4EGYA

Crystal structure of arar(dbd) in complex with operator ora1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
81
structure length
81
Chain Sequence
LEVLFQGPLGSEFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLLYSVQGGGTFVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arabinose metabolism transcriptional repressor
publication title Spacing between core recognition motifs determines relative orientation of AraR monomers on bipartite operators.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
total genus 24
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4egyA00
3DQVC 5LGUA 2PBIA 4UVCA 3L00A 2UXNA 4A12A 2L3DA 2K27A 4DNCA 4ENMA 4G7HF 5CVRA 4UUVA 1B4AA 1OKRA 2CGPA 3TDUC 2DTRA 2XAGA 4EV0A 1CF7B 2QZ8A 3I54A 5CVJA 3Q5FA 3J80Z 1QO0D 4FHTA 3HTSB 1T98A 2EA4A 4A0XA 4CXFA 1HKTA 3ERED 1SD7A 1ZG5A 1SFXA 2A69F 1SMTA 1IAWA 3ZPLA 5EEHA 3GO5A 3F8NA 1U5TC 4HA8A 2P4WA 1HW5A 2BBYA 2VOOA 2FRHA 1SD6A 1J5YA 1FX7A 3VFZA 1TQPA 1BIAA 5FFZA 3MZHA 3CO6C 3IHUA 3JTGA 1U3EM 2V9VA 3ISPA 2XHKA 1IN6A 3FMSA 3P9CA 5L3BA 3IKTA 2X4HA 1DPRA 2XAQA 1K78A 2O8XA 3FMQA 4PDKA 2FXAA 3RKWA 2HTJA 3M9AA 4Q5SF 5LHHA 1JHHA 5J8FA 5BPIA 3FZVA 2M5WA 3F22A 5HLGA 2XROA 3ROUA 3SZTA 1QZYA 2KIMA 3K2ZA 3CUOA 2YX4A 3VB2A 2CG4A 2NS0A 2NNNA 2P7VB 4EJTA 3F8MA 3RDIA 1XN7A 3Q9VA 4HX8A 1BI3A 2CYYA 3V8LA 3LQRA 2VE8A 4L9TA 1HQCA 2KKOA 3V8KA 1YIOA 5CJ9A 3MWMA 2JRTA 3FF5A 4HBLA 5JFRA 1U6GA 1UHWA 2HFHA 1ZLJA 5FLXK 3Q9SA 3PQJA 4ZYHA 1BJAA 2EV6A 1XD7A 4IRGA 2HYFA 3KLNA 2DPDA 4HX7A 1FBSA 1TQIA 2C6YA 2K4BA 1ZGJA 5E1ZB 3FM5A 3C1DA 4HV6A 1USTA 3U9GA 5L3DA 2IJLA 3DPLC 2PJPA 1FSEA 5CVUA 1SD4A 1P92A 5CVVA 2YU3A 1BC8C 3RPQA 1R7JA 1DP7P 4RS8A 4AWXB 4RGUA 3IWFA 2Q2EA 3RIRA 5ILVA 2CFXA 5KK1A 2EFOA 2NYXA 2P5VA 4UNOA 2AXLA 1U5TA 4NHJA 2G7UA 3QU6A 1X3UA 5AIQA 2JT1A 5H20A 4RGSA 2FOKA 4KFCA 1W5TA 5DCFA 4ESBA 2H6CA 1ZN2A 2P5KA 3J80K 1T38A 1T6SA 5E1WA 4M9ZA 3DKWA 1B6AA 3G73A 2VOPA 3BZ6A 2WV0A 3I5UA 3KP3A 5L3CA 2P6SA 1BI1A 3KP4A 3RKYA 3ELKA 4KN4X 1ON2A 3I4PA 4MTDA 1OPCA 2CW0F 1IRFA 3EDPA 4EJVA 3BPVA 3JSPA 2ISYA 4G8XA 3K69A 4RB3C 3WE2A 2FE3A 2PLYA 4M6XA 2AS5F 1FSHA 3KE2A 2ESHA 2F5FA 1L0OC 3GW2A 2CSOA 1STZA 3I59B 1XB4A 4UV9A 2QBYA 2DQLA 1R5GA 4XSXF 4LLGF 4CZZA 3SQNA 1FLIA 1G3SA 1AOYA 3ZN0A 4U0YA 3HHHA 4I2OA 4G94A 2MH2A 3TO6A 2W25A 2OZ6A 5DV5A 1YYVA 3ZMVA 3FXRA 2MA3A 3ZMSA 3E5QA 3EQLF 3QPHA 1LDDA 2Y0MA 5LLQA 5DD4A 5LRSA 4N9HA 1FNNA 3AAFA 1HW2A 3BOQA 1O7FA 4EM1A 1FPQA 3QAHA 2QVOA 2L54A 4I0AA 4ESJA 2ADUA 5D5VB 4L9JA 2Y48A 2VBXA 4KIFA 2KIUA 4EM0B 1AWCA 4ZZDA 4RGRA 3WTYC 1RUNA 5HVQC 1ZYRF 2KJBA 1YQAA 3D5LA 2DLLA 4GYIA 1YS7A 3P9IA 1W7PD 2LSOA 5K5OA 2J5OA 3T1BA 2F2EA 1RI7A 2F5EA 2G9WA 1BIBA 4AVPA 5JHUA 1F5TA 2JZYA 3IC7A 1S29A 2A61A 2M45A 3V4GA 2FBIA 3GFLA 4KT5C 2FA5A 4FX4A 4LG0B 2OZUA 5CLSA 4I01A 5FGMA 2V1UA 4WF2A 2L02A 3KEQA 4Z2YA 4M72A 3RI4A 5KVRA 5DD8A 3F21A 2H6BA 3B73A 2HKOA 2FSWA 5LHGA 1FWZA 4RAZA 1V4RA 2VBWA 1R36A 1OR7A 5DDGA 1QBJA 1C0WA 3RPUA 3K1PA 2BYVE 4HLXA 3C7JA 3HRSA 2ZNYA 3LSTA 1QPMA 2PMUA 1Z91A 3KP5A 1MDMA 1KQ8A 5DCMB 5LRRA 5HS9A 2GZWA 3K1MA 1GVJA 1D5VA 1E17A 5ILSA 1J2XA 1LVAA 5BMZA 5J6XA 2XKOA 1I1GA 2D1HA 4YFKF 3DV8A 4B09A 2A3SA 1BC7C 1ODDA 3REOA 4HQMA 3R61A 4A6DA 1J0RA 2OBPA 4BNCA 4M9SA 3GFMA 1P2FA 1GHCA 4M9XA 3HRTA 4KA4A 2VC0A 5HDNA 2BGCA 5FLXZ 5DYMA 1KU2A 5BPDA 4O5VA 4HOBA 3P9KA 4RB2C 1ZH5A 2FNAA 1XGOA 2VBYA 4EQQA 3GEZA 1J59A 3N97A 2D2WA 2GWRA 2DAOA 2BV6A 5IT3A 1UHMA 2ZO4A 3LAPA 3HOTA 4EMSA 4HF2A 4G6DA 4WXHA 2DFIA 2P5LC 3WTZA 3GLXA 1OYIA 3L2CA 3EUHA 3WGGA 3M1EA 2RQPA 2R3SA 5CYVA 4G6QA 1YW9A 4JQFA 4WXCA 2FQ3A 3H92A 2STTA 4JBAA 1OYYA 2ZMEB 3DPTA 1TW3A 3MQ0A 3EETA 4MQ9F 4CYDA 4ENJA 3ML6A 5LEJA 3T5XA 3WGHA 2VT3A 2B0LA 3N4MA 4IRHA 3PQKA 1IXCA 4ZZLA 1TNSA 1LQ1A 3C3WA 4ESFA 4EJUA 2IVMA 4S04A 4BYYA 3L09A 3CLOA 1D3YA 3HHGA 2V1XA 3RYRA 1LDJA 4L9NA 3B02A 4U88A 3LA3A 1UFMA 4EJOA 2R7DA 2O0YA 1K6OA 2VODA 2PN6A 4OIQF 1EH8A 2GXGA 4Y15A 4MEXF 3WTVC 3QP5A 2IP2A 3QRFF 1G3WA 5D5UB 1WWXA 5E17F 1LB2A 4HW0A 1GXPA 1MGTA 5ICEA 1XDSA 2EFNA 2ZNZA 2KIFA 3LWFA 2HOEA 4KICA 1H9TA 2DK8A 5H6RA 2E1NA 3KP2A 1R22A 4L9VA 4BH9A 4GXOA 2DI3A 4P9FA 2IPQX 3KFWX 3LA7A 3NQOA 4MHGA 4IHTA 1CF7A 2Z3YA 2WTEA 1KA8A 1ZRCA 5D5WB 4KUMA 3L7WA 3F6VA 1BBYA 2W24A 1MJAA 4L0ZB 4FX0A 1BOAA 3FX3A 3PFIA 5K5RA 1HKQA 3WTSC 3F8CA 4HAMA 2A5YB 3WE3A 2RV8A 3V7SA 3M8EA 1V3FA 2YX7A 1WSUA 2XV4S 4HQEA 2FU4A 2DQRA 4UV8A 5HS8A 3I0TA 3GVAA 5HS7A 2CO5A 2FF4A 5FO5A 1P4WA 3LA2A 1IXRC 3K9TA 3BJ6A 1LNWA 2K7LA 4I02A 1ZARA 4A2UA 1MD0A 1E2XA 2JPBA 3I58A 1B9MA 1YLFA 1L3LA 2BEOA 2QQ9A 3ZQ7A 5AONA 1FYLA 3KETA 2ZFWA 2W85A 3BWGA 1O7LA 4M74A 5E18F 3M7GA 3KZZA 4AIJA 2MBFA 1XGMA 4R1HA 1DPUA 2OAZA 1JGSA 4BXUA 1ZREA 1XGNA 2XVCA 2QWWA 2GQQA 3I53A 2CQKA 4OIPF 1BI2A 3RYPA 2QYOA 5F1RA 4LB5A 2A6HF 4RB0A 4XBFA 4Q4ZF 1KQ0A 2RVCA 3W6JB 3EYIA 3H3UA 3CUQC 2M1BA 2HDCA 4A6EA 3FMRA 3FXUA 1ZGAA 1S7AA 3K0LA 3QP6A 2WWYA 5BQTA 2ZBKA 1Q1HA 1FOKA 1XSVA 2HQRA 5JR3A 1T39A 3WGIA 2EV0A 2GA2A 2IA0A 4G9YA 4IJAA 4MQVA 4PGGA 2YR2A 3LAJA 2G7HA 1HBXG 2L4MA 1KYWA 2V6CA 4CGZA 1U78A 3HRUA 4BHPA 4AIKA 2EA2A 3JSOA 1I5ZA 4LGWA 3CUQB 4U7DA 3C18A 4ZYGA 5D4SA 1I6XA 4UVBA 2MH9A 3V7CA 1SAXA 1T0FA 4IXAA 1ZRFA 1R1TA 3V8JA 3G3ZA 3OOPA 4MGRA 1QQIA 1S6LA 2VE9A 3F6OA 2K4JA 5FB2A 4LJZF 3WTXC 3GYHX 1ULYA 5HLIA 4RGXA 3O3KA 4ON0A 3TQNA 2E7WA 2EWNA 1FP1D 2NRAC 3NRVA 4AIHA 3WTTC 1JXSA 1RNLA 5D6EA 3TGNA 1PDNC 1FP2A 4LB6B 4Y17A 2RGVA 3MCZA 5ED4A 1H0MA 1T2KA 3E6BA 1KU7A 3JAMZ 3R0AA 4ENKA 2VC1A 4LFUA 3GWZA 4OU0A 3I59A 3GXOA 3VEPA 1IF1A 2R7FA 1YS6A 1HXDA 3GZ5A 2FBHA 5D4RA 1YFHA 3NEUA 1SFEA 1U2WA 4HF1A 1TW2A 1W7PB 2P7CB 5F64A 2M30A 3HSFA 3MZYA 1QNTA 1REPC 4FT8A 1TBXA 3ZMUA 4YIIA 3RKXA 3HOSA 3R0JA 3CUQA 2HR3A 3R4KA 3CJNA 3ZN1A 5ERIA 1B9NA 5L3FA 2RNJA 2LNBA 1JHFA 1XDUA 2HKXA 2EFWA 1IUYA 2JPCA 2OA4A 4YG2F 5LEKA 3GX4X 3GUDA 1F1ZA 3T8RA 2ESNA 4OINF 5CVIA 1IZ1A 1R5HA 1WQ2A 1FZPB 2H09A 4U7BA 3FXQA 1IN8A 1YW7A 1HSJA 1VTNC 4XSZF 2NNYA 1JE8A 2K02A 5L3GA 1U8RA 1W4MA 3O6BB 2XASA 1IW7F 2FMYA 2Z99A 3HIFA 2IT0A 4P9UA 3FHZA 3WG9A 3F72A 1USSA 3DF8A 4UXNA 5E1XA 2A68F 4ETSA 4L18B 5BOXA 3EYYA 2RN7A 1PP7U 1ON1A 1KGSA 2LF8A 1P6RA 2DU9A 1R1UA 2J5PA 2LF7A 4MEYF 4WXDA 4LG0A 1LEBA 2P8TA 4EJWA 1MKMA 4CICA 3WTUC 4HLYA 1IN7A 5E8GA 4GGGA 1TTYA 1R23A 3MAJA 1FT9A 4L0YB 3SZPA 1XMKA 4UVAA 1F4KA 4PZJA 4WX9A 3KP6A 1IRGA 2PG4A 3QPTA 4AD9A 5FD5A 3KLOA 2ZCWA 1TLHB 2KRFA 2EK5A 4R8HA 2X0LA 5ILUA 2MLGA 4G7OF 1QGPA 1B1BA 1BM9A 3TOAA 4XRFA 5DCMA 3L9FA 4ENNA 2V79A 2IW5A 2Q0OA 1QZZA 3COAC 2JTVA 1BI0A 2Y75A 5LHIA 5BS6A 1R00A 4EVIA 1G6NA 3R60A 4LLLA 3JAMK 4BHBA 4WCGA 2V1DA 3K1NA 1XMAA 1ZG3A 5E8IA 5D8KB 2DBBA 2IA2A 3T0YA 1FYKA 2XUBA 2OD5A 4A0YA 4HDVA 1HW1A 4ZYDA 1ZG1A 1Z1DA 2UXXA 5A2QZ 5K5QA 2XRNA 2JSCA 4WWCA 2A07F 4KYWA 3E6MA 1ZHFA 3M8FA 2XAHA 1I1SA 5DUIA 4DQ2A 3E6DA 4UHTA 5AIPA 2F5CA 5DEQA 2D1VA 3ECOA 4HZFA 2QUFA 4I7HA 3DFGA 2W84A 2E1CA 2QQBA 3WODF 1ZRDA 4A0ZA 3IKVA 3CO7C 1UCRA 1U5TB 4O6JA 5D8LB 4R79A 2TDXA 4I0BA 4EGZA 1O3SA 3F23A 4CO8A 3ABUA 3HYIA 1WKMA 2ZMEA 1P4AA 2HTSA 5F6FA 3TDZC 3QU3A 2VBZA 5JI6A 3ECHA 2RKHA 5FD6A 4TV7A 5ICCA 2NAZA 1HKSA 4M6YA 3BDDA 1Z05A 1PUEE 2HZTA 4MNUA 5LBQA 1S3JA 4Y13A 3MFKA 2H94A 2O6GE 3HTUA 1J9IA 4EM2A 3H3ZA 4LMYA 2YPRA 4LLNA 2VXZA 4NQWA 1DDNA 1W5SA 1OYWA 5HOOA 1RZ4A 2HEOA 3J81Z 2L01A 2Z33A 1G3TA 3KP7A 1WRJA 1HSTA 2OU2A 2IRFG 4PCQA 1Z6TA 1KYZA 4KN7X 4BHCA 3T8TA 5D6FA 1Y0UA 1I27A 1G3YA 2QM3A 2QBYB 1XCVA 4I98B 4KNYA 2QENA 4K2EA 3LFKA 4KMFA 3E5XA 2ETHA 4N0BA 3VODA 4NB5A 1XSDA 3HSEA 5LGTA 1LEAA 2PMHA 3MEXA 1J75A 4CDGA 3ZP5A 1B59A 3BJOA 3FWEA 4P55A 1D8KA 4M73A 1YG2A 2PFBA 3ZMDA 3BROA 2FNPA 1NHAA 1LDKB 1RIOH 3IRQA 2IA1A 3ABTA 3SHFA 4IHSA 1O3RA 2WC2A 1KQ9A 2XAJA 5LGNA 3S2WA 3U1DA 4YFXF 3DXJF 6PAXA 2DK5A 2K86A 3SFZA 1F9NA 2UZKA 4P5OA 4QLCU 4HDUA 2FEZA 2MLKA 2HYGD 2GIVA 4MTEA 2ELHA 2KJCA 3IWZA 4U0VA 4HX4A 2FBKA 3D0SA 4BAYA 1J7KA 1FC3A 4OMYA 3IRRA 4BQAA 2OQGA 2EFPA 5IT9Z 3QOPA 1FYMA 2PI0A 1S8NA 1YW8A 3ULQB 2ZXJA 1MJBA 4HF0A 1IXSB 5A2QK 3OV8A 2Z5UA 5HDGA 2ISZA 3WU1B 2EFQA 3J7AO 4O3MA 1IN5A 5DUKA 2HQNA 1OMIA 3GFJA 3TKYA 2QQAA 4P96A 5HDKA 4A5MA 4IVNA 1FY7A 4ZH4F 4WK8F 4G7ZF 3JW4A 1K79A 4XLPF 2GAUA 4HYEA 1G4DA 1MZBA 3W6KB 4A5NA 3BJAA 2ACJA 4U0WA 2P6TA 3F8FA 3F3XA 2QLZA 1P4XA 3KCCA 4I09A 1EH6A 1PP8F 5E20A 2L4AA 3TOBA 2XKPA 1TNTA 4YFNF 1Z9CA 2H27A 1TQMA 4D0PA 3SXYA 1EH7A 4JK1X 3E3VA 2Z9OA 5JVTA 1DUXC 3FM3A 1YTYA 2M87A 1R1VA 5ICFA 4GCVA 1SD5A 5HLHA 2O61A 4CHUA 3VOEA 1XCBA 1MDMB 3TO7A 2COMA 4LK0F 2D45A 2VONA 4Q48A 2Q8KA 2DPUA 2OQRA 1MJ9A 2VT2A 4EGYA 2STWA 1EV7A 3J81K 3I64A 3TO9A 2O3FA 2F5DA 1S7OA 5D5XB 2PEXA 4F7ZA 5K1YA 2BE5F 5ICGA 4YIFA 2DW4A 1XSXA 3IL2A 2EJRA 4M71A 3E97A 3KEOA 3GZ6A 3HUGA 5J8CA 4KDPA 1XGSA 2XGXA 2LKPA 2CWEA 4KIGA 4PGHA 2GXBA 1RUOA 5FFXA 3BY6A 4OIRF 3KZYA 2RDPA 3E6CC 4IPAA 2ZKZA 4RAYA 1A04A 4OOIA 3CDHA 2MD5A 4OMZA 1UB9A 2HS5A 3F8BA 2XIGA 4E70A 1H9GA 1KU3A 2E7XA 3RTRA 1IN4A 3RJPA 1SMYF 1O57A 2YSRA 1ZLKA 1LJ9A 3HRMA 4KIBA 1D8JA 1R58A 5EEGA 3P7NA 3BP8A 4KMUX 1YO5C 3GF2A 1ONVA 3O2PE 1O3TA 5TRDA 1KU9A 3ZMZA 5IT9K 3E5UA 2VN2A 4N9IA 5L3EA 2M8EA 3JTHA 4RB1A 2W57A 1K7AA 3HSRA 3GFIA 2RC4A 3WU0A 1SFUA 3CTAA 4OIOF 3ZMTA 4S05A 4LD5A 3BPXA 1BN5A 1Z6RA 2EB7A 4HV5A 2PQ8A 2DO7A 4Q47A 2XAFA 4IRIA 4H0EA 3DP7A 4L5JA 4GO1A 3U2RA 2DT5A 4LK1F 1W7PA 2EV5A 2ZJ2A 4IF4A 3I71A 2O03A 4L5IA 1CGPA 2A6EF 4ZYEA 4XLNF 1WI9A 4GYGA 4B8XA 3LQQA 1FBUA 4ASNA 3V7RA 1K78B 1ZAOA 3DEUA 3WTWC 5H6QA 2FMLA 4QWQA 2MC3A 2LDUA 2UWMA 1Z7UA 5TJJA 2HWVA 1FBQA 2HGCA 3R6SA 1GXQA 1O3QA 2GA1A
chains in the Genus database with same CATH superfamily
4BU2A 3DQVC 5IP7J 5LGUA 4L5EA 3SDBA 1EF4A 2PBIA 4UVCA 2KZVA 3L00A 4A3GJ 2UXNA 4A12A 5TGTA 3ZQHA 4BXFA 3G4SI 2L3DA 2LC2A 3CMYA 1ZKGA 3CJQB 2K27A 3ASNH 4DNCA 5IYBJ 3P5JA 3ZGKA 4ENMA 3AKZA 3B6CA 4G7HF 1NH3A 2ZSHB 1VFCA 1R9TJ 5CVRA 4UUVA 1B4AA 1OKRA 4BKXA 2CGPA 3TDUC 2DTRA 2XAGA 2ID3A 3BG9A 4PJ0C 4EV0A 1CF7B 2QZ8A 3I54A 5CVJA 1R49A 4RLFA 3Q5FA 2CV2A 2VJJA 3J80Z 3JRHA 4D5FA 2R5ZA 2DOFA 1QO0D 4PSWA 4A3LJ 5C3EJ 1DP3A 4FHTA 1UZCA 4A69C 1T98A 2EA4A 3HTSB 1MSFC 3OYFA 4A0XA 4CXFA 1HKTA 3ERED 1SD7A 1ZG5A 4Y33A 1SFXA 1R4NB 3KEYA 2DFFA 2RNGA 4OAYA 2A69F 1SMTA 1IJWC 1IAWA 3ZPLA 5EEHA 3GO5A 3F8NA 1U5TC 4HA8A 3RSNA 4BQNA 3GTJJ 2LD5A 1B8IB 2P4WA 3DEEA 2CQ7A 1HW5A 4CYCA 3IAS2 3S8PA 1R6RA 2BBYA 2VOOA 2FRHA 4ZJZA 1T56A 1SD6A 3FXOA 3TW7A 2D5VA 5GADJ 1J5YA 5DTDA 4RBOA 2IGOA 4Z6YA 4Y3OA 2HVQA 1AU7A 1FX7A 3VFZA 1TQPA 2JN6A 1IV6A 1BIAA 5FFZA 3MZHA 2W82A 3CO6C 2KPMA 4IHYA 2EZKA 3IHUA 4FISA 3JTGA 1U3EM 3NWSA 2V9VA 3ISPA 1PVEA 1Y39A 2XHKA 2WAFA 1IN6A 5J3LA 2CUJA 1W5CC 3OYMA 1JKOC 4FE4A 1A35A 1X2MA 4BY7J 2IS1A 3FMSA 2L5QA 2E1MB 3P9CA 2BHZA 5L3BA 2NS7A 3IKTA 3G2BA 2X4HA 5K7FA 3VSLA 4EATA 1LFUP 1DPRA 2XAQA 1K78A 1X3WB 1YJNI 3MN2A 3OS0A 1VQMI 1TL8A 1MBHA 2O8XA 3FMQA 2JVGA 4PDKA 2FXAA 3RKWA 2HTJA 3M9AA 4Q5SF 3OYCA 1FJLA 4PJNA 5LHHA 1F43A 1JHHA 3K4KA 5J8FA 1R5ID 2E35A 3FKIJ 5BPIA 5EDNA 3FZVA 4QPOA 2M5WA 3F22A 1RC9A 2W1OA 3TP3A 5HLGA 2QSHX 2XROA 4FE7A 3ROUA 2Z1DA 3SZTA 1QZYA 2KIMA 1XMXA 2K9NA 3K2ZA 4AIDA 3Q0VA 2VKEA 2AQFA 1Z7LA 5GAEJ 1IV8A 3CUOA 2YX4A 3VB2A 2CG4A 2NS0A 2LRDA 2NNNA 3E7LA 2P7VB 3QPLA 3MMYB 3AL0C 5EJCA 3K7AJ 4EJTA 4DJAA 1MNEA 2R7TA 2L7FP 3F8MA 3RDIA 1XN7A 3Q9VA 4KJZA 1RPWA 1D0XA 4HX8A 1BI3A 2CYYA 4D5CA 3V8LA 5K7HA 3CCYA 2HYJA 2VKVA 3LQRA 3Q0UA 2VE8A 4L9TA 1HQCA 2KKOA 3V8KA 1YIOA 1MMNA 5CJ9A 3MWMA 2JRTA 4HSTA 3FF5A 4HBLA 2M7AA 5JFRA 1U6GA 2DA7A 1UHWA 2IGMA 2HFHA 1ZLJA 4UUTA 5FLXK 3OYEA 2V9PA 4BXXJ 1OCPA 3Q9SA 3PQJA 2JK3A 3NWTA 4ZYHA 1BJAA 2EV6A 2KHMA 3CDLA 2E5NA 3AFHA 1FOWA 1XD7A 4IRGA 4XORA 2HYFA 3KLNA 2DPDA 4HX7A 1FBSA 1TQIA 1LUJB 2C6YA 3JRCA 2K4BA 2AO9A 1ZGJA 1NG7A 3PSIA 5E1ZB 2R93J 4Y52J 3FM5A 3C1DA 4HV6A 2JA6J 3DPUA 1USTA 3U9GA 3MD2A 5L3DA 2IJLA 3DPLC 4Y7NJ 2PJPA 1MNMC 1FSEA 5CVUA 4W1UA 1SD4A 1Y1WJ 3AL0B 1P92A 5CVVA 5TISC 1R4MB 2YU3A 3OWTA 3RPQA 1BC8C 1R7JA 1UG2A 1DP7P 4RS8A 2BVMA 4AWXB 4RGUA 3S15J 4M6VA 2DMNA 3IWFA 2Q2EA 3RIRA 5ILVA 2CFXA 1GV2A 2O5RA 2UUZA 3EUAA 2L7MP 1V5FA 5KK1A 3G71I 2EFOA 2NYXA 2P5VA 4UNOA 1GVDA 4JYKA 2H1LA 2IGKA 3AG1H 2AQEA 2AXLA 1Y6IA 3IP4B 1R71A 1U5TA 4NHJA 2G7UA 3QU6A 1X3UA 1QVTA 1HDPA 5AIQA 2JT1A 5H20A 1X4PA 4RGSA 3RQIA 1RKTA 2FOKA 4KFCA 1W5TA 4DBQA 5DCFA 5F0HA 1A5JA 2M0CA 2QKMB 3DTKA 2H6CA 1ZN2A 2P5KA 4ESBA 1MMGA 3J80K 4IQ4A 1T6SA 1T38A 5E1WA 2DA6A 4M9ZA 3DKWA 1B6AA 4XMYA 3G73A 2VOPA 3BZ6A 4JP0A 2WV0A 5EG0B 3DTEA 4F93B 1EA3A 5B66C 3MVPA 3I5UA 3KP3A 5L3CA 2JA2A 2DXIA 2X85A 3HB9A 2F5VA 2BY0A 1X19A 2P6SA 4A3JJ 1BI1A 3KP4A 2VASA 3RKYA 3ELKA 2DOEA 1WHUA 4KN4X 1ON2A 1ETVA 2Y9ZA 4YELA 4ITVA 3I4PA 4MTDA 1OPCA 2CW0F 4AVZA 3GTKJ 1IRFA 3EDPA 2HZDA 4EJVA 2NVTJ 2QF7A 3BPVA 3VDXA 5JHFA 3JSPA 1WJEA 2ISYA 4G8XA 1MBEA 1QA6A 3K69A 4GFBA 4RB3C 3WE2A 2FE3A 2W4SA 2PLYA 2FD5A 4M6XA 1X1BA 2AS5F 1FSHA 3WG7H 3KE2A 2ESHA 2HVSA 2F5FA 3TP0A 1OR7C 3LNQA 1ZGWA 3GTMJ 2XF6A 1L0OC 4E7HA 1VQ6I 3GW2A 3M3YJ 4XM3A 4HPQA 2XSDC 2CSOA 2M4GA 1STZA 1VF9A 3D5RC 3VYUB 4CCKA 4XKVA 3I59B 3CC7I 4DOZA 1XB4A 4QIWN 4PSXA 3W2VA 4UV9A 4X1EA 2DDAA 2QBYA 4IHWA 4XKWA 2JVHA 2DQLA 1R5GA 4XSXF 4G12A 4LLGF 4CZZA 2O9LA 1TT0A 1RKWA 3SQNA 4RDUA 3BR6A 2ZSIB 2Y30A 3CJRB 2CUZA 1FLIA 1G3SA 4XR6A 1X1CA 3RKQA 3CLQA 1AOYA 2R5YA 2E60A 3ZN0A 2QQ8A 1VQPI 2EQRA 4F52A 3OR1C 4U0YA 2LY1A 3HHHA 1T8IA 4BUPA 4I2OA 4G94A 1T33A 2MH2A 4E7JA 4BJ6C 3TO6A 2W25A 2OZ6A 5DV5A 1YYVA 2EIJH 2LKSA 2XGEA 3W6VA 3ZMVA 4LOCA 3FXRA 2MA3A 3ZMSA 3BG7A 3K4CA 3E5QA 3EQLF 1WFXA 2DA3A 2K9QA 3QPHA 3HDDA 5FROA 1LDDA 2L9RA 3A03A 2Y0MA 4LIVA 4XLFA 2EZHA 3LSIA 3OYLA 1W0UA 3LSKA 5LLQA 3GTOJ 5DD4A 1U9OA 3ZRGA 5LRSA 3JCUC 4N9HA 1FNNA 4XN3A 2K85A 3AAFA 1APLC 2E2HJ 1WPKA 1HW2A 1RR8C 3BOQA 2X51A 2K3PA 1O7FA 4EM1A 1Z0XA 2WAEA 3A01B 1VQ4I 1FPQA 3QAHA 1K6YA 2QVOA 2L54A 4I0AA 5M5YJ 4ESJA 2ADUA 1EJ9A 4B3AA 2HOSA 4CCLA 5D5VB 4L9JA 4IHXA 2Y48A 2VBXA 2W48A 4CZCA 1JT6A 4KIFA 2KIUA 4EM0B 2BOLA 3FISA 2VL8A 1AWCA 2B7EA 4ZZDA 4RGRA 2VJ4A 2K3FA 2CW8A 2LTPA 2DA2A 2A5WA 3BZKA 3WTYC 2HXOA 1JJ6C 1RUNA 3EUHC 4XN0A 5HVQC 1ZYRF 2KJBA 1YQAA 2LY2A 4BE0A 3D5LA 2DLLA 3PM1A 4GYIA 1YS7A 3P9IA 4FETA 1GDTA 1W7PD 2LSOA 2XF5A 3JR9A 3CMMA 4Y4RA 2DA5A 5K5OA 2ELJA 2J5OA 3T1BA 1K61A 5GPAA 2F2EA 3CCRI 1RI7A 2F5EA 2X6WA 3GTQJ 2G9WA 1BIBA 4AVPA 2ME6A 5KAIC 5JHUA 3FBNB 3CC4I 4NBQA 1F5TA 4BL0B 2JZYA 3IC7A 1S29A 2A61A 2M45A 2IS6A 5CPRB 3H36A 3V4GA 2FBIA 3GFLA 4KT5C 2FA5A 4FX4A 4LG0B 2OZUA 3E1SA 1TT5B 5CLSA 4HNUA 2RAEA 3H0DA 4I01A 5FGMA 2V1UA 4WF2A 2L02A 1S5LC 3KEQA 3DBRB 4Z2YA 1LVKA 4M72A 3RI4A 5KVRA 5DD8A 1UMQA 3F21A 2H6BA 1HF0A 3HEFA 2NOGA 3B73A 2HKOA 2FSWA 1U0JA 3HPHA 5LHGA 1FWZA 2OTLI 2L7KA 2CMPA 3S1MJ 4RAZA 3C2GA 1AKHA 1V4RA 3M1CA 2VBWA 1R36A 1OR7A 5DDGA 4YRVA 1W36C 3BR2A 1QBJA 1YITI 1C0WA 3K70D 3RPUA 3HOYJ 3K1PA 2BYVE 4HLXA 4BBRJ 3C7JA 3HRSA 2ZNYA 3LSTA 1QPMA 2PMUA 4HEA2 1Z91A 3KP5A 2ZJQF 3G1MA 1MDMA 1KQ8A 2LK2A 1POGA 2VXDA 5DCMB 5LRRA 5HS9A 2GZWA 3K1MA 2HVRA 1GVJA 1D5VA 2RREA 1E17A 5ILSA 1YE9A 5FRNA 2HOTA 1J2XA 3A01A 1LVAA 1YIJI 3L2WA 2CFOA 5BMZA 3Q3SA 2YU9J 5M3FJ 5J6XA 2XKOA 1I1GA 4NC8A 2D1HA 2DDBA 3CQZJ 4D7MA 4YFKF 3DV8A 4AUXA 4B09A 4IEJA 2A3SA 2CJJA 1BC7C 1ODDA 3DU6A 2M34A 3REOA 4CH7A 4HQMA 5BNGA 3R61A 4ZYAA 4A6DA 1J0RA 2OBPA 3FXJA 3OYKA 4BNCA 4M9SA 3GFMA 1P2FA 5KCMA 4DW6A 1GHCA 2ME0A 2MABA 4BGDA 3LSMA 4M9XA 3HRTA 4KA4A 2VC0A 5HDNA 2BGCA 5FLXZ 2PMZN 5DYMA 4BJTA 1KU2A 1JUPA 1VI0A 5BPDA 4O5VA 4HOBA 3P9KA 4JX6A 3ZQIA 4RB2C 1ZH5A 3PUFA 2FNAA 1XGOA 2OJED 2VBYA 4DZPA 5M5XJ 4EQQA 3GEZA 1P9QC 1OQYA 1J59A 3N97A 2D2WA 1ETKA 2G0EA 1A6QA 1DU6A 1OLTA 2DFHA 2GWRA 3LFUA 2DAOA 2BV6A 5IT3A 1UHMA 4YEJA 2ZO4A 3LAPA 1JT0A 2E19A 3HOTA 4EMSA 1Y8RB 4HF2A 4G6DA 2EPFA 3QYBA 1GUUA 4WXHA 2DFIA 3KYLA 3GBGA 3WTZA 2P5LC 3GLXA 2KP6A 4XL9A 2JQ7A 4NNJA 2EILH 1OYIA 3L2CA 2W00A 3EUHA 3WGGA 1E3HA 3M1EA 3UNGC 4J19A 2RQPA 2R3SA 5CYVA 4G6QA 1YW9A 3J7ZI 3CC2I 2K9SA 1P7IA 4JQFA 1XG1A 4WXCA 4DYQA 4BY1J 2FQ3A 3H92A 2STTA 1S72I 1FIAA 5E3LA 2AXTC 3CJTB 1OYYA 4JBAA 4PUSA 4A3BJ 2ZMEB 3KYCB 2DMQA 4I6ZA 1Z3YA 4BE1A 2P81A 3DPTA 1TW3A 3MQ0A 2XB5A 3FIWA 2R7WA 4XOPA 3EETA 4MQ9F 1MBGA 1Z3XA 4II3A 2M2EA 2E1MC 4CYDA 2E34A 4ENJA 3ML6A 1IUFA 2LOOA 3ZCOA 2L7ZA 4E4HA 5LEJA 4DYRA 1V54H 2N8GA 4V2FA 4A3CJ 4N4OB 3T5XA 1TZLA 4LIUA 1VQNI 3K4JA 3WGHA 3ZOBA 1SVMA 1TWGJ 2VT3A 3PIOF 2B0LA 2LREA 3LSPA 3N4MA 2JUGA 4IRHA 2ZJPF 2ECBA 1LE8B 3PQKA 1ETXA 1IXCA 4ZZLA 3UKGA 1TNSA 1FMWA 1LQ1A 1MMDA 3C3WA 4ESFA 2GXAA 4EJUA 2IVMA 4S04A 1Z77A 3FBIB 4NQWB 3DKXA 4A3DJ 2XPUA 4XNFA 4BYYA 3BQZA 3L09A 1E0EA 1H88C 3CLOA 1SFKA 3K4NA 2EIMH 3C2BA 4A3EJ 1D3YA 3HHGA 2V1XA 3RYRA 4D7NA 5J1RA 1LDJA 4L9NA 3B02A 1WJAA 4U88A 1RETA 3CESA 1UFMA 3LA3A 4CCNA 4EJOA 1PUFB 1X58A 2R7DA 2O0YA 2VQCA 1K6OA 3CP2A 2VODA 4F92B 2PN6A 4OIQF 2IXSA 1EH8A 2L9NA 2DMUA 2GXGA 4Y15A 4MEXF 1WCMJ 5EGOB 3QP5A 2IP2A 3WTVC 3QRFF 4CA0A 5FLMJ 2LMDA 3CZ6A 1G3WA 4M3GA 3CCLI 4BEHA 3A0HC 5D5UB 3ZQGA 1HCRA 1WWXA 5E17F 1LB2A 1MNDA 4HW0A 3BT9A 1GXPA 2KL4A 1MGTA 5ICEA 2PMZA 4RA2A 2ZNZA 1XDSA 2EFNA 2KIFA 3LWFA 2HOEA 4KICA 3OS1A 2DA1A 2MYSA 2XF7A 3G6EI 3OYAA 1H9TA 2DK8A 5H6RA 1RR7A 2E1NA 3KP2A 1R22A 4L9VA 4BH9A 4GXOA 4NC6A 2XPVA 2DI3A 3LOCA 3HPGA 4P9FA 2IPQX 1SANA 3KFWX 2IS2A 2OF7A 3LA7A 3LMMA 3NQOA 2CW7A 2MW8A 3GTPJ 5J47A 1E3OC 1ZTRA 4MHGA 4CCMA 1P7JA 4IO9F 4IHTA 4ZTFA 1CF7A 1WJDA 2Z3YA 4BE2A 2HNHA 2WTEA 1KA8A 2R7OA 1K4TA 2XB0X 3VPRA 1ZRCA 2F6CA 2VPRA 5D5WB 4KUMA 1D5YA 1DQUA 3L7WA 3F6VA 1BBYA 1ACIA 4C30A 2W24A 4GRIA 4BS9A 2DFEA 1MJAA 4L0ZB 4FX0A 1BOAA 2CUFA 3FX3A 3PFIA 4AM3A 5K5RA 1X4OA 1HKQA 3WTSC 3F8CA 4OWRB 4HAMA 4ZC3A 2A5YB 3WE3A 2RV8A 3V7SA 4NC7A 3M8EA 2AHQA 3OSGA 3BQYA 2CQNA 1OJLA 1K83J 1V3FA 1B8IA 1BW5A 1RESA 4UB6C 2YX7A 2HU9A 1WSUA 1T0FC 1LPQA 1T08B 2XV4S 4G6TB 4HQEA 2FU4A 2DQRA 4UV8A 3OSFA 2LBFB 5HS8A 5JLWA 3I0TA 3GVAA 5HS7A 4X6AJ 5IY5H 1ZR2A 2CQQA 2CO5A 3QODA 3HBLA 1YJWI 3U1KA 1T95A 3MZ8A 3DBHB 2IAIA 2F4IA 1DGRM 1V5GA 2B63J 2FF4A 2MSYA 5FO5A 1P4WA 1B72B 3LA2A 5J4VA 1IXRC 3K9TA 3BJ6A 1KZHA 4DIQA 1LNWA 2JWTA 1VQ7I 2K7LA 4I02A 1ZARA 4ABZA 1D0ZA 4A2UA 1MD0A 3DEWA 5H2FC 1E2XA 3OYHA 2JPBA 1JKRC 3H0GJ 3QYEA 5E3NA 2TRTA 2DJNA 1JTXA 3I58A 3H5AA 2CU7A 3PIPF 3GLLA 5IP9J 1B9MA 1YLFA 1JUMA 1L3LA 2BEOA 2QQ9A 3ZQ7A 5AONA 2Z2SB 4OAZA 3W2AA 1FYLA 3KETA 3OIOA 2ZFWA 4JX5A 2MG4A 4BDZA 2KDOA 1VNDA 2W85A 1XX5A 3BWGA 4J00A 1O7LA 1F36A 4M74A 5E18F 3JRDA 3M7GA 1FTZA 3LSJA 2QEXI 3KZZA 2LKXA 4PJLA 4AIJA 3ABMH 2MBFA 1XGMA 2KLOA 4R1HA 4BBSJ 1DPUA 2OAZA 4XIDA 1JGSA 4BXUA 1ZREA 4ZDLA 2XGCA 4C3JJ 1ORKA 1XGNA 3EPZA 2XVCA 2DJIA 2QWWA 2GQQA 2XAUA 3I53A 2CQKA 3PNVA 2CS3A 1LFBA 2OCCH 2XDVA 4OIPF 1BI2A 3RYPA 2WA0A 3KIOA 2VB6A 2QYOA 4ZTJA 5F1RA 5CQGA 3LSRA 2A6HF 4LB5A 2WB1N 5F27A 4RB0A 4RMNA 4W97A 1FIPA 4XBFA 4Q4ZF 1KQ0A 2QA4I 2RVCA 4IZZA 3W6JB 1WJFA 2HQAA 3EYIA 1NG6A 3H3UA 3H9GA 4B4CA 3VWBA 3CUQC 2M1BA 2HDCA 4A6EA 3FMRA 3FXUA 5EZHA 1ZGAA 4V2GA 1S7AA 3K0LA 3QP6A 2L9SA 3QQAA 3SEZA 2V4JC 2WWYA 5BQTA 2ZBKA 1Q1HA 1FOKA 1XSVA 3D5SC 4V19K 2HQRA 2I5UA 1JUSA 2CUEA 5E79C 5JR3A 1JGGA 1T39A 3WGIA 1I39A 3BR5A 2EV0A 1YX5A 5M5WJ 2GA2A 2IA0A 5EYRA 4G9YA 4IJAA 3HUGB 2GBYA 4MQVA 2LLKA 4PGGA 2YR2A 3LAJA 2G7HA 1HBXG 1SVLA 3OYIA 2L4MA 3IAM2 5FKMA 3DBLB 1KYWA 2DODA 3L2UA 2V6CA 3ONQA 1TWFJ 4CGZA 1U78A 3HRUA 4BHPA 2BY2A 1VQOI 2Z16A 4AIKA 2EA2A 2XPWA 2V7FA 5J1YA 1EKEA 3A0BC 3JSOA 1I5ZA 3MKYB 4LGWA 3CUQB 5K7ZA 5F04A 5IOYA 4U7DA 3L1PA 3C18A 2R7ZJ 4ZYGA 1VQ5I 2K9MA 1E3PA 5D4SA 2H8RA 2M8GX 1I6XA 4IKFA 4UVBA 2MH9A 1U9NA 1WI3A 4X0GA 3IH4A 3V7CA 1SAXA 2PJRB 1T0FA 4IXAA 4HNVA 1BA5A 1XPXA 3IV5A 2JA7J 1ZRFA 2VI6A 1R1TA 3V8JA 1WVRA 4XLEA 3DKYA 3IH2A 3G3ZA 2WV1A 3OOPA 4MGRA 1QQIA 1S6LA 2KDZA 2VE9A 4XLCA 3F6OA 2HPMA 2KZGA 3DLAA 3ZQFA 5EG0A 2K4JA 3QPSA 2NVQJ 5FB2A 2CV1A 2IS4A 4LJZF 3WTXC 3GYHX 1TC3C 1ULYA 1FEXA 5HODA 2ZJRF 4FQGA 5HLIA 3HOXJ 4RGXA 3RCOA 2NOJB 4LG3A 3N05A 3O3KA 3PUBA 3B6AA 1Y0NA 4AU7A 4A3IJ 4ON0A 3TQNA 2VKDA 2E7WA 2NVXJ 2EWNA 3OIPA 3OYDA 5LD2C 4AC0A 3I3LA 1FP1D 3S93A 3OYBA 2JSPA 2NRAC 1FTTA 2BXZA 1QRYA 2BZTA 2X6OA 3NRVA 2E36A 4AIHA 3HOUJ 3HGYA 4HG2A 3S16J 3RQ4A 3WTTC 1JXSA 2X6YA 3H5RA 1RNLA 5D6EA 3TGNA 1PDNC 1FP2A 1N77A 4LB6B 4Y17A 3H1CA 1LKXA 4BQOA 3JRBA 2RGVA 3MCZA 5ED4A 2GIZA 1H0MA 1N75A 1T2KA 3E6BA 2PX9A 9ANTA 1BR2A 1S9HA 2DMPA 1KU7A 2GM4A 3JAMZ 4A3KJ 2WB1A 4JX4A 2VIXA 3R0AA 4ENKA 2VC1A 1OCZH 4LFUA 3GWZA 1UJ8A 4OU0A 1H89C 1A31A 3I59A 2LH9A 3GXOA 3VEPA 1YX3A 4B43A 1IF1A 2R7FA 3RZOJ 3C2HA 1YS6A 1IDYA 1N25A 1HXDA 3GZ5A 1W0TA 4CUGA 2FBHA 4I99C 5D4RA 1YFHA 1BOBA 3NEUA 1OISA 1SFEA 1U2WA 4HF1A 1TW2A 1W7PB 2P0WA 2P7CB 2BY3A 5F64A 3K70C 1V5EA 3S3OA 2M30A 3HSFA 5FRMA 3MZYA 1YHQI 2MC4A 1VQKI 3L2QA 1QNTA 3ESWB 1REPC 2V9KA 4FT8A 2A6TA 1YJ9I 1TBXA 3ZMUA 4YIIA 3RKXA 3HOSA 5CQEA 5B1BH 3R0JA 3CUQA 2HR3A 1ZQ3P 3LL7A 3R4KA 5FKLA 1U8BA 3CJNA 2KISA 3ZN1A 2JRMA 4U87A 5ERIA 2OUMA 3TEDA 1B9NA 1JI8A 1FMVA 5L3FA 3CDIA 2RNJA 2LY9A 3BTCA 2LNBA 1JHFA 2F4OB 4NDLA 2M0MA 1XDUA 2HKXA 2EFWA 2BY1A 1X1PA 1IUYA 2JPCA 4ZDPA 2OA4A 4YG2F 1KONA 2M3AA 3I4NJ 2FX0A 2E71A 2KQRA 5LEKA 2MGQA 2K9LA 3S3MA 1I6HJ 4UB8C 3GX4X 3GUDA 3MKWB 3FHNA 1F1ZA 3T8RA 2ESNA 3BG3A 4OINF 5CVIA 1IZ1A 5IP6A 5B3SH 1R5HA 1WQ2A 1FZPB 2H09A 4C3IJ 3BTLA 4U7BA 4D1QA 3FXQA 1IN8A 2R5ZB 2K40A 4M3DA 1YW7A 1BL0A 1HSJA 2JA5J 2IEKA 3VYTB 1VTNC 3PO3J 4XSZF 2NNYA 1JE8A 4MLOA 2K02A 5L3GA 2ZXIA 1I3QJ 1U8RA 1W4MA 3O6BB 3CCUI 2XASA 4BDYA 1IW7F 2FMYA 1MH4A 2Z99A 3CMAI 3HIFA 2IT0A 3OIQA 3RZDJ 4P9UA 3FHZA 1ZELA 3MKZA 3WG9A 3F72A 4CCOA 1MSEC 1USSA 1W36D 3DF8A 3CP8A 4E7KA 3W3CA 4UXNA 2I8DA 5E1XA 2V26A 2A68F 1GT0C 1TP4A 4CYCB 2COBA 4ETSA 2H1KA 4L18B 4RLQA 5BOXA 3EYYA 2RN7A 1PP7U 5FKKA 1ON1A 2ZMEC 2DYSH 2MD0A 1KGSA 1ETYA 4XQFA 3OYNA 1TWAJ 2LF8A 3HOZJ 1P6RA 1WJCA 2HQ5A 3HGGA 2WY8Q 2DU9A 1R1UA 2J5PA 2LF7A 4MEYF 3CF2A 4WXDA 5GP9A 3BC8A 4LG0A 1LEBA 2P8TA 4EJWA 1IG7A 3HG9A 3HL2A 3K4MA 1DGWY 2TCTA 3M07A 3S32A 1MKMA 4CICA 3LSHA 5FKOA 4M3BA 3WTUC 2Y9YA 3O8GA 4XRMA 2GOMA 1ETQA 4HLYA 2LG4A 1IN7A 5GPCA 5E8GA 4GGGA 1TTYA 1R23A 3MAJA 2BVLA 4C9YA 1JKPC 2JA8J 3DLLF 1FT9A 4L0YB 3WHBA 3VYRB 1V55H 3SZPA 1MH3A 1XMKA 4UVAA 3BR1A 2X6XA 1F4KA 3BTIA 2ICWG 4PZJA 4WX9A 3KYDB 3KP6A 4HRIA 4DBRA 1IRGA 4RAGA 2PG4A 3QPTA 4AD9A 5FD5A 3PL8A 3KLOA 2ZCWA 4UY8I 2WADA 1TLHB 2KRFA 2EK5A 1VQ9I 4JOMA 4R8HA 3VSKA 2R7RA 2X0LA 5ILUA 2MLGA 4G7OF 1QGPA 3F9KA 1B1BA 1BM9A 3TOAA 4XRFA 1FOYA 2EZLA 5DCMA 3L9FA 4ENNA 3JRAA 2V79A 2XC7A 1K4SA 2IW5A 3TMOA 3HZJA 3A2KA 3S1RJ 1O3QA 2Q0OA 3HXLA 4ANJA 1QZZA 3COAC 2JTVA 1MIJA 4QPQA 1BI0A 5IYCJ 2Y75A 4CSWA 5LHIA 1AA7A 5BS6A 2HOAA 1R00A 4EVIA 1G6NA 4C2UA 3R60A 4LLLA 3JAMK 4YIRX 4BHBA 3GTGJ 2EZIA 4WCGA 2V1DA 3K1NA 1XMAA 1NTCA 1ZG3A 5E8IA 5D8KB 3I56I 2DBBA 3G1OA 3WU2C 1TWCJ 2IA2A 3OL4A 2XRLA 5FKNA 3UR3C 1GLNA 3GZNB 2CQXA 3T0YA 1FYKA 2XUBA 2FQ4A 2OD5A 1BR4A 4A0YA 2F4MB 4HDVA 1HW1A 2ECCA 4XK4A 1ETOA 4ZYDA 1ZG1A 1Z1DA 2UXXA 4II2A 2LR8A 3DCFA 1X1AA 5A2QZ 1LFPA 5K5QA 1ETWA 2XRNA 2Y0SA 2JSCA 3SEQA 5DM6F 1Y8QB 4WWCA 2A07F 2EH3A 4KYWA 1WH5A 3E6MA 1ZHFA 3M8FA 3TW6A 1OCRH 5FJ8J 1I3AA 2XAHA 2W7NA 1IRZA 4S0HB 3V42A 1I1SA 5DUIA 4DQ2A 3SDGA 1JKQC 3BZCA 3E6DA 4UHTA 1I50J 1IC8A 3G1LA 3Q0WA 1YI2I 5AIPA 2F5CA 5DEQA 2D1VA 2DYRH 2GOXB 2Q2EB 3ECOA 4HZFA 2QUFA 4I7HA 3DFGA 2W84A 2R7QA 3JREA 2E1CA 2QQBA 1CQTA 3GTLJ 2VKHA 2M9HA 4XLHA 3I55I 3WODF 1S7EA 1ZRDA 3FK6A 5EZGA 4A0ZA 3IKVA 1D0YA 4PK4A 4XKCA 1XS9A 3CO7C 5C4XJ 1UCRA 1U5TB 4O6JA 5D8LB 4R79A 4A3MJ 3NAUA 2TDXA 3K4LA 4H4KC 1D1AA 4I0BA 4C2MJ 4EGZA 5C4JJ 3HOVJ 1O3SA 3F23A 4CO8A 1D1BA 4IOCF 3ABUA 3HYIA 2FUG2 1WKMA 2VJ5A 4XRSA 2ZMEA 1P4AA 2R4GA 2HTSA 2DA4A 5F6FA 2IBDA 3TDZC 3QU3A 1JJ8C 3BR3A 2GLOA 3TL4X 2VBZA 4E7SA 5JI6A 1SVOA 2DCEA 5F08A 3ECHA 2RKHA 4B47A 3J7YJ 5FD6A 4TV7A 2NAZA 5ICCA 1G2HA 1HKSA 4M6YA 3BDDA 1OCOH 1Z05A 3ZQQA 5HNHA 1PUEE 2HZTA 4MNUA 5LBQA 2LFBA 2JJ7A 2QKLB 1S3JA 1Q1VA 4Y13A 3CMEI 3E0JB 3MFKA 5F0FA 2H94A 3CCJI 2O6GE 3HTUA 1J9IA 3BG5A 2V1NA 3OMYA 2VPLA 2Y69H 3O8HA 1LE8A 4EM2A 3H3ZA 4LMYA 2KRHA 2YPRA 2I10A 4LLNA 4XOTA 4XICA 3OS2A 2VXZA 4NQWA 1UG0A 4DZJA 1SFOJ 3OL3A 1DDNA 1W5SA 1OYWA 5HOOA 1QHHD 2VUMJ 3KPHA 1RZ4A 2HEOA 3J81Z 2L01A 3ZQCA 2Z33A 1QU3A 5IYDJ 1G3TA 1HDDC 2EINH 1MMSA 3KP7A 4D9JA 2OTJI 1Z67A 3CCEI 4MIMA 4KT6A 1G59A 1WRJA 2BW3B 5J4YA 1HSTA 3SJMA 2OU2A 3QYFA 2IRFG 3S1NJ 2OV7A 1PUFA 4PCQA 1Z6TA 1KYZA 2CV0A 2CRGA 4KN7X 4BHCA 2V6EA 4BJ5C 3T8TA 5D6FA 3DWLE 1Y0UA 1I27A 1G3YA 2E1OA 2QM3A 2QBYB 1XCVA 5EGOA 4HSRA 4I98B 4KNYA 2QENA 4K2EA 3LFKA 4P1WA 5KHDA 4BACA 3E5XA 4KMFA 3FDYA 2ETHA 4N0BA 3VODA 4NB5A 1XSDA 3HSEA 3D1NI 5LGTA 3KZIC 1LEAA 2PMHA 3MEXA 5FLVA 1IGNA 2R5YB 2JMWA 4CDGA 1J75A 3CF5F 3ZP5A 1B59A 3BJOA 1VQLI 1UHSA 3HM5A 3I4MJ 3FWEA 4C2TA 2L0KA 4P55A 1QHGA 2M7BA 1D8KA 4M73A 2FJ1A 1YG2A 1W1WE 2PFBA 3ZMDA 3BROA 2LP0A 1X3ZB 2FNPA 1NHAA 2OC6A 1LDKB 1RIOH 3IRQA 2IA1A 3ABTA 3SHFA 4IHSA 2X1EA 1O3RA 2WY7Q 4B48A 2WC2A 1WJ5A 1KQ9A 2XAJA 1GV5A 3SZGA 5LGNA 3S2WA 3U1DA 4YFXF 5DM7F 4IOAF 1OFCX 3DXJF 6PAXA 2DK5A 4F3QA 3S17J 4XRSG 1VZ0A 2K86A 2Q1ZB 1YRNB 3SFZA 1F9NA 3PO2J 2UZKA 2VQLA 4P5OA 4QLCU 4B1RA 4HDUA 2FEZA 2LVSA 2MLKA 2HYGD 3A4CA 2GIVA 4MTEA 2BHYA 3BG6A 2ELHA 4DYCA 2E5ZA 2KJCA 3S14J 5E3MA 2DMTA 3IWZA 1IRXA 4U0VA 1VQ8I 1Y56A 2WBMA 1AHDP 1MBKA 3BCBA 3X2QH 4HX4A 5JLXA 3HOWJ 2FBKA 4IQJA 3D0SA 4QSHA 4BAYA 2RQQA 1ITYA 1J7KA 5IPAA 1FC3A 4OMYA 3IRRA 4M3FA 1M1EB 1HLVA 4BQAA 2OQGA 2EFPA 3BLYA 4XKBA 4F55A 5IT9Z 3QOPA 4IX7A 1FYMA 2PI0A 2HPIA 4PFOA 1S8NA 1YW8A 2EIKH 2ZXJA 5J1UA 3ULQB 5JVGF 1HA8A 3M8JA 1ERDA 2LBFA 1MJBA 3ASOH 1IXSB 4HF0A 5A2QK 4HNTA 3OV8A 3OYGA 3F0CA 2FOWA 2Z5UA 3VYSB 5HDGA 4A3FJ 3WU1B 2BW3A 2ISZA 3K10A 2EFQA 3J7AO 4O3MA 1IN5A 4UUSB 3CD6I 2ELKA 3L2VA 3MKLA 3ZQLA 5DUKA 1IDZA 2HQNA 1B72A 3QWLA 1OMIA 2DN0A 2KMUA 3ZR8X 4E6KG 3GFJA 3H9JA 3TKYA 3OOUA 3H5NA 1HC8A 2NS8A 2QQAA 3I9V2 4P96A 3SYTA 3A02A 4A5MA 5HDKA 1WGXA 3FXKA 1SAUA 2B9SA 4EEFG 2HI3A 4IVNA 5GAHJ 4B44A 5HLTA 1FY7A 4E7IA 4ZH4F 4WK8F 2BXYA 4G7ZF 3JW4A 1K79A 3CCVI 4XLPF 2GAUA 2YUSA 3FXLA 2DTZA 4HYEA 3QOEA 1G4DA 1QPIA 1MZBA 3W6KB 2KT0A 4A5NA 3BJAA 2ACJA 4U0WA 2P6TA 3F8FA 3F3XA 2QLZA 4IHVA 1P4XA 3KCCA 3RPUD 4N4NB 4I09A 1EH6A 1PP8F 2UV1A 2WAQN 2L4AA 2XKPA 1OCCH 1TNTA 5E20A 3TOBA 4YFNF 1Z9CA 1TQMA 2H27A 4D0PA 1X1DA 2ZFUA 3PFYA 3JRGA 3SXYA 1EH7A 3S1QJ 4JK1X 3E3VA 3EUKL 2Z9OA 2OCEA 2ID6A 2XGDA 2VJIA 5JVTA 1AKHB 2E2IJ 1MBFA 1SEUA 1DUXC 2X48A 4GDFA 3FM3A 1HOMA 1YTYA 2M87A 1R1VA 5F0CA 5ICFA 4GCVA 3JRIA 3W2WA 1SD5A 5HLHA 2O61A 4RM3A 4CHUA 2MFZA 2R0QC 3PSFA 1YRNA 3VOEA 1WJBA 1XCBA 3A1YA 5KAFC 1MDMB 3TO7A 2COMA 3ABKH 4LK0F 2ZXWH 2R7VA 2D45A 3SFIA 2R92J 3ZXSA 2VONA 4MO7A 4NUBA 4M3EA 1PYVA 2DOAA 3S2DJ 2QCOA 1UAAA 4Q48A 2Q8KA 2DPUA 2E2JJ 2OQRA 1MJ9A 2VT2A 4EGYA 2STWA 3OYJA 3HKZN 1EV7A 3J81K 3GCMA 3OY9A 3I64A 1PJRA 5M3MJ 3OR2C 1QVUA 3TO9A 2O3FA 4BQQA 4FCYA 2R7SA 2F5DA 1ENHA 1S7OA 3S2HJ 4AYBN 5D5XB 2PEXA 4F7ZA 5K1YA 2BE5F 5IOZA 4FASD 2LYCA 1D1CA 4MFEA 4DGWB 5ICGA 2DT7B 3WHCA 4YIFA 1ZR4A 1YOVB 2DW4A 1XSXA 3IL2A 5GTHC 2EJRA 5E3OA 1WZ2A 1QZEA 4M71A 1NK2P 5F1JA 2NVYJ 2M4KA 1JTYA 3E97A 3KEOA 3TBIA 3GZ6A 2VQGA 5B5EC 3FXMA 4E7LA 4XLAA 3HUGA 3M4OJ 5J8CA 3PNTA 1XGSA 4KDPA 1DU0A 1N78A 2Y31A 2XGXA 4UUSA 1MMAA 2LKPA 2CWEA 4KIGA 4RAFA 4A93J 2KFDA 2L9VA 2HDWA 3L2RA 3CCQI 2KRCA 4PGHA 1RUOA 2GXBA 5FFXA 3BY6A 4OIRF 3GMEA 3KZYA 2R7XA 1ZK8A 2YS9A 4E7ZA 2RDPA 2F48A 3E6CC 3BCAA 4IPAA 2ZKZA 4RAYA 1A04A 4J01A 4OOIA 3LSGA 4F91B 3HC7A 3CDHA 3CCSI 2L2OA 2NXNB 2MD5A 3CCMI 3DTIA 1UELB 4XONA 4QTRA 3J7AY 1FOXA 4KITB 2VLAA 3U21A 5J40A 4OMZA 3BR0A 3HJEA 5LFAA 2PJRA 1UB9A 2H8WA 2HS5A 4B3XA 3F8BA 3FK7A 2XIGA 4IL6C 4E70A 1H9GA 1KU3A 2E7XA 3RTRA 3S3NA 1IN4A 3RJPA 5GTIC 1X2NA 3IUOA 4PJMA 3K4BA 1SMYF 1O57A 1G8XA 2YSRA 4ZDOA 1Y1VJ 1ZLKA 1LJ9A 3HRMA 4KIBA 4LITA 1WH7A 3JRFA 2QSFX 3KX2A 1O4XA 1D8JA 1OCTC 2QSGX 2JUCA 3ERMA 4PFPA 1H8AC 1R58A 2EBIA 5EEGA 3P7NA 1TWHJ 2WAQA 2ZXHA 3BP8A 3K2AA 4CCJA 4KMUX 1BJZA 3GF2A 1YO5C 2HDDA 2DT6A 4I76A 3ABLH 1ONVA 3AG3H 3O2PE 1O3TA 5TRDA 1KU9A 1MW7A 3ZMZA 1NK3P 5IT9K 2Y0SN 3E5UA 2VN2A 5HNFA 1SC7A 4N9IA 5L3EA 2X9DA 5B1AH 1A36A 2M8EA 3NARA 1BW6A 3AG2H 4KISA 3JTHA 4RB1A 1Z21A 2W57A 1K7AA 2Y2ZA 3HSRA 5EEAA 3GFIA 2RC4A 3WU0A 2R7UA 1J09A 1SFUA 3H9QA 3CTAA 2CH0A 2OPTA 2XSJC 2X1CA 3ZMTA 4C3HJ 4LD5A 4S05A 4OIOF 3BPXA 5GAGJ 1BN5A 3IH3A 3BTJA 1Z6RA 2EB7A 4HV5A 2QGUA 2PQ8A 5C44J 2DO7A 4Q47A 2XAFA 4IRIA 3PJRA 4H0EA 2K5CA 3DP7A 4L5JA 4GO1A 3U2RA 1XC5A 2DT5A 1IO2A 3HKZA 1RRJA 2ZC2A 4MFDA 3PNYA 4LK1F 1W7PA 2EV5A 2ZJ2A 4IF4A 3I71A 4AYBA 2O03A 2IGNA 2A05A 1MBJA 1XTAA 2VQHA 4PJJA 3K6GA 4FTHA 2NVUB 2O8KA 4L5IA 1CGPA 2A6EF 4ZYEA 3DU5A 4XLNF 1WI9A 5EF6A 4GYGA 4RM2A 4B8XA 3LQQA 1FBUA 4ASNA 5CKTA 4BEHB 2O7OA 3V7RA 1A6IA 1K78B 3H3VK 1ZAOA 3DEUA 3WTWC 5H6QA 2FMLA 2HXIA 5DS9A 3AG4H 3H35A 2ZB9A 2X1DA 4QWQA 3FKJA 1BR1A 2MC3A 2LDUA 2UWMA 1Z7UA 5TJJA 2HWVA 5KNLA 1FBQA 2HGCA 3R6SA 1GXQA 2KIQA 2GA1A
chains in the Genus database with same CATH topology
3DQVC 5LGUA 2PBIA 4UVCA 3L00A 2UXNA 4A12A 2L3DA 2K27A 4DNCA 4ENMA 4G7HF 5CVRA 4UUVA 1B4AA 1OKRA 2CGPA 3TDUC 2DTRA 2XAGA 4EV0A 1CF7B 2QZ8A 3I54A 5CVJA 3Q5FA 3J80Z 1QO0D 4FHTA 3HTSB 1T98A 2EA4A 4A0XA 4CXFA 1HKTA 3ERED 1SD7A 1ZG5A 1SFXA 2A69F 1SMTA 1IAWA 3ZPLA 5EEHA 3GO5A 3F8NA 1U5TC 4HA8A 2P4WA 1HW5A 2BBYA 2VOOA 2FRHA 1SD6A 1J5YA 1FX7A 3VFZA 1TQPA 1BIAA 5FFZA 3MZHA 3CO6C 3IHUA 3JTGA 1U3EM 2V9VA 3ISPA 2XHKA 1IN6A 3FMSA 3P9CA 5L3BA 3IKTA 2X4HA 1DPRA 2XAQA 1K78A 2O8XA 3FMQA 4PDKA 2FXAA 3RKWA 2HTJA 3M9AA 4Q5SF 5LHHA 1JHHA 5J8FA 5BPIA 3FZVA 2M5WA 3F22A 5HLGA 2XROA 3ROUA 3SZTA 1QZYA 2KIMA 3K2ZA 3CUOA 2YX4A 3VB2A 2CG4A 2NS0A 2NNNA 2P7VB 4EJTA 3F8MA 3RDIA 1XN7A 3Q9VA 4HX8A 1BI3A 2CYYA 3V8LA 3LQRA 2VE8A 4L9TA 1HQCA 2KKOA 3V8KA 1YIOA 5CJ9A 3MWMA 2JRTA 3FF5A 4HBLA 5JFRA 1U6GA 1UHWA 2HFHA 1ZLJA 5FLXK 3Q9SA 3PQJA 4ZYHA 1BJAA 2EV6A 1XD7A 4IRGA 2HYFA 3KLNA 2DPDA 4HX7A 1FBSA 1TQIA 2C6YA 2K4BA 1ZGJA 5E1ZB 3FM5A 3C1DA 4HV6A 1USTA 3U9GA 5L3DA 2IJLA 3DPLC 2PJPA 1FSEA 5CVUA 1SD4A 1P92A 5CVVA 2YU3A 1BC8C 3RPQA 1R7JA 1DP7P 4RS8A 4AWXB 4RGUA 3IWFA 2Q2EA 3RIRA 5ILVA 2CFXA 5KK1A 2EFOA 2NYXA 2P5VA 4UNOA 2AXLA 1U5TA 4NHJA 2G7UA 3QU6A 1X3UA 5AIQA 2JT1A 5H20A 4RGSA 2FOKA 4KFCA 1W5TA 5DCFA 4ESBA 2H6CA 1ZN2A 2P5KA 3J80K 1T38A 1T6SA 5E1WA 4M9ZA 3DKWA 1B6AA 3G73A 2VOPA 3BZ6A 2WV0A 3I5UA 3KP3A 5L3CA 2P6SA 1BI1A 3KP4A 3RKYA 3ELKA 4KN4X 1ON2A 3I4PA 4MTDA 1OPCA 2CW0F 1IRFA 3EDPA 4EJVA 3BPVA 3JSPA 2ISYA 4G8XA 3K69A 4RB3C 3WE2A 2FE3A 2PLYA 4M6XA 2AS5F 1FSHA 3KE2A 2ESHA 2F5FA 1L0OC 3GW2A 2CSOA 1STZA 3I59B 1XB4A 4UV9A 2QBYA 2DQLA 1R5GA 4XSXF 4LLGF 4CZZA 3SQNA 1FLIA 1G3SA 1AOYA 3ZN0A 4U0YA 3HHHA 4I2OA 4G94A 2MH2A 3TO6A 2W25A 2OZ6A 5DV5A 1YYVA 3ZMVA 3FXRA 2MA3A 3ZMSA 3E5QA 3EQLF 3QPHA 1LDDA 2Y0MA 5LLQA 5DD4A 5LRSA 4N9HA 1FNNA 3AAFA 1HW2A 3BOQA 1O7FA 4EM1A 1FPQA 3QAHA 2QVOA 2L54A 4I0AA 4ESJA 2ADUA 5D5VB 4L9JA 2Y48A 2VBXA 4KIFA 2KIUA 4EM0B 1AWCA 4ZZDA 4RGRA 3WTYC 1RUNA 5HVQC 1ZYRF 2KJBA 1YQAA 3D5LA 2DLLA 4GYIA 1YS7A 3P9IA 1W7PD 2LSOA 5K5OA 2J5OA 3T1BA 2F2EA 1RI7A 2F5EA 2G9WA 1BIBA 4AVPA 5JHUA 1F5TA 2JZYA 3IC7A 1S29A 2A61A 2M45A 3V4GA 2FBIA 3GFLA 4KT5C 2FA5A 4FX4A 4LG0B 2OZUA 5CLSA 4I01A 5FGMA 2V1UA 4WF2A 2L02A 3KEQA 4Z2YA 4M72A 3RI4A 5KVRA 5DD8A 3F21A 2H6BA 3B73A 2HKOA 2FSWA 5LHGA 1FWZA 4RAZA 1V4RA 2VBWA 1R36A 1OR7A 5DDGA 1QBJA 1C0WA 3RPUA 3K1PA 2BYVE 4HLXA 3C7JA 3HRSA 2ZNYA 3LSTA 1QPMA 2PMUA 1Z91A 3KP5A 1MDMA 1KQ8A 5DCMB 5LRRA 5HS9A 2GZWA 3K1MA 1GVJA 1D5VA 1E17A 5ILSA 1J2XA 1LVAA 5BMZA 5J6XA 2XKOA 1I1GA 2D1HA 4YFKF 3DV8A 4B09A 2A3SA 1BC7C 1ODDA 3REOA 4HQMA 3R61A 4A6DA 1J0RA 2OBPA 4BNCA 4M9SA 3GFMA 1P2FA 1GHCA 4M9XA 3HRTA 4KA4A 2VC0A 5HDNA 2BGCA 5FLXZ 5DYMA 1KU2A 5BPDA 4O5VA 4HOBA 3P9KA 4RB2C 1ZH5A 2FNAA 1XGOA 2VBYA 4EQQA 3GEZA 1J59A 3N97A 2D2WA 2GWRA 2DAOA 2BV6A 5IT3A 1UHMA 2ZO4A 3LAPA 3HOTA 4EMSA 4HF2A 4G6DA 4WXHA 2DFIA 2P5LC 3WTZA 3GLXA 1OYIA 3L2CA 3EUHA 3WGGA 3M1EA 2RQPA 2R3SA 5CYVA 4G6QA 1YW9A 4JQFA 4WXCA 2FQ3A 3H92A 2STTA 4JBAA 1OYYA 2ZMEB 3DPTA 1TW3A 3MQ0A 3EETA 4MQ9F 4CYDA 4ENJA 3ML6A 5LEJA 3T5XA 3WGHA 2VT3A 2B0LA 3N4MA 4IRHA 3PQKA 1IXCA 4ZZLA 1TNSA 1LQ1A 3C3WA 4ESFA 4EJUA 2IVMA 4S04A 4BYYA 3L09A 3CLOA 1D3YA 3HHGA 2V1XA 3RYRA 1LDJA 4L9NA 3B02A 4U88A 3LA3A 1UFMA 4EJOA 2R7DA 2O0YA 1K6OA 2VODA 2PN6A 4OIQF 1EH8A 2GXGA 4Y15A 4MEXF 3WTVC 3QP5A 2IP2A 3QRFF 1G3WA 5D5UB 1WWXA 5E17F 1LB2A 4HW0A 1GXPA 1MGTA 5ICEA 1XDSA 2EFNA 2ZNZA 2KIFA 3LWFA 2HOEA 4KICA 1H9TA 2DK8A 5H6RA 2E1NA 3KP2A 1R22A 4L9VA 4BH9A 4GXOA 2DI3A 4P9FA 2IPQX 3KFWX 3LA7A 3NQOA 4MHGA 4IHTA 1CF7A 2Z3YA 2WTEA 1KA8A 1ZRCA 5D5WB 4KUMA 3L7WA 3F6VA 1BBYA 2W24A 1MJAA 4L0ZB 4FX0A 1BOAA 3FX3A 3PFIA 5K5RA 1HKQA 3WTSC 3F8CA 4HAMA 2A5YB 3WE3A 2RV8A 3V7SA 3M8EA 1V3FA 2YX7A 1WSUA 2XV4S 4HQEA 2FU4A 2DQRA 4UV8A 5HS8A 3I0TA 3GVAA 5HS7A 2CO5A 2FF4A 5FO5A 1P4WA 3LA2A 1IXRC 3K9TA 3BJ6A 1LNWA 2K7LA 4I02A 1ZARA 4A2UA 1MD0A 1E2XA 2JPBA 3I58A 1B9MA 1YLFA 1L3LA 2BEOA 2QQ9A 3ZQ7A 5AONA 1FYLA 3KETA 2ZFWA 2W85A 3BWGA 1O7LA 4M74A 5E18F 3M7GA 3KZZA 4AIJA 2MBFA 1XGMA 4R1HA 1DPUA 2OAZA 1JGSA 4BXUA 1ZREA 1XGNA 2XVCA 2QWWA 2GQQA 3I53A 2CQKA 4OIPF 1BI2A 3RYPA 2QYOA 5F1RA 4LB5A 2A6HF 4RB0A 4XBFA 4Q4ZF 1KQ0A 2RVCA 3W6JB 3EYIA 3H3UA 3CUQC 2M1BA 2HDCA 4A6EA 3FMRA 3FXUA 1ZGAA 1S7AA 3K0LA 3QP6A 2WWYA 5BQTA 2ZBKA 1Q1HA 1FOKA 1XSVA 2HQRA 5JR3A 1T39A 3WGIA 2EV0A 2GA2A 2IA0A 4G9YA 4IJAA 4MQVA 4PGGA 2YR2A 3LAJA 2G7HA 1HBXG 2L4MA 1KYWA 2V6CA 4CGZA 1U78A 3HRUA 4BHPA 4AIKA 2EA2A 3JSOA 1I5ZA 4LGWA 3CUQB 4U7DA 3C18A 4ZYGA 5D4SA 1I6XA 4UVBA 2MH9A 3V7CA 1SAXA 1T0FA 4IXAA 1ZRFA 1R1TA 3V8JA 3G3ZA 3OOPA 4MGRA 1QQIA 1S6LA 2VE9A 3F6OA 2K4JA 5FB2A 4LJZF 3WTXC 3GYHX 1ULYA 5HLIA 4RGXA 3O3KA 4ON0A 3TQNA 2E7WA 2EWNA 1FP1D 2NRAC 3NRVA 4AIHA 3WTTC 1JXSA 1RNLA 5D6EA 3TGNA 1PDNC 1FP2A 4LB6B 4Y17A 2RGVA 3MCZA 5ED4A 1H0MA 1T2KA 3E6BA 1KU7A 3JAMZ 3R0AA 4ENKA 2VC1A 4LFUA 3GWZA 4OU0A 3I59A 3GXOA 3VEPA 1IF1A 2R7FA 1YS6A 1HXDA 3GZ5A 2FBHA 5D4RA 1YFHA 3NEUA 1SFEA 1U2WA 4HF1A 1TW2A 1W7PB 2P7CB 5F64A 2M30A 3HSFA 3MZYA 1QNTA 1REPC 4FT8A 1TBXA 3ZMUA 4YIIA 3RKXA 3HOSA 3R0JA 3CUQA 2HR3A 3R4KA 3CJNA 3ZN1A 5ERIA 1B9NA 5L3FA 2RNJA 2LNBA 1JHFA 1XDUA 2HKXA 2EFWA 1IUYA 2JPCA 2OA4A 4YG2F 5LEKA 3GX4X 3GUDA 1F1ZA 3T8RA 2ESNA 4OINF 5CVIA 1IZ1A 1R5HA 1WQ2A 1FZPB 2H09A 4U7BA 3FXQA 1IN8A 1YW7A 1HSJA 1VTNC 4XSZF 2NNYA 1JE8A 2K02A 5L3GA 1U8RA 1W4MA 3O6BB 2XASA 1IW7F 2FMYA 2Z99A 3HIFA 2IT0A 4P9UA 3FHZA 3WG9A 3F72A 1USSA 3DF8A 4UXNA 5E1XA 2A68F 4ETSA 4L18B 5BOXA 3EYYA 2RN7A 1PP7U 1ON1A 1KGSA 2LF8A 1P6RA 2DU9A 1R1UA 2J5PA 2LF7A 4MEYF 4WXDA 4LG0A 1LEBA 2P8TA 4EJWA 1MKMA 4CICA 3WTUC 4HLYA 1IN7A 5E8GA 4GGGA 1TTYA 1R23A 3MAJA 1FT9A 4L0YB 3SZPA 1XMKA 4UVAA 1F4KA 4PZJA 4WX9A 3KP6A 1IRGA 2PG4A 3QPTA 4AD9A 5FD5A 3KLOA 2ZCWA 1TLHB 2KRFA 2EK5A 4R8HA 2X0LA 5ILUA 2MLGA 4G7OF 1QGPA 1B1BA 1BM9A 3TOAA 4XRFA 5DCMA 3L9FA 4ENNA 2V79A 2IW5A 2Q0OA 1QZZA 3COAC 2JTVA 1BI0A 2Y75A 5LHIA 5BS6A 1R00A 4EVIA 1G6NA 3R60A 4LLLA 3JAMK 4BHBA 4WCGA 2V1DA 3K1NA 1XMAA 1ZG3A 5E8IA 5D8KB 2DBBA 2IA2A 3T0YA 1FYKA 2XUBA 2OD5A 4A0YA 4HDVA 1HW1A 4ZYDA 1ZG1A 1Z1DA 2UXXA 5A2QZ 5K5QA 2XRNA 2JSCA 4WWCA 2A07F 4KYWA 3E6MA 1ZHFA 3M8FA 2XAHA 1I1SA 5DUIA 4DQ2A 3E6DA 4UHTA 5AIPA 2F5CA 5DEQA 2D1VA 3ECOA 4HZFA 2QUFA 4I7HA 3DFGA 2W84A 2E1CA 2QQBA 3WODF 1ZRDA 4A0ZA 3IKVA 3CO7C 1UCRA 1U5TB 4O6JA 5D8LB 4R79A 2TDXA 4I0BA 4EGZA 1O3SA 3F23A 4CO8A 3ABUA 3HYIA 1WKMA 2ZMEA 1P4AA 2HTSA 5F6FA 3TDZC 3QU3A 2VBZA 5JI6A 3ECHA 2RKHA 5FD6A 4TV7A 5ICCA 2NAZA 1HKSA 4M6YA 3BDDA 1Z05A 1PUEE 2HZTA 4MNUA 5LBQA 1S3JA 4Y13A 3MFKA 2H94A 2O6GE 3HTUA 1J9IA 4EM2A 3H3ZA 4LMYA 2YPRA 4LLNA 2VXZA 4NQWA 1DDNA 1W5SA 1OYWA 5HOOA 1RZ4A 2HEOA 3J81Z 2L01A 2Z33A 1G3TA 3KP7A 1WRJA 1HSTA 2OU2A 2IRFG 4PCQA 1Z6TA 1KYZA 4KN7X 4BHCA 3T8TA 5D6FA 1Y0UA 1I27A 1G3YA 2QM3A 2QBYB 1XCVA 4I98B 4KNYA 2QENA 4K2EA 3LFKA 4KMFA 3E5XA 2ETHA 4N0BA 3VODA 4NB5A 1XSDA 3HSEA 5LGTA 1LEAA 2PMHA 3MEXA 1J75A 4CDGA 3ZP5A 1B59A 3BJOA 3FWEA 4P55A 1D8KA 4M73A 1YG2A 2PFBA 3ZMDA 3BROA 2FNPA 1NHAA 1LDKB 1RIOH 3IRQA 2IA1A 3ABTA 3SHFA 4IHSA 1O3RA 2WC2A 1KQ9A 2XAJA 5LGNA 3S2WA 3U1DA 4YFXF 3DXJF 6PAXA 2DK5A 2K86A 3SFZA 1F9NA 2UZKA 4P5OA 4QLCU 4HDUA 2FEZA 2MLKA 2HYGD 2GIVA 4MTEA 2ELHA 2KJCA 3IWZA 4U0VA 4HX4A 2FBKA 3D0SA 4BAYA 1J7KA 1FC3A 4OMYA 3IRRA 4BQAA 2OQGA 2EFPA 5IT9Z 3QOPA 1FYMA 2PI0A 1S8NA 1YW8A 3ULQB 2ZXJA 1MJBA 4HF0A 1IXSB 5A2QK 3OV8A 2Z5UA 5HDGA 2ISZA 3WU1B 2EFQA 3J7AO 4O3MA 1IN5A 5DUKA 2HQNA 1OMIA 3GFJA 3TKYA 2QQAA 4P96A 5HDKA 4A5MA 4IVNA 1FY7A 4ZH4F 4WK8F 4G7ZF 3JW4A 1K79A 4XLPF 2GAUA 4HYEA 1G4DA 1MZBA 3W6KB 4A5NA 3BJAA 2ACJA 4U0WA 2P6TA 3F8FA 3F3XA 2QLZA 1P4XA 3KCCA 4I09A 1EH6A 1PP8F 5E20A 2L4AA 3TOBA 2XKPA 1TNTA 4YFNF 1Z9CA 2H27A 1TQMA 4D0PA 3SXYA 1EH7A 4JK1X 3E3VA 2Z9OA 5JVTA 1DUXC 3FM3A 1YTYA 2M87A 1R1VA 5ICFA 4GCVA 1SD5A 5HLHA 2O61A 4CHUA 3VOEA 1XCBA 1MDMB 3TO7A 2COMA 4LK0F 2D45A 2VONA 4Q48A 2Q8KA 2DPUA 2OQRA 1MJ9A 2VT2A 4EGYA 2STWA 1EV7A 3J81K 3I64A 3TO9A 2O3FA 2F5DA 1S7OA 5D5XB 2PEXA 4F7ZA 5K1YA 2BE5F 5ICGA 4YIFA 2DW4A 1XSXA 3IL2A 2EJRA 4M71A 3E97A 3KEOA 3GZ6A 3HUGA 5J8CA 4KDPA 1XGSA 2XGXA 2LKPA 2CWEA 4KIGA 4PGHA 2GXBA 1RUOA 5FFXA 3BY6A 4OIRF 3KZYA 2RDPA 3E6CC 4IPAA 2ZKZA 4RAYA 1A04A 4OOIA 3CDHA 2MD5A 4OMZA 1UB9A 2HS5A 3F8BA 2XIGA 4E70A 1H9GA 1KU3A 2E7XA 3RTRA 1IN4A 3RJPA 1SMYF 1O57A 2YSRA 1ZLKA 1LJ9A 3HRMA 4KIBA 1D8JA 1R58A 5EEGA 3P7NA 3BP8A 4KMUX 1YO5C 3GF2A 1ONVA 3O2PE 1O3TA 5TRDA 1KU9A 3ZMZA 5IT9K 3E5UA 2VN2A 4N9IA 5L3EA 2M8EA 3JTHA 4RB1A 2W57A 1K7AA 3HSRA 3GFIA 2RC4A 3WU0A 1SFUA 3CTAA 4OIOF 3ZMTA 4S05A 4LD5A 3BPXA 1BN5A 1Z6RA 2EB7A 4HV5A 2PQ8A 2DO7A 4Q47A 2XAFA 4IRIA 4H0EA 3DP7A 4L5JA 4GO1A 3U2RA 2DT5A 4LK1F 1W7PA 2EV5A 2ZJ2A 4IF4A 3I71A 2O03A 4L5IA 1CGPA 2A6EF 4ZYEA 4XLNF 1WI9A 4GYGA 4B8XA 3LQQA 1FBUA 4ASNA 3V7RA 1K78B 1ZAOA 3DEUA 3WTWC 5H6QA 2FMLA 4QWQA 2MC3A 2LDUA 2UWMA 1Z7UA 5TJJA 2HWVA 1FBQA 2HGCA 3R6SA 1GXQA 1O3QA 2GA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DQV C;  5LGU A;  2PBI A;  4UVC A;  3L00 A;  2UXN A;  4A12 A;  2L3D A;  2K27 A;  4DNC A;  4ENM A;  4G7H F;  5CVR A;  4UUV A;  1B4A A;  1OKR A;  2CGP A;  3TDU C;  2DTR A;  2XAG A;  4EV0 A;  1CF7 B;  2QZ8 A;  3I54 A;  5CVJ A;  3Q5F A;  3J80 Z;  1QO0 D;  4FHT A;  3HTS B;  1T98 A;  2EA4 A;  4A0X A;  4CXF A;  1HKT A;  3ERE D;  1SD7 A;  1ZG5 A;  1SFX A;  2A69 F;  1SMT A;  1IAW A;  3ZPL A;  5EEH A;  3GO5 A;  3F8N A;  1U5T C;  4HA8 A;  2P4W A;  1HW5 A;  2BBY A;  2VOO A;  2FRH A;  1SD6 A;  1J5Y A;  1FX7 A;  3VFZ A;  1TQP A;  1BIA A;  5FFZ A;  3MZH A;  3CO6 C;  3IHU A;  3JTG A;  1U3E M;  2V9V A;  3ISP A;  2XHK A;  1IN6 A;  3FMS A;  3P9C A;  5L3B A;  3IKT A;  2X4H A;  1DPR A;  2XAQ A;  1K78 A;  2O8X A;  3FMQ A;  4PDK A;  2FXA A;  3RKW A;  2HTJ A;  3M9A A;  4Q5S F;  5LHH A;  1JHH A;  5J8F A;  5BPI A;  3FZV A;  2M5W A;  3F22 A;  5HLG A;  2XRO A;  3ROU A;  3SZT A;  1QZY A;  2KIM A;  3K2Z A;  3CUO A;  2YX4 A;  3VB2 A;  2CG4 A;  2NS0 A;  2NNN A;  2P7V B;  4EJT A;  3F8M A;  3RDI A;  1XN7 A;  3Q9V A;  4HX8 A;  1BI3 A;  2CYY A;  3V8L A;  3LQR A;  2VE8 A;  4L9T A;  1HQC A;  2KKO A;  3V8K A;  1YIO A;  5CJ9 A;  3MWM A;  2JRT A;  3FF5 A;  4HBL A;  5JFR A;  1U6G A;  1UHW A;  2HFH A;  1ZLJ A;  5FLX K;  3Q9S A;  3PQJ A;  4ZYH A;  1BJA A;  2EV6 A;  1XD7 A;  4IRG A;  2HYF A;  3KLN A;  2DPD A;  4HX7 A;  1FBS A;  1TQI A;  2C6Y A;  2K4B A;  1ZGJ A;  5E1Z B;  3FM5 A;  3C1D A;  4HV6 A;  1UST A;  3U9G A;  5L3D A;  2IJL A;  3DPL C;  2PJP A;  1FSE A;  5CVU A;  1SD4 A;  1P92 A;  5CVV A;  2YU3 A;  1BC8 C;  3RPQ A;  1R7J A;  1DP7 P;  4RS8 A;  4AWX B;  4RGU A;  3IWF A;  2Q2E A;  3RIR A;  5ILV A;  2CFX A;  5KK1 A;  2EFO A;  2NYX A;  2P5V A;  4UNO A;  2AXL A;  1U5T A;  4NHJ A;  2G7U A;  3QU6 A;  1X3U A;  5AIQ A;  2JT1 A;  5H20 A;  4RGS A;  2FOK A;  4KFC A;  1W5T A;  5DCF A;  4ESB A;  2H6C A;  1ZN2 A;  2P5K A;  3J80 K;  1T38 A;  1T6S A;  5E1W A;  4M9Z A;  3DKW A;  1B6A A;  3G73 A;  2VOP A;  3BZ6 A;  2WV0 A;  3I5U A;  3KP3 A;  5L3C A;  2P6S A;  1BI1 A;  3KP4 A;  3RKY A;  3ELK A;  4KN4 X;  1ON2 A;  3I4P A;  4MTD A;  1OPC A;  2CW0 F;  1IRF A;  3EDP A;  4EJV A;  3BPV A;  3JSP A;  2ISY A;  4G8X A;  3K69 A;  4RB3 C;  3WE2 A;  2FE3 A;  2PLY A;  4M6X A;  2AS5 F;  1FSH A;  3KE2 A;  2ESH A;  2F5F A;  1L0O C;  3GW2 A;  2CSO A;  1STZ A;  3I59 B;  1XB4 A;  4UV9 A;  2QBY A;  2DQL A;  1R5G A;  4XSX F;  4LLG F;  4CZZ A;  3SQN A;  1FLI A;  1G3S A;  1AOY A;  3ZN0 A;  4U0Y A;  3HHH A;  4I2O A;  4G94 A;  2MH2 A;  3TO6 A;  2W25 A;  2OZ6 A;  5DV5 A;  1YYV A;  3ZMV A;  3FXR A;  2MA3 A;  3ZMS A;  3E5Q A;  3EQL F;  3QPH A;  1LDD A;  2Y0M A;  5LLQ A;  5DD4 A;  5LRS A;  4N9H A;  1FNN A;  3AAF A;  1HW2 A;  3BOQ A;  1O7F A;  4EM1 A;  1FPQ A;  3QAH A;  2QVO A;  2L54 A;  4I0A A;  4ESJ A;  2ADU A;  5D5V B;  4L9J A;  2Y48 A;  2VBX A;  4KIF A;  2KIU A;  4EM0 B;  1AWC A;  4ZZD A;  4RGR A;  3WTY C;  1RUN A;  5HVQ C;  1ZYR F;  2KJB A;  1YQA A;  3D5L A;  2DLL A;  4GYI A;  1YS7 A;  3P9I A;  1W7P D;  2LSO A;  5K5O A;  2J5O A;  3T1B A;  2F2E A;  1RI7 A;  2F5E A;  2G9W A;  1BIB A;  4AVP A;  5JHU A;  1F5T A;  2JZY A;  3IC7 A;  1S29 A;  2A61 A;  2M45 A;  3V4G A;  2FBI A;  3GFL A;  4KT5 C;  2FA5 A;  4FX4 A;  4LG0 B;  2OZU A;  5CLS A;  4I01 A;  5FGM A;  2V1U A;  4WF2 A;  2L02 A;  3KEQ A;  4Z2Y A;  4M72 A;  3RI4 A;  5KVR A;  5DD8 A;  3F21 A;  2H6B A;  3B73 A;  2HKO A;  2FSW A;  5LHG A;  1FWZ A;  4RAZ A;  1V4R A;  2VBW A;  1R36 A;  1OR7 A;  5DDG A;  1QBJ A;  1C0W A;  3RPU A;  3K1P A;  2BYV E;  4HLX A;  3C7J A;  3HRS A;  2ZNY A;  3LST A;  1QPM A;  2PMU A;  1Z91 A;  3KP5 A;  1MDM A;  1KQ8 A;  5DCM B;  5LRR A;  5HS9 A;  2GZW A;  3K1M A;  1GVJ A;  1D5V A;  1E17 A;  5ILS A;  1J2X A;  1LVA A;  5BMZ A;  5J6X A;  2XKO A;  1I1G A;  2D1H A;  4YFK F;  3DV8 A;  4B09 A;  2A3S A;  1BC7 C;  1ODD A;  3REO A;  4HQM A;  3R61 A;  4A6D A;  1J0R A;  2OBP A;  4BNC A;  4M9S A;  3GFM A;  1P2F A;  1GHC A;  4M9X A;  3HRT A;  4KA4 A;  2VC0 A;  5HDN A;  2BGC A;  5FLX Z;  5DYM A;  1KU2 A;  5BPD A;  4O5V A;  4HOB A;  3P9K A;  4RB2 C;  1ZH5 A;  2FNA A;  1XGO A;  2VBY A;  4EQQ A;  3GEZ A;  1J59 A;  3N97 A;  2D2W A;  2GWR A;  2DAO A;  2BV6 A;  5IT3 A;  1UHM A;  2ZO4 A;  3LAP A;  3HOT A;  4EMS A;  4HF2 A;  4G6D A;  4WXH A;  2DFI A;  2P5L C;  3WTZ A;  3GLX A;  1OYI A;  3L2C A;  3EUH A;  3WGG A;  3M1E A;  2RQP A;  2R3S A;  5CYV A;  4G6Q A;  1YW9 A;  4JQF A;  4WXC A;  2FQ3 A;  3H92 A;  2STT A;  4JBA A;  1OYY A;  2ZME B;  3DPT A;  1TW3 A;  3MQ0 A;  3EET A;  4MQ9 F;  4CYD A;  4ENJ A;  3ML6 A;  5LEJ A;  3T5X A;  3WGH A;  2VT3 A;  2B0L A;  3N4M A;  4IRH A;  3PQK A;  1IXC A;  4ZZL A;  1TNS A;  1LQ1 A;  3C3W A;  4ESF A;  4EJU A;  2IVM A;  4S04 A;  4BYY A;  3L09 A;  3CLO A;  1D3Y A;  3HHG A;  2V1X A;  3RYR A;  1LDJ A;  4L9N A;  3B02 A;  4U88 A;  3LA3 A;  1UFM A;  4EJO A;  2R7D A;  2O0Y A;  1K6O A;  2VOD A;  2PN6 A;  4OIQ F;  1EH8 A;  2GXG A;  4Y15 A;  4MEX F;  3WTV C;  3QP5 A;  2IP2 A;  3QRF F;  1G3W A;  5D5U B;  1WWX A;  5E17 F;  1LB2 A;  4HW0 A;  1GXP A;  1MGT A;  5ICE A;  1XDS A;  2EFN A;  2ZNZ A;  2KIF A;  3LWF A;  2HOE A;  4KIC A;  1H9T A;  2DK8 A;  5H6R A;  2E1N A;  3KP2 A;  1R22 A;  4L9V A;  4BH9 A;  4GXO A;  2DI3 A;  4P9F A;  2IPQ X;  3KFW X;  3LA7 A;  3NQO A;  4MHG A;  4IHT A;  1CF7 A;  2Z3Y A;  2WTE A;  1KA8 A;  1ZRC A;  5D5W B;  4KUM A;  3L7W A;  3F6V A;  1BBY A;  2W24 A;  1MJA A;  4L0Z B;  4FX0 A;  1BOA A;  3FX3 A;  3PFI A;  5K5R A;  1HKQ A;  3WTS C;  3F8C A;  4HAM A;  2A5Y B;  3WE3 A;  2RV8 A;  3V7S A;  3M8E A;  1V3F A;  2YX7 A;  1WSU A;  2XV4 S;  4HQE A;  2FU4 A;  2DQR A;  4UV8 A;  5HS8 A;  3I0T A;  3GVA A;  5HS7 A;  2CO5 A;  2FF4 A;  5FO5 A;  1P4W A;  3LA2 A;  1IXR C;  3K9T A;  3BJ6 A;  1LNW A;  2K7L A;  4I02 A;  1ZAR A;  4A2U A;  1MD0 A;  1E2X A;  2JPB A;  3I58 A;  1B9M A;  1YLF A;  1L3L A;  2BEO A;  2QQ9 A;  3ZQ7 A;  5AON A;  1FYL A;  3KET A;  2ZFW A;  2W85 A;  3BWG A;  1O7L A;  4M74 A;  5E18 F;  3M7G A;  3KZZ A;  4AIJ A;  2MBF A;  1XGM A;  4R1H A;  1DPU A;  2OAZ A;  1JGS A;  4BXU A;  1ZRE A;  1XGN A;  2XVC A;  2QWW A;  2GQQ A;  3I53 A;  2CQK A;  4OIP F;  1BI2 A;  3RYP A;  2QYO A;  5F1R A;  4LB5 A;  2A6H F;  4RB0 A;  4XBF A;  4Q4Z F;  1KQ0 A;  2RVC A;  3W6J B;  3EYI A;  3H3U A;  3CUQ C;  2M1B A;  2HDC A;  4A6E A;  3FMR A;  3FXU A;  1ZGA A;  1S7A A;  3K0L A;  3QP6 A;  2WWY A;  5BQT A;  2ZBK A;  1Q1H A;  1FOK A;  1XSV A;  2HQR A;  5JR3 A;  1T39 A;  3WGI A;  2EV0 A;  2GA2 A;  2IA0 A;  4G9Y A;  4IJA A;  4MQV A;  4PGG A;  2YR2 A;  3LAJ A;  2G7H A;  1HBX G;  2L4M A;  1KYW A;  2V6C A;  4CGZ A;  1U78 A;  3HRU A;  4BHP A;  4AIK A;  2EA2 A;  3JSO A;  1I5Z A;  4LGW A;  3CUQ B;  4U7D A;  3C18 A;  4ZYG A;  5D4S A;  1I6X A;  4UVB A;  2MH9 A;  3V7C A;  1SAX A;  1T0F A;  4IXA A;  1ZRF A;  1R1T A;  3V8J A;  3G3Z A;  3OOP A;  4MGR A;  1QQI A;  1S6L A;  2VE9 A;  3F6O A;  2K4J A;  5FB2 A;  4LJZ F;  3WTX C;  3GYH X;  1ULY A;  5HLI A;  4RGX A;  3O3K A;  4ON0 A;  3TQN A;  2E7W A;  2EWN A;  1FP1 D;  2NRA C;  3NRV A;  4AIH A;  3WTT C;  1JXS A;  1RNL A;  5D6E A;  3TGN A;  1PDN C;  1FP2 A;  4LB6 B;  4Y17 A;  2RGV A;  3MCZ A;  5ED4 A;  1H0M A;  1T2K A;  3E6B A;  1KU7 A;  3JAM Z;  3R0A A;  4ENK A;  2VC1 A;  4LFU A;  3GWZ A;  4OU0 A;  3I59 A;  3GXO A;  3VEP A;  1IF1 A;  2R7F A;  1YS6 A;  1HXD A;  3GZ5 A;  2FBH A;  5D4R A;  1YFH A;  3NEU A;  1SFE A;  1U2W A;  4HF1 A;  1TW2 A;  1W7P B;  2P7C B;  5F64 A;  2M30 A;  3HSF A;  3MZY A;  1QNT A;  1REP C;  4FT8 A;  1TBX A;  3ZMU A;  4YII A;  3RKX A;  3HOS A;  3R0J A;  3CUQ A;  2HR3 A;  3R4K A;  3CJN A;  3ZN1 A;  5ERI A;  1B9N A;  5L3F A;  2RNJ A;  2LNB A;  1JHF A;  1XDU A;  2HKX A;  2EFW A;  1IUY A;  2JPC A;  2OA4 A;  4YG2 F;  5LEK A;  3GX4 X;  3GUD A;  1F1Z A;  3T8R A;  2ESN A;  4OIN F;  5CVI A;  1IZ1 A;  1R5H A;  1WQ2 A;  1FZP B;  2H09 A;  4U7B A;  3FXQ A;  1IN8 A;  1YW7 A;  1HSJ A;  1VTN C;  4XSZ F;  2NNY A;  1JE8 A;  2K02 A;  5L3G A;  1U8R A;  1W4M A;  3O6B B;  2XAS A;  1IW7 F;  2FMY A;  2Z99 A;  3HIF A;  2IT0 A;  4P9U A;  3FHZ A;  3WG9 A;  3F72 A;  1USS A;  3DF8 A;  4UXN A;  5E1X A;  2A68 F;  4ETS A;  4L18 B;  5BOX A;  3EYY A;  2RN7 A;  1PP7 U;  1ON1 A;  1KGS A;  2LF8 A;  1P6R A;  2DU9 A;  1R1U A;  2J5P A;  2LF7 A;  4MEY F;  4WXD A;  4LG0 A;  1LEB A;  2P8T A;  4EJW A;  1MKM A;  4CIC A;  3WTU C;  4HLY A;  1IN7 A;  5E8G A;  4GGG A;  1TTY A;  1R23 A;  3MAJ A;  1FT9 A;  4L0Y B;  3SZP A;  1XMK A;  4UVA A;  1F4K A;  4PZJ A;  4WX9 A;  3KP6 A;  1IRG A;  2PG4 A;  3QPT A;  4AD9 A;  5FD5 A;  3KLO A;  2ZCW A;  1TLH B;  2KRF A;  2EK5 A;  4R8H A;  2X0L A;  5ILU A;  2MLG A;  4G7O F;  1QGP A;  1B1B A;  1BM9 A;  3TOA A;  4XRF A;  5DCM A;  3L9F A;  4ENN A;  2V79 A;  2IW5 A;  2Q0O A;  1QZZ A;  3COA C;  2JTV A;  1BI0 A;  2Y75 A;  5LHI A;  5BS6 A;  1R00 A;  4EVI A;  1G6N A;  3R60 A;  4LLL A;  3JAM K;  4BHB A;  4WCG A;  2V1D A;  3K1N A;  1XMA A;  1ZG3 A;  5E8I A;  5D8K B;  2DBB A;  2IA2 A;  3T0Y A;  1FYK A;  2XUB A;  2OD5 A;  4A0Y A;  4HDV A;  1HW1 A;  4ZYD A;  1ZG1 A;  1Z1D A;  2UXX A;  5A2Q Z;  5K5Q A;  2XRN A;  2JSC A;  4WWC A;  2A07 F;  4KYW A;  3E6M A;  1ZHF A;  3M8F A;  2XAH A;  1I1S A;  5DUI A;  4DQ2 A;  3E6D A;  4UHT A;  5AIP A;  2F5C A;  5DEQ A;  2D1V A;  3ECO A;  4HZF A;  2QUF A;  4I7H A;  3DFG A;  2W84 A;  2E1C A;  2QQB A;  3WOD F;  1ZRD A;  4A0Z A;  3IKV A;  3CO7 C;  1UCR A;  1U5T B;  4O6J A;  5D8L B;  4R79 A;  2TDX A;  4I0B A;  4EGZ A;  1O3S A;  3F23 A;  4CO8 A;  3ABU A;  3HYI A;  1WKM A;  2ZME A;  1P4A A;  2HTS A;  5F6F A;  3TDZ C;  3QU3 A;  2VBZ A;  5JI6 A;  3ECH A;  2RKH A;  5FD6 A;  4TV7 A;  5ICC A;  2NAZ A;  1HKS A;  4M6Y A;  3BDD A;  1Z05 A;  1PUE E;  2HZT A;  4MNU A;  5LBQ A;  1S3J A;  4Y13 A;  3MFK A;  2H94 A;  2O6G E;  3HTU A;  1J9I A;  4EM2 A;  3H3Z A;  4LMY A;  2YPR A;  4LLN A;  2VXZ A;  4NQW A;  1DDN A;  1W5S A;  1OYW A;  5HOO A;  1RZ4 A;  2HEO A;  3J81 Z;  2L01 A;  2Z33 A;  1G3T A;  3KP7 A;  1WRJ A;  1HST A;  2OU2 A;  2IRF G;  4PCQ A;  1Z6T A;  1KYZ A;  4KN7 X;  4BHC A;  3T8T A;  5D6F A;  1Y0U A;  1I27 A;  1G3Y A;  2QM3 A;  2QBY B;  1XCV A;  4I98 B;  4KNY A;  2QEN A;  4K2E A;  3LFK A;  4KMF A;  3E5X A;  2ETH A;  4N0B A;  3VOD A;  4NB5 A;  1XSD A;  3HSE A;  5LGT A;  1LEA A;  2PMH A;  3MEX A;  1J75 A;  4CDG A;  3ZP5 A;  1B59 A;  3BJO A;  3FWE A;  4P55 A;  1D8K A;  4M73 A;  1YG2 A;  2PFB A;  3ZMD A;  3BRO A;  2FNP A;  1NHA A;  1LDK B;  1RIO H;  3IRQ A;  2IA1 A;  3ABT A;  3SHF A;  4IHS A;  1O3R A;  2WC2 A;  1KQ9 A;  2XAJ A;  5LGN A;  3S2W A;  3U1D A;  4YFX F;  3DXJ F;  6PAX A;  2DK5 A;  2K86 A;  3SFZ A;  1F9N A;  2UZK A;  4P5O A;  4QLC U;  4HDU A;  2FEZ A;  2MLK A;  2HYG D;  2GIV A;  4MTE A;  2ELH A;  2KJC A;  3IWZ A;  4U0V A;  4HX4 A;  2FBK A;  3D0S A;  4BAY A;  1J7K A;  1FC3 A;  4OMY A;  3IRR A;  4BQA A;  2OQG A;  2EFP A;  5IT9 Z;  3QOP A;  1FYM A;  2PI0 A;  1S8N A;  1YW8 A;  3ULQ B;  2ZXJ A;  1MJB A;  4HF0 A;  1IXS B;  5A2Q K;  3OV8 A;  2Z5U A;  5HDG A;  2ISZ A;  3WU1 B;  2EFQ A;  3J7A O;  4O3M A;  1IN5 A;  5DUK A;  2HQN A;  1OMI A;  3GFJ A;  3TKY A;  2QQA A;  4P96 A;  5HDK A;  4A5M A;  4IVN A;  1FY7 A;  4ZH4 F;  4WK8 F;  4G7Z F;  3JW4 A;  1K79 A;  4XLP F;  2GAU A;  4HYE A;  1G4D A;  1MZB A;  3W6K B;  4A5N A;  3BJA A;  2ACJ A;  4U0W A;  2P6T A;  3F8F A;  3F3X A;  2QLZ A;  1P4X A;  3KCC A;  4I09 A;  1EH6 A;  1PP8 F;  5E20 A;  2L4A A;  3TOB A;  2XKP A;  1TNT A;  4YFN F;  1Z9C A;  2H27 A;  1TQM A;  4D0P A;  3SXY A;  1EH7 A;  4JK1 X;  3E3V A;  2Z9O A;  5JVT A;  1DUX C;  3FM3 A;  1YTY A;  2M87 A;  1R1V A;  5ICF A;  4GCV A;  1SD5 A;  5HLH A;  2O61 A;  4CHU A;  3VOE A;  1XCB A;  1MDM B;  3TO7 A;  2COM A;  4LK0 F;  2D45 A;  2VON A;  4Q48 A;  2Q8K A;  2DPU A;  2OQR A;  1MJ9 A;  2VT2 A;  4EGY A;  2STW A;  1EV7 A;  3J81 K;  3I64 A;  3TO9 A;  2O3F A;  2F5D A;  1S7O A;  5D5X B;  2PEX A;  4F7Z A;  5K1Y A;  2BE5 F;  5ICG A;  4YIF A;  2DW4 A;  1XSX A;  3IL2 A;  2EJR A;  4M71 A;  3E97 A;  3KEO A;  3GZ6 A;  3HUG A;  5J8C A;  4KDP A;  1XGS A;  2XGX A;  2LKP A;  2CWE A;  4KIG A;  4PGH A;  2GXB A;  1RUO A;  5FFX A;  3BY6 A;  4OIR F;  3KZY A;  2RDP A;  3E6C C;  4IPA A;  2ZKZ A;  4RAY A;  1A04 A;  4OOI A;  3CDH A;  2MD5 A;  4OMZ A;  1UB9 A;  2HS5 A;  3F8B A;  2XIG A;  4E70 A;  1H9G A;  1KU3 A;  2E7X A;  3RTR A;  1IN4 A;  3RJP A;  1SMY F;  1O57 A;  2YSR A;  1ZLK A;  1LJ9 A;  3HRM A;  4KIB A;  1D8J A;  1R58 A;  5EEG A;  3P7N A;  3BP8 A;  4KMU X;  1YO5 C;  3GF2 A;  1ONV A;  3O2P E;  1O3T A;  5TRD A;  1KU9 A;  3ZMZ A;  5IT9 K;  3E5U A;  2VN2 A;  4N9I A;  5L3E A;  2M8E A;  3JTH A;  4RB1 A;  2W57 A;  1K7A A;  3HSR A;  3GFI A;  2RC4 A;  3WU0 A;  1SFU A;  3CTA A;  4OIO F;  3ZMT A;  4S05 A;  4LD5 A;  3BPX A;  1BN5 A;  1Z6R A;  2EB7 A;  4HV5 A;  2PQ8 A;  2DO7 A;  4Q47 A;  2XAF A;  4IRI A;  4H0E A;  3DP7 A;  4L5J A;  4GO1 A;  3U2R A;  2DT5 A;  4LK1 F;  1W7P A;  2EV5 A;  2ZJ2 A;  4IF4 A;  3I71 A;  2O03 A;  4L5I A;  1CGP A;  2A6E F;  4ZYE A;  4XLN F;  1WI9 A;  4GYG A;  4B8X A;  3LQQ A;  1FBU A;  4ASN A;  3V7R A;  1K78 B;  1ZAO A;  3DEU A;  3WTW C;  5H6Q A;  2FML A;  4QWQ A;  2MC3 A;  2LDU A;  2UWM A;  1Z7U A;  5TJJ A;  2HWV A;  1FBQ A;  2HGC A;  3R6S A;  1GXQ A;  1O3Q A;  2GA1 A; 
#chains in the Genus database with same CATH topology
 4BU2 A;  3DQV C;  5IP7 J;  5LGU A;  4L5E A;  3SDB A;  1EF4 A;  2PBI A;  4UVC A;  2KZV A;  3L00 A;  4A3G J;  2UXN A;  4A12 A;  5TGT A;  3ZQH A;  4BXF A;  3G4S I;  2L3D A;  2LC2 A;  3CMY A;  1ZKG A;  3CJQ B;  2K27 A;  3ASN H;  4DNC A;  5IYB J;  3P5J A;  3ZGK A;  4ENM A;  3AKZ A;  3B6C A;  4G7H F;  1NH3 A;  2ZSH B;  1VFC A;  1R9T J;  5CVR A;  4UUV A;  1B4A A;  1OKR A;  4BKX A;  2CGP A;  3TDU C;  2DTR A;  2XAG A;  2ID3 A;  3BG9 A;  4PJ0 C;  4EV0 A;  1CF7 B;  2QZ8 A;  3I54 A;  5CVJ A;  1R49 A;  4RLF A;  3Q5F A;  2CV2 A;  2VJJ A;  3J80 Z;  3JRH A;  4D5F A;  2R5Z A;  2DOF A;  1QO0 D;  4PSW A;  4A3L J;  5C3E J;  1DP3 A;  4FHT A;  1UZC A;  4A69 C;  1T98 A;  2EA4 A;  3HTS B;  1MSF C;  3OYF A;  4A0X A;  4CXF A;  1HKT A;  3ERE D;  1SD7 A;  1ZG5 A;  4Y33 A;  1SFX A;  1R4N B;  3KEY A;  2DFF A;  2RNG A;  4OAY A;  2A69 F;  1SMT A;  1IJW C;  1IAW A;  3ZPL A;  5EEH A;  3GO5 A;  3F8N A;  1U5T C;  4HA8 A;  3RSN A;  4BQN A;  3GTJ J;  2LD5 A;  1B8I B;  2P4W A;  3DEE A;  2CQ7 A;  1HW5 A;  4CYC A;  3IAS 2;  3S8P A;  1R6R A;  2BBY A;  2VOO A;  2FRH A;  4ZJZ A;  1T56 A;  1SD6 A;  3FXO A;  3TW7 A;  2D5V A;  5GAD J;  1J5Y A;  5DTD A;  4RBO A;  2IGO A;  4Z6Y A;  4Y3O A;  2HVQ A;  1AU7 A;  1FX7 A;  3VFZ A;  1TQP A;  2JN6 A;  1IV6 A;  1BIA A;  5FFZ A;  3MZH A;  2W82 A;  3CO6 C;  2KPM A;  4IHY A;  2EZK A;  3IHU A;  4FIS A;  3JTG A;  1U3E M;  3NWS A;  2V9V A;  3ISP A;  1PVE A;  1Y39 A;  2XHK A;  2WAF A;  1IN6 A;  5J3L A;  2CUJ A;  1W5C C;  3OYM A;  1JKO C;  4FE4 A;  1A35 A;  1X2M A;  4BY7 J;  2IS1 A;  3FMS A;  2L5Q A;  2E1M B;  3P9C A;  2BHZ A;  5L3B A;  2NS7 A;  3IKT A;  3G2B A;  2X4H A;  5K7F A;  3VSL A;  4EAT A;  1LFU P;  1DPR A;  2XAQ A;  1K78 A;  1X3W B;  1YJN I;  3MN2 A;  3OS0 A;  1VQM I;  1TL8 A;  1MBH A;  2O8X A;  3FMQ A;  2JVG A;  4PDK A;  2FXA A;  3RKW A;  2HTJ A;  3M9A A;  4Q5S F;  3OYC A;  1FJL A;  4PJN A;  5LHH A;  1F43 A;  1JHH A;  3K4K A;  5J8F A;  1R5I D;  2E35 A;  3FKI J;  5BPI A;  5EDN A;  3FZV A;  4QPO A;  2M5W A;  3F22 A;  1RC9 A;  2W1O A;  3TP3 A;  5HLG A;  2QSH X;  2XRO A;  4FE7 A;  3ROU A;  2Z1D A;  3SZT A;  1QZY A;  2KIM A;  1XMX A;  2K9N A;  3K2Z A;  4AID A;  3Q0V A;  2VKE A;  2AQF A;  1Z7L A;  5GAE J;  1IV8 A;  3CUO A;  2YX4 A;  3VB2 A;  2CG4 A;  2NS0 A;  2LRD A;  2NNN A;  3E7L A;  2P7V B;  3QPL A;  3MMY B;  3AL0 C;  5EJC A;  3K7A J;  4EJT A;  4DJA A;  1MNE A;  2R7T A;  2L7F P;  3F8M A;  3RDI A;  1XN7 A;  3Q9V A;  4KJZ A;  1RPW A;  1D0X A;  4HX8 A;  1BI3 A;  2CYY A;  4D5C A;  3V8L A;  5K7H A;  3CCY A;  2HYJ A;  2VKV A;  3LQR A;  3Q0U A;  2VE8 A;  4L9T A;  1HQC A;  2KKO A;  3V8K A;  1YIO A;  1MMN A;  5CJ9 A;  3MWM A;  2JRT A;  4HST A;  3FF5 A;  4HBL A;  2M7A A;  5JFR A;  1U6G A;  2DA7 A;  1UHW A;  2IGM A;  2HFH A;  1ZLJ A;  4UUT A;  5FLX K;  3OYE A;  2V9P A;  4BXX J;  1OCP A;  3Q9S A;  3PQJ A;  2JK3 A;  3NWT A;  4ZYH A;  1BJA A;  2EV6 A;  2KHM A;  3CDL A;  2E5N A;  3AFH A;  1FOW A;  1XD7 A;  4IRG A;  4XOR A;  2HYF A;  3KLN A;  2DPD A;  4HX7 A;  1FBS A;  1TQI A;  1LUJ B;  2C6Y A;  3JRC A;  2K4B A;  2AO9 A;  1ZGJ A;  1NG7 A;  3PSI A;  5E1Z B;  2R93 J;  4Y52 J;  3FM5 A;  3C1D A;  4HV6 A;  2JA6 J;  3DPU A;  1UST A;  3U9G A;  3MD2 A;  5L3D A;  2IJL A;  3DPL C;  4Y7N J;  2PJP A;  1MNM C;  1FSE A;  5CVU A;  4W1U A;  1SD4 A;  1Y1W J;  3AL0 B;  1P92 A;  5CVV A;  5TIS C;  1R4M B;  2YU3 A;  3OWT A;  3RPQ A;  1BC8 C;  1R7J A;  1UG2 A;  1DP7 P;  4RS8 A;  2BVM A;  4AWX B;  4RGU A;  3S15 J;  4M6V A;  2DMN A;  3IWF A;  2Q2E A;  3RIR A;  5ILV A;  2CFX A;  1GV2 A;  2O5R A;  2UUZ A;  3EUA A;  2L7M P;  1V5F A;  5KK1 A;  3G71 I;  2EFO A;  2NYX A;  2P5V A;  4UNO A;  1GVD A;  4JYK A;  2H1L A;  2IGK A;  3AG1 H;  2AQE A;  2AXL A;  1Y6I A;  3IP4 B;  1R71 A;  1U5T A;  4NHJ A;  2G7U A;  3QU6 A;  1X3U A;  1QVT A;  1HDP A;  5AIQ A;  2JT1 A;  5H20 A;  1X4P A;  4RGS A;  3RQI A;  1RKT A;  2FOK A;  4KFC A;  1W5T A;  4DBQ A;  5DCF A;  5F0H A;  1A5J A;  2M0C A;  2QKM B;  3DTK A;  2H6C A;  1ZN2 A;  2P5K A;  4ESB A;  1MMG A;  3J80 K;  4IQ4 A;  1T6S A;  1T38 A;  5E1W A;  2DA6 A;  4M9Z A;  3DKW A;  1B6A A;  4XMY A;  3G73 A;  2VOP A;  3BZ6 A;  4JP0 A;  2WV0 A;  5EG0 B;  3DTE A;  4F93 B;  1EA3 A;  5B66 C;  3MVP A;  3I5U A;  3KP3 A;  5L3C A;  2JA2 A;  2DXI A;  2X85 A;  3HB9 A;  2F5V A;  2BY0 A;  1X19 A;  2P6S A;  4A3J J;  1BI1 A;  3KP4 A;  2VAS A;  3RKY A;  3ELK A;  2DOE A;  1WHU A;  4KN4 X;  1ON2 A;  1ETV A;  2Y9Z A;  4YEL A;  4ITV A;  3I4P A;  4MTD A;  1OPC A;  2CW0 F;  4AVZ A;  3GTK J;  1IRF A;  3EDP A;  2HZD A;  4EJV A;  2NVT J;  2QF7 A;  3BPV A;  3VDX A;  5JHF A;  3JSP A;  1WJE A;  2ISY A;  4G8X A;  1MBE A;  1QA6 A;  3K69 A;  4GFB A;  4RB3 C;  3WE2 A;  2FE3 A;  2W4S A;  2PLY A;  2FD5 A;  4M6X A;  1X1B A;  2AS5 F;  1FSH A;  3WG7 H;  3KE2 A;  2ESH A;  2HVS A;  2F5F A;  3TP0 A;  1OR7 C;  3LNQ A;  1ZGW A;  3GTM J;  2XF6 A;  1L0O C;  4E7H A;  1VQ6 I;  3GW2 A;  3M3Y J;  4XM3 A;  4HPQ A;  2XSD C;  2CSO A;  2M4G A;  1STZ A;  1VF9 A;  3D5R C;  3VYU B;  4CCK A;  4XKV A;  3I59 B;  3CC7 I;  4DOZ A;  1XB4 A;  4QIW N;  4PSX A;  3W2V A;  4UV9 A;  4X1E A;  2DDA A;  2QBY A;  4IHW A;  4XKW A;  2JVH A;  2DQL A;  1R5G A;  4XSX F;  4G12 A;  4LLG F;  4CZZ A;  2O9L A;  1TT0 A;  1RKW A;  3SQN A;  4RDU A;  3BR6 A;  2ZSI B;  2Y30 A;  3CJR B;  2CUZ A;  1FLI A;  1G3S A;  4XR6 A;  1X1C A;  3RKQ A;  3CLQ A;  1AOY A;  2R5Y A;  2E60 A;  3ZN0 A;  2QQ8 A;  1VQP I;  2EQR A;  4F52 A;  3OR1 C;  4U0Y A;  2LY1 A;  3HHH A;  1T8I A;  4BUP A;  4I2O A;  4G94 A;  1T33 A;  2MH2 A;  4E7J A;  4BJ6 C;  3TO6 A;  2W25 A;  2OZ6 A;  5DV5 A;  1YYV A;  2EIJ H;  2LKS A;  2XGE A;  3W6V A;  3ZMV A;  4LOC A;  3FXR A;  2MA3 A;  3ZMS A;  3BG7 A;  3K4C A;  3E5Q A;  3EQL F;  1WFX A;  2DA3 A;  2K9Q A;  3QPH A;  3HDD A;  5FRO A;  1LDD A;  2L9R A;  3A03 A;  2Y0M A;  4LIV A;  4XLF A;  2EZH A;  3LSI A;  3OYL A;  1W0U A;  3LSK A;  5LLQ A;  3GTO J;  5DD4 A;  1U9O A;  3ZRG A;  5LRS A;  3JCU C;  4N9H A;  1FNN A;  4XN3 A;  2K85 A;  3AAF A;  1APL C;  2E2H J;  1WPK A;  1HW2 A;  1RR8 C;  3BOQ A;  2X51 A;  2K3P A;  1O7F A;  4EM1 A;  1Z0X A;  2WAE A;  3A01 B;  1VQ4 I;  1FPQ A;  3QAH A;  1K6Y A;  2QVO A;  2L54 A;  4I0A A;  5M5Y J;  4ESJ A;  2ADU A;  1EJ9 A;  4B3A A;  2HOS A;  4CCL A;  5D5V B;  4L9J A;  4IHX A;  2Y48 A;  2VBX A;  2W48 A;  4CZC A;  1JT6 A;  4KIF A;  2KIU A;  4EM0 B;  2BOL A;  3FIS A;  2VL8 A;  1AWC A;  2B7E A;  4ZZD A;  4RGR A;  2VJ4 A;  2K3F A;  2CW8 A;  2LTP A;  2DA2 A;  2A5W A;  3BZK A;  3WTY C;  2HXO A;  1JJ6 C;  1RUN A;  3EUH C;  4XN0 A;  5HVQ C;  1ZYR F;  2KJB A;  1YQA A;  2LY2 A;  4BE0 A;  3D5L A;  2DLL A;  3PM1 A;  4GYI A;  1YS7 A;  3P9I A;  4FET A;  1GDT A;  1W7P D;  2LSO A;  2XF5 A;  3JR9 A;  3CMM A;  4Y4R A;  2DA5 A;  5K5O A;  2ELJ A;  2J5O A;  3T1B A;  1K61 A;  5GPA A;  2F2E A;  3CCR I;  1RI7 A;  2F5E A;  2X6W A;  3GTQ J;  2G9W A;  1BIB A;  4AVP A;  2ME6 A;  5KAI C;  5JHU A;  3FBN B;  3CC4 I;  4NBQ A;  1F5T A;  4BL0 B;  2JZY A;  3IC7 A;  1S29 A;  2A61 A;  2M45 A;  2IS6 A;  5CPR B;  3H36 A;  3V4G A;  2FBI A;  3GFL A;  4KT5 C;  2FA5 A;  4FX4 A;  4LG0 B;  2OZU A;  3E1S A;  1TT5 B;  5CLS A;  4HNU A;  2RAE A;  3H0D A;  4I01 A;  5FGM A;  2V1U A;  4WF2 A;  2L02 A;  1S5L C;  3KEQ A;  3DBR B;  4Z2Y A;  1LVK A;  4M72 A;  3RI4 A;  5KVR A;  5DD8 A;  1UMQ A;  3F21 A;  2H6B A;  1HF0 A;  3HEF A;  2NOG A;  3B73 A;  2HKO A;  2FSW A;  1U0J A;  3HPH A;  5LHG A;  1FWZ A;  2OTL I;  2L7K A;  2CMP A;  3S1M J;  4RAZ A;  3C2G A;  1AKH A;  1V4R A;  3M1C A;  2VBW A;  1R36 A;  1OR7 A;  5DDG A;  4YRV A;  1W36 C;  3BR2 A;  1QBJ A;  1YIT I;  1C0W A;  3K70 D;  3RPU A;  3HOY J;  3K1P A;  2BYV E;  4HLX A;  4BBR J;  3C7J A;  3HRS A;  2ZNY A;  3LST A;  1QPM A;  2PMU A;  4HEA 2;  1Z91 A;  3KP5 A;  2ZJQ F;  3G1M A;  1MDM A;  1KQ8 A;  2LK2 A;  1POG A;  2VXD A;  5DCM B;  5LRR A;  5HS9 A;  2GZW A;  3K1M A;  2HVR A;  1GVJ A;  1D5V A;  2RRE A;  1E17 A;  5ILS A;  1YE9 A;  5FRN A;  2HOT A;  1J2X A;  3A01 A;  1LVA A;  1YIJ I;  3L2W A;  2CFO A;  5BMZ A;  3Q3S A;  2YU9 J;  5M3F J;  5J6X A;  2XKO A;  1I1G A;  4NC8 A;  2D1H A;  2DDB A;  3CQZ J;  4D7M A;  4YFK F;  3DV8 A;  4AUX A;  4B09 A;  4IEJ A;  2A3S A;  2CJJ A;  1BC7 C;  1ODD A;  3DU6 A;  2M34 A;  3REO A;  4CH7 A;  4HQM A;  5BNG A;  3R61 A;  4ZYA A;  4A6D A;  1J0R A;  2OBP A;  3FXJ A;  3OYK A;  4BNC A;  4M9S A;  3GFM A;  1P2F A;  5KCM A;  4DW6 A;  1GHC A;  2ME0 A;  2MAB A;  4BGD A;  3LSM A;  4M9X A;  3HRT A;  4KA4 A;  2VC0 A;  5HDN A;  2BGC A;  5FLX Z;  2PMZ N;  5DYM A;  4BJT A;  1KU2 A;  1JUP A;  1VI0 A;  5BPD A;  4O5V A;  4HOB A;  3P9K A;  4JX6 A;  3ZQI A;  4RB2 C;  1ZH5 A;  3PUF A;  2FNA A;  1XGO A;  2OJE D;  2VBY A;  4DZP A;  5M5X J;  4EQQ A;  3GEZ A;  1P9Q C;  1OQY A;  1J59 A;  3N97 A;  2D2W A;  1ETK A;  2G0E A;  1A6Q A;  1DU6 A;  1OLT A;  2DFH A;  2GWR A;  3LFU A;  2DAO A;  2BV6 A;  5IT3 A;  1UHM A;  4YEJ A;  2ZO4 A;  3LAP A;  1JT0 A;  2E19 A;  3HOT A;  4EMS A;  1Y8R B;  4HF2 A;  4G6D A;  2EPF A;  3QYB A;  1GUU A;  4WXH A;  2DFI A;  3KYL A;  3GBG A;  3WTZ A;  2P5L C;  3GLX A;  2KP6 A;  4XL9 A;  2JQ7 A;  4NNJ A;  2EIL H;  1OYI A;  3L2C A;  2W00 A;  3EUH A;  3WGG A;  1E3H A;  3M1E A;  3UNG C;  4J19 A;  2RQP A;  2R3S A;  5CYV A;  4G6Q A;  1YW9 A;  3J7Z I;  3CC2 I;  2K9S A;  1P7I A;  4JQF A;  1XG1 A;  4WXC A;  4DYQ A;  4BY1 J;  2FQ3 A;  3H92 A;  2STT A;  1S72 I;  1FIA A;  5E3L A;  2AXT C;  3CJT B;  1OYY A;  4JBA A;  4PUS A;  4A3B J;  2ZME B;  3KYC B;  2DMQ A;  4I6Z A;  1Z3Y A;  4BE1 A;  2P81 A;  3DPT A;  1TW3 A;  3MQ0 A;  2XB5 A;  3FIW A;  2R7W A;  4XOP A;  3EET A;  4MQ9 F;  1MBG A;  1Z3X A;  4II3 A;  2M2E A;  2E1M C;  4CYD A;  2E34 A;  4ENJ A;  3ML6 A;  1IUF A;  2LOO A;  3ZCO A;  2L7Z A;  4E4H A;  5LEJ A;  4DYR A;  1V54 H;  2N8G A;  4V2F A;  4A3C J;  4N4O B;  3T5X A;  1TZL A;  4LIU A;  1VQN I;  3K4J A;  3WGH A;  3ZOB A;  1SVM A;  1TWG J;  2VT3 A;  3PIO F;  2B0L A;  2LRE A;  3LSP A;  3N4M A;  2JUG A;  4IRH A;  2ZJP F;  2ECB A;  1LE8 B;  3PQK A;  1ETX A;  1IXC A;  4ZZL A;  3UKG A;  1TNS A;  1FMW A;  1LQ1 A;  1MMD A;  3C3W A;  4ESF A;  2GXA A;  4EJU A;  2IVM A;  4S04 A;  1Z77 A;  3FBI B;  4NQW B;  3DKX A;  4A3D J;  2XPU A;  4XNF A;  4BYY A;  3BQZ A;  3L09 A;  1E0E A;  1H88 C;  3CLO A;  1SFK A;  3K4N A;  2EIM H;  3C2B A;  4A3E J;  1D3Y A;  3HHG A;  2V1X A;  3RYR A;  4D7N A;  5J1R A;  1LDJ A;  4L9N A;  3B02 A;  1WJA A;  4U88 A;  1RET A;  3CES A;  1UFM A;  3LA3 A;  4CCN A;  4EJO A;  1PUF B;  1X58 A;  2R7D A;  2O0Y A;  2VQC A;  1K6O A;  3CP2 A;  2VOD A;  4F92 B;  2PN6 A;  4OIQ F;  2IXS A;  1EH8 A;  2L9N A;  2DMU A;  2GXG A;  4Y15 A;  4MEX F;  1WCM J;  5EGO B;  3QP5 A;  2IP2 A;  3WTV C;  3QRF F;  4CA0 A;  5FLM J;  2LMD A;  3CZ6 A;  1G3W A;  4M3G A;  3CCL I;  4BEH A;  3A0H C;  5D5U B;  3ZQG A;  1HCR A;  1WWX A;  5E17 F;  1LB2 A;  1MND A;  4HW0 A;  3BT9 A;  1GXP A;  2KL4 A;  1MGT A;  5ICE A;  2PMZ A;  4RA2 A;  2ZNZ A;  1XDS A;  2EFN A;  2KIF A;  3LWF A;  2HOE A;  4KIC A;  3OS1 A;  2DA1 A;  2MYS A;  2XF7 A;  3G6E I;  3OYA A;  1H9T A;  2DK8 A;  5H6R A;  1RR7 A;  2E1N A;  3KP2 A;  1R22 A;  4L9V A;  4BH9 A;  4GXO A;  4NC6 A;  2XPV A;  2DI3 A;  3LOC A;  3HPG A;  4P9F A;  2IPQ X;  1SAN A;  3KFW X;  2IS2 A;  2OF7 A;  3LA7 A;  3LMM A;  3NQO A;  2CW7 A;  2MW8 A;  3GTP J;  5J47 A;  1E3O C;  1ZTR A;  4MHG A;  4CCM A;  1P7J A;  4IO9 F;  4IHT A;  4ZTF A;  1CF7 A;  1WJD A;  2Z3Y A;  4BE2 A;  2HNH A;  2WTE A;  1KA8 A;  2R7O A;  1K4T A;  2XB0 X;  3VPR A;  1ZRC A;  2F6C A;  2VPR A;  5D5W B;  4KUM A;  1D5Y A;  1DQU A;  3L7W A;  3F6V A;  1BBY A;  1ACI A;  4C30 A;  2W24 A;  4GRI A;  4BS9 A;  2DFE A;  1MJA A;  4L0Z B;  4FX0 A;  1BOA A;  2CUF A;  3FX3 A;  3PFI A;  4AM3 A;  5K5R A;  1X4O A;  1HKQ A;  3WTS C;  3F8C A;  4OWR B;  4HAM A;  4ZC3 A;  2A5Y B;  3WE3 A;  2RV8 A;  3V7S A;  4NC7 A;  3M8E A;  2AHQ A;  3OSG A;  3BQY A;  2CQN A;  1OJL A;  1K83 J;  1V3F A;  1B8I A;  1BW5 A;  1RES A;  4UB6 C;  2YX7 A;  2HU9 A;  1WSU A;  1T0F C;  1LPQ A;  1T08 B;  2XV4 S;  4G6T B;  4HQE A;  2FU4 A;  2DQR A;  4UV8 A;  3OSF A;  2LBF B;  5HS8 A;  5JLW A;  3I0T A;  3GVA A;  5HS7 A;  4X6A J;  5IY5 H;  1ZR2 A;  2CQQ A;  2CO5 A;  3QOD A;  3HBL A;  1YJW I;  3U1K A;  1T95 A;  3MZ8 A;  3DBH B;  2IAI A;  2F4I A;  1DGR M;  1V5G A;  2B63 J;  2FF4 A;  2MSY A;  5FO5 A;  1P4W A;  1B72 B;  3LA2 A;  5J4V A;  1IXR C;  3K9T A;  3BJ6 A;  1KZH A;  4DIQ A;  1LNW A;  2JWT A;  1VQ7 I;  2K7L A;  4I02 A;  1ZAR A;  4ABZ A;  1D0Z A;  4A2U A;  1MD0 A;  3DEW A;  5H2F C;  1E2X A;  3OYH A;  2JPB A;  1JKR C;  3H0G J;  3QYE A;  5E3N A;  2TRT A;  2DJN A;  1JTX A;  3I58 A;  3H5A A;  2CU7 A;  3PIP F;  3GLL A;  5IP9 J;  1B9M A;  1YLF A;  1JUM A;  1L3L A;  2BEO A;  2QQ9 A;  3ZQ7 A;  5AON A;  2Z2S B;  4OAZ A;  3W2A A;  1FYL A;  3KET A;  3OIO A;  2ZFW A;  4JX5 A;  2MG4 A;  4BDZ A;  2KDO A;  1VND A;  2W85 A;  1XX5 A;  3BWG A;  4J00 A;  1O7L A;  1F36 A;  4M74 A;  5E18 F;  3JRD A;  3M7G A;  1FTZ A;  3LSJ A;  2QEX I;  3KZZ A;  2LKX A;  4PJL A;  4AIJ A;  3ABM H;  2MBF A;  1XGM A;  2KLO A;  4R1H A;  4BBS J;  1DPU A;  2OAZ A;  4XID A;  1JGS A;  4BXU A;  1ZRE A;  4ZDL A;  2XGC A;  4C3J J;  1ORK A;  1XGN A;  3EPZ A;  2XVC A;  2DJI A;  2QWW A;  2GQQ A;  2XAU A;  3I53 A;  2CQK A;  3PNV A;  2CS3 A;  1LFB A;  2OCC H;  2XDV A;  4OIP F;  1BI2 A;  3RYP A;  2WA0 A;  3KIO A;  2VB6 A;  2QYO A;  4ZTJ A;  5F1R A;  5CQG A;  3LSR A;  2A6H F;  4LB5 A;  2WB1 N;  5F27 A;  4RB0 A;  4RMN A;  4W97 A;  1FIP A;  4XBF A;  4Q4Z F;  1KQ0 A;  2QA4 I;  2RVC A;  4IZZ A;  3W6J B;  1WJF A;  2HQA A;  3EYI A;  1NG6 A;  3H3U A;  3H9G A;  4B4C A;  3VWB A;  3CUQ C;  2M1B A;  2HDC A;  4A6E A;  3FMR A;  3FXU A;  5EZH A;  1ZGA A;  4V2G A;  1S7A A;  3K0L A;  3QP6 A;  2L9S A;  3QQA A;  3SEZ A;  2V4J C;  2WWY A;  5BQT A;  2ZBK A;  1Q1H A;  1FOK A;  1XSV A;  3D5S C;  4V19 K;  2HQR A;  2I5U A;  1JUS A;  2CUE A;  5E79 C;  5JR3 A;  1JGG A;  1T39 A;  3WGI A;  1I39 A;  3BR5 A;  2EV0 A;  1YX5 A;  5M5W J;  2GA2 A;  2IA0 A;  5EYR A;  4G9Y A;  4IJA A;  3HUG B;  2GBY A;  4MQV A;  2LLK A;  4PGG A;  2YR2 A;  3LAJ A;  2G7H A;  1HBX G;  1SVL A;  3OYI A;  2L4M A;  3IAM 2;  5FKM A;  3DBL B;  1KYW A;  2DOD A;  3L2U A;  2V6C A;  3ONQ A;  1TWF J;  4CGZ A;  1U78 A;  3HRU A;  4BHP A;  2BY2 A;  1VQO I;  2Z16 A;  4AIK A;  2EA2 A;  2XPW A;  2V7F A;  5J1Y A;  1EKE A;  3A0B C;  3JSO A;  1I5Z A;  3MKY B;  4LGW A;  3CUQ B;  5K7Z A;  5F04 A;  5IOY A;  4U7D A;  3L1P A;  3C18 A;  2R7Z J;  4ZYG A;  1VQ5 I;  2K9M A;  1E3P A;  5D4S A;  2H8R A;  2M8G X;  1I6X A;  4IKF A;  4UVB A;  2MH9 A;  1U9N A;  1WI3 A;  4X0G A;  3IH4 A;  3V7C A;  1SAX A;  2PJR B;  1T0F A;  4IXA A;  4HNV A;  1BA5 A;  1XPX A;  3IV5 A;  2JA7 J;  1ZRF A;  2VI6 A;  1R1T A;  3V8J A;  1WVR A;  4XLE A;  3DKY A;  3IH2 A;  3G3Z A;  2WV1 A;  3OOP A;  4MGR A;  1QQI A;  1S6L A;  2KDZ A;  2VE9 A;  4XLC A;  3F6O A;  2HPM A;  2KZG A;  3DLA A;  3ZQF A;  5EG0 A;  2K4J A;  3QPS A;  2NVQ J;  5FB2 A;  2CV1 A;  2IS4 A;  4LJZ F;  3WTX C;  3GYH X;  1TC3 C;  1ULY A;  1FEX A;  5HOD A;  2ZJR F;  4FQG A;  5HLI A;  3HOX J;  4RGX A;  3RCO A;  2NOJ B;  4LG3 A;  3N05 A;  3O3K A;  3PUB A;  3B6A A;  1Y0N A;  4AU7 A;  4A3I J;  4ON0 A;  3TQN A;  2VKD A;  2E7W A;  2NVX J;  2EWN A;  3OIP A;  3OYD A;  5LD2 C;  4AC0 A;  3I3L A;  1FP1 D;  3S93 A;  3OYB A;  2JSP A;  2NRA C;  1FTT A;  2BXZ A;  1QRY A;  2BZT A;  2X6O A;  3NRV A;  2E36 A;  4AIH A;  3HOU J;  3HGY A;  4HG2 A;  3S16 J;  3RQ4 A;  3WTT C;  1JXS A;  2X6Y A;  3H5R A;  1RNL A;  5D6E A;  3TGN A;  1PDN C;  1FP2 A;  1N77 A;  4LB6 B;  4Y17 A;  3H1C A;  1LKX A;  4BQO A;  3JRB A;  2RGV A;  3MCZ A;  5ED4 A;  2GIZ A;  1H0M A;  1N75 A;  1T2K A;  3E6B A;  2PX9 A;  9ANT A;  1BR2 A;  1S9H A;  2DMP A;  1KU7 A;  2GM4 A;  3JAM Z;  4A3K J;  2WB1 A;  4JX4 A;  2VIX A;  3R0A A;  4ENK A;  2VC1 A;  1OCZ H;  4LFU A;  3GWZ A;  1UJ8 A;  4OU0 A;  1H89 C;  1A31 A;  3I59 A;  2LH9 A;  3GXO A;  3VEP A;  1YX3 A;  4B43 A;  1IF1 A;  2R7F A;  3RZO J;  3C2H A;  1YS6 A;  1IDY A;  1N25 A;  1HXD A;  3GZ5 A;  1W0T A;  4CUG A;  2FBH A;  4I99 C;  5D4R A;  1YFH A;  1BOB A;  3NEU A;  1OIS A;  1SFE A;  1U2W A;  4HF1 A;  1TW2 A;  1W7P B;  2P0W A;  2P7C B;  2BY3 A;  5F64 A;  3K70 C;  1V5E A;  3S3O A;  2M30 A;  3HSF A;  5FRM A;  3MZY A;  1YHQ I;  2MC4 A;  1VQK I;  3L2Q A;  1QNT A;  3ESW B;  1REP C;  2V9K A;  4FT8 A;  2A6T A;  1YJ9 I;  1TBX A;  3ZMU A;  4YII A;  3RKX A;  3HOS A;  5CQE A;  5B1B H;  3R0J A;  3CUQ A;  2HR3 A;  1ZQ3 P;  3LL7 A;  3R4K A;  5FKL A;  1U8B A;  3CJN A;  2KIS A;  3ZN1 A;  2JRM A;  4U87 A;  5ERI A;  2OUM A;  3TED A;  1B9N A;  1JI8 A;  1FMV A;  5L3F A;  3CDI A;  2RNJ A;  2LY9 A;  3BTC A;  2LNB A;  1JHF A;  2F4O B;  4NDL A;  2M0M A;  1XDU A;  2HKX A;  2EFW A;  2BY1 A;  1X1P A;  1IUY A;  2JPC A;  4ZDP A;  2OA4 A;  4YG2 F;  1KON A;  2M3A A;  3I4N J;  2FX0 A;  2E71 A;  2KQR A;  5LEK A;  2MGQ A;  2K9L A;  3S3M A;  1I6H J;  4UB8 C;  3GX4 X;  3GUD A;  3MKW B;  3FHN A;  1F1Z A;  3T8R A;  2ESN A;  3BG3 A;  4OIN F;  5CVI A;  1IZ1 A;  5IP6 A;  5B3S H;  1R5H A;  1WQ2 A;  1FZP B;  2H09 A;  4C3I J;  3BTL A;  4U7B A;  4D1Q A;  3FXQ A;  1IN8 A;  2R5Z B;  2K40 A;  4M3D A;  1YW7 A;  1BL0 A;  1HSJ A;  2JA5 J;  2IEK A;  3VYT B;  1VTN C;  3PO3 J;  4XSZ F;  2NNY A;  1JE8 A;  4MLO A;  2K02 A;  5L3G A;  2ZXI A;  1I3Q J;  1U8R A;  1W4M A;  3O6B B;  3CCU I;  2XAS A;  4BDY A;  1IW7 F;  2FMY A;  1MH4 A;  2Z99 A;  3CMA I;  3HIF A;  2IT0 A;  3OIQ A;  3RZD J;  4P9U A;  3FHZ A;  1ZEL A;  3MKZ A;  3WG9 A;  3F72 A;  4CCO A;  1MSE C;  1USS A;  1W36 D;  3DF8 A;  3CP8 A;  4E7K A;  3W3C A;  4UXN A;  2I8D A;  5E1X A;  2V26 A;  2A68 F;  1GT0 C;  1TP4 A;  4CYC B;  2COB A;  4ETS A;  2H1K A;  4L18 B;  4RLQ A;  5BOX A;  3EYY A;  2RN7 A;  1PP7 U;  5FKK A;  1ON1 A;  2ZME C;  2DYS H;  2MD0 A;  1KGS A;  1ETY A;  4XQF A;  3OYN A;  1TWA J;  2LF8 A;  3HOZ J;  1P6R A;  1WJC A;  2HQ5 A;  3HGG A;  2WY8 Q;  2DU9 A;  1R1U A;  2J5P A;  2LF7 A;  4MEY F;  3CF2 A;  4WXD A;  5GP9 A;  3BC8 A;  4LG0 A;  1LEB A;  2P8T A;  4EJW A;  1IG7 A;  3HG9 A;  3HL2 A;  3K4M A;  1DGW Y;  2TCT A;  3M07 A;  3S32 A;  1MKM A;  4CIC A;  3LSH A;  5FKO A;  4M3B A;  3WTU C;  2Y9Y A;  3O8G A;  4XRM A;  2GOM A;  1ETQ A;  4HLY A;  2LG4 A;  1IN7 A;  5GPC A;  5E8G A;  4GGG A;  1TTY A;  1R23 A;  3MAJ A;  2BVL A;  4C9Y A;  1JKP C;  2JA8 J;  3DLL F;  1FT9 A;  4L0Y B;  3WHB A;  3VYR B;  1V55 H;  3SZP A;  1MH3 A;  1XMK A;  4UVA A;  3BR1 A;  2X6X A;  1F4K A;  3BTI A;  2ICW G;  4PZJ A;  4WX9 A;  3KYD B;  3KP6 A;  4HRI A;  4DBR A;  1IRG A;  4RAG A;  2PG4 A;  3QPT A;  4AD9 A;  5FD5 A;  3PL8 A;  3KLO A;  2ZCW A;  4UY8 I;  2WAD A;  1TLH B;  2KRF A;  2EK5 A;  1VQ9 I;  4JOM A;  4R8H A;  3VSK A;  2R7R A;  2X0L A;  5ILU A;  2MLG A;  4G7O F;  1QGP A;  3F9K A;  1B1B A;  1BM9 A;  3TOA A;  4XRF A;  1FOY A;  2EZL A;  5DCM A;  3L9F A;  4ENN A;  3JRA A;  2V79 A;  2XC7 A;  1K4S A;  2IW5 A;  3TMO A;  3HZJ A;  3A2K A;  3S1R J;  1O3Q A;  2Q0O A;  3HXL A;  4ANJ A;  1QZZ A;  3COA C;  2JTV A;  1MIJ A;  4QPQ A;  1BI0 A;  5IYC J;  2Y75 A;  4CSW A;  5LHI A;  1AA7 A;  5BS6 A;  2HOA A;  1R00 A;  4EVI A;  1G6N A;  4C2U A;  3R60 A;  4LLL A;  3JAM K;  4YIR X;  4BHB A;  3GTG J;  2EZI A;  4WCG A;  2V1D A;  3K1N A;  1XMA A;  1NTC A;  1ZG3 A;  5E8I A;  5D8K B;  3I56 I;  2DBB A;  3G1O A;  3WU2 C;  1TWC J;  2IA2 A;  3OL4 A;  2XRL A;  5FKN A;  3UR3 C;  1GLN A;  3GZN B;  2CQX A;  3T0Y A;  1FYK A;  2XUB A;  2FQ4 A;  2OD5 A;  1BR4 A;  4A0Y A;  2F4M B;  4HDV A;  1HW1 A;  2ECC A;  4XK4 A;  1ETO A;  4ZYD A;  1ZG1 A;  1Z1D A;  2UXX A;  4II2 A;  2LR8 A;  3DCF A;  1X1A A;  5A2Q Z;  1LFP A;  5K5Q A;  1ETW A;  2XRN A;  2Y0S A;  2JSC A;  3SEQ A;  5DM6 F;  1Y8Q B;  4WWC A;  2A07 F;  2EH3 A;  4KYW A;  1WH5 A;  3E6M A;  1ZHF A;  3M8F A;  3TW6 A;  1OCR H;  5FJ8 J;  1I3A A;  2XAH A;  2W7N A;  1IRZ A;  4S0H B;  3V42 A;  1I1S A;  5DUI A;  4DQ2 A;  3SDG A;  1JKQ C;  3BZC A;  3E6D A;  4UHT A;  1I50 J;  1IC8 A;  3G1L A;  3Q0W A;  1YI2 I;  5AIP A;  2F5C A;  5DEQ A;  2D1V A;  2DYR H;  2GOX B;  2Q2E B;  3ECO A;  4HZF A;  2QUF A;  4I7H A;  3DFG A;  2W84 A;  2R7Q A;  3JRE A;  2E1C A;  2QQB A;  1CQT A;  3GTL J;  2VKH A;  2M9H A;  4XLH A;  3I55 I;  3WOD F;  1S7E A;  1ZRD A;  3FK6 A;  5EZG A;  4A0Z A;  3IKV A;  1D0Y A;  4PK4 A;  4XKC A;  1XS9 A;  3CO7 C;  5C4X J;  1UCR A;  1U5T B;  4O6J A;  5D8L B;  4R79 A;  4A3M J;  3NAU A;  2TDX A;  3K4L A;  4H4K C;  1D1A A;  4I0B A;  4C2M J;  4EGZ A;  5C4J J;  3HOV J;  1O3S A;  3F23 A;  4CO8 A;  1D1B A;  4IOC F;  3ABU A;  3HYI A;  2FUG 2;  1WKM A;  2VJ5 A;  4XRS A;  2ZME A;  1P4A A;  2R4G A;  2HTS A;  2DA4 A;  5F6F A;  2IBD A;  3TDZ C;  3QU3 A;  1JJ8 C;  3BR3 A;  2GLO A;  3TL4 X;  2VBZ A;  4E7S A;  5JI6 A;  1SVO A;  2DCE A;  5F08 A;  3ECH A;  2RKH A;  4B47 A;  3J7Y J;  5FD6 A;  4TV7 A;  2NAZ A;  5ICC A;  1G2H A;  1HKS A;  4M6Y A;  3BDD A;  1OCO H;  1Z05 A;  3ZQQ A;  5HNH A;  1PUE E;  2HZT A;  4MNU A;  5LBQ A;  2LFB A;  2JJ7 A;  2QKL B;  1S3J A;  1Q1V A;  4Y13 A;  3CME I;  3E0J B;  3MFK A;  5F0F A;  2H94 A;  3CCJ I;  2O6G E;  3HTU A;  1J9I A;  3BG5 A;  2V1N A;  3OMY A;  2VPL A;  2Y69 H;  3O8H A;  1LE8 A;  4EM2 A;  3H3Z A;  4LMY A;  2KRH A;  2YPR A;  2I10 A;  4LLN A;  4XOT A;  4XIC A;  3OS2 A;  2VXZ A;  4NQW A;  1UG0 A;  4DZJ A;  1SFO J;  3OL3 A;  1DDN A;  1W5S A;  1OYW A;  5HOO A;  1QHH D;  2VUM J;  3KPH A;  1RZ4 A;  2HEO A;  3J81 Z;  2L01 A;  3ZQC A;  2Z33 A;  1QU3 A;  5IYD J;  1G3T A;  1HDD C;  2EIN H;  1MMS A;  3KP7 A;  4D9J A;  2OTJ I;  1Z67 A;  3CCE I;  4MIM A;  4KT6 A;  1G59 A;  1WRJ A;  2BW3 B;  5J4Y A;  1HST A;  3SJM A;  2OU2 A;  3QYF A;  2IRF G;  3S1N J;  2OV7 A;  1PUF A;  4PCQ A;  1Z6T A;  1KYZ A;  2CV0 A;  2CRG A;  4KN7 X;  4BHC A;  2V6E A;  4BJ5 C;  3T8T A;  5D6F A;  3DWL E;  1Y0U A;  1I27 A;  1G3Y A;  2E1O A;  2QM3 A;  2QBY B;  1XCV A;  5EGO A;  4HSR A;  4I98 B;  4KNY A;  2QEN A;  4K2E A;  3LFK A;  4P1W A;  5KHD A;  4BAC A;  3E5X A;  4KMF A;  3FDY A;  2ETH A;  4N0B A;  3VOD A;  4NB5 A;  1XSD A;  3HSE A;  3D1N I;  5LGT A;  3KZI C;  1LEA A;  2PMH A;  3MEX A;  5FLV A;  1IGN A;  2R5Y B;  2JMW A;  4CDG A;  1J75 A;  3CF5 F;  3ZP5 A;  1B59 A;  3BJO A;  1VQL I;  1UHS A;  3HM5 A;  3I4M J;  3FWE A;  4C2T A;  2L0K A;  4P55 A;  1QHG A;  2M7B A;  1D8K A;  4M73 A;  2FJ1 A;  1YG2 A;  1W1W E;  2PFB A;  3ZMD A;  3BRO A;  2LP0 A;  1X3Z B;  2FNP A;  1NHA A;  2OC6 A;  1LDK B;  1RIO H;  3IRQ A;  2IA1 A;  3ABT A;  3SHF A;  4IHS A;  2X1E A;  1O3R A;  2WY7 Q;  4B48 A;  2WC2 A;  1WJ5 A;  1KQ9 A;  2XAJ A;  1GV5 A;  3SZG A;  5LGN A;  3S2W A;  3U1D A;  4YFX F;  5DM7 F;  4IOA F;  1OFC X;  3DXJ F;  6PAX A;  2DK5 A;  4F3Q A;  3S17 J;  4XRS G;  1VZ0 A;  2K86 A;  2Q1Z B;  1YRN B;  3SFZ A;  1F9N A;  3PO2 J;  2UZK A;  2VQL A;  4P5O A;  4QLC U;  4B1R A;  4HDU A;  2FEZ A;  2LVS A;  2MLK A;  2HYG D;  3A4C A;  2GIV A;  4MTE A;  2BHY A;  3BG6 A;  2ELH A;  4DYC A;  2E5Z A;  2KJC A;  3S14 J;  5E3M A;  2DMT A;  3IWZ A;  1IRX A;  4U0V A;  1VQ8 I;  1Y56 A;  2WBM A;  1AHD P;  1MBK A;  3BCB A;  3X2Q H;  4HX4 A;  5JLX A;  3HOW J;  2FBK A;  4IQJ A;  3D0S A;  4QSH A;  4BAY A;  2RQQ A;  1ITY A;  1J7K A;  5IPA A;  1FC3 A;  4OMY A;  3IRR A;  4M3F A;  1M1E B;  1HLV A;  4BQA A;  2OQG A;  2EFP A;  3BLY A;  4XKB A;  4F55 A;  5IT9 Z;  3QOP A;  4IX7 A;  1FYM A;  2PI0 A;  2HPI A;  4PFO A;  1S8N A;  1YW8 A;  2EIK H;  2ZXJ A;  5J1U A;  3ULQ B;  5JVG F;  1HA8 A;  3M8J A;  1ERD A;  2LBF A;  1MJB A;  3ASO H;  1IXS B;  4HF0 A;  5A2Q K;  4HNT A;  3OV8 A;  3OYG A;  3F0C A;  2FOW A;  2Z5U A;  3VYS B;  5HDG A;  4A3F J;  3WU1 B;  2BW3 A;  2ISZ A;  3K10 A;  2EFQ A;  3J7A O;  4O3M A;  1IN5 A;  4UUS B;  3CD6 I;  2ELK A;  3L2V A;  3MKL A;  3ZQL A;  5DUK A;  1IDZ A;  2HQN A;  1B72 A;  3QWL A;  1OMI A;  2DN0 A;  2KMU A;  3ZR8 X;  4E6K G;  3GFJ A;  3H9J A;  3TKY A;  3OOU A;  3H5N A;  1HC8 A;  2NS8 A;  2QQA A;  3I9V 2;  4P96 A;  3SYT A;  3A02 A;  4A5M A;  5HDK A;  1WGX A;  3FXK A;  1SAU A;  2B9S A;  4EEF G;  2HI3 A;  4IVN A;  5GAH J;  4B44 A;  5HLT A;  1FY7 A;  4E7I A;  4ZH4 F;  4WK8 F;  2BXY A;  4G7Z F;  3JW4 A;  1K79 A;  3CCV I;  4XLP F;  2GAU A;  2YUS A;  3FXL A;  2DTZ A;  4HYE A;  3QOE A;  1G4D A;  1QPI A;  1MZB A;  3W6K B;  2KT0 A;  4A5N A;  3BJA A;  2ACJ A;  4U0W A;  2P6T A;  3F8F A;  3F3X A;  2QLZ A;  4IHV A;  1P4X A;  3KCC A;  3RPU D;  4N4N B;  4I09 A;  1EH6 A;  1PP8 F;  2UV1 A;  2WAQ N;  2L4A A;  2XKP A;  1OCC H;  1TNT A;  5E20 A;  3TOB A;  4YFN F;  1Z9C A;  1TQM A;  2H27 A;  4D0P A;  1X1D A;  2ZFU A;  3PFY A;  3JRG A;  3SXY A;  1EH7 A;  3S1Q J;  4JK1 X;  3E3V A;  3EUK L;  2Z9O A;  2OCE A;  2ID6 A;  2XGD A;  2VJI A;  5JVT A;  1AKH B;  2E2I J;  1MBF A;  1SEU A;  1DUX C;  2X48 A;  4GDF A;  3FM3 A;  1HOM A;  1YTY A;  2M87 A;  1R1V A;  5F0C A;  5ICF A;  4GCV A;  3JRI A;  3W2W A;  1SD5 A;  5HLH A;  2O61 A;  4RM3 A;  4CHU A;  2MFZ A;  2R0Q C;  3PSF A;  1YRN A;  3VOE A;  1WJB A;  1XCB A;  3A1Y A;  5KAF C;  1MDM B;  3TO7 A;  2COM A;  3ABK H;  4LK0 F;  2ZXW H;  2R7V A;  2D45 A;  3SFI A;  2R92 J;  3ZXS A;  2VON A;  4MO7 A;  4NUB A;  4M3E A;  1PYV A;  2DOA A;  3S2D J;  2QCO A;  1UAA A;  4Q48 A;  2Q8K A;  2DPU A;  2E2J J;  2OQR A;  1MJ9 A;  2VT2 A;  4EGY A;  2STW A;  3OYJ A;  3HKZ N;  1EV7 A;  3J81 K;  3GCM A;  3OY9 A;  3I64 A;  1PJR A;  5M3M J;  3OR2 C;  1QVU A;  3TO9 A;  2O3F A;  4BQQ A;  4FCY A;  2R7S A;  2F5D A;  1ENH A;  1S7O A;  3S2H J;  4AYB N;  5D5X B;  2PEX A;  4F7Z A;  5K1Y A;  2BE5 F;  5IOZ A;  4FAS D;  2LYC A;  1D1C A;  4MFE A;  4DGW B;  5ICG A;  2DT7 B;  3WHC A;  4YIF A;  1ZR4 A;  1YOV B;  2DW4 A;  1XSX A;  3IL2 A;  5GTH C;  2EJR A;  5E3O A;  1WZ2 A;  1QZE A;  4M71 A;  1NK2 P;  5F1J A;  2NVY J;  2M4K A;  1JTY A;  3E97 A;  3KEO A;  3TBI A;  3GZ6 A;  2VQG A;  5B5E C;  3FXM A;  4E7L A;  4XLA A;  3HUG A;  3M4O J;  5J8C A;  3PNT A;  1XGS A;  4KDP A;  1DU0 A;  1N78 A;  2Y31 A;  2XGX A;  4UUS A;  1MMA A;  2LKP A;  2CWE A;  4KIG A;  4RAF A;  4A93 J;  2KFD A;  2L9V A;  2HDW A;  3L2R A;  3CCQ I;  2KRC A;  4PGH A;  1RUO A;  2GXB A;  5FFX A;  3BY6 A;  4OIR F;  3GME A;  3KZY A;  2R7X A;  1ZK8 A;  2YS9 A;  4E7Z A;  2RDP A;  2F48 A;  3E6C C;  3BCA A;  4IPA A;  2ZKZ A;  4RAY A;  1A04 A;  4J01 A;  4OOI A;  3LSG A;  4F91 B;  3HC7 A;  3CDH A;  3CCS I;  2L2O A;  2NXN B;  2MD5 A;  3CCM I;  3DTI A;  1UEL B;  4XON A;  4QTR A;  3J7A Y;  1FOX A;  4KIT B;  2VLA A;  3U21 A;  5J40 A;  4OMZ A;  3BR0 A;  3HJE A;  5LFA A;  2PJR A;  1UB9 A;  2H8W A;  2HS5 A;  4B3X A;  3F8B A;  3FK7 A;  2XIG A;  4IL6 C;  4E70 A;  1H9G A;  1KU3 A;  2E7X A;  3RTR A;  3S3N A;  1IN4 A;  3RJP A;  5GTI C;  1X2N A;  3IUO A;  4PJM A;  3K4B A;  1SMY F;  1O57 A;  1G8X A;  2YSR A;  4ZDO A;  1Y1V J;  1ZLK A;  1LJ9 A;  3HRM A;  4KIB A;  4LIT A;  1WH7 A;  3JRF A;  2QSF X;  3KX2 A;  1O4X A;  1D8J A;  1OCT C;  2QSG X;  2JUC A;  3ERM A;  4PFP A;  1H8A C;  1R58 A;  2EBI A;  5EEG A;  3P7N A;  1TWH J;  2WAQ A;  2ZXH A;  3BP8 A;  3K2A A;  4CCJ A;  4KMU X;  1BJZ A;  3GF2 A;  1YO5 C;  2HDD A;  2DT6 A;  4I76 A;  3ABL H;  1ONV A;  3AG3 H;  3O2P E;  1O3T A;  5TRD A;  1KU9 A;  1MW7 A;  3ZMZ A;  1NK3 P;  5IT9 K;  2Y0S N;  3E5U A;  2VN2 A;  5HNF A;  1SC7 A;  4N9I A;  5L3E A;  2X9D A;  5B1A H;  1A36 A;  2M8E A;  3NAR A;  1BW6 A;  3AG2 H;  4KIS A;  3JTH A;  4RB1 A;  1Z21 A;  2W57 A;  1K7A A;  2Y2Z A;  3HSR A;  5EEA A;  3GFI A;  2RC4 A;  3WU0 A;  2R7U A;  1J09 A;  1SFU A;  3H9Q A;  3CTA A;  2CH0 A;  2OPT A;  2XSJ C;  2X1C A;  3ZMT A;  4C3H J;  4LD5 A;  4S05 A;  4OIO F;  3BPX A;  5GAG J;  1BN5 A;  3IH3 A;  3BTJ A;  1Z6R A;  2EB7 A;  4HV5 A;  2QGU A;  2PQ8 A;  5C44 J;  2DO7 A;  4Q47 A;  2XAF A;  4IRI A;  3PJR A;  4H0E A;  2K5C A;  3DP7 A;  4L5J A;  4GO1 A;  3U2R A;  1XC5 A;  2DT5 A;  1IO2 A;  3HKZ A;  1RRJ A;  2ZC2 A;  4MFD A;  3PNY A;  4LK1 F;  1W7P A;  2EV5 A;  2ZJ2 A;  4IF4 A;  3I71 A;  4AYB A;  2O03 A;  2IGN A;  2A05 A;  1MBJ A;  1XTA A;  2VQH A;  4PJJ A;  3K6G A;  4FTH A;  2NVU B;  2O8K A;  4L5I A;  1CGP A;  2A6E F;  4ZYE A;  3DU5 A;  4XLN F;  1WI9 A;  5EF6 A;  4GYG A;  4RM2 A;  4B8X A;  3LQQ A;  1FBU A;  4ASN A;  5CKT A;  4BEH B;  2O7O A;  3V7R A;  1A6I A;  1K78 B;  3H3V K;  1ZAO A;  3DEU A;  3WTW C;  5H6Q A;  2FML A;  2HXI A;  5DS9 A;  3AG4 H;  3H35 A;  2ZB9 A;  2X1D A;  4QWQ A;  3FKJ A;  1BR1 A;  2MC3 A;  2LDU A;  2UWM A;  1Z7U A;  5TJJ A;  2HWV A;  5KNL A;  1FBQ A;  2HGC A;  3R6S A;  1GXQ A;  2KIQ A;  2GA1 A; 
#chains in the Genus database with same CATH homology
 3DQV C;  5LGU A;  2PBI A;  4UVC A;  3L00 A;  2UXN A;  4A12 A;  2L3D A;  2K27 A;  4DNC A;  4ENM A;  4G7H F;  5CVR A;  4UUV A;  1B4A A;  1OKR A;  2CGP A;  3TDU C;  2DTR A;  2XAG A;  4EV0 A;  1CF7 B;  2QZ8 A;  3I54 A;  5CVJ A;  3Q5F A;  3J80 Z;  1QO0 D;  4FHT A;  3HTS B;  1T98 A;  2EA4 A;  4A0X A;  4CXF A;  1HKT A;  3ERE D;  1SD7 A;  1ZG5 A;  1SFX A;  2A69 F;  1SMT A;  1IAW A;  3ZPL A;  5EEH A;  3GO5 A;  3F8N A;  1U5T C;  4HA8 A;  2P4W A;  1HW5 A;  2BBY A;  2VOO A;  2FRH A;  1SD6 A;  1J5Y A;  1FX7 A;  3VFZ A;  1TQP A;  1BIA A;  5FFZ A;  3MZH A;  3CO6 C;  3IHU A;  3JTG A;  1U3E M;  2V9V A;  3ISP A;  2XHK A;  1IN6 A;  3FMS A;  3P9C A;  5L3B A;  3IKT A;  2X4H A;  1DPR A;  2XAQ A;  1K78 A;  2O8X A;  3FMQ A;  4PDK A;  2FXA A;  3RKW A;  2HTJ A;  3M9A A;  4Q5S F;  5LHH A;  1JHH A;  5J8F A;  5BPI A;  3FZV A;  2M5W A;  3F22 A;  5HLG A;  2XRO A;  3ROU A;  3SZT A;  1QZY A;  2KIM A;  3K2Z A;  3CUO A;  2YX4 A;  3VB2 A;  2CG4 A;  2NS0 A;  2NNN A;  2P7V B;  4EJT A;  3F8M A;  3RDI A;  1XN7 A;  3Q9V A;  4HX8 A;  1BI3 A;  2CYY A;  3V8L A;  3LQR A;  2VE8 A;  4L9T A;  1HQC A;  2KKO A;  3V8K A;  1YIO A;  5CJ9 A;  3MWM A;  2JRT A;  3FF5 A;  4HBL A;  5JFR A;  1U6G A;  1UHW A;  2HFH A;  1ZLJ A;  5FLX K;  3Q9S A;  3PQJ A;  4ZYH A;  1BJA A;  2EV6 A;  1XD7 A;  4IRG A;  2HYF A;  3KLN A;  2DPD A;  4HX7 A;  1FBS A;  1TQI A;  2C6Y A;  2K4B A;  1ZGJ A;  5E1Z B;  3FM5 A;  3C1D A;  4HV6 A;  1UST A;  3U9G A;  5L3D A;  2IJL A;  3DPL C;  2PJP A;  1FSE A;  5CVU A;  1SD4 A;  1P92 A;  5CVV A;  2YU3 A;  1BC8 C;  3RPQ A;  1R7J A;  1DP7 P;  4RS8 A;  4AWX B;  4RGU A;  3IWF A;  2Q2E A;  3RIR A;  5ILV A;  2CFX A;  5KK1 A;  2EFO A;  2NYX A;  2P5V A;  4UNO A;  2AXL A;  1U5T A;  4NHJ A;  2G7U A;  3QU6 A;  1X3U A;  5AIQ A;  2JT1 A;  5H20 A;  4RGS A;  2FOK A;  4KFC A;  1W5T A;  5DCF A;  4ESB A;  2H6C A;  1ZN2 A;  2P5K A;  3J80 K;  1T38 A;  1T6S A;  5E1W A;  4M9Z A;  3DKW A;  1B6A A;  3G73 A;  2VOP A;  3BZ6 A;  2WV0 A;  3I5U A;  3KP3 A;  5L3C A;  2P6S A;  1BI1 A;  3KP4 A;  3RKY A;  3ELK A;  4KN4 X;  1ON2 A;  3I4P A;  4MTD A;  1OPC A;  2CW0 F;  1IRF A;  3EDP A;  4EJV A;  3BPV A;  3JSP A;  2ISY A;  4G8X A;  3K69 A;  4RB3 C;  3WE2 A;  2FE3 A;  2PLY A;  4M6X A;  2AS5 F;  1FSH A;  3KE2 A;  2ESH A;  2F5F A;  1L0O C;  3GW2 A;  2CSO A;  1STZ A;  3I59 B;  1XB4 A;  4UV9 A;  2QBY A;  2DQL A;  1R5G A;  4XSX F;  4LLG F;  4CZZ A;  3SQN A;  1FLI A;  1G3S A;  1AOY A;  3ZN0 A;  4U0Y A;  3HHH A;  4I2O A;  4G94 A;  2MH2 A;  3TO6 A;  2W25 A;  2OZ6 A;  5DV5 A;  1YYV A;  3ZMV A;  3FXR A;  2MA3 A;  3ZMS A;  3E5Q A;  3EQL F;  3QPH A;  1LDD A;  2Y0M A;  5LLQ A;  5DD4 A;  5LRS A;  4N9H A;  1FNN A;  3AAF A;  1HW2 A;  3BOQ A;  1O7F A;  4EM1 A;  1FPQ A;  3QAH A;  2QVO A;  2L54 A;  4I0A A;  4ESJ A;  2ADU A;  5D5V B;  4L9J A;  2Y48 A;  2VBX A;  4KIF A;  2KIU A;  4EM0 B;  1AWC A;  4ZZD A;  4RGR A;  3WTY C;  1RUN A;  5HVQ C;  1ZYR F;  2KJB A;  1YQA A;  3D5L A;  2DLL A;  4GYI A;  1YS7 A;  3P9I A;  1W7P D;  2LSO A;  5K5O A;  2J5O A;  3T1B A;  2F2E A;  1RI7 A;  2F5E A;  2G9W A;  1BIB A;  4AVP A;  5JHU A;  1F5T A;  2JZY A;  3IC7 A;  1S29 A;  2A61 A;  2M45 A;  3V4G A;  2FBI A;  3GFL A;  4KT5 C;  2FA5 A;  4FX4 A;  4LG0 B;  2OZU A;  5CLS A;  4I01 A;  5FGM A;  2V1U A;  4WF2 A;  2L02 A;  3KEQ A;  4Z2Y A;  4M72 A;  3RI4 A;  5KVR A;  5DD8 A;  3F21 A;  2H6B A;  3B73 A;  2HKO A;  2FSW A;  5LHG A;  1FWZ A;  4RAZ A;  1V4R A;  2VBW A;  1R36 A;  1OR7 A;  5DDG A;  1QBJ A;  1C0W A;  3RPU A;  3K1P A;  2BYV E;  4HLX A;  3C7J A;  3HRS A;  2ZNY A;  3LST A;  1QPM A;  2PMU A;  1Z91 A;  3KP5 A;  1MDM A;  1KQ8 A;  5DCM B;  5LRR A;  5HS9 A;  2GZW A;  3K1M A;  1GVJ A;  1D5V A;  1E17 A;  5ILS A;  1J2X A;  1LVA A;  5BMZ A;  5J6X A;  2XKO A;  1I1G A;  2D1H A;  4YFK F;  3DV8 A;  4B09 A;  2A3S A;  1BC7 C;  1ODD A;  3REO A;  4HQM A;  3R61 A;  4A6D A;  1J0R A;  2OBP A;  4BNC A;  4M9S A;  3GFM A;  1P2F A;  1GHC A;  4M9X A;  3HRT A;  4KA4 A;  2VC0 A;  5HDN A;  2BGC A;  5FLX Z;  5DYM A;  1KU2 A;  5BPD A;  4O5V A;  4HOB A;  3P9K A;  4RB2 C;  1ZH5 A;  2FNA A;  1XGO A;  2VBY A;  4EQQ A;  3GEZ A;  1J59 A;  3N97 A;  2D2W A;  2GWR A;  2DAO A;  2BV6 A;  5IT3 A;  1UHM A;  2ZO4 A;  3LAP A;  3HOT A;  4EMS A;  4HF2 A;  4G6D A;  4WXH A;  2DFI A;  2P5L C;  3WTZ A;  3GLX A;  1OYI A;  3L2C A;  3EUH A;  3WGG A;  3M1E A;  2RQP A;  2R3S A;  5CYV A;  4G6Q A;  1YW9 A;  4JQF A;  4WXC A;  2FQ3 A;  3H92 A;  2STT A;  4JBA A;  1OYY A;  2ZME B;  3DPT A;  1TW3 A;  3MQ0 A;  3EET A;  4MQ9 F;  4CYD A;  4ENJ A;  3ML6 A;  5LEJ A;  3T5X A;  3WGH A;  2VT3 A;  2B0L A;  3N4M A;  4IRH A;  3PQK A;  1IXC A;  4ZZL A;  1TNS A;  1LQ1 A;  3C3W A;  4ESF A;  4EJU A;  2IVM A;  4S04 A;  4BYY A;  3L09 A;  3CLO A;  1D3Y A;  3HHG A;  2V1X A;  3RYR A;  1LDJ A;  4L9N A;  3B02 A;  4U88 A;  3LA3 A;  1UFM A;  4EJO A;  2R7D A;  2O0Y A;  1K6O A;  2VOD A;  2PN6 A;  4OIQ F;  1EH8 A;  2GXG A;  4Y15 A;  4MEX F;  3WTV C;  3QP5 A;  2IP2 A;  3QRF F;  1G3W A;  5D5U B;  1WWX A;  5E17 F;  1LB2 A;  4HW0 A;  1GXP A;  1MGT A;  5ICE A;  1XDS A;  2EFN A;  2ZNZ A;  2KIF A;  3LWF A;  2HOE A;  4KIC A;  1H9T A;  2DK8 A;  5H6R A;  2E1N A;  3KP2 A;  1R22 A;  4L9V A;  4BH9 A;  4GXO A;  2DI3 A;  4P9F A;  2IPQ X;  3KFW X;  3LA7 A;  3NQO A;  4MHG A;  4IHT A;  1CF7 A;  2Z3Y A;  2WTE A;  1KA8 A;  1ZRC A;  5D5W B;  4KUM A;  3L7W A;  3F6V A;  1BBY A;  2W24 A;  1MJA A;  4L0Z B;  4FX0 A;  1BOA A;  3FX3 A;  3PFI A;  5K5R A;  1HKQ A;  3WTS C;  3F8C A;  4HAM A;  2A5Y B;  3WE3 A;  2RV8 A;  3V7S A;  3M8E A;  1V3F A;  2YX7 A;  1WSU A;  2XV4 S;  4HQE A;  2FU4 A;  2DQR A;  4UV8 A;  5HS8 A;  3I0T A;  3GVA A;  5HS7 A;  2CO5 A;  2FF4 A;  5FO5 A;  1P4W A;  3LA2 A;  1IXR C;  3K9T A;  3BJ6 A;  1LNW A;  2K7L A;  4I02 A;  1ZAR A;  4A2U A;  1MD0 A;  1E2X A;  2JPB A;  3I58 A;  1B9M A;  1YLF A;  1L3L A;  2BEO A;  2QQ9 A;  3ZQ7 A;  5AON A;  1FYL A;  3KET A;  2ZFW A;  2W85 A;  3BWG A;  1O7L A;  4M74 A;  5E18 F;  3M7G A;  3KZZ A;  4AIJ A;  2MBF A;  1XGM A;  4R1H A;  1DPU A;  2OAZ A;  1JGS A;  4BXU A;  1ZRE A;  1XGN A;  2XVC A;  2QWW A;  2GQQ A;  3I53 A;  2CQK A;  4OIP F;  1BI2 A;  3RYP A;  2QYO A;  5F1R A;  4LB5 A;  2A6H F;  4RB0 A;  4XBF A;  4Q4Z F;  1KQ0 A;  2RVC A;  3W6J B;  3EYI A;  3H3U A;  3CUQ C;  2M1B A;  2HDC A;  4A6E A;  3FMR A;  3FXU A;  1ZGA A;  1S7A A;  3K0L A;  3QP6 A;  2WWY A;  5BQT A;  2ZBK A;  1Q1H A;  1FOK A;  1XSV A;  2HQR A;  5JR3 A;  1T39 A;  3WGI A;  2EV0 A;  2GA2 A;  2IA0 A;  4G9Y A;  4IJA A;  4MQV A;  4PGG A;  2YR2 A;  3LAJ A;  2G7H A;  1HBX G;  2L4M A;  1KYW A;  2V6C A;  4CGZ A;  1U78 A;  3HRU A;  4BHP A;  4AIK A;  2EA2 A;  3JSO A;  1I5Z A;  4LGW A;  3CUQ B;  4U7D A;  3C18 A;  4ZYG A;  5D4S A;  1I6X A;  4UVB A;  2MH9 A;  3V7C A;  1SAX A;  1T0F A;  4IXA A;  1ZRF A;  1R1T A;  3V8J A;  3G3Z A;  3OOP A;  4MGR A;  1QQI A;  1S6L A;  2VE9 A;  3F6O A;  2K4J A;  5FB2 A;  4LJZ F;  3WTX C;  3GYH X;  1ULY A;  5HLI A;  4RGX A;  3O3K A;  4ON0 A;  3TQN A;  2E7W A;  2EWN A;  1FP1 D;  2NRA C;  3NRV A;  4AIH A;  3WTT C;  1JXS A;  1RNL A;  5D6E A;  3TGN A;  1PDN C;  1FP2 A;  4LB6 B;  4Y17 A;  2RGV A;  3MCZ A;  5ED4 A;  1H0M A;  1T2K A;  3E6B A;  1KU7 A;  3JAM Z;  3R0A A;  4ENK A;  2VC1 A;  4LFU A;  3GWZ A;  4OU0 A;  3I59 A;  3GXO A;  3VEP A;  1IF1 A;  2R7F A;  1YS6 A;  1HXD A;  3GZ5 A;  2FBH A;  5D4R A;  1YFH A;  3NEU A;  1SFE A;  1U2W A;  4HF1 A;  1TW2 A;  1W7P B;  2P7C B;  5F64 A;  2M30 A;  3HSF A;  3MZY A;  1QNT A;  1REP C;  4FT8 A;  1TBX A;  3ZMU A;  4YII A;  3RKX A;  3HOS A;  3R0J A;  3CUQ A;  2HR3 A;  3R4K A;  3CJN A;  3ZN1 A;  5ERI A;  1B9N A;  5L3F A;  2RNJ A;  2LNB A;  1JHF A;  1XDU A;  2HKX A;  2EFW A;  1IUY A;  2JPC A;  2OA4 A;  4YG2 F;  5LEK A;  3GX4 X;  3GUD A;  1F1Z A;  3T8R A;  2ESN A;  4OIN F;  5CVI A;  1IZ1 A;  1R5H A;  1WQ2 A;  1FZP B;  2H09 A;  4U7B A;  3FXQ A;  1IN8 A;  1YW7 A;  1HSJ A;  1VTN C;  4XSZ F;  2NNY A;  1JE8 A;  2K02 A;  5L3G A;  1U8R A;  1W4M A;  3O6B B;  2XAS A;  1IW7 F;  2FMY A;  2Z99 A;  3HIF A;  2IT0 A;  4P9U A;  3FHZ A;  3WG9 A;  3F72 A;  1USS A;  3DF8 A;  4UXN A;  5E1X A;  2A68 F;  4ETS A;  4L18 B;  5BOX A;  3EYY A;  2RN7 A;  1PP7 U;  1ON1 A;  1KGS A;  2LF8 A;  1P6R A;  2DU9 A;  1R1U A;  2J5P A;  2LF7 A;  4MEY F;  4WXD A;  4LG0 A;  1LEB A;  2P8T A;  4EJW A;  1MKM A;  4CIC A;  3WTU C;  4HLY A;  1IN7 A;  5E8G A;  4GGG A;  1TTY A;  1R23 A;  3MAJ A;  1FT9 A;  4L0Y B;  3SZP A;  1XMK A;  4UVA A;  1F4K A;  4PZJ A;  4WX9 A;  3KP6 A;  1IRG A;  2PG4 A;  3QPT A;  4AD9 A;  5FD5 A;  3KLO A;  2ZCW A;  1TLH B;  2KRF A;  2EK5 A;  4R8H A;  2X0L A;  5ILU A;  2MLG A;  4G7O F;  1QGP A;  1B1B A;  1BM9 A;  3TOA A;  4XRF A;  5DCM A;  3L9F A;  4ENN A;  2V79 A;  2IW5 A;  2Q0O A;  1QZZ A;  3COA C;  2JTV A;  1BI0 A;  2Y75 A;  5LHI A;  5BS6 A;  1R00 A;  4EVI A;  1G6N A;  3R60 A;  4LLL A;  3JAM K;  4BHB A;  4WCG A;  2V1D A;  3K1N A;  1XMA A;  1ZG3 A;  5E8I A;  5D8K B;  2DBB A;  2IA2 A;  3T0Y A;  1FYK A;  2XUB A;  2OD5 A;  4A0Y A;  4HDV A;  1HW1 A;  4ZYD A;  1ZG1 A;  1Z1D A;  2UXX A;  5A2Q Z;  5K5Q A;  2XRN A;  2JSC A;  4WWC A;  2A07 F;  4KYW A;  3E6M A;  1ZHF A;  3M8F A;  2XAH A;  1I1S A;  5DUI A;  4DQ2 A;  3E6D A;  4UHT A;  5AIP A;  2F5C A;  5DEQ A;  2D1V A;  3ECO A;  4HZF A;  2QUF A;  4I7H A;  3DFG A;  2W84 A;  2E1C A;  2QQB A;  3WOD F;  1ZRD A;  4A0Z A;  3IKV A;  3CO7 C;  1UCR A;  1U5T B;  4O6J A;  5D8L B;  4R79 A;  2TDX A;  4I0B A;  4EGZ A;  1O3S A;  3F23 A;  4CO8 A;  3ABU A;  3HYI A;  1WKM A;  2ZME A;  1P4A A;  2HTS A;  5F6F A;  3TDZ C;  3QU3 A;  2VBZ A;  5JI6 A;  3ECH A;  2RKH A;  5FD6 A;  4TV7 A;  5ICC A;  2NAZ A;  1HKS A;  4M6Y A;  3BDD A;  1Z05 A;  1PUE E;  2HZT A;  4MNU A;  5LBQ A;  1S3J A;  4Y13 A;  3MFK A;  2H94 A;  2O6G E;  3HTU A;  1J9I A;  4EM2 A;  3H3Z A;  4LMY A;  2YPR A;  4LLN A;  2VXZ A;  4NQW A;  1DDN A;  1W5S A;  1OYW A;  5HOO A;  1RZ4 A;  2HEO A;  3J81 Z;  2L01 A;  2Z33 A;  1G3T A;  3KP7 A;  1WRJ A;  1HST A;  2OU2 A;  2IRF G;  4PCQ A;  1Z6T A;  1KYZ A;  4KN7 X;  4BHC A;  3T8T A;  5D6F A;  1Y0U A;  1I27 A;  1G3Y A;  2QM3 A;  2QBY B;  1XCV A;  4I98 B;  4KNY A;  2QEN A;  4K2E A;  3LFK A;  4KMF A;  3E5X A;  2ETH A;  4N0B A;  3VOD A;  4NB5 A;  1XSD A;  3HSE A;  5LGT A;  1LEA A;  2PMH A;  3MEX A;  1J75 A;  4CDG A;  3ZP5 A;  1B59 A;  3BJO A;  3FWE A;  4P55 A;  1D8K A;  4M73 A;  1YG2 A;  2PFB A;  3ZMD A;  3BRO A;  2FNP A;  1NHA A;  1LDK B;  1RIO H;  3IRQ A;  2IA1 A;  3ABT A;  3SHF A;  4IHS A;  1O3R A;  2WC2 A;  1KQ9 A;  2XAJ A;  5LGN A;  3S2W A;  3U1D A;  4YFX F;  3DXJ F;  6PAX A;  2DK5 A;  2K86 A;  3SFZ A;  1F9N A;  2UZK A;  4P5O A;  4QLC U;  4HDU A;  2FEZ A;  2MLK A;  2HYG D;  2GIV A;  4MTE A;  2ELH A;  2KJC A;  3IWZ A;  4U0V A;  4HX4 A;  2FBK A;  3D0S A;  4BAY A;  1J7K A;  1FC3 A;  4OMY A;  3IRR A;  4BQA A;  2OQG A;  2EFP A;  5IT9 Z;  3QOP A;  1FYM A;  2PI0 A;  1S8N A;  1YW8 A;  3ULQ B;  2ZXJ A;  1MJB A;  4HF0 A;  1IXS B;  5A2Q K;  3OV8 A;  2Z5U A;  5HDG A;  2ISZ A;  3WU1 B;  2EFQ A;  3J7A O;  4O3M A;  1IN5 A;  5DUK A;  2HQN A;  1OMI A;  3GFJ A;  3TKY A;  2QQA A;  4P96 A;  5HDK A;  4A5M A;  4IVN A;  1FY7 A;  4ZH4 F;  4WK8 F;  4G7Z F;  3JW4 A;  1K79 A;  4XLP F;  2GAU A;  4HYE A;  1G4D A;  1MZB A;  3W6K B;  4A5N A;  3BJA A;  2ACJ A;  4U0W A;  2P6T A;  3F8F A;  3F3X A;  2QLZ A;  1P4X A;  3KCC A;  4I09 A;  1EH6 A;  1PP8 F;  5E20 A;  2L4A A;  3TOB A;  2XKP A;  1TNT A;  4YFN F;  1Z9C A;  2H27 A;  1TQM A;  4D0P A;  3SXY A;  1EH7 A;  4JK1 X;  3E3V A;  2Z9O A;  5JVT A;  1DUX C;  3FM3 A;  1YTY A;  2M87 A;  1R1V A;  5ICF A;  4GCV A;  1SD5 A;  5HLH A;  2O61 A;  4CHU A;  3VOE A;  1XCB A;  1MDM B;  3TO7 A;  2COM A;  4LK0 F;  2D45 A;  2VON A;  4Q48 A;  2Q8K A;  2DPU A;  2OQR A;  1MJ9 A;  2VT2 A;  4EGY A;  2STW A;  1EV7 A;  3J81 K;  3I64 A;  3TO9 A;  2O3F A;  2F5D A;  1S7O A;  5D5X B;  2PEX A;  4F7Z A;  5K1Y A;  2BE5 F;  5ICG A;  4YIF A;  2DW4 A;  1XSX A;  3IL2 A;  2EJR A;  4M71 A;  3E97 A;  3KEO A;  3GZ6 A;  3HUG A;  5J8C A;  4KDP A;  1XGS A;  2XGX A;  2LKP A;  2CWE A;  4KIG A;  4PGH A;  2GXB A;  1RUO A;  5FFX A;  3BY6 A;  4OIR F;  3KZY A;  2RDP A;  3E6C C;  4IPA A;  2ZKZ A;  4RAY A;  1A04 A;  4OOI A;  3CDH A;  2MD5 A;  4OMZ A;  1UB9 A;  2HS5 A;  3F8B A;  2XIG A;  4E70 A;  1H9G A;  1KU3 A;  2E7X A;  3RTR A;  1IN4 A;  3RJP A;  1SMY F;  1O57 A;  2YSR A;  1ZLK A;  1LJ9 A;  3HRM A;  4KIB A;  1D8J A;  1R58 A;  5EEG A;  3P7N A;  3BP8 A;  4KMU X;  1YO5 C;  3GF2 A;  1ONV A;  3O2P E;  1O3T A;  5TRD A;  1KU9 A;  3ZMZ A;  5IT9 K;  3E5U A;  2VN2 A;  4N9I A;  5L3E A;  2M8E A;  3JTH A;  4RB1 A;  2W57 A;  1K7A A;  3HSR A;  3GFI A;  2RC4 A;  3WU0 A;  1SFU A;  3CTA A;  4OIO F;  3ZMT A;  4S05 A;  4LD5 A;  3BPX A;  1BN5 A;  1Z6R A;  2EB7 A;  4HV5 A;  2PQ8 A;  2DO7 A;  4Q47 A;  2XAF A;  4IRI A;  4H0E A;  3DP7 A;  4L5J A;  4GO1 A;  3U2R A;  2DT5 A;  4LK1 F;  1W7P A;  2EV5 A;  2ZJ2 A;  4IF4 A;  3I71 A;  2O03 A;  4L5I A;  1CGP A;  2A6E F;  4ZYE A;  4XLN F;  1WI9 A;  4GYG A;  4B8X A;  3LQQ A;  1FBU A;  4ASN A;  3V7R A;  1K78 B;  1ZAO A;  3DEU A;  3WTW C;  5H6Q A;  2FML A;  4QWQ A;  2MC3 A;  2LDU A;  2UWM A;  1Z7U A;  5TJJ A;  2HWV A;  1FBQ A;  2HGC A;  3R6S A;  1GXQ A;  1O3Q A;  2GA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...