CCJ I;  2HPI A;  4UY8 I;  5LEJ A;  5JVT A;  2M45 A;  1W36 D;  4CCJ A;  3MEX A;  2PJR B;  2DU9 A;  3FMQ A;  2CQ7 A;  2QQ9 A;  3AG2 H;  3K4B A;  1LEA A;  3GBG A;  2D5V A;  2HR3 A;  4ENM A;  1JKQ C;  2LKX A;  4EM2 A;  1MDM A;  4ZTF A;  3OYK A;  1CGP A;  3A01 A;  3A03 A;  1O7F A;  4ZC3 A;  4Y3O A;  2VE9 A;  3ECO A;  3PUB A;  4C2U A;  1ACI A;  2LBF B;  4EEF G;  2M34 A;  1H0M A;  2CV1 A;  2K9Q A;  4GO1 A;  2JPB A;  2Y0M A;  3CCE I;  2WV0 A;  1D1C A;  3HSR A;  4ZDP A;  2H09 A;  2M8G X;  3OMY A;  3TO6 A;  3JW4 A;  3LSP A;  3A4C A;  1R23 A;  1C0W A;  4E7K A;  1F9N A;  2LLK A;  3OL3 A;  1SMT A;  3SEQ A;  2E34 A;  2FRH A;  2L4M A;  2PI0 A;  3F23 A;  2O61 A;  4M9Z A;  4NC6 A;  2JUC A;  1WSU A;  5LBQ A;  4B47 A;  1UZC A;  3F9K A;  1XS9 A;  3MZ8 A;  2HXI A;  3L2W A;  4A0Y A;  3LSK A;  5D5U B;  3J7Y J;  3M7G A;  3RYR A;  2KFD A;  2A3S A;  4A12 A;  1QGP A;  3GFJ A;  1MMN A;  3OYN A;  2LF7 A;  4LIT A;  4FCY A;  5CVU A;  3CP8 A;  1VTN C;  4B4C A;  5CYV A;  1BIB A;  2FBH A;  1I1G A;  1RIO H;  4D7N A;  3C2G A;  5ICG A;  1IRG A;  1ZLK A;  2XUB A;  4GFB A;  1OFC X;  2YR2 A;  2ZJQ F;  4QPO A;  4E7S A;  4KYW A;  1TT5 B;  4BAY A;  3LA2 A;  1UMQ A;  3L9F A;  5EEG A;  2XSJ C;  2EV0 A;  2KJB A;  2XGC A;  2W57 A;  1O3S A;  5IYB J;  2Y69 H;  3J7A Y;  2K5C A;  1UHW A;  1W7P B;  4BHP A;  5DS9 A;  4LB6 B;  1ZYR F; 
#chains in the Genus database with same CATH homology
 3TKY A;  2HQR A;  3FWE A;  2EFN A;  4YFK F;  1E17 A;  2W85 A;  4PCQ A;  1WQ2 A;  1HXD A;  5L3C A;  3E6B A;  3PFI A;  2HTJ A;  2Q2E A;  3WU1 B;  4KA4 A;  2GA2 A;  3U2R A;  1EH7 A;  5FLX K;  2A5Y B;  4RB3 C;  5D4S A;  2YX7 A;  4IPA A;  2WC2 A;  2OZ6 A;  1ZAR A;  2XAG A;  2NNN A;  4G6Q A;  1TNT A;  4N9H A;  3VFZ A;  1S29 A;  3I71 A;  4R8H A;  5FD5 A;  3ULQ B;  3HSE A;  1S7O A;  5FGM A;  5HDG A;  1B9M A;  3O6B B;  4KT5 C;  3ZPL A;  4ZZL A;  4GCV A;  1U78 A;  4BNC A;  1SAX A;  2FOK A;  5DD4 A;  2MLK A;  3WGI A;  2XRN A;  2L02 A;  1IZ1 A;  2PEX A;  1G6N A;  1Z91 A;  1I27 A;  5LGN A;  4U0V A;  1K6O A;  5ICC A;  3FM3 A;  1PP8 F;  3K1N A;  3FF5 A;  4EJO A;  3ZMT A;  3SFZ A;  5HOO A;  4N9I A;  2COM A;  2QLZ A;  1K78 A;  4M6Y A;  1RZ4 A;  1Z9C A;  2TDX A;  3JTH A;  1FYK A;  1T0F A;  4FT8 A;  1F4K A;  4ETS A;  1GHC A;  2MH2 A;  1G3W A;  1FSH A;  4XRF A;  4KMU X;  1P4X A;  1XSD A;  2MC3 A;  5JHU A;  4GXO A;  3JAM Z;  5ERI A;  4IVN A;  3KZZ A;  4Q4Z F;  2ZFW A;  5E1W A;  4H0E A;  3N4M A;  1TBX A;  2IW5 A;  2STT A;  5D8L B;  1W5S A;  1H9T A;  3BJA A;  3DPT A;  4LGW A;  3ZMD A;  1LJ9 A;  3WTY C;  2GQQ A;  1W4M A;  1LDD A;  3EUH A;  2PN6 A;  3RDI A;  2DI3 A;  4R79 A;  1OYI A;  2BGC A;  2DK5 A;  4AD9 A;  1D5V A;  3DF8 A;  1LQ1 A;  3DXJ F;  6PAX A;  2YU3 A;  1R5H A;  4HF0 A;  3DKW A;  3QP5 A;  1P4A A;  1YW8 A;  2XKP A;  3HUG A;  2UWM A;  4KMF A;  1T38 A;  2DW4 A;  4EJV A;  4MEX F;  4WCG A;  2NNY A;  4CXF A;  2EFW A;  3TOB A;  2QQA A;  4UVB A;  2GIV A;  3BJO A;  2GZW A;  3G73 A;  2V1X A;  1ON1 A;  3KLN A;  1T6S A;  3B73 A;  3SHF A;  1KQ9 A;  3F8B A;  3GWZ A;  3WTS C;  1IUY A;  1FBU A;  4LK1 F;  2EFQ A;  5BPI A;  5DV5 A;  4XSZ F;  3HRM A;  4FHT A;  4RGS A;  3ELK A;  2GWR A;  3IWF A;  3BJ6 A;  4LJZ F;  5HDK A;  4MNU A;  1W7P D;  3N97 A;  1TQP A;  2X4H A;  5BOX A;  3QP6 A;  4BQA A;  1IN7 A;  1IXS B;  4HOB A;  1QBJ A;  2A6H F;  5BS6 A;  5E18 F;  5L3B A;  2JSC A;  3ROU A;  4EV0 A;  3SZT A;  1PUE E;  4F7Z A;  4O6J A;  1FOK A;  5H20 A;  3GFI A;  3EDP A;  3U1D A;  2PMU A;  2CFX A;  2M8E A;  1CF7 A;  2W84 A;  2P5V A;  2QVO A;  5EEH A;  1TNS A;  1ZH5 A;  4N0B A;  4EVI A;  2K86 A;  2CGP A;  2UXN A;  3F8C A;  2HZT A;  3KP4 A;  4HX4 A;  2MH9 A;  5CVV A;  2EV6 A;  4OIR F;  5LRR A;  2EFO A;  1BI0 A;  2FA5 A;  3WOD F;  3IC7 A;  2ZME B;  3ISP A;  3GUD A;  4JQF A;  3TDZ C;  3BPX A;  1OPC A;  2QEN A;  3NRV A;  4WXC A;  5F6F A;  1FYL A;  2QBY A;  5AIP A;  5DEQ A;  3VB2 A;  3GF2 A;  3I0T A;  3WGG A;  5HLG A;  1QPM A;  1FBQ A;  2E7X A;  4LFU A;  1BC7 C;  2ZKZ A;  1U6G A;  5CVR A;  3L2C A;  2L01 A;  1FWZ A;  4HLY A;  1GVJ A;  3L00 A;  3TGN A;  3GLX A;  4WF2 A;  4ON0 A;  3RKW A;  5L3F A;  3F6V A;  1P6R A;  3BP8 A;  4HF2 A;  2V9V A;  1BI1 A;  1REP C;  1U5T C;  3D5L A;  1FZP B;  4AIJ A;  3VEP A;  1ZRD A;  4RB0 A;  4RGU A;  4Y15 A;  3RPU A;  4HAM A;  5K5Q A;  2FQ3 A;  2PMH A;  4L9V A;  4EJW A;  3E6C C;  1U5T B;  2JRT A;  2YX4 A;  2XRO A;  3WTT C;  3FMS A;  2XKO A;  3LA7 A;  2UZK A;  3T5X A;  3R60 A;  2D2W A;  4ENK A;  1S8N A;  3T8R A;  3R0J A;  5H6Q A;  1V3F A;  2HKX A;  2GXG A;  3WG9 A;  1HKS A;  3W6J B;  4IF4 A;  5CVI A;  2VE8 A;  3T1B A;  1Z6T A;  4YFX F;  2VT3 A;  3HRS A;  1XGN A;  2O6G E;  4M72 A;  5F64 A;  3ABU A;  3FMR A;  2FML A;  3TO7 A;  3FZV A;  4NB5 A;  2KIU A;  1QO0 D;  2FE3 A;  3V8K A;  1K7A A;  2VXZ A;  2YPR A;  3BY6 A;  3CUO A;  4EGZ A;  5E8G A;  1ZG1 A;  2IT0 A;  1I5Z A;  3F72 A;  3FX3 A;  3V8L A;  3HOS A;  4P9F A;  5L3G A;  2CYY A;  3K69 A;  3GXO A;  2V79 A;  3F8M A;  2EA2 A;  4ESB A;  2VON A;  1BI3 A;  3B02 A;  2RDP A;  1R00 A;  2RV8 A;  4OMZ A;  5DDG A;  4FX0 A;  2Y75 A;  3HIF A;  2FMY A;  4RAZ A;  4HV5 A;  2E1C A;  2PLY A;  3SZP A;  1IN4 A;  3HTU A;  1KQ8 A;  2Z5U A;  1UFM A;  4P5O A;  4GYG A;  4WWC A;  3J80 K;  1XSX A;  4A5N A;  1AOY A;  4S04 A;  1IW7 F;  3GZ6 A;  2HKO A;  4ZYE A;  3KE2 A;  4LLN A;  2DBB A;  2IA0 A;  4Z2Y A;  1DPU A;  3ZMS A;  3KP6 A;  1SFX A;  4K2E A;  3V7S A;  5J8C A;  4KUM A;  2BYV E;  2WWY A;  4Q47 A;  4RB1 A;  3QPH A;  5A2Q Z;  4HZF A;  4U0W A;  2IA2 A;  2MBF A;  1ODD A;  1WWX A;  1I1S A;  1KYZ A;  4DQ2 A;  4L9J A;  3EYI A;  1SD6 A;  3CLO A;  5IT9 K;  3RPQ A;  1IRF A;  2VC0 A;  3I54 A;  2KKO A;  3CUQ A;  1D3Y A;  1B59 A;  2A61 A;  2LKP A;  3ZN1 A;  2LDU A;  2ISZ A;  2NRA C;  1XD7 A;  2DLL A;  1XGM A;  2ADU A;  3LQR A;  3CJN A;  4MQV A;  2HQN A;  1LDK B;  5CLS A;  4MQ9 F;  3KEO A;  4KDP A;  3QAH A;  2HOE A;  5DUI A;  3F6O A;  2NAZ A;  1R1U A;  2V1U A;  1PP7 U;  2O03 A;  3I59 B;  2DK8 A;  1KU2 A;  2KJC A;  2BV6 A;  4HX7 A;  4U7B A;  1FY7 A;  1G3Y A;  4UV9 A;  2F5E A;  1IXC A;  4OU0 A;  5DCM A;  5LEK A;  2PFB A;  1A04 A;  3SQN A;  2X0L A;  3LWF A;  4HW0 A;  4YG2 F;  3IRQ A;  3E5U A;  4U88 A;  1J75 A;  4L0Z B;  4M6X A;  1B9N A;  3BRO A;  4HYE A;  1IF1 A;  2RGV A;  1YIO A;  1XN7 A;  1MJ9 A;  2G7U A;  4B09 A;  1IN6 A;  2D45 A;  3NEU A;  4ESJ A;  3GFL A;  1B1B A;  3REO A;  3DPL C;  2OU2 A;  3J80 Z;  5TJJ A;  4ENN A;  2FU4 A;  3WTV C;  1YS7 A;  2E1N A;  4IHT A;  3M8E A;  2KIF A;  3HYI A;  4M73 A;  4CYD A;  2P6S A;  4MTE A;  1TQM A;  2G9W A;  3WE2 A;  1MDM B;  2HEO A;  4G7Z F;  1TW2 A;  2E7W A;  5HS9 A;  1J0R A;  4IRG A;  2STW A;  1R36 A;  2XGX A;  1ZG3 A;  4ZYH A;  3LFK A;  1R7J A;  1DUX C;  2IPQ X;  2RKH A;  3GX4 X;  5FB2 A;  5HDN A;  2L4A A;  3Q9V A;  3QPT A;  1HW5 A;  3HHH A;  2XAQ A;  1XB4 A;  1FLI A;  1QQI A;  4UHT A;  4PZJ A;  2JZY A;  2ZME A;  2JTV A;  1YS6 A;  4HLX A;  2XAS A;  2MA3 A;  3IRR A;  2L54 A;  4IHS A;  1O3T A;  2IVM A;  3S2W A;  4MTD A;  2VBX A;  1HSJ A;  2F2E A;  3V8J A;  1ZLJ A;  2CQK A;  3PQK A;  1W5T A;  1FP1 D;  3E6M A;  1JGS A;  4HDV A;  1KQ0 A;  5ED4 A;  2A68 F;  4I0A A;  3HRU A;  1ZGA A;  2QWW A;  5DUK A;  3KZY A;  5ILS A;  1LEB A;  4D0P A;  4A6E A;  1F1Z A;  1IAW A;  4MEY F;  3JSP A;  2PJP A;  3E6D A;  5FLX Z;  4HQE A;  1TW3 A;  4EJU A;  2A69 F;  4Y13 A;  1MZB A;  3R6S A;  3K9T A;  4ZYG A;  1HQC A;  4YIF A;  4IXA A;  2BBY A;  3R4K A;  2DAO A;  1E2X A;  1YFH A;  5HLI A;  3KP5 A;  4EM0 B;  1KA8 A;  1MJA A;  3RKY A;  1JE8 A;  3LAJ A;  1LB2 A;  3QU6 A;  2RN7 A;  1R22 A;  5BMZ A;  2Q8K A;  3K1M A;  2P4W A;  5AON A;  1P2F A;  4U0Y A;  3TQN A;  4I0B A;  3ZN0 A;  3MCZ A;  5JFR A;  4QLC U;  4UVC A;  3M1E A;  2EV5 A;  2PQ8 A;  3F8N A;  3HHG A;  3ZMZ A;  4UXN A;  1XGO A;  5L3D A;  3L09 A;  4P55 A;  3AAF A;  5IT3 A;  3LAP A;  3C1D A;  1G4D A;  1KU3 A;  3DV8 A;  1RI7 A;  2B0L A;  3K1P A;  3ECH A;  2HWV A;  3P7N A;  2HFH A;  4NQW A;  2PBI A;  3VOE A;  4OMY A;  1B6A A;  3WTU C;  1EV7 A;  4A0X A;  4R1H A;  1KU7 A;  1FNN A;  2G7H A;  4EGY A;  1USS A;  4GGG A;  1FP2 A;  3MFK A;  2F5D A;  4KNY A;  3CDH A;  1J59 A;  4JBA A;  1XMA A;  4CHU A;  1MJB A;  2OD5 A;  3C18 A;  3LQQ A;  1YLF A;  1LNW A;  3EQL F;  2DPD A;  2KRF A;  2XV4 S;  2VOD A;  4OIO F;  3G3Z A;  5J6X A;  1FT9 A;  1GXQ A;  2DQL A;  1R5G A;  3JTG A;  3DEU A;  3WTW C;  3OV8 A;  3NQO A;  2EFP A;  2DT5 A;  4ASN A;  1UB9 A;  1U8R A;  3BWG A;  5DD8 A;  1O3Q A;  3R0A A;  2WTE A;  5AIQ A;  3GVA A;  2ISY A;  1ZHF A;  4IJA A;  4TV7 A;  3FM5 A;  2AS5 F;  1Z7U A;  2RQP A;  5L3E A;  5D6F A;  4ENJ A;  3KFW X;  4LLG F;  1XSV A;  1SFE A;  1LDJ A;  4RB2 C;  3RJP A;  4BYY A;  1F5T A;  1W7P A;  4UV8 A;  1PDN C;  1U3E M;  1T39 A;  2XVC A;  5J8F A;  2OQG A;  4CZZ A;  1EH6 A;  3IKT A;  2ETH A;  2H94 A;  1RUN A;  5ILU A;  4OIN F;  2QUF A;  2OBP A;  3DP7 A;  5E17 F;  3I59 A;  4QWQ A;  3V4G A;  3VOD A;  2IRF G;  2VN2 A;  2HGC A;  2Z33 A;  3I5U A;  3QRF F;  4EM1 A;  2GA1 A;  1YTY A;  1DDN A;  2F5C A;  3MZY A;  2P7V B;  4Q48 A;  1HBX G;  1UST A;  3W6K B;  2ELH A;  2M1B A;  2VT2 A;  3O2P E;  2QM3 A;  2VBW A;  3WGH A;  1Z6R A;  3QU3 A;  1V4R A;  3T8T A;  2RNJ A;  4AWX B;  2FNP A;  3H3U A;  2ESH A;  5F1R A;  2XIG A;  4A6D A;  3DQV C;  1KYW A;  1Z1D A;  1ZN2 A;  3I64 A;  2CO5 A;  2HDC A;  3CO6 C;  2JT1 A;  4OIQ F;  2FEZ A;  5TRD A;  2LSO A;  1TLH B;  2OA4 A;  4LB5 A;  3KLO A;  5JI6 A;  3H92 A;  2FBK A;  1XCV A;  4HDU A;  2UXX A;  1FX7 A;  1TQI A;  1J5Y A;  3I53 A;  4I09 A;  4XLP F;  5ICE A;  4PGG A;  2W25 A;  4WXH A;  2ZO4 A;  2V1D A;  3KP3 A;  2C6Y A;  5FFZ A;  4G9Y A;  5LHH A;  5DYM A;  2QBY B;  3JSO A;  1R1T A;  4WK8 F;  4U7D A;  4NHJ A;  4I01 A;  4GYI A;  3OOP A;  1FPQ A;  1RNL A;  3ZQ7 A;  1L0O C;  3EYY A;  2ZNZ A;  5KK1 A;  3ZP5 A;  2OAZ A;  1I6X A;  2CG4 A;  4I02 A;  3BOQ A;  3FHZ A;  1SD5 A;  3GZ5 A;  2V6C A;  3J7A O;  1UCR A;  5D8K B;  3GFM A;  3M9A A;  2NYX A;  1XGS A;  2J5P A;  2O8X A;  2OZU A;  4HA8 A;  1J7K A;  2LF8 A;  2GAU A;  1O7L A;  1T98 A;  1UHM A;  2EA4 A;  4BHB A;  1KU9 A;  1YG2 A;  2QZ8 A;  1HKT A;  1HST A;  3V7C A;  4L9T A;  3HTS B;  2VOO A;  3JAM K;  1ZGJ A;  2ZCW A;  4XBF A;  3I58 A;  1BOA A;  1BM9 A;  4M9X A;  3E5Q A;  2EK5 A;  4HQM A;  2ESN A;  1MD0 A;  3J81 K;  2VC1 A;  2K4B A;  5K5R A;  4O5V A;  2HS5 A;  1TTY A;  5FD6 A;  4PDK A;  4S05 A;  2QYO A;  5K5O A;  1FYM A;  3TO9 A;  4OIP F;  4G8X A;  1BIA A;  4UVA A;  4YFN F;  2R3S A;  2DTR A;  2IA1 A;  1Z05 A;  3RI4 A;  3ZMV A;  4I7H A;  4P96 A;  3F21 A;  1ZG5 A;  3SXY A;  3RYP A;  3P9K A;  2CW0 F;  1R1V A;  1P4W A;  2FNA A;  5LHG A;  3RKX A;  3E97 A;  4A2U A;  4BXU A;  5BQT A;  1IXR C;  1YW7 A;  1U2W A;  4P9U A;  2P7C B;  3O3K A;  4KN7 X;  3M8F A;  4LG0 B;  1XMK A;  2EWN A;  2EJR A;  1YW9 A;  4O3M A;  5FO5 A;  4IRI A;  3T0Y A;  4A0Z A;  4HX8 A;  2HYF A;  1O57 A;  1DP7 P;  1WI9 A;  3FXR A;  4M71 A;  2FSW A;  3F22 A;  2XAJ A;  1OYW A;  2Y48 A;  5ICF A;  4CDG A;  4ZZD A;  3BZ6 A;  2FBI A;  2M87 A;  4LD5 A;  3TDU C;  4ZYD A;  1FBS A;  2CSO A;  4L5J A;  4PGH A;  4UNO A;  1Y0U A;  2DFI A;  1S3J A;  2M5W A;  1YO5 C;  3GYH X;  1QZZ A;  1T2K A;  1NHA A;  3MZH A;  5LGU A;  4AIK A;  3IHU A;  3P9C A;  4UUV A;  3LST A;  4A5M A;  4KIB A;  1J9I A;  2BE5 F;  5IT9 Z;  2IP2 A;  3P9I A;  1ON2 A;  4DNC A;  1BI2 A;  1YQA A;  3CUQ C;  5CVJ A;  2VOP A;  5E1X A;  3QOP A;  4L0Y B;  2A07 F;  1HW1 A;  3CUQ B;  2XAH A;  4KN4 X;  2XAF A;  3KET A;  4EQQ A;  1ZRF A;  5FFX A;  2CWE A;  3ML6 A;  3RTR A;  1OMI A;  2DPU A;  1MKM A;  2P8T A;  3J81 Z;  1ZRE A;  3ABT A;  1SMY F;  3C7J A;  1QNT A;  4RGX A;  2NS0 A;  3RIR A;  4RS8 A;  2DQR A;  1GXP A;  1SD7 A;  1D8K A;  4WXD A;  1H9G A;  4AVP A;  2DO7 A;  4B8X A;  2D1V A;  3K0L A;  4JK1 X;  5HLH A;  3GEZ A;  3E3V A;  3Q5F A;  1JHF A;  1QZY A;  4I98 B;  3KP7 A;  2VBZ A;  1U5T A;  3IKV A;  4M9S A;  3C3W A;  2ZJ2 A;  1D8J A;  1X3U A;  2JPC A;  1ZRC A;  5HS8 A;  4LLL A;  5DCM B;  2HYG D;  1P92 A;  2RC4 A;  2K7L A;  4KIG A;  4AIH A;  4M74 A;  3MAJ A;  1XDU A;  5CJ9 A;  2Z3Y A;  1BJA A;  1EH8 A;  2K4J A;  5E20 A;  2MD5 A;  1XDS A;  2Q0O A;  4L5I A;  5D5V B;  2P6T A;  1IN5 A;  4E70 A;  1K79 A;  1J2X A;  3WTX C;  1JXS A;  4I2O A;  1Q1H A;  3K2Z A;  4MGR A;  2R7D A;  3U9G A;  3F8F A;  3MQ0 A;  3ZMU A;  4KIF A;  2J5O A;  1RUO A;  2ZBK A;  2HTS A;  4Q5S F;  1ZAO A;  2QQB A;  2H27 A;  2O3F A;  3CTA A;  3R61 A;  3FXQ A;  1FC3 A;  2D1H A;  4RGR A;  2Z99 A;  2KIM A;  5E1Z B;  4HF1 A;  1K78 B;  3F3X A;  3MWM A;  1OR7 A;  2PG4 A;  4L9N A;  2F5F A;  1IN8 A;  2H6B A;  4HV6 A;  2P5K A;  4G7O F;  3HOT A;  4OOI A;  4RAY A;  1SFU A;  1B4A A;  2K02 A;  4L18 B;  2XHK A;  3E5X A;  3I4P A;  3WE3 A;  2ZXJ A;  3H3Z A;  4G7H F;  5LHI A;  4ESF A;  3HSF A;  2BEO A;  5LLQ A;  1KGS A;  1OKR A;  3L7W A;  2AXL A;  2M30 A;  4XLN F;  4YII A;  4XSX F;  1ONV A;  1R58 A;  2Z9O A;  3FXU A;  3IWZ A;  4WX9 A;  5KVR A;  3TOA A;  3LA3 A;  2OQR A;  4LMY A;  1YYV A;  1BBY A;  2IJL A;  2A6E F;  1JHH A;  2EB7 A;  5BPD A;  4CIC A;  2W24 A;  5A2Q K;  1XCB A;  1HW2 A;  4KFC A;  2ZNY A;  5LRS A;  4CO8 A;  2ACJ A;  4BHC A;  2GXB A;  2R7F A;  2K27 A;  5D4R A;  2O0Y A;  4BH9 A;  5ILV A;  2P5L C;  5D6E A;  1WRJ A;  1DPR A;  5HVQ C;  4ZH4 F;  2VBY A;  4G94 A;  3D0S A;  3DFG A;  1O3R A;  1MGT A;  5LGT A;  1LVA A;  2MLG A;  1STZ A;  3BDD A;  4CGZ A;  4LK0 F;  4KIC A;  3V7R A;  1WKM A;  3PQJ A;  5DCF A;  1ULY A;  3KP2 A;  1OYY A;  3COA C;  5HS7 A;  2L3D A;  4Y17 A;  5JR3 A;  2LNB A;  1BN5 A;  3KCC A;  3WU0 A;  3GO5 A;  3ERE D;  4G6D A;  5K1Y A;  3HRT A;  4EMS A;  2H6C A;  1SD4 A;  2RVC A;  5H6R A;  1G3S A;  2FXA A;  3EET A;  1BC8 C;  1S7A A;  1AWC A;  3IL2 A;  5D5X B;  1S6L A;  3WTZ A;  4EJT A;  1L3L A;  1CF7 B;  4MHG A;  4LG0 A;  4HBL A;  5D5W B;  3GW2 A;  3BPV A;  4FX4 A;  3KEQ A;  1HKQ A;  2FF4 A;  4IRH A;  5E8I A;  1FSE A;  2YSR A;  1G3T A;  3Q9S A;  3CO7 C;  5LEJ A;  5JVT A;  2M45 A;  3MEX A;  2DU9 A;  3FMQ A;  2QQ9 A;  1LEA A;  2HR3 A;  4ENM A;  4EM2 A;  1MDM A;  1CGP A;  1O7F A;  2VE9 A;  3ECO A;  1H0M A;  4GO1 A;  2JPB A;  2Y0M A;  2WV0 A;  3HSR A;  2H09 A;  3TO6 A;  3JW4 A;  1R23 A;  1C0W A;  1F9N A;  1SMT A;  2FRH A;  2L4M A;  2PI0 A;  3F23 A;  2O61 A;  4M9Z A;  1WSU A;  5LBQ A;  4A0Y A;  5D5U B;  3M7G A;  3RYR A;  2A3S A;  4A12 A;  1QGP A;  3GFJ A;  1VTN C;  2LF7 A;  5CVU A;  5CYV A;  1BIB A;  2FBH A;  1I1G A;  1RIO H;  5ICG A;  1IRG A;  1ZLK A;  2XUB A;  2YR2 A;  4KYW A;  4BAY A;  3LA2 A;  3L9F A;  5EEG A;  2EV0 A;  2KJB A;  2W57 A;  1O3S A;  1UHW A;  1W7P B;  4BHP A;  4LB6 B;  1ZYR F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...