4EGYA

Crystal structure of arar(dbd) in complex with operator ora1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
81
structure length
81
Chain Sequence
LEVLFQGPLGSEFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLLYSVQGGGTFVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Spacing between core recognition motifs determines relative orientation of AraR monomers on bipartite operators.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
molecule keywords Arabinose metabolism transcriptional repressor
total genus 24
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4egyA00
4GCVA 4OOIA 2UZKA 1J2XA 2CWEA 4M6YA 3DPTA 4ENJA 3HRUA 1RUOA 2A68F 4Z2YA 4P55A 2F5EA 3MWMA 2VT3A 2B0LA 2HFHA 2PMUA 2TDXA 3HRTA 1HKTA 1IW7F 2EV0A 2JT1A 2JZYA 3HIFA 2HTJA 1BOAA 1JGSA 1R00A 3LA3A 4M6XA 2A5YB 3E6MA 2F5DA 2QBYB 3V8JA 3V8KA 1D5VA 1UCRA 2FBHA 1BC8C 4I01A 1G3YA 2XVCA 4MQVA 2A6EF 3F21A 5BPDA 3I59B 1H9TA 1R1TA 2CO5A 5D8LB 2CSOA 3R61A 1HSJA 2OU2A 3F8BA 1TNSA 2Q0OA 5DV5A 3TDUC 3V4GA 2YX4A 2BYVE 1R7JA 1K7AA 1I1GA 1LEAA 5DCMB 3M7GA 4D0PA 3I71A 1PP7U 3HRMA 1YS7A 5DEQA 2R3SA 2IVMA 1TBXA 4AD9A 1BI3A 2QBYA 1OR7A 1BJAA 5ICCA 3QOPA 4CO8A 4KA4A 1FBSA 1Z91A 3W6KB 3M8EA 4MTDA 2C6YA 1ZRDA 1V4RA 2FBKA 4L9TA 2HZTA 2R7DA 2OZUA 1W7PA 4ZYEA 4M71A 3JTGA 2ZNYA 3BP8A 5TJJA 3WGIA 1L3LA 2GWRA 3HOTA 4M73A 3SZTA 3FMQA 1XMKA 4MEYF 2K86A 2Z33A 1PUEE 4CGZA 1SD5A 5E1XA 2KIFA 5LLQA 3FWEA 3K9TA 4EM1A 1ZARA 1P4WA 1MJ9A 5DD8A 2Q2EA 3T0YA 4UHTA 1BN5A 3CTAA 3MZYA 3P7NA 2L4AA 4RB1A 4H0EA 2CQKA 3LQRA 2DQRA 1SMYF 4YFXF 1B9MA 1IN5A 2NYXA 1KU3A 5K5QA 3AAFA 3TOBA 3BJAA 3KZZA 1SFEA 3RDIA 4KFCA 1G3TA 4L18B 1O3RA 2QZ8A 3G3ZA 2BBYA 2IT0A 1OPCA 2J5OA 4FT8A 4KNYA 1IUYA 1IXCA 2AXLA 2GXGA 2XROA 3BY6A 2ZNZA 3M8FA 1DDNA 3EUHA 2XHKA 4QLCU 1XMAA 4IRHA 4HLXA 5A2QZ 5E18F 5LEJA 4MHGA 5J6XA 4Y17A 1ZHFA 1FYMA 1IRGA 2PEXA 2A07F 2QQAA 3ULQB 1V3FA 3ABUA 1R22A 1ZLKA 5H6QA 1ZLJA 3HSFA 3CUQB 4L9JA 5DUIA 3ZN0A 1XGMA 1ZH5A 5E8IA 1SD6A 3QP6A 3W6JB 2MD5A 1RUNA 5CVVA 3KP5A 5H20A 2GA1A 3DP7A 3KP7A 4MTEA 1T2KA 3GXOA 2JRTA 1FSHA 1MDMB 2G9WA 2XV4S 1LQ1A 2FA5A 2DQLA 4M9XA 4LJZF 3R0JA 2JTVA 3KZYA 4UVCA 5FGMA 4HV6A 4UNOA 4K2EA 1DPRA 3E6CC 5D8KB 5J8FA 2FQ3A 4PDKA 4OIPF 3WU0A 4TV7A 1H0MA 3R0AA 1QO0D 3GF2A 3KEQA 3F3XA 5L3CA 3K1PA 5F1RA 2OAZA 1XGNA 4OU0A 1AWCA 2RC4A 2ZBKA 3I5UA 1ZYRF 3CO7C 4PGGA 3NEUA 4HQMA 2XGXA 3V7CA 5DCFA 1O3QA 3I53A 1BC7C 4GO1A 5JFRA 5A2QK 3GUDA 3L2CA 1DPUA 2K7LA 3T8TA 4BHPA 4KIFA 4A5MA 3WTTC 3KE2A 2XAJA 4WCGA 4I02A 4EJTA 2FOKA 2L01A 2Z99A 3HRSA 5HS9A 3E5XA 1XGSA 1O7LA 4G9YA 4UXNA 4HOBA 2VODA 3VEPA 1MGTA 5IT9Z 4M9SA 3GVAA 3MAJA 4MQ9F 3S2WA 4UVAA 2QM3A 5E1WA 3P9CA 5CVUA 2DK5A 4IJAA 4P96A 1MJAA 1SAXA 5ICEA 3DXJF 5K5OA 2V9VA 2PBIA 1MJBA 5BQTA 2PLYA 2FRHA 3E5QA 1OYWA 2R7FA 2HYFA 4LLLA 3I0TA 4Y13A 1I27A 3M9AA 2GQQA 1RNLA 4BH9A 5E20A 1HXDA 2ZMEA 3TOAA 4HW0A 4Y15A 4Q47A 3I58A 2FXAA 4G7OF 4OIOF 1J59A 1R5GA 5LHHA 1B59A 3PQKA 1KYZA 2LNBA 4HYEA 4CXFA 4YG2F 2H27A 3MQ0A 2LF8A 2COMA 2PG4A 1E17A 3GYHX 1QZYA 2ZCWA 3ERED 1SD7A 4EMSA 2XKOA 4R8HA 1FBUA 4G6QA 3F6VA 1Z6RA 3RTRA 3J81K 2IA1A 1TNTA 1LDDA 3WGHA 1ZGJA 1Z7UA 1HW2A 4OMZA 2V1XA 5HDNA 1QQIA 3E6BA 2PN6A 2W84A 3EDPA 2UXXA 3IRRA 4RGRA 2HOEA 3P9IA 5D6EA 3FZVA 2NNYA 3OV8A 2P5LC 2PJPA 5L3BA 4O5VA 4I0AA 2RKHA 3RYRA 2HTSA 4ENKA 3P9KA 2O8XA 1SMTA 2M87A 3K69A 2EFOA 4M74A 4ENNA 2IA0A 3LWFA 5LGTA 3KCCA 2HDCA 1D8JA 2CGPA 4ZYGA 1STZA 3CUOA 5LRRA 2Y75A 2KIUA 2P6SA 1BI2A 3GW2A 2DBBA 3K1MA 3FX3A 2QLZA 1OMIA 1IN6A 2FE3A 5HOOA 4P9UA 4IRGA 3FXUA 1JHHA 1T0FA 3NRVA 4CYDA 2W25A 2ESHA 4JBAA 1XDUA 5CYVA 1FOKA 2XKPA 2HQNA 5ILSA 1TTYA 3EETA 5D4RA 1ON2A 3R60A 5EEGA 4BXUA 1JXSA 1IXSB 1R58A 3EQLF 2STWA 2IRFG 2IA2A 4FX0A 2VBYA 3F8FA 4RB2C 5D6FA 3WTYC 1YTYA 1LDJA 5E8GA 1U78A 4L5IA 3GZ6A 4KN7X 4EM0B 1U8RA 4M9ZA 3FMSA 1FX7A 2VBZA 1K78B 3BOQA 3ISPA 2EV6A 4NHJA 1HSTA 4I7HA 4EJWA 2O6GE 3BDDA 1XN7A 3DKWA 3MCZA 4LLGF 4GYIA 3MFKA 2LSOA 1REPC 1YYVA 4BNCA 1P4XA 3ELKA 6PAXA 1U5TA 3LSTA 3O3KA 2KJBA 2D1VA 4LB5A 1U2WA 5EEHA 4IXAA 4LK1F 1KA8A 1K6OA 3RKWA 3TGNA 1FP1D 5LRSA 3KLNA 3R6SA 3CUQC 4I09A 1ZG5A 1S29A 4IVNA 2XAGA 3KP2A 2XAHA 2ZO4A 2MLGA 5K5RA 3QRFF 4L9VA 2D1HA 5CVRA 5DD4A 3B73A 3HTUA 1YQAA 4LB6B 3KFWX 3V7SA 1W4MA 4YFNF 5FD5A 5FLXZ 1WRJA 1BIBA 2EA2A 4LG0A 4RS8A 1ZREA 3F8MA 4MGRA 2OZ6A 1F1ZA 4KT5C 2V1UA 4HF2A 1RIOH 3CDHA 5H6RA 5DYMA 4G8XA 3C18A 1A04A 2W85A 3TO9A 2M5WA 4HQEA 3HHGA 5LGNA 3IRQA 3F72A 4F7ZA 1TW2A 4KIGA 2UXNA 1J5YA 3BJOA 3T8RA 1EH8A 4G7HF 5JVTA 1MKMA 1WSUA 4MNUA 5FB2A 2FF4A 4B09A 4KMUX 4NB5A 3RKXA 4DQ2A 3M1EA 3HYIA 2VE8A 3TDZC 1T98A 3BROA 2V6CA 4CHUA 1USSA 1H9GA 1GVJA 5L3DA 1LJ9A 1ONVA 3FF5A 1W7PB 4ESBA 3I4PA 2RN7A 3IC7A 1IF1A 4MEXF 2EFPA 3VOEA 1EV7A 1QBJA 4OMYA 2HKXA 3I59A 4IHTA 2M30A 2FSWA 4RB0A 2F5FA 2VOOA 1O57A 2XASA 1I1SA 2F5CA 5FLXK 4HBLA 1R5HA 5HS8A 2VBXA 4A6EA 4IPAA 1SFUA 4AVPA 4HAMA 1XSXA 4RB3C 2Y0MA 2LF7A 3C7JA 3H3ZA 3IL2A 4HX8A 5FO5A 1R23A 3BJ6A 3ML6A 3LA2A 4XSZF 4N9HA 4XRFA 3E5UA 3DPLC 2A61A 4ZZDA 3U9GA 3GZ5A 3N4MA 3MEXA 4HF0A 1LEBA 1F5TA 4XBFA 2BGCA 2GXBA 1T6SA 2QQBA 2UWMA 4EQQA 2L54A 1GXPA 1QNTA 1XD7A 3ROUA 2MC3A 5JR3A 4U7BA 2P4WA 1U3EM 4S05A 5LBQA 5D4SA 1FSEA 2F2EA 4FX4A 2DPDA 1R1VA 2X4HA 4AWXB 2MLKA 1VTNC 2ACJA 3QU3A 3B02A 3RPQA 5J8CA 1OYIA 5HS7A 3CLOA 2P6TA 2ISYA 3COAC 3IWFA 5E1ZB 2EK5A 4A2UA 3ZMDA 4AIHA 1B1BA 3SZPA 2LKPA 4YIIA 2K4JA 2V1DA 1KQ8A 1P4AA 3F8NA 2ZKZA 4BHBA 2VC0A 1K79A 3VFZA 4E70A 3HTSB 4I0BA 3FM3A 2XRNA 2VC1A 1ON1A 1U5TB 1J0RA 4U0YA 4O3MA 2DW4A 4RGXA 3E3VA 2JPBA 2CW0F 2O61A 4IHSA 1W5TA 3DQVC 3JAMK 1FLIA 1D8KA 1TQIA 1HBXG 1QZZA 2RDPA 2JSCA 2J5PA 2P8TA 1MDMA 4GGGA 1KGSA 3VB2A 3FHZA 1B6AA 2L3DA 3E6DA 4IRIA 4A12A 3LQQA 1ODDA 3BPXA 3ZMZA 5BS6A 2EB7A 4Q48A 3J7AO 5D5UB 3I64A 5ILUA 2DT5A 1Z9CA 1ZGAA 4A6DA 2HQRA 4AIJA 1AOYA 4EGZA 2ELHA 2K02A 4ENMA 1WWXA 3WTSC 2EJRA 1KQ9A 2VXZA 1SD4A 2IP2A 4KMFA 2JPCA 2K27A 2BV6A 1P2FA 1UHMA 4WXCA 4S04A 1UFMA 3BZ6A 1YLFA 4AIKA 5TRDA 4BQAA 2XUBA 2XAQA 2Z5UA 2KKOA 4OIQF 1ULYA 3KEOA 4L5JA 4ASNA 3J80Z 1XSVA 2K4BA 4KIBA 4PCQA 5FD6A 4EJVA 2X0LA 4EM2A 3TO6A 3DV8A 1P92A 3GFLA 2WWYA 1FT9A 2WC2A 3KLOA 3JAMZ 1XSDA 5E17F 1F4KA 1YW8A 4QWQA 2CFXA 1RZ4A 4WXHA 1TLHB 1SFXA 2O03A 5DUKA 3BPVA 1RI7A 2PQ8A 2HGCA 2XIGA 1Y0UA 3K0LA 4BYYA 1Q1HA 1W7PD 1T38A 2E1CA 4A0YA 1LVAA 3GWZA 3GLXA 4GYGA 3SFZA 1CF7A 1BIAA 3EYYA 2OQRA 2RQPA 3F8CA 3GX4X 2ESNA 1TW3A 2QWWA 4ESJA 4ZYHA 1S6LA 3FXRA 3V7RA 2HR3A 5HDKA 2M45A 5DDGA 1Z05A 1ZG3A 2O3FA 2PMHA 3DFGA 1KU7A 3ZMTA 3F22A 3QP5A 4JK1X 2RNJA 2FBIA 3FMRA 2DI3A 2L02A 3FM5A 4LG0B 3KP4A 3JW4A 1O3TA 1IN8A 2W24A 1LDKB 4ON0A 1XB4A 3RPUA 4LK0F 1XDSA 1Z6TA 3RJPA 2A69F 2MBFA 1DUXC 1OYYA 5AIPA 1XCVA 4UV9A 3JSOA 4XLPF 3QPTA 5L3GA 4CDGA 2GAUA 3ECHA 3HSRA 4G7ZF 3CJNA 4N0BA 1YG2A 1T39A 2YPRA 1FZPB 4KN4X 2EWNA 4RGUA 1I6XA 2ADUA 3L00A 3LA7A 5D5WB 5FFXA 3SXYA 1CF7B 3WE3A 2ZJ2A 3ABTA 1YO5C 3MZHA 2GZWA 4EJOA 2MA3A 1J7KA 1FYLA 4R1HA 1JE8A 3KP3A 3ZMSA 3WU1B 3RIRA 3ZPLA 3WGGA 2V79A 4O6JA 3WTXC 3JTHA 1BI0A 3ZQ7A 1W5SA 5D5XB 2MH9A 4WXDA 3IWZA 3H92A 2QUFA 1HKSA 5FFZA 3J80K 3FXQA 1X3UA 5LHGA 1FWZA 5HLIA 4A0XA 4PZJA 3QPHA 4FHTA 2DFIA 4ETSA 1KYWA 3K2ZA 5HVQC 4ZYDA 2A3SA 2FNAA 2NNNA 1FBQA 4NQWA 2RV8A 4JQFA 4KYWA 4ESFA 1U5TC 1R36A 5BMZA 2FNPA 4U88A 2HS5A 3L7WA 4CICA 4N9IA 3LAPA 5LEKA 5JHUA 2GIVA 3HSEA 2E7XA 3WTWC 4UUVA 3LFKA 2NRAC 1KU2A 1UHWA 4B8XA 1IZ1A 2WTEA 4CZZA 1C0WA 4P5OA 2DU9A 5F6FA 1IN4A 2A6HF 4EJUA 4G94A 4HF1A 4YIFA 1O3SA 4L9NA 1S7AA 1LB2A 2ISZA 2HEOA 5LGUA 1S8NA 1L0OC 1FNNA 3C3WA 2AS5F 3ZMUA 5DCMA 3L09A 1ZRCA 3HUGA 2QYOA 1EH7A 2MH2A 4LD5A 3G73A 2OA4A 2DLLA 4Q4ZF 2PFBA 1HKQA 5CVJA 1J75A 3J81Z 1D3YA 3TQNA 4BHCA 3H3UA 3KP6A 2YSRA 1J9IA 3OOPA 2EV5A 1YS6A 1WQ2A 2BEOA 4KDPA 3SQNA 2D2WA 2VBWA 4I2OA 2KRFA 4UV8A 4EGYA 1TQMA 5AONA 4XSXF 2BE5F 2Y48A 3Q9SA 2OBPA 1HQCA 3U2RA 1O7FA 3IKVA 1YW9A 2OQGA 2P7VB 3QAHA 4DNCA 1PDNC 2VE9A 5JI6A 5K1YA 1F9NA 2ZFWA 3E97A 4ZH4F 4LFUA 4U0VA 5ICFA 1S7OA 4G6DA 1FC3A 3GFMA 4PGHA 2H09A 1QGPA 2KJCA 3WE2A 4GXOA 2P5VA 2YX7A 3HHHA 5L3EA 5HDGA 5IT3A 2YR2A 4U7DA 2PI0A 3REOA 3HOSA 1BBYA 2HKOA 3QU6A 2IW5A 2G7HA 2STTA 4LLNA 1S3JA 2P7CB 2VOPA 1GXQA 3I54A 1BM9A 4A0ZA 1YFHA 1TQPA 3GO5A 1XGOA 4OINF 2DK8A 2EFQA 3K1NA 1HW1A 2M8EA 2FU4A 4KUMA 3PQJA 1G3SA 3F23A 3V8LA 1KQ0A 4RAYA 3T5XA 2E1NA 4UVBA 3L9FA 5KK1A 3RKYA 1Z1DA 2Z9OA 3SHFA 2H6BA 5CLSA 2H94A 5ILVA 2HWVA 2EA4A 3JSPA 1IAWA 2DTRA 3GEZA 4OIRF 2KIMA 1WKMA 1ZN2A 5AIQA 4R79A 1E2XA 1JHFA 1G4DA 3D5LA 3GFJA 2CG4A 2DAOA 3D0SA 2VN2A 3KETA 3CUQA 2LDUA 3ZP5A 2D45A 2M1BA 1QPMA 1KU9A 2FMYA 3GFIA 2EFNA 2YU3A 1DP7P 1YIOA 4RAZA 2RGVA 5L3FA 4P9FA 3ZN1A 3LAJA 5CVIA 4L0YB 3EYIA 2L4MA 4U0WA 3O6BB 4M72A 3T1BA 4LGWA 4HV5A 3R4KA 2FMLA 2OD5A 2E7WA 4IF4A 1OKRA 4HDVA 5LHIA 2ZXJA 4I98B 2W57A 2IJLA 5F64A 5CJ9A 4Q5SF 1B4AA 1I5ZA 4WWCA 5BPIA 3WTVC 2QQ9A 1IN7A 4BAYA 2DPUA 1CGPA 2IPQX 4EVIA 1R1UA 3PFIA 1K78A 2CYYA 2ETHA 5HLHA 3TO7A 3WODF 2RVCA 4HX7A 4YFKF 3F6OA 5IT9K 4A5NA 3C1DA 3ECOA 4ZZLA 1HW5A 3ZMVA 2P5KA 3DEUA 3O2PE 2VONA 1MZBA 1WI9A 4EV0A 1P6RA 2XAFA 3Q9VA 1UB9A 5HLGA 1ZAOA 1ZRFA 2NS0A 4RGSA 3NQOA 1FY7A 1G3WA 1EH6A 2DO7A 2HYGD 4HZFA 5ED4A 4LMYA 4KICA 3VODA 4L0ZB 4HDUA 3WTZA 3WG9A 1BI1A 1YW7A 4HLYA 1FP2A 1LNWA 5BOXA 2WV0A 3RYPA 2EFWA 5ERIA 1B9NA 1G6NA 3CO6C 1XCBA 3TKYA 4HA8A 2GA2A 1IXRC 1PP8F 1NHAA 3RI4A 3N97A 2O0YA 3WTUC 4HX4A 2VT2A 5KVRA 1IRFA 1MD0A 2Z3YA 1USTA 4WX9A 1GHCA 2NAZA 5ICGA 1ZG1A 4WK8F 3U1DA 2G7UA 2H6CA 1U6GA 3DF8A 2FEZA 3Q5FA 3IHUA 5D5VB 4WF2A 3IKTA 2QENA 1FPQA 2Q8KA 3BWGA 2QVOA 1FYKA 4XLNF 2ZMEB
chains in the Genus database with same CATH superfamily
2RAEA 4J01A 2LH9A 4GCVA 5CKTA 4OOIA 2MGQA 1TWAJ 2UZKA 2F6CA 1J2XA 1YJ9I 1A35A 2CWEA 4M3DA 4M6YA 3LL7A 2CQQA 3CJRB 3DPTA 4BGDA 3A01A 4ENJA 5TGTA 1MMNA 1OR7C 4E7SA 3HRUA 4XICA 1RUOA 2WB1A 3HBLA 3VYRB 2A68F 2LP0A 2M0CA 3IUOA 4Z2YA 4P55A 2F5EA 3HZJA 3MWMA 5B5EC 2VT3A 5KHDA 2B0LA 2HFHA 2PMUA 4JX4A 2TDXA 3HRTA 2NVTJ 1HKTA 1IW7F 2EV0A 2JT1A 2JZYA 3A0BC 3HIFA 4CCJA 2HTJA 1BOAA 1D0YA 3L2UA 2R92J 1JGSA 1R00A 3LA3A 1CQTA 4M6XA 2A5YB 2BY0A 3CCQI 3E6MA 2F5DA 2QBYB 5FKMA 3V8JA 3V8KA 5J1RA 5EF6A 2XB5A 1D5VA 1UCRA 2JA7J 2FBHA 4HNUA 1VQOI 1BC8C 1MBJA 4I01A 2A6TA 1TT5B 1A5JA 1YX5A 4L5EA 1G3YA 4I99C 4D5FA 2XVCA 4HSRA 2EIKH 2LOOA 3EUAA 3S15J 4MQVA 2A6EF 2HI3A 3J7YJ 3F21A 5BPDA 3I59B 1R6RA 2GBYA 5J40A 3SFIA 1H9TA 4DBQA 4E7JA 4DW6A 1R1TA 1I39A 3SZGA 3HKZA 2CO5A 5D8LB 2CSOA 4CH7A 3R61A 1HSJA 2OU2A 3F8BA 1TNSA 3ZQHA 2Q0OA 5DV5A 1Y0NA 3TDUC 1U0JA 3V4GA 3OWTA 1FMVA 2YX4A 2BYVE 5IYDJ 1R7JA 1K7AA 1I1GA 1LEAA 1W5CC 1VI0A 1BR1A 1UMQA 3I71A 3M7GA 5DCMB 4D0PA 1PP7U 2GLOA 5EEAA 1VFCA 3HRMA 1YS7A 5DEQA 2R3SA 2IVMA 1TBXA 5B1BH 4AD9A 1BI3A 1X2MA 3BTIA 4PFOA 2QBYA 1OR7A 1BJAA 4BUPA 5ICCA 1X58A 3QOPA 4CO8A 3TW7A 4KA4A 1BOBA 1FBSA 1Z91A 4V19K 3W6KB 2EINH 3M8EA 4MTDA 1Y8QB 2C6YA 3E1SA 1ZRDA 1V4RA 2FBKA 4L9TA 2HZTA 1T56A 2OZUA 2R7DA 3QPSA 1EJ9A 1W7PA 4ZYEA 4BEHB 4M71A 3MD2A 1JUMA 3JTGA 2ZNYA 2HZDA 2H1KA 3A4CA 3BP8A 3S8PA 1N78A 5TJJA 3K6GA 5EGOA 3WGIA 1L3LA 2GWRA 2L9NA 3HOTA 4M73A 3SZTA 3FMQA 1XMKA 2CUEA 4MEYF 2K86A 1B8IA 2Z33A 3DU5A 1PUEE 4CGZA 1QHHD 1SD5A 5E1XA 1PUFA 2KIFA 2HPMA 4DZPA 2E71A 3FWEA 2Y0SA 5LLQA 1AU7A 3ZOBA 5M3MJ 3K9TA 1IDYA 2E19A 1ZARA 3U1KA 4EM1A 4G6TB 4BY7J 1P4WA 2KL4A 1YRNA 1MJ9A 5B66C 4XNFA 4CCLA 2KRCA 5DD8A 2Q2EA 3T0YA 5H2FC 4UHTA 4MFEA 1BN5A 1S72I 4F3QA 3P5JA 1X4PA 3HB9A 2HQ5A 2EIJH 3CTAA 3MZYA 3BR1A 3P7NA 1APLC 2L4AA 4RB1A 4H0EA 2CQKA 3LQRA 1YE9A 2DQRA 2E35A 1SMYF 2E1OA 4YFXF 3I4MJ 1B9MA 1IN5A 2NYXA 3PIOF 3QYBA 1K4SA 1KU3A 2CMPA 2W4SA 3HPHA 2HNHA 2A05A 2AO9A 5K5QA 3AAFA 2OTJI 4ITVA 3TOBA 3BJAA 3KZZA 3ZXSA 4UB8C 4BE0A 1SFEA 3RDIA 4XORA 2B63J 4KFCA 1G3TA 1P7IA 4L18B 1O3RA 1YJWI 2QZ8A 2AHQA 3FXLA 2KDOA 2KHMA 3DBHB 4H4KC 3GBGA 3G3ZA 1QU3A 2BBYA 1YI2I 1VQKI 1A6IA 2IT0A 4NC7A 2FJ1A 1OPCA 3HOYJ 2KZGA 2X1CA 3SJMA 2J5OA 4N4NB 4FT8A 4KNYA 1IUYA 3UKGA 2H8WA 1RESA 1IXCA 2R5YB 5B3SH 3BR6A 2AXLA 2GXGA 1PYVA 2XROA 2BY1A 5CPRB 3BY6A 5C4XJ 2ZNZA 2ID6A 2VKHA 3M8FA 4NBQA 2ZC2A 1DDNA 3EUHA 2XHKA 2ZJRF 1Z3XA 4QLCU 4A69C 1XMAA 2IAIA 5GPCA 4IRHA 4E4HA 5LFAA 3TL4X 2XC7A 3FBIB 2K85A 4HLXA 1A36A 5A2QZ 5E18F 5LEJA 4MHGA 4Y52J 5J6XA 4Y17A 2VPLA 1X3ZB 1ZHFA 1FYMA 3DWLE 1IRGA 1WHUA 2PEXA 2KLOA 2A07F 2PJRB 2QQAA 4XLCA 3ULQB 3A03A 1V3FA 3ABUA 1R22A 2B7EA 5KAFC 1ZLKA 2X48A 5C4JJ 3JR9A 3AG4H 5H6QA 2R7RA 3H3VK 1ZLJA 3HSFA 3CUQB 3W2WA 4BJ5C 2LBFA 4OAYA 4XR6A 4L9JA 5DUIA 3ZN0A 1XGMA 1LUJB 1ZH5A 3HOVJ 3QOEA 2IS2A 2IGMA 2V26A 4RBOA 5E8IA 4LIVA 1SD6A 3QP6A 3W6JB 3FK7A 2MD5A 1RUNA 5CVVA 3KP5A 1IG7A 2VJ5A 3ASNH 3FBNB 1FOWA 2GA1A 5H20A 1LE8A 3HGGA 3DP7A 3KP7A 4MTEA 2LMDA 1M1EB 1VQ4I 1HA8A 1T2KA 3GXOA 2JRTA 2B9SA 4BXXJ 1FSHA 1GDTA 5IP6A 1MDMB 3OIPA 2G9WA 5DTDA 2XV4S 3VYSB 2RNGA 2R7UA 3H5NA 1LQ1A 2FA5A 2DQLA 4M9XA 3GTJJ 4LJZF 3R0JA 2JTVA 1DGWY 2DMUA 1W0UA 3ZRGA 3KZYA 4UVCA 4PSXA 5FGMA 4HV6A 2DN0A 2L2OA 4K2EA 3QODA 1DPRA 3E6CC 4UNOA 3ESWB 5D8KB 5J8FA 2FQ3A 1D1BA 1MMAA 4PDKA 4OIPF 4YEJA 3WU0A 1O4XA 2VL8A 1MBFA 3W3CA 4TV7A 1ZGWA 1H0MA 3R0AA 1QO0D 3GF2A 3KEQA 3F3XA 5L3CA 2LVSA 3K1PA 5F1RA 2OAZA 2DDAA 4M3EA 1XGNA 4OU0A 4X1EA 1AWCA 4XONA 2RC4A 2ZBKA 2R7SA 1Y1VJ 3I5UA 1AKHB 1ZYRF 3JRAA 3CO7C 2K9LA 2DXIA 4PGGA 1JI8A 3DTIA 3NEUA 2Y30A 2XGXA 3H0GJ 4HQMA 3V7CA 1I3QJ 2V7FA 4B3XA 3NAUA 5DCFA 2LBFB 4IQJA 1MMGA 1O3QA 4CYCB 3I53A 1BC7C 3HGYA 1POGA 4GO1A 5JFRA 1V5GA 5A2QK 1FTZA 3GUDA 5J4VA 3L2CA 4XRSG 2CJJA 1SFOJ 3WHBA 1DPUA 1R49A 3CCLI 2K7LA 1MMDA 3T8TA 4BHPA 2CRGA 3TP0A 4KIFA 4A5MA 3WTTC 3K4CA 3KE2A 1X1DA 4A3CJ 3M4OJ 2NXNB 2XAJA 2OCCH 3DBLB 2HOSA 4WCGA 2CUZA 1XTAA 4I02A 3LSMA 3S2DJ 4IX7A 2OPTA 3B6CA 4EJTA 3PNTA 2W82A 2FOKA 2L01A 2Z99A 5J4YA 3HRSA 5HS9A 2DCEA 1JKPC 5IP9J 1HC8A 1RETA 1T33A 1VF9A 3E5XA 1XGSA 1O7LA 4F52A 4G9YA 4UXNA 2PX9A 4HOBA 1JT6A 3KYDB 4AVZA 2L9RA 2VODA 3GTMJ 4D5CA 3VEPA 1MGTA 1IC8A 2LR8A 5IT9Z 2QEXI 4M9SA 4XMYA 3GVAA 3MAJA 2HVRA 4C9YA 3H35A 1IO2A 4MQ9F 2ME0A 1ETVA 3S2WA 4UVAA 2QM3A 5E1WA 3X2QH 4BJTA 3P9CA 2Y69H 2WBMA 2DK5A 4IJAA 3A1YA 5CVUA 1W36D 3CMYA 3VSKA 2HOAA 5FLVA 2JA2A 4ANJA 3PO3J 4P96A 1MJAA 1SAXA 1TL8A 3FXOA 5ICEA 3DXJF 5K5OA 2V9VA 2PBIA 2JA8J 1BJZA 1MJBA 5BQTA 2PLYA 3K4LA 4FQGA 3E5QA 2FRHA 1OYWA 2R7FA 2HYFA 4LLLA 3I0TA 4MFDA 2QA4I 2N8GA 4Y13A 1I27A 2FQ4A 3M9AA 2GQQA 1RNLA 4BL0B 1XX5A 4BH9A 1N77A 5E20A 4ZTFA 1SAUA 3OYGA 1HXDA 2ZMEA 3TOAA 4HW0A 1VQMI 4Y15A 5FRMA 4Q47A 5F0HA 3I58A 1K83J 2IS6A 1LFUP 3RSNA 3QQAA 2KRHA 2FXAA 4G7OF 3CC4I 4OIOF 1J59A 2LY1A 4A3MJ 1R5GA 4XN3A 1B59A 3PQKA 1KYZA 4JOMA 2XF5A 4D9JA 2LNBA 5LHHA 4HYEA 3S3NA 4CXFA 4YG2F 2H27A 3MQ0A 1RKWA 2PJRA 1ETXA 5FKOA 2E1MC 1JKQC 1S9HA 4LITA 2LF8A 5M3FJ 4UUSA 3SEZA 3OYDA 5GAHJ 2COMA 1VQ5I 1QVTA 2PG4A 4KISA 3OSGA 1E17A 4XLFA 1A6QA 2X9DA 3GYHX 1QZYA 4S0HB 2ZCWA 3ERED 1SD7A 3BG3A 2XKOA 4EMSA 4V2FA 4R8HA 1FBUA 2BY2A 2F4IA 4RA2A 1XG1A 1OCOH 4G6QA 3F6VA 1IDZA 4FE7A 4ZDOA 2JRMA 1Z6RA 3CESA 3RTRA 2H1LA 5IP7J 3GTQJ 4D1QA 2HVSA 3J81K 4A3LJ 2BHZA 1TNTA 2IA1A 2VB6A 1LDDA 3WGHA 3S93A 2QF7A 3V42A 5CQEA 3ZGKA 1ZQ3P 2DJIA 1ZGJA 3HPGA 3LFUA 5F0CA 1X2NA 2CW7A 3BR3A 1OCRH 1Z7UA 3KIOA 1HW2A 5E3NA 4OMZA 2A5WA 1H88C 2CH0A 2V1XA 5HDNA 1QQIA 1JTXA 1YIJI 1VQLI 3E6BA 3L2VA 2PN6A 2W84A 3EDPA 2UXXA 3IRRA 4RGRA 2HOEA 3P9IA 3A02A 5D6EA 3CMMA 2VUMJ 2KDZA 2K3FA 3FZVA 2NNYA 3CCEI 3OV8A 2P5LC 1MIJA 2PJPA 3OL3A 2CV2A 5L3BA 3S1QJ 1TWFJ 4O5VA 1VQ6I 2XPUA 4I0AA 2RKHA 4NC8A 2HTSA 4XKBA 3P9KA 3RYRA 4XLHA 4ENKA 2O8XA 1SMTA 1JT0A 1HDDC 2M87A 3K69A 2ZXHA 4XM3A 1MSEC 1QRYA 3QYEA 3GTOJ 2EFOA 4M74A 4ENNA 2IA0A 3LWFA 2NS8A 5LGTA 2DA3A 3KCCA 2HDCA 3OYAA 1ENHA 2HDWA 4AIDA 5K7ZA 1D8JA 2CGPA 4ZYGA 3C2BA 1OLTA 1STZA 2R7TA 3U21A 2AXTC 3CUOA 1VNDA 5LRRA 4F91B 1ERDA 2Y75A 2KIUA 2P6SA 1BI2A 3GW2A 3H0DA 2GOMA 2DBBA 1MBGA 2HXIA 4AYBN 3K1MA 3FX3A 3PSIA 2QLZA 2WAFA 1OMIA 4DJAA 5FJ8J 2Y2ZA 1IN6A 1VQNI 2IS4A 3BR0A 4E6KG 4XOPA 2FE3A 4MIMA 5HOOA 4P9UA 1V5FA 2XPWA 5GTIC 4IRGA 3FXUA 5KAIC 1JHHA 1T0FA 2BVLA 3NRVA 4A3FJ 3IAS2 3E0JB 2WA0A 1AHDP 4UUSB 4PK4A 2GXAA 3HKZN 2OC6A 4CYDA 1MH3A 2W25A 1X1CA 2ESHA 2WAEA 4JBAA 1UHSA 1XDUA 5CYVA 1FOKA 2XKPA 3PM1A 4BEHA 2HQNA 3LOCA 4ZJZA 4BACA 5ILSA 1TTYA 3EETA 5D4RA 1OCCH 3I9V2 1VQ9I 2DOFA 1ON2A 3R60A 5EEGA 4BXUA 2P81A 5IY5H 1JXSA 2MG4A 1IXSB 1R58A 1TWHJ 3EQLF 2STWA 2IRFG 5DM6F 3L2WA 2E36A 2IGNA 3S1MJ 2IA2A 2VQHA 3NWTA 2E60A 4FX0A 2VBYA 3F8FA 4A3JJ 4RB2C 5D6FA 3WTYC 1XMXA 2DFEA 1YTYA 1LDJA 5E8GA 5EG0B 3DPUA 3DTEA 1U78A 3HOUJ 4L5IA 5E3LA 4Y33A 3GZ6A 4KN7X 2XB0X 4EM0B 3NWSA 1OCTC 2MFZA 3JRDA 1U8RA 4M9ZA 2Q1ZB 3H5RA 1E3PA 3FMSA 4E7IA 1FX7A 1WI3A 2VBZA 3QWLA 4ZTJA 1SEUA 1K78B 3BOQA 3CC2I 4F55A 3ISPA 2VASA 2CV0A 2EV6A 4CZCA 1K61A 1LFPA 2BY3A 4NHJA 2RQQA 1HSTA 3M1CA 4I7HA 4NC6A 3CQZJ 3H9GA 5GAGJ 4EJWA 1BR4A 2O6GE 3S2HJ 4XK4A 3BDDA 1XN7A 3DKWA 3MCZA 4JP0A 4LLGF 2DOEA 2E5ZA 2AQEA 4GYIA 3MFKA 4BE1A 2LSOA 2LKXA 1REPC 5HNFA 1YYVA 4BNCA 2YUSA 2X6YA 1P4XA 3K4BA 1D0ZA 3ELKA 6PAXA 4E7LA 2DYRH 1U5TA 3OR1C 3LSTA 3O3KA 2KJBA 2D1VA 4LB5A 1U2WA 3CCVI 2Y0SN 3I56I 1TC3C 4PJNA 4IXAA 4LK1F 2COBA 5EEHA 1KA8A 4BJ6C 1K6OA 3MKYB 3DLAA 4C30A 1HF0A 2M2EA 3RKWA 3OL4A 3TGNA 1FP1D 5LRSA 3KLNA 3R6SA 3CUQC 3FISA 4I09A 3FK6A 1ZG5A 1S29A 2DMTA 4IVNA 2XAGA 3KP2A 2XAHA 1IJWC 2ZO4A 2MLGA 5K5RA 2VJ4A 5EGOB 4CYCA 2XDVA 3QRFF 2K9QA 3J7AY 3NARA 4L9VA 2D1HA 2MABA 5CVRA 5DD4A 3B73A 1B72B 1I50J 3HTUA 3HOWJ 1YQAA 4LB6B 2OF7A 2XGDA 3KFWX 3V7SA 1W4MA 1TP4A 1ZTRA 4YFNF 3KYLA 5FD5A 3OS1A 2KP6A 5FLXZ 1WRJA 3S14J 1BIBA 4UY8I 1I6HJ 3CP8A 3Q0VA 2EA2A 4LG0A 3CCUI 4RS8A 4XLEA 3OSFA 1ZREA 2BXZA 3F8MA 1ETWA 4QPOA 4MGRA 4IL6C 2OZ6A 1F1ZA 4KT5C 2V1UA 3CCYA 1UELB 4HF2A 1R4MB 1SC7A 1RIOH 2DMNA 2EZIA 3HM5A 2DOAA 3CDHA 3S1RJ 5H6RA 5DYMA 4G8XA 3C18A 2WB1N 1A04A 2W85A 3F9KA 5F0FA 2IEKA 2QQ8A 3TO9A 2PMZA 3GTPJ 2M5WA 4CCMA 4HQEA 3DU6A 4XL9A 3HHGA 4CUGA 5LGNA 3ZQGA 3IRQA 2DT6A 4A3KJ 1X3WB 3F72A 4F7ZA 1TW2A 4KIGA 1JJ6C 3VPRA 2KISA 3LNQA 3MKWB 2UXNA 3MKLA 1J5YA 1YITI 3BJOA 3KYCB 3T8RA 5EYRA 2O9LA 1EH8A 4G7HF 5JVTA 1MKMA 1P9QC 2F4OB 3IH2A 4QPQA 1WSUA 4MNUA 5FB2A 3J7ZI 2FF4A 1OFCX 1DGRM 1ZR2A 2M34A 3PUBA 4B09A 4KMUX 1N75A 1N25A 4NB5A 3RKXA 3OS0A 3BC8A 4HEA2 3S3OA 4DQ2A 1NTCA 3M1EA 1DU6A 3HYIA 2VE8A 3HJEA 3TDZC 1T98A 4QTRA 3BROA 3JREA 2V6CA 5E3MA 4CHUA 1USSA 1H9GA 2WAQN 1GVJA 4C2MJ 5L3DA 3BG9A 4CCOA 4G12A 1LJ9A 1ONVA 4BU2A 1IV6A 1J09A 1BA5A 3FF5A 3I55I 3DLLF 1W7PB 4ESBA 4J19A 3I4PA 2RN7A 3IC7A 3ABLH 1IF1A 4MEXF 2EFPA 3VOEA 3AKZA 1EV7A 2ZB9A 3O8GA 1QBJA 4OMYA 2JUGA 3WG7H 1VQ7I 5F04A 2HKXA 3I59A 4C2TA 2EBIA 4IHTA 2M30A 1D1AA 4YELA 2FSWA 4RB0A 3HEFA 3W2AA 2F5FA 3OOUA 1O57A 2VOOA 4RDUA 1S5LC 2XASA 5GP9A 1A31A 3FXJA 1I1SA 2IGKA 2F5CA 5FLXK 4HBLA 1R5HA 3GLLA 5HS8A 2MW8A 3DTKA 2VBXA 3ZCOA 2L7KA 2M4GA 2K9NA 4A6EA 3PL8A 4IPAA 1SFUA 4AVPA 5FKKA 4F92B 1Z7LA 4HAMA 1XSXA 4RB3C 2Y0MA 2DJNA 2LF7A 3D1NI 4IHYA 1AA7A 4GRIA 1WJ5A 3C7JA 2NVYJ 3H3ZA 2IGOA 3IL2A 4HX8A 5FO5A 1R23A 3BJ6A 1DP3A 3E7LA 4RMNA 3PNYA 4A3EJ 3ML6A 4NNJA 1Z77A 3LA2A 4XSZF 4N9HA 4XRFA 3E5UA 1YX3A 3DPLC 2A61A 2LTPA 4JX5A 4ZZDA 3U9GA 3GZ5A 3N4MA 3MEXA 4HF0A 2EIMH 4DBRA 5GAEJ 1F5TA 1LEBA 2HXOA 2BGCA 4XBFA 2R7WA 5JLXA 1F36A 2GXBA 1YHQI 4IEJA 3TP3A 1T6SA 2QQBA 2UWMA 4EQQA 2L54A 1GXPA 3G71I 2GOXB 3BCAA 1QNTA 1XD7A 3ROUA 2W48A 2MC3A 5JR3A 4U7BA 3L2RA 3KPHA 2X1EA 4DYRA 2NVQJ 2P4WA 1U3EM 4S05A 5LBQA 5D4SA 1FSEA 2F2EA 3D5SC 2DT7B 4FX4A 3RQIA 2DPDA 1BW5A 1R1VA 2X4HA 3OR2C 4AWXB 2MLKA 1VTNC 1W0TA 3GCMA 4BQQA 2ACJA 3QU3A 4DYQA 3B02A 4II3A 2HYJA 3RPQA 2TRTA 5J8CA 1OYIA 5HS7A 3CLOA 2P6TA 2ISYA 3COAC 4M3BA 3IWFA 1K6YA 5E1ZB 3QPLA 2EK5A 4A2UA 5KNLA 3LSIA 4RM3A 3ZMDA 4AIHA 1B1BA 1ETQA 3SZPA 4EATA 2LKPA 2IS1A 1WZ2A 1LPQA 3F0CA 1Z0XA 4YIIA 3VDXA 2K4JA 2V1DA 1KQ8A 1P4AA 3F8NA 1ZELA 2ZKZA 4IQ4A 2VC0A 4BHBA 2JVGA 1K79A 3CJQB 3VFZA 1IV8A 4E70A 3HTSB 2R4GA 3AG3H 4I0BA 3FM3A 2XRNA 2VC1A 2LD5A 1VQ8I 1ON1A 1U5TB 4A93J 1J0RA 4U0YA 4O3MA 2L5QA 2DW4A 4RGXA 1G59A 1RPWA 2XGCA 3E3VA 2JPBA 2CW0F 4Z6YA 4IO9F 2O61A 2DMQA 1U9NA 4B4CA 2JA5J 4IHSA 1W5TA 3QYFA 3DQVC 3TEDA 3LMMA 3JAMK 1FLIA 1GLNA 1D8KA 4DZJA 1TQIA 2F4MB 2L9VA 3VYTB 4DYCA 1T8IA 1HBXG 1QZZA 1UJ8A 2RDPA 2R5ZB 1YOVB 2W7NA 4HNVA 1GV2A 2JSCA 2J5PA 3S17J 2ZJQF 2P8TA 1MDMA 4GGGA 1KGSA 2VIXA 3VB2A 3FHZA 4BY1J 1B6AA 2X85A 2ZMEC 2JQ7A 2EZKA 2L3DA 2QKLB 3E6DA 4IRIA 4A12A 3LQQA 1ODDA 3BPXA 4LIUA 3ZMZA 1Y56A 5BS6A 2EB7A 4Q48A 3J7AO 3KX2A 5D5UB 3I64A 4CCNA 1WJFA 2R7QA 2EPFA 5ILUA 2DT5A 4AYBA 4XQFA 1GT0C 1Z9CA 1HOMA 3ASOH 1ZGAA 4A6DA 2HQRA 5HNHA 3AFHA 1TWCJ 4AIJA 1AOYA 4EGZA 2ELHA 3TMOA 2K02A 4ABZA 1Y6IA 1LVKA 4XLAA 3D5RC 3FDYA 4ENMA 1WWXA 2TCTA 2O7OA 3WTSC 2Y9ZA 4XN0A 2LLKA 1SANA 2EJRA 2KZVA 4E7HA 1KQ9A 2VXZA 3WU2C 5J1YA 2EILH 1ETOA 2M7BA 1SD4A 2DDBA 4LOCA 2IP2A 4KMFA 2JPCA 2ICWG 4M3FA 1KONA 2K27A 2GM4A 2GIZA 4XOTA 2BV6A 1P2FA 4B3AA 2DA1A 1UHMA 4WXCA 4S04A 1UFMA 3BZ6A 1YLFA 1RR7A 4AIKA 5TRDA 1MNDA 5EG0A 3BR2A 2QSGX 4BQAA 2XUBA 3HXLA 1UAAA 2XAQA 2Z5UA 4A3BJ 3K7AJ 2KKOA 4U87A 4OIQF 1TWGJ 1NG7A 1ULYA 2FD5A 3KEOA 1FJLA 4L5JA 2JSPA 2VQGA 4ASNA 4IHXA 2LK2A 1XSVA 3J80Z 3BT9A 3HDDA 5LD2C 1WGXA 4IOAF 2K4BA 4KIBA 1Y8RB 4PCQA 4QSHA 2VJJA 4IOCF 5FD6A 4EJVA 2X0LA 3GMEA 4EM2A 3BG6A 3TO6A 3DV8A 1JKOC 3ABMH 1P92A 3GFLA 5JLWA 3OS2A 2WWYA 1JGGA 1FT9A 2WC2A 2XAUA 3KLOA 3JAMZ 1XSDA 5E17F 1IRZA 1F4KA 1YW8A 5K7FA 4QWQA 2CFXA 1RZ4A 3LSGA 5FKLA 1V54H 2M3AA 3Q0WA 3DCFA 5E79C 4WXHA 4XRSA 3CCJI 1ACIA 3L1PA 3BG7A 1TLHB 2R93J 3OYMA 3CDIA 3K70D 3FIWA 3FKIJ 1SFXA 4UUTA 4ZC3A 1EF4A 2G0EA 3MVPA 3DKYA 2O03A 5DUKA 4I6ZA 1GUUA 1ITYA 3BPVA 1RI7A 2PQ8A 4IHWA 2HGCA 2Q2EB 2LY2A 2XIGA 5KCMA 2EQRA 1Y0UA 5FROA 1YRNB 3K0LA 4BYYA 3ZQQA 1Q1HA 1W7PD 1T38A 2E1CA 3I4NJ 5F08A 4A0YA 1D0XA 1LVAA 9ANTA 3GWZA 3GLXA 1T08B 3CMAI 4B48A 1WH5A 1BL0A 1QA6A 1WJDA 4FETA 3SYTA 5FRNA 4GYGA 2M7AA 2HDDA 3SFZA 5GTHC 1CF7A 1BIAA 2PMZN 4X6AJ 3EYYA 3SDGA 2L9SA 1BW6A 2OQRA 2RQPA 4PUSA 3F8CA 1RKTA 4RLFA 4BKXA 3GX4X 1JJ8C 2R7ZJ 2ESNA 2EZHA 2QCOA 2E5NA 1MSFC 1TW3A 4XIDA 2QWWA 1X4OA 4ESJA 1BR2A 4ZYHA 1B72A 1OQYA 1S6LA 3FXRA 2DA6A 3V7RA 1DQUA 2HR3A 5HDKA 2CW8A 2ZSHB 2M45A 1RR8C 5DDGA 3TBIA 1Z05A 1ZG3A 2O3FA 2PMHA 3DFGA 2QSFX 5J3LA 1WJAA 1MBKA 1KU7A 3ZMTA 3F22A 3H5AA 3QP5A 4JK1X 2RNJA 2FBIA 5F27A 1NK2P 1E3OC 3FMRA 3CD6I 2MYSA 3M8JA 2DI3A 2L02A 3FM5A 4LG0B 3KP4A 2M0MA 3JW4A 1X1BA 3H9JA 2JMWA 1IN8A 1O3TA 4QIWN 2W24A 1LDKB 4EEFG 1MNMC 1IUFA 1QVUA 4ON0A 3PSFA 1XB4A 5B1AH 3RPUA 4LK0F 3OYCA 3HL2A 3CC7I 1LKXA 1XDSA 1Z6TA 3CF2A 3G2BA 3RJPA 2A69F 1GVDA 2MBFA 1DUXC 4FE4A 1OYYA 5AIPA 1XCVA 4UV9A 3JSOA 3JRBA 1LFBA 1HCRA 2X6XA 1OCPA 3OYEA 5GPAA 4HSTA 4XLPF 3QPTA 2DA2A 3FXMA 3LSPA 5L3GA 2ID3A 3ABKH 3H36A 3OIQA 1MBHA 3K4MA 4CDGA 2GAUA 5M5YJ 3ECHA 3HSRA 4G7ZF 3CJNA 3PNVA 1SVLA 4N0BA 3HOXJ 3H9QA 1YG2A 3MKZA 1T39A 1QHGA 2R7VA 2YPRA 1FZPB 4KN4X 2EWNA 2KQRA 3OYKA 2OCEA 3FHNA 3W6VA 4RGUA 1I6XA 2ADUA 3L00A 3G1LA 2QSHX 3LA7A 5D5WB 5FFXA 3SXYA 1CF7B 2VPRA 3WE3A 2ZJ2A 4C2UA 3ABTA 3DEEA 5FKNA 3WHCA 1VQPI 1FMWA 2Z1DA 5JVGF 1YO5C 5DS9A 3MZHA 2X51A 3B6AA 1SFKA 4YRVA 2BVMA 2BOLA 3C2GA 2GZWA 4EJOA 2CQNA 4XKVA 4C3IJ 2MA3A 3S16J 1J7KA 3HG9A 1WJEA 3ERMA 4DIQA 3DEWA 3G4SI 1FYLA 4R1HA 2CUJA 1JE8A 2R5YA 4JYKA 3KP3A 2WV1A 4FCYA 4PJ0C 2WY8Q 1G8XA 3OYLA 1D1CA 3ZMSA 3WU1B 4A3DJ 2IBDA 3RIRA 3TW6A 5IPAA 3ZPLA 3WGGA 2DA7A 2V79A 4O6JA 3WTXC 2LG4A 1RC9A 3JTHA 4PSWA 3OYBA 1S7EA 1BI0A 4W1UA 2W00A 3ZQ7A 1DU0A 2BW3A 1W5SA 4BQOA 5D5XB 2WADA 4II2A 1Z3YA 2MH9A 1F43A 4WXDA 3IWZA 2HPIA 2HOTA 3H92A 1JKRC 2QUFA 2R7OA 1Y39A 4D7NA 1HKSA 5FFZA 3J80K 3FXQA 1X3UA 5LHGA 1FWZA 5HLIA 1W1WE 1SVOA 1VZ0A 2OJED 4A0XA 3OYFA 3AL0C 2IXSA 3K4NA 2KPMA 2M9HA 2R5ZA 4PZJA 3QPHA 4FHTA 4B47A 3UR3C 2DFIA 4ETSA 1KYWA 3MN2A 3K2ZA 5HVQC 4ZYDA 3BG5A 3A01B 2ELJA 2L7ZA 3IH4A 4YIRX 2WY7Q 2A3SA 4PJMA 1GV5A 2K5CA 1ZK8A 2FNAA 2NVXJ 2L0KA 2V6EA 4UB6C 2NNNA 2XGEA 3G6EI 1U8BA 1FBQA 4NQWA 2RV8A 2E2IJ 2ZXWH 4JQFA 2HQAA 4ESFA 4KYWA 2YU9J 1U5TC 3OY9A 4Y3OA 1R36A 5BMZA 4XKWA 5IOYA 1E0EA 4PJLA 3DKXA 1R5ID 2FNPA 2DMPA 4U88A 4HNTA 5E3OA 2HS5A 2MD0A 1PVEA 1WCMJ 3L7WA 4CICA 4N9IA 3CF5F 3LAPA 5LEKA 1R4NB 2EH3A 2GIVA 5JHUA 3HSEA 1HDPA 3HUGB 4E7ZA 3LSRA 5M5XJ 2E7XA 3IP4B 3WTWC 3RZOJ 4MLOA 3BCBA 4UUVA 1Q1VA 4A3GJ 2M4KA 2K9MA 3LFKA 2NRAC 1KU2A 4JX6A 1UHWA 4B8XA 1IZ1A 3JCUC 2WTEA 2XF7A 4CZZA 5HODA 1C0WA 4P5OA 4AUXA 3IV5A 4BBRJ 3RCOA 2DU9A 5F6FA 1IN4A 2A6HF 4EJUA 2UUZA 3GTLJ 1XPXA 2O5RA 4G94A 4HF1A 3MMYB 4YIFA 4XKCA 1O3SA 4L9NA 4NUBA 1S7AA 1LB2A 2ISZA 2HEOA 2ELKA 3A2KA 4KITB 5LGUA 1S8NA 1H89C 1L0OC 1FNNA 2FUG2 2I10A 4P1WA 1FIPA 2I5UA 4OAZA 1WFXA 4ZDLA 3CP2A 3C3WA 2MC4A 4DGWB 3ONQA 2AS5F 3BZKA 1X1AA 2X1DA 3HOZJ 3ZMUA 4PFPA 1ORKA 2XPVA 2VLAA 5DCMA 2MSYA 3L09A 1ZRCA 3HUGA 3HC7A 2QYOA 2D5VA 3S1NJ 1EH7A 1NG6A 3FKJA 2MH2A 4B1RA 3IAM2 2KMUA 5K7HA 4LD5A 2K40A 3G73A 2Y9YA 3C2HA 2OA4A 4KT6A 2BHYA 2DLLA 3S32A 3BTCA 1JTYA 4Q4ZF 2PFBA 2JWTA 2X6OA 1UG2A 3Q3SA 1HKQA 1WJBA 5CVJA 1W36C 1J75A 2V9PA 1WVRA 1D3YA 3J81Z 3TQNA 4BHCA 2E1MB 2NOJB 4BDZA 3H3UA 3KP6A 2L7MP 2YSRA 1J9IA 3OOPA 2EV5A 3DBRB 3G1OA 1YS6A 1WQ2A 2BEOA 4KDPA 3SQNA 2D2WA 2VBWA 4I2OA 2F48A 2KRFA 4UV8A 4EGYA 1TQMA 2L7FP 5AONA 3CCMI 1QZEA 4XSXF 2BE5F 2XRLA 2Y48A 3Q9SA 5JHFA 2OBPA 2VI6A 1HQCA 1XC5A 3U2RA 1O7FA 2LC2A 3IKVA 1YW9A 1MH4A 3M3YJ 3EUHC 3JRCA 2OQGA 2P7VB 3QAHA 4DNCA 1PDNC 3LSHA 1UZCA 2XF6A 2CV1A 2VE9A 2H8RA 1XS9A 5JI6A 3W2VA 3JRFA 5K1YA 1F9NA 2ZFWA 3GZNB 3CDLA 3E97A 4ZH4F 4LFUA 4U0VA 5ICFA 1R9TJ 5EDNA 1S7OA 4G6DA 1FC3A 1T0FC 4RM2A 3GFMA 4PGHA 2H09A 1QGPA 2KJCA 5IYBJ 3WE2A 4GXOA 4RAGA 2P5VA 3ZR8X 2YX7A 3HHHA 5L3EA 5HDGA 4HRIA 2XSJC 3PUFA 5BNGA 2K3PA 5IT3A 4PJJA 2VKDA 2YR2A 2CQXA 4U7DA 2VXDA 4AC0A 2PI0A 2CU7A 4B44A 5HLTA 1AKHA 2Z16A 3REOA 3I3LA 3HOSA 1BBYA 1E3HA 2HKOA 2V4JC 3QU6A 3RQ4A 2IW5A 1MMSA 4X0GA 3CLQA 4GDFA 2LYCA 2ZFUA 2G7HA 2STTA 2RREA 3GTGJ 4LLNA 1S3JA 2V1NA 2W1OA 2P7CB 2VOPA 3ZQLA 1ZKGA 2P0WA 4C3JJ 3FXKA 1GXQA 2VKVA 1FEXA 3I54A 3PFYA 2F5VA 1BM9A 2ECBA 4BXFA 2E2HJ 4A0ZA 1T95A 1YFHA 3K10A 3VYUB 1TQPA 2YS9A 2JUCA 3RPUD 3GO5A 5C3EJ 4IHVA 1XGOA 4OINF 2DK8A 4OWRB 4J00A 4A3IJ 4I76A 4GFBA 2EFQA 3K1NA 1HW1A 2M8EA 2OV7A 3JRHA 3PO2J 2LKSA 2VQLA 2LRDA 3CJTB 4RAFA 2FU4A 2ME6A 1NK3P 3CCSI 4KJZA 2CUFA 1LE8B 4KUMA 3O8HA 3PQJA 1G3SA 5IOZA 3F23A 1D5YA 3ZQCA 1OJLA 1G2HA 3V8LA 1KQ0A 4RAYA 3T5XA 2Y31A 2E1NA 4UVBA 3L9FA 3LSJA 1NH3A 1PJRA 5KK1A 3VSLA 3RKYA 4BS9A 3BLYA 1WPKA 1KZHA 1Z1DA 2Z9OA 3SHFA 4IZZA 2WAQA 2CQ7A 1ZR4A 2H6BA 5CLSA 2H94A 5CQGA 4AU7A 2R7XA 2XSDC 2AQFA 5ILVA 2HWVA 2NOGA 1ETYA 2EA4A 1Z21A 3JSPA 1EKEA 2NS7A 1IAWA 2DTRA 3GEZA 4M3GA 3K4JA 4OIRF 2V9KA 2KIMA 1WKMA 1ZN2A 3SEQA 4C3HJ 2E2JJ 5AIQA 2O8KA 4R79A 3H1CA 4HPQA 2I8DA 3KEYA 1E2XA 1JHFA 2DODA 2KT0A 4MO7A 1G4DA 1FOYA 3D5LA 3GFJA 1QPIA 4N4OB 5TISC 3ZQIA 2CG4A 1X19A 2DAOA 2JA6J 3D0SA 2KIQA 2VN2A 3KETA 3CUQA 2ZXIA 2LDUA 5GADJ 3ZP5A 1IGNA 2D45A 2M1BA 4W97A 1QPMA 1KU9A 1MNEA 3OMYA 2FMYA 5IYCJ 3GFIA 2EFNA 2YU3A 3OYNA 1U9OA 1R71A 1DP7P 4V2GA 1V5EA 2JK3A 3Q0UA 5EJCA 1YIOA 4RAZA 4BBSJ 1FOXA 2RGVA 5DM7F 3JRGA 5L3FA 4E7KA 4P9FA 3ZN1A 2FX0A 3LAJA 5CVIA 2DA5A 5F1JA 4L0YB 3LSKA 3EYIA 2L4MA 1EA3A 4U0WA 5J1UA 3JRIA 3AL0B 4AM3A 3O6BB 4M72A 3T1BA 1Y1WJ 4LGWA 4HV5A 4FTHA 1JUSA 1B8IB 3MZ8A 3R4KA 5M5WJ 3KZIC 2FMLA 2OD5A 2E7WA 4CCKA 1H8AC 3VWBA 1UG0A 1MBEA 5EZGA 4Y4RA 4IF4A 1OKRA 2LFBA 4HDVA 3M07A 5LHIA 2LY9A 1P7JA 2ZXJA 4I98B 2W57A 2IJLA 2DFHA 3EPZA 5F64A 5CJ9A 4Q5SF 1B4AA 1I5ZA 4WWCA 5BPIA 3WTVC 2QQ9A 1IN7A 4BAYA 2DA4A 2DTZA 2DPUA 4IKFA 1CGPA 2BZTA 2IPQX 3PJRA 2VJIA 4EVIA 1R1UA 3PFIA 1K78A 1JUPA 2CYYA 4DOZA 4BE2A 1FTTA 2OTLI 2HVQA 3BZCA 2R0QC 2ETHA 5HLHA 3TO7A 3WODF 4XRMA 2CS3A 2RVCA 4HX7A 3OYHA 1X1PA 4YFKF 3RZDJ 1K4TA 3BQZA 3F6OA 4CSWA 5IT9K 4A5NA 3C1DA 3ECOA 3GTKJ 2BXYA 2ZSIB 4ZZLA 2JN6A 1HW5A 4CA0A 2QGUA 3S3MA 1TZLA 2E34A 4D7MA 2CFOA 4BQNA 2DFFA 3ZMVA 2P5KA 1WJCA 3DEUA 3O2PE 1OCZH 2Z2SB 1MZBA 2VONA 5J47A 1IRXA 1WI9A 3OYIA 3BTJA 4EV0A 1ETKA 1P6RA 1Z67A 2XAFA 3Q9VA 3K70C 1UB9A 5HLGA 2ZJPF 1I3AA 1ZAOA 1ZRFA 2NS0A 1TT0A 1OISA 1V55H 4RGSA 3SDBA 2FOWA 3CZ6A 3PIPF 3NQOA 3UNGC 1FY7A 1G3WA 1EH6A 4BDYA 1RRJA 2QKMB 3N05A 2DO7A 2HYGD 4HZFA 2OUMA 5ED4A 4LMYA 4Y7NJ 2K9SA 4KICA 1FIAA 3VODA 4L0ZB 1PUFB 4M6VA 4HDUA 3WTZA 4LG3A 4FASD 5FLMJ 1MW7A 3CCRI 2DYSH 3WG9A 3OIOA 2UV1A 1BI1A 1YW7A 4HLYA 3CMEI 1FP2A 1LNWA 2VQCA 5BOXA 2WV0A 3RYPA 3AG2H 3ZQFA 2NVUB 2EFWA 1YJNI 5ERIA 1B9NA 1G6NA 5C44J 3CO6C 1XCBA 3BQYA 3TKYA 4HA8A 2GA2A 3OYJA 2X6WA 1IXRC 3G1MA 2EZLA 1NHAA 2KFDA 4RLQA 1WH7A 1PP8F 2ECCA 3RI4A 3N97A 2O0YA 3WTUC 3IH3A 4HX4A 2VT2A 2BW3B 2HU9A 5KVRA 1IRFA 1MD0A 4ZYAA 3BR5A 3EUKL 2Z3YA 1USTA 4NQWB 4WX9A 1GHCA 1HLVA 2NAZA 5ICGA 4WK8F 1ZG1A 3U1DA 2G7UA 2H6CA 2M8GX 1U6GA 4NDLA 3DF8A 2FEZA 4B43A 3Q5FA 4ZDPA 2JVHA 3IHUA 3K2AA 3L2QA 5D5VB 3BTLA 4WF2A 4FISA 3AG1H 2JJ7A 4HG2A 4F93B 2VKEA 3K4KA 3IKTA 2QENA 1FPQA 2Q8KA 1SVMA 3BWGA 2QVOA 3RKQA 1FYKA 4XLNF 5EZHA 2ZMEB 2LREA 3A0HC
chains in the Genus database with same CATH topology
4GCVA 4OOIA 2UZKA 1J2XA 2CWEA 4M6YA 3DPTA 4ENJA 3HRUA 1RUOA 2A68F 4Z2YA 4P55A 2F5EA 3MWMA 2VT3A 2B0LA 2HFHA 2PMUA 2TDXA 3HRTA 1HKTA 1IW7F 2EV0A 2JT1A 2JZYA 3HIFA 2HTJA 1BOAA 1JGSA 1R00A 3LA3A 4M6XA 2A5YB 3E6MA 2F5DA 2QBYB 3V8JA 3V8KA 1D5VA 1UCRA 2FBHA 1BC8C 4I01A 1G3YA 2XVCA 4MQVA 2A6EF 3F21A 5BPDA 3I59B 1H9TA 1R1TA 2CO5A 5D8LB 2CSOA 3R61A 1HSJA 2OU2A 3F8BA 1TNSA 2Q0OA 5DV5A 3TDUC 3V4GA 2YX4A 2BYVE 1R7JA 1K7AA 1I1GA 1LEAA 5DCMB 3M7GA 4D0PA 3I71A 1PP7U 3HRMA 1YS7A 5DEQA 2R3SA 2IVMA 1TBXA 4AD9A 1BI3A 2QBYA 1OR7A 1BJAA 5ICCA 3QOPA 4CO8A 4KA4A 1FBSA 1Z91A 3W6KB 3M8EA 4MTDA 2C6YA 1ZRDA 1V4RA 2FBKA 4L9TA 2HZTA 2R7DA 2OZUA 1W7PA 4ZYEA 4M71A 3JTGA 2ZNYA 3BP8A 5TJJA 3WGIA 1L3LA 2GWRA 3HOTA 4M73A 3SZTA 3FMQA 1XMKA 4MEYF 2K86A 2Z33A 1PUEE 4CGZA 1SD5A 5E1XA 2KIFA 5LLQA 3FWEA 3K9TA 4EM1A 1ZARA 1P4WA 1MJ9A 5DD8A 2Q2EA 3T0YA 4UHTA 1BN5A 3CTAA 3MZYA 3P7NA 2L4AA 4RB1A 4H0EA 2CQKA 3LQRA 2DQRA 1SMYF 4YFXF 1B9MA 1IN5A 2NYXA 1KU3A 5K5QA 3AAFA 3TOBA 3BJAA 3KZZA 1SFEA 3RDIA 4KFCA 1G3TA 4L18B 1O3RA 2QZ8A 3G3ZA 2BBYA 2IT0A 1OPCA 2J5OA 4FT8A 4KNYA 1IUYA 1IXCA 2AXLA 2GXGA 2XROA 3BY6A 2ZNZA 3M8FA 1DDNA 3EUHA 2XHKA 4QLCU 1XMAA 4IRHA 4HLXA 5A2QZ 5E18F 5LEJA 4MHGA 5J6XA 4Y17A 1ZHFA 1FYMA 1IRGA 2PEXA 2A07F 2QQAA 3ULQB 1V3FA 3ABUA 1R22A 1ZLKA 5H6QA 1ZLJA 3HSFA 3CUQB 4L9JA 5DUIA 3ZN0A 1XGMA 1ZH5A 5E8IA 1SD6A 3QP6A 3W6JB 2MD5A 1RUNA 5CVVA 3KP5A 5H20A 2GA1A 3DP7A 3KP7A 4MTEA 1T2KA 3GXOA 2JRTA 1FSHA 1MDMB 2G9WA 2XV4S 1LQ1A 2FA5A 2DQLA 4M9XA 4LJZF 3R0JA 2JTVA 3KZYA 4UVCA 5FGMA 4HV6A 4UNOA 4K2EA 1DPRA 3E6CC 5D8KB 5J8FA 2FQ3A 4PDKA 4OIPF 3WU0A 4TV7A 1H0MA 3R0AA 1QO0D 3GF2A 3KEQA 3F3XA 5L3CA 3K1PA 5F1RA 2OAZA 1XGNA 4OU0A 1AWCA 2RC4A 2ZBKA 3I5UA 1ZYRF 3CO7C 4PGGA 3NEUA 4HQMA 2XGXA 3V7CA 5DCFA 1O3QA 3I53A 1BC7C 4GO1A 5JFRA 5A2QK 3GUDA 3L2CA 1DPUA 2K7LA 3T8TA 4BHPA 4KIFA 4A5MA 3WTTC 3KE2A 2XAJA 4WCGA 4I02A 4EJTA 2FOKA 2L01A 2Z99A 3HRSA 5HS9A 3E5XA 1XGSA 1O7LA 4G9YA 4UXNA 4HOBA 2VODA 3VEPA 1MGTA 5IT9Z 4M9SA 3GVAA 3MAJA 4MQ9F 3S2WA 4UVAA 2QM3A 5E1WA 3P9CA 5CVUA 2DK5A 4IJAA 4P96A 1MJAA 1SAXA 5ICEA 3DXJF 5K5OA 2V9VA 2PBIA 1MJBA 5BQTA 2PLYA 2FRHA 3E5QA 1OYWA 2R7FA 2HYFA 4LLLA 3I0TA 4Y13A 1I27A 3M9AA 2GQQA 1RNLA 4BH9A 5E20A 1HXDA 2ZMEA 3TOAA 4HW0A 4Y15A 4Q47A 3I58A 2FXAA 4G7OF 4OIOF 1J59A 1R5GA 5LHHA 1B59A 3PQKA 1KYZA 2LNBA 4HYEA 4CXFA 4YG2F 2H27A 3MQ0A 2LF8A 2COMA 2PG4A 1E17A 3GYHX 1QZYA 2ZCWA 3ERED 1SD7A 4EMSA 2XKOA 4R8HA 1FBUA 4G6QA 3F6VA 1Z6RA 3RTRA 3J81K 2IA1A 1TNTA 1LDDA 3WGHA 1ZGJA 1Z7UA 1HW2A 4OMZA 2V1XA 5HDNA 1QQIA 3E6BA 2PN6A 2W84A 3EDPA 2UXXA 3IRRA 4RGRA 2HOEA 3P9IA 5D6EA 3FZVA 2NNYA 3OV8A 2P5LC 2PJPA 5L3BA 4O5VA 4I0AA 2RKHA 3RYRA 2HTSA 4ENKA 3P9KA 2O8XA 1SMTA 2M87A 3K69A 2EFOA 4M74A 4ENNA 2IA0A 3LWFA 5LGTA 3KCCA 2HDCA 1D8JA 2CGPA 4ZYGA 1STZA 3CUOA 5LRRA 2Y75A 2KIUA 2P6SA 1BI2A 3GW2A 2DBBA 3K1MA 3FX3A 2QLZA 1OMIA 1IN6A 2FE3A 5HOOA 4P9UA 4IRGA 3FXUA 1JHHA 1T0FA 3NRVA 4CYDA 2W25A 2ESHA 4JBAA 1XDUA 5CYVA 1FOKA 2XKPA 2HQNA 5ILSA 1TTYA 3EETA 5D4RA 1ON2A 3R60A 5EEGA 4BXUA 1JXSA 1IXSB 1R58A 3EQLF 2STWA 2IRFG 2IA2A 4FX0A 2VBYA 3F8FA 4RB2C 5D6FA 3WTYC 1YTYA 1LDJA 5E8GA 1U78A 4L5IA 3GZ6A 4KN7X 4EM0B 1U8RA 4M9ZA 3FMSA 1FX7A 2VBZA 1K78B 3BOQA 3ISPA 2EV6A 4NHJA 1HSTA 4I7HA 4EJWA 2O6GE 3BDDA 1XN7A 3DKWA 3MCZA 4LLGF 4GYIA 3MFKA 2LSOA 1REPC 1YYVA 4BNCA 1P4XA 3ELKA 6PAXA 1U5TA 3LSTA 3O3KA 2KJBA 2D1VA 4LB5A 1U2WA 5EEHA 4IXAA 4LK1F 1KA8A 1K6OA 3RKWA 3TGNA 1FP1D 5LRSA 3KLNA 3R6SA 3CUQC 4I09A 1ZG5A 1S29A 4IVNA 2XAGA 3KP2A 2XAHA 2ZO4A 2MLGA 5K5RA 3QRFF 4L9VA 2D1HA 5CVRA 5DD4A 3B73A 3HTUA 1YQAA 4LB6B 3KFWX 3V7SA 1W4MA 4YFNF 5FD5A 5FLXZ 1WRJA 1BIBA 2EA2A 4LG0A 4RS8A 1ZREA 3F8MA 4MGRA 2OZ6A 1F1ZA 4KT5C 2V1UA 4HF2A 1RIOH 3CDHA 5H6RA 5DYMA 4G8XA 3C18A 1A04A 2W85A 3TO9A 2M5WA 4HQEA 3HHGA 5LGNA 3IRQA 3F72A 4F7ZA 1TW2A 4KIGA 2UXNA 1J5YA 3BJOA 3T8RA 1EH8A 4G7HF 5JVTA 1MKMA 1WSUA 4MNUA 5FB2A 2FF4A 4B09A 4KMUX 4NB5A 3RKXA 4DQ2A 3M1EA 3HYIA 2VE8A 3TDZC 1T98A 3BROA 2V6CA 4CHUA 1USSA 1H9GA 1GVJA 5L3DA 1LJ9A 1ONVA 3FF5A 1W7PB 4ESBA 3I4PA 2RN7A 3IC7A 1IF1A 4MEXF 2EFPA 3VOEA 1EV7A 1QBJA 4OMYA 2HKXA 3I59A 4IHTA 2M30A 2FSWA 4RB0A 2F5FA 2VOOA 1O57A 2XASA 1I1SA 2F5CA 5FLXK 4HBLA 1R5HA 5HS8A 2VBXA 4A6EA 4IPAA 1SFUA 4AVPA 4HAMA 1XSXA 4RB3C 2Y0MA 2LF7A 3C7JA 3H3ZA 3IL2A 4HX8A 5FO5A 1R23A 3BJ6A 3ML6A 3LA2A 4XSZF 4N9HA 4XRFA 3E5UA 3DPLC 2A61A 4ZZDA 3U9GA 3GZ5A 3N4MA 3MEXA 4HF0A 1LEBA 1F5TA 4XBFA 2BGCA 2GXBA 1T6SA 2QQBA 2UWMA 4EQQA 2L54A 1GXPA 1QNTA 1XD7A 3ROUA 2MC3A 5JR3A 4U7BA 2P4WA 1U3EM 4S05A 5LBQA 5D4SA 1FSEA 2F2EA 4FX4A 2DPDA 1R1VA 2X4HA 4AWXB 2MLKA 1VTNC 2ACJA 3QU3A 3B02A 3RPQA 5J8CA 1OYIA 5HS7A 3CLOA 2P6TA 2ISYA 3COAC 3IWFA 5E1ZB 2EK5A 4A2UA 3ZMDA 4AIHA 1B1BA 3SZPA 2LKPA 4YIIA 2K4JA 2V1DA 1KQ8A 1P4AA 3F8NA 2ZKZA 4BHBA 2VC0A 1K79A 3VFZA 4E70A 3HTSB 4I0BA 3FM3A 2XRNA 2VC1A 1ON1A 1U5TB 1J0RA 4U0YA 4O3MA 2DW4A 4RGXA 3E3VA 2JPBA 2CW0F 2O61A 4IHSA 1W5TA 3DQVC 3JAMK 1FLIA 1D8KA 1TQIA 1HBXG 1QZZA 2RDPA 2JSCA 2J5PA 2P8TA 1MDMA 4GGGA 1KGSA 3VB2A 3FHZA 1B6AA 2L3DA 3E6DA 4IRIA 4A12A 3LQQA 1ODDA 3BPXA 3ZMZA 5BS6A 2EB7A 4Q48A 3J7AO 5D5UB 3I64A 5ILUA 2DT5A 1Z9CA 1ZGAA 4A6DA 2HQRA 4AIJA 1AOYA 4EGZA 2ELHA 2K02A 4ENMA 1WWXA 3WTSC 2EJRA 1KQ9A 2VXZA 1SD4A 2IP2A 4KMFA 2JPCA 2K27A 2BV6A 1P2FA 1UHMA 4WXCA 4S04A 1UFMA 3BZ6A 1YLFA 4AIKA 5TRDA 4BQAA 2XUBA 2XAQA 2Z5UA 2KKOA 4OIQF 1ULYA 3KEOA 4L5JA 4ASNA 3J80Z 1XSVA 2K4BA 4KIBA 4PCQA 5FD6A 4EJVA 2X0LA 4EM2A 3TO6A 3DV8A 1P92A 3GFLA 2WWYA 1FT9A 2WC2A 3KLOA 3JAMZ 1XSDA 5E17F 1F4KA 1YW8A 4QWQA 2CFXA 1RZ4A 4WXHA 1TLHB 1SFXA 2O03A 5DUKA 3BPVA 1RI7A 2PQ8A 2HGCA 2XIGA 1Y0UA 3K0LA 4BYYA 1Q1HA 1W7PD 1T38A 2E1CA 4A0YA 1LVAA 3GWZA 3GLXA 4GYGA 3SFZA 1CF7A 1BIAA 3EYYA 2OQRA 2RQPA 3F8CA 3GX4X 2ESNA 1TW3A 2QWWA 4ESJA 4ZYHA 1S6LA 3FXRA 3V7RA 2HR3A 5HDKA 2M45A 5DDGA 1Z05A 1ZG3A 2O3FA 2PMHA 3DFGA 1KU7A 3ZMTA 3F22A 3QP5A 4JK1X 2RNJA 2FBIA 3FMRA 2DI3A 2L02A 3FM5A 4LG0B 3KP4A 3JW4A 1O3TA 1IN8A 2W24A 1LDKB 4ON0A 1XB4A 3RPUA 4LK0F 1XDSA 1Z6TA 3RJPA 2A69F 2MBFA 1DUXC 1OYYA 5AIPA 1XCVA 4UV9A 3JSOA 4XLPF 3QPTA 5L3GA 4CDGA 2GAUA 3ECHA 3HSRA 4G7ZF 3CJNA 4N0BA 1YG2A 1T39A 2YPRA 1FZPB 4KN4X 2EWNA 4RGUA 1I6XA 2ADUA 3L00A 3LA7A 5D5WB 5FFXA 3SXYA 1CF7B 3WE3A 2ZJ2A 3ABTA 1YO5C 3MZHA 2GZWA 4EJOA 2MA3A 1J7KA 1FYLA 4R1HA 1JE8A 3KP3A 3ZMSA 3WU1B 3RIRA 3ZPLA 3WGGA 2V79A 4O6JA 3WTXC 3JTHA 1BI0A 3ZQ7A 1W5SA 5D5XB 2MH9A 4WXDA 3IWZA 3H92A 2QUFA 1HKSA 5FFZA 3J80K 3FXQA 1X3UA 5LHGA 1FWZA 5HLIA 4A0XA 4PZJA 3QPHA 4FHTA 2DFIA 4ETSA 1KYWA 3K2ZA 5HVQC 4ZYDA 2A3SA 2FNAA 2NNNA 1FBQA 4NQWA 2RV8A 4JQFA 4KYWA 4ESFA 1U5TC 1R36A 5BMZA 2FNPA 4U88A 2HS5A 3L7WA 4CICA 4N9IA 3LAPA 5LEKA 5JHUA 2GIVA 3HSEA 2E7XA 3WTWC 4UUVA 3LFKA 2NRAC 1KU2A 1UHWA 4B8XA 1IZ1A 2WTEA 4CZZA 1C0WA 4P5OA 2DU9A 5F6FA 1IN4A 2A6HF 4EJUA 4G94A 4HF1A 4YIFA 1O3SA 4L9NA 1S7AA 1LB2A 2ISZA 2HEOA 5LGUA 1S8NA 1L0OC 1FNNA 3C3WA 2AS5F 3ZMUA 5DCMA 3L09A 1ZRCA 3HUGA 2QYOA 1EH7A 2MH2A 4LD5A 3G73A 2OA4A 2DLLA 4Q4ZF 2PFBA 1HKQA 5CVJA 1J75A 3J81Z 1D3YA 3TQNA 4BHCA 3H3UA 3KP6A 2YSRA 1J9IA 3OOPA 2EV5A 1YS6A 1WQ2A 2BEOA 4KDPA 3SQNA 2D2WA 2VBWA 4I2OA 2KRFA 4UV8A 4EGYA 1TQMA 5AONA 4XSXF 2BE5F 2Y48A 3Q9SA 2OBPA 1HQCA 3U2RA 1O7FA 3IKVA 1YW9A 2OQGA 2P7VB 3QAHA 4DNCA 1PDNC 2VE9A 5JI6A 5K1YA 1F9NA 2ZFWA 3E97A 4ZH4F 4LFUA 4U0VA 5ICFA 1S7OA 4G6DA 1FC3A 3GFMA 4PGHA 2H09A 1QGPA 2KJCA 3WE2A 4GXOA 2P5VA 2YX7A 3HHHA 5L3EA 5HDGA 5IT3A 2YR2A 4U7DA 2PI0A 3REOA 3HOSA 1BBYA 2HKOA 3QU6A 2IW5A 2G7HA 2STTA 4LLNA 1S3JA 2P7CB 2VOPA 1GXQA 3I54A 1BM9A 4A0ZA 1YFHA 1TQPA 3GO5A 1XGOA 4OINF 2DK8A 2EFQA 3K1NA 1HW1A 2M8EA 2FU4A 4KUMA 3PQJA 1G3SA 3F23A 3V8LA 1KQ0A 4RAYA 3T5XA 2E1NA 4UVBA 3L9FA 5KK1A 3RKYA 1Z1DA 2Z9OA 3SHFA 2H6BA 5CLSA 2H94A 5ILVA 2HWVA 2EA4A 3JSPA 1IAWA 2DTRA 3GEZA 4OIRF 2KIMA 1WKMA 1ZN2A 5AIQA 4R79A 1E2XA 1JHFA 1G4DA 3D5LA 3GFJA 2CG4A 2DAOA 3D0SA 2VN2A 3KETA 3CUQA 2LDUA 3ZP5A 2D45A 2M1BA 1QPMA 1KU9A 2FMYA 3GFIA 2EFNA 2YU3A 1DP7P 1YIOA 4RAZA 2RGVA 5L3FA 4P9FA 3ZN1A 3LAJA 5CVIA 4L0YB 3EYIA 2L4MA 4U0WA 3O6BB 4M72A 3T1BA 4LGWA 4HV5A 3R4KA 2FMLA 2OD5A 2E7WA 4IF4A 1OKRA 4HDVA 5LHIA 2ZXJA 4I98B 2W57A 2IJLA 5F64A 5CJ9A 4Q5SF 1B4AA 1I5ZA 4WWCA 5BPIA 3WTVC 2QQ9A 1IN7A 4BAYA 2DPUA 1CGPA 2IPQX 4EVIA 1R1UA 3PFIA 1K78A 2CYYA 2ETHA 5HLHA 3TO7A 3WODF 2RVCA 4HX7A 4YFKF 3F6OA 5IT9K 4A5NA 3C1DA 3ECOA 4ZZLA 1HW5A 3ZMVA 2P5KA 3DEUA 3O2PE 2VONA 1MZBA 1WI9A 4EV0A 1P6RA 2XAFA 3Q9VA 1UB9A 5HLGA 1ZAOA 1ZRFA 2NS0A 4RGSA 3NQOA 1FY7A 1G3WA 1EH6A 2DO7A 2HYGD 4HZFA 5ED4A 4LMYA 4KICA 3VODA 4L0ZB 4HDUA 3WTZA 3WG9A 1BI1A 1YW7A 4HLYA 1FP2A 1LNWA 5BOXA 2WV0A 3RYPA 2EFWA 5ERIA 1B9NA 1G6NA 3CO6C 1XCBA 3TKYA 4HA8A 2GA2A 1IXRC 1PP8F 1NHAA 3RI4A 3N97A 2O0YA 3WTUC 4HX4A 2VT2A 5KVRA 1IRFA 1MD0A 2Z3YA 1USTA 4WX9A 1GHCA 2NAZA 5ICGA 1ZG1A 4WK8F 3U1DA 2G7UA 2H6CA 1U6GA 3DF8A 2FEZA 3Q5FA 3IHUA 5D5VB 4WF2A 3IKTA 2QENA 1FPQA 2Q8KA 3BWGA 2QVOA 1FYKA 4XLNF 2ZMEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCV A;  4OOI A;  2UZK A;  1J2X A;  2CWE A;  4M6Y A;  3DPT A;  4ENJ A;  3HRU A;  1RUO A;  2A68 F;  4Z2Y A;  4P55 A;  2F5E A;  3MWM A;  2VT3 A;  2B0L A;  2HFH A;  2PMU A;  2TDX A;  3HRT A;  1HKT A;  1IW7 F;  2EV0 A;  2JT1 A;  2JZY A;  3HIF A;  2HTJ A;  1BOA A;  1JGS A;  1R00 A;  3LA3 A;  4M6X A;  2A5Y B;  3E6M A;  2F5D A;  2QBY B;  3V8J A;  3V8K A;  1D5V A;  1UCR A;  2FBH A;  1BC8 C;  4I01 A;  1G3Y A;  2XVC A;  4MQV A;  2A6E F;  3F21 A;  5BPD A;  3I59 B;  1H9T A;  1R1T A;  2CO5 A;  5D8L B;  2CSO A;  3R61 A;  1HSJ A;  2OU2 A;  3F8B A;  1TNS A;  2Q0O A;  5DV5 A;  3TDU C;  3V4G A;  2YX4 A;  2BYV E;  1R7J A;  1K7A A;  1I1G A;  1LEA A;  5DCM B;  3M7G A;  4D0P A;  3I71 A;  1PP7 U;  3HRM A;  1YS7 A;  5DEQ A;  2R3S A;  2IVM A;  1TBX A;  4AD9 A;  1BI3 A;  2QBY A;  1OR7 A;  1BJA A;  5ICC A;  3QOP A;  4CO8 A;  4KA4 A;  1FBS A;  1Z91 A;  3W6K B;  3M8E A;  4MTD A;  2C6Y A;  1ZRD A;  1V4R A;  2FBK A;  4L9T A;  2HZT A;  2R7D A;  2OZU A;  1W7P A;  4ZYE A;  4M71 A;  3JTG A;  2ZNY A;  3BP8 A;  5TJJ A;  3WGI A;  1L3L A;  2GWR A;  3HOT A;  4M73 A;  3SZT A;  3FMQ A;  1XMK A;  4MEY F;  2K86 A;  2Z33 A;  1PUE E;  4CGZ A;  1SD5 A;  5E1X A;  2KIF A;  5LLQ A;  3FWE A;  3K9T A;  4EM1 A;  1ZAR A;  1P4W A;  1MJ9 A;  5DD8 A;  2Q2E A;  3T0Y A;  4UHT A;  1BN5 A;  3CTA A;  3MZY A;  3P7N A;  2L4A A;  4RB1 A;  4H0E A;  2CQK A;  3LQR A;  2DQR A;  1SMY F;  4YFX F;  1B9M A;  1IN5 A;  2NYX A;  1KU3 A;  5K5Q A;  3AAF A;  3TOB A;  3BJA A;  3KZZ A;  1SFE A;  3RDI A;  4KFC A;  1G3T A;  4L18 B;  1O3R A;  2QZ8 A;  3G3Z A;  2BBY A;  2IT0 A;  1OPC A;  2J5O A;  4FT8 A;  4KNY A;  1IUY A;  1IXC A;  2AXL A;  2GXG A;  2XRO A;  3BY6 A;  2ZNZ A;  3M8F A;  1DDN A;  3EUH A;  2XHK A;  4QLC U;  1XMA A;  4IRH A;  4HLX A;  5A2Q Z;  5E18 F;  5LEJ A;  4MHG A;  5J6X A;  4Y17 A;  1ZHF A;  1FYM A;  1IRG A;  2PEX A;  2A07 F;  2QQA A;  3ULQ B;  1V3F A;  3ABU A;  1R22 A;  1ZLK A;  5H6Q A;  1ZLJ A;  3HSF A;  3CUQ B;  4L9J A;  5DUI A;  3ZN0 A;  1XGM A;  1ZH5 A;  5E8I A;  1SD6 A;  3QP6 A;  3W6J B;  2MD5 A;  1RUN A;  5CVV A;  3KP5 A;  5H20 A;  2GA1 A;  3DP7 A;  3KP7 A;  4MTE A;  1T2K A;  3GXO A;  2JRT A;  1FSH A;  1MDM B;  2G9W A;  2XV4 S;  1LQ1 A;  2FA5 A;  2DQL A;  4M9X A;  4LJZ F;  3R0J A;  2JTV A;  3KZY A;  4UVC A;  5FGM A;  4HV6 A;  4UNO A;  4K2E A;  1DPR A;  3E6C C;  5D8K B;  5J8F A;  2FQ3 A;  4PDK A;  4OIP F;  3WU0 A;  4TV7 A;  1H0M A;  3R0A A;  1QO0 D;  3GF2 A;  3KEQ A;  3F3X A;  5L3C A;  3K1P A;  5F1R A;  2OAZ A;  1XGN A;  4OU0 A;  1AWC A;  2RC4 A;  2ZBK A;  3I5U A;  1ZYR F;  3CO7 C;  4PGG A;  3NEU A;  4HQM A;  2XGX A;  3V7C A;  5DCF A;  1O3Q A;  3I53 A;  1BC7 C;  4GO1 A;  5JFR A;  5A2Q K;  3GUD A;  3L2C A;  1DPU A;  2K7L A;  3T8T A;  4BHP A;  4KIF A;  4A5M A;  3WTT C;  3KE2 A;  2XAJ A;  4WCG A;  4I02 A;  4EJT A;  2FOK A;  2L01 A;  2Z99 A;  3HRS A;  5HS9 A;  3E5X A;  1XGS A;  1O7L A;  4G9Y A;  4UXN A;  4HOB A;  2VOD A;  3VEP A;  1MGT A;  5IT9 Z;  4M9S A;  3GVA A;  3MAJ A;  4MQ9 F;  3S2W A;  4UVA A;  2QM3 A;  5E1W A;  3P9C A;  5CVU A;  2DK5 A;  4IJA A;  4P96 A;  1MJA A;  1SAX A;  5ICE A;  3DXJ F;  5K5O A;  2V9V A;  2PBI A;  1MJB A;  5BQT A;  2PLY A;  2FRH A;  3E5Q A;  1OYW A;  2R7F A;  2HYF A;  4LLL A;  3I0T A;  4Y13 A;  1I27 A;  3M9A A;  2GQQ A;  1RNL A;  4BH9 A;  5E20 A;  1HXD A;  2ZME A;  3TOA A;  4HW0 A;  4Y15 A;  4Q47 A;  3I58 A;  2FXA A;  4G7O F;  4OIO F;  1J59 A;  1R5G A;  5LHH A;  1B59 A;  3PQK A;  1KYZ A;  2LNB A;  4HYE A;  4CXF A;  4YG2 F;  2H27 A;  3MQ0 A;  2LF8 A;  2COM A;  2PG4 A;  1E17 A;  3GYH X;  1QZY A;  2ZCW A;  3ERE D;  1SD7 A;  4EMS A;  2XKO A;  4R8H A;  1FBU A;  4G6Q A;  3F6V A;  1Z6R A;  3RTR A;  3J81 K;  2IA1 A;  1TNT A;  1LDD A;  3WGH A;  1ZGJ A;  1Z7U A;  1HW2 A;  4OMZ A;  2V1X A;  5HDN A;  1QQI A;  3E6B A;  2PN6 A;  2W84 A;  3EDP A;  2UXX A;  3IRR A;  4RGR A;  2HOE A;  3P9I A;  5D6E A;  3FZV A;  2NNY A;  3OV8 A;  2P5L C;  2PJP A;  5L3B A;  4O5V A;  4I0A A;  2RKH A;  3RYR A;  2HTS A;  4ENK A;  3P9K A;  2O8X A;  1SMT A;  2M87 A;  3K69 A;  2EFO A;  4M74 A;  4ENN A;  2IA0 A;  3LWF A;  5LGT A;  3KCC A;  2HDC A;  1D8J A;  2CGP A;  4ZYG A;  1STZ A;  3CUO A;  5LRR A;  2Y75 A;  2KIU A;  2P6S A;  1BI2 A;  3GW2 A;  2DBB A;  3K1M A;  3FX3 A;  2QLZ A;  1OMI A;  1IN6 A;  2FE3 A;  5HOO A;  4P9U A;  4IRG A;  3FXU A;  1JHH A;  1T0F A;  3NRV A;  4CYD A;  2W25 A;  2ESH A;  4JBA A;  1XDU A;  5CYV A;  1FOK A;  2XKP A;  2HQN A;  5ILS A;  1TTY A;  3EET A;  5D4R A;  1ON2 A;  3R60 A;  5EEG A;  4BXU A;  1JXS A;  1IXS B;  1R58 A;  3EQL F;  2STW A;  2IRF G;  2IA2 A;  4FX0 A;  2VBY A;  3F8F A;  4RB2 C;  5D6F A;  3WTY C;  1YTY A;  1LDJ A;  5E8G A;  1U78 A;  4L5I A;  3GZ6 A;  4KN7 X;  4EM0 B;  1U8R A;  4M9Z A;  3FMS A;  1FX7 A;  2VBZ A;  1K78 B;  3BOQ A;  3ISP A;  2EV6 A;  4NHJ A;  1HST A;  4I7H A;  4EJW A;  2O6G E;  3BDD A;  1XN7 A;  3DKW A;  3MCZ A;  4LLG F;  4GYI A;  3MFK A;  2LSO A;  1REP C;  1YYV A;  4BNC A;  1P4X A;  3ELK A;  6PAX A;  1U5T A;  3LST A;  3O3K A;  2KJB A;  2D1V A;  4LB5 A;  1U2W A;  5EEH A;  4IXA A;  4LK1 F;  1KA8 A;  1K6O A;  3RKW A;  3TGN A;  1FP1 D;  5LRS A;  3KLN A;  3R6S A;  3CUQ C;  4I09 A;  1ZG5 A;  1S29 A;  4IVN A;  2XAG A;  3KP2 A;  2XAH A;  2ZO4 A;  2MLG A;  5K5R A;  3QRF F;  4L9V A;  2D1H A;  5CVR A;  5DD4 A;  3B73 A;  3HTU A;  1YQA A;  4LB6 B;  3KFW X;  3V7S A;  1W4M A;  4YFN F;  5FD5 A;  5FLX Z;  1WRJ A;  1BIB A;  2EA2 A;  4LG0 A;  4RS8 A;  1ZRE A;  3F8M A;  4MGR A;  2OZ6 A;  1F1Z A;  4KT5 C;  2V1U A;  4HF2 A;  1RIO H;  3CDH A;  5H6R A;  5DYM A;  4G8X A;  3C18 A;  1A04 A;  2W85 A;  3TO9 A;  2M5W A;  4HQE A;  3HHG A;  5LGN A;  3IRQ A;  3F72 A;  4F7Z A;  1TW2 A;  4KIG A;  2UXN A;  1J5Y A;  3BJO A;  3T8R A;  1EH8 A;  4G7H F;  5JVT A;  1MKM A;  1WSU A;  4MNU A;  5FB2 A;  2FF4 A;  4B09 A;  4KMU X;  4NB5 A;  3RKX A;  4DQ2 A;  3M1E A;  3HYI A;  2VE8 A;  3TDZ C;  1T98 A;  3BRO A;  2V6C A;  4CHU A;  1USS A;  1H9G A;  1GVJ A;  5L3D A;  1LJ9 A;  1ONV A;  3FF5 A;  1W7P B;  4ESB A;  3I4P A;  2RN7 A;  3IC7 A;  1IF1 A;  4MEX F;  2EFP A;  3VOE A;  1EV7 A;  1QBJ A;  4OMY A;  2HKX A;  3I59 A;  4IHT A;  2M30 A;  2FSW A;  4RB0 A;  2F5F A;  2VOO A;  1O57 A;  2XAS A;  1I1S A;  2F5C A;  5FLX K;  4HBL A;  1R5H A;  5HS8 A;  2VBX A;  4A6E A;  4IPA A;  1SFU A;  4AVP A;  4HAM A;  1XSX A;  4RB3 C;  2Y0M A;  2LF7 A;  3C7J A;  3H3Z A;  3IL2 A;  4HX8 A;  5FO5 A;  1R23 A;  3BJ6 A;  3ML6 A;  3LA2 A;  4XSZ F;  4N9H A;  4XRF A;  3E5U A;  3DPL C;  2A61 A;  4ZZD A;  3U9G A;  3GZ5 A;  3N4M A;  3MEX A;  4HF0 A;  1LEB A;  1F5T A;  4XBF A;  2BGC A;  2GXB A;  1T6S A;  2QQB A;  2UWM A;  4EQQ A;  2L54 A;  1GXP A;  1QNT A;  1XD7 A;  3ROU A;  2MC3 A;  5JR3 A;  4U7B A;  2P4W A;  1U3E M;  4S05 A;  5LBQ A;  5D4S A;  1FSE A;  2F2E A;  4FX4 A;  2DPD A;  1R1V A;  2X4H A;  4AWX B;  2MLK A;  1VTN C;  2ACJ A;  3QU3 A;  3B02 A;  3RPQ A;  5J8C A;  1OYI A;  5HS7 A;  3CLO A;  2P6T A;  2ISY A;  3COA C;  3IWF A;  5E1Z B;  2EK5 A;  4A2U A;  3ZMD A;  4AIH A;  1B1B A;  3SZP A;  2LKP A;  4YII A;  2K4J A;  2V1D A;  1KQ8 A;  1P4A A;  3F8N A;  2ZKZ A;  4BHB A;  2VC0 A;  1K79 A;  3VFZ A;  4E70 A;  3HTS B;  4I0B A;  3FM3 A;  2XRN A;  2VC1 A;  1ON1 A;  1U5T B;  1J0R A;  4U0Y A;  4O3M A;  2DW4 A;  4RGX A;  3E3V A;  2JPB A;  2CW0 F;  2O61 A;  4IHS A;  1W5T A;  3DQV C;  3JAM K;  1FLI A;  1D8K A;  1TQI A;  1HBX G;  1QZZ A;  2RDP A;  2JSC A;  2J5P A;  2P8T A;  1MDM A;  4GGG A;  1KGS A;  3VB2 A;  3FHZ A;  1B6A A;  2L3D A;  3E6D A;  4IRI A;  4A12 A;  3LQQ A;  1ODD A;  3BPX A;  3ZMZ A;  5BS6 A;  2EB7 A;  4Q48 A;  3J7A O;  5D5U B;  3I64 A;  5ILU A;  2DT5 A;  1Z9C A;  1ZGA A;  4A6D A;  2HQR A;  4AIJ A;  1AOY A;  4EGZ A;  2ELH A;  2K02 A;  4ENM A;  1WWX A;  3WTS C;  2EJR A;  1KQ9 A;  2VXZ A;  1SD4 A;  2IP2 A;  4KMF A;  2JPC A;  2K27 A;  2BV6 A;  1P2F A;  1UHM A;  4WXC A;  4S04 A;  1UFM A;  3BZ6 A;  1YLF A;  4AIK A;  5TRD A;  4BQA A;  2XUB A;  2XAQ A;  2Z5U A;  2KKO A;  4OIQ F;  1ULY A;  3KEO A;  4L5J A;  4ASN A;  3J80 Z;  1XSV A;  2K4B A;  4KIB A;  4PCQ A;  5FD6 A;  4EJV A;  2X0L A;  4EM2 A;  3TO6 A;  3DV8 A;  1P92 A;  3GFL A;  2WWY A;  1FT9 A;  2WC2 A;  3KLO A;  3JAM Z;  1XSD A;  5E17 F;  1F4K A;  1YW8 A;  4QWQ A;  2CFX A;  1RZ4 A;  4WXH A;  1TLH B;  1SFX A;  2O03 A;  5DUK A;  3BPV A;  1RI7 A;  2PQ8 A;  2HGC A;  2XIG A;  1Y0U A;  3K0L A;  4BYY A;  1Q1H A;  1W7P D;  1T38 A;  2E1C A;  4A0Y A;  1LVA A;  3GWZ A;  3GLX A;  4GYG A;  3SFZ A;  1CF7 A;  1BIA A;  3EYY A;  2OQR A;  2RQP A;  3F8C A;  3GX4 X;  2ESN A;  1TW3 A;  2QWW A;  4ESJ A;  4ZYH A;  1S6L A;  3FXR A;  3V7R A;  2HR3 A;  5HDK A;  2M45 A;  5DDG A;  1Z05 A;  1ZG3 A;  2O3F A;  2PMH A;  3DFG A;  1KU7 A;  3ZMT A;  3F22 A;  3QP5 A;  4JK1 X;  2RNJ A;  2FBI A;  3FMR A;  2DI3 A;  2L02 A;  3FM5 A;  4LG0 B;  3KP4 A;  3JW4 A;  1O3T A;  1IN8 A;  2W24 A;  1LDK B;  4ON0 A;  1XB4 A;  3RPU A;  4LK0 F;  1XDS A;  1Z6T A;  3RJP A;  2A69 F;  2MBF A;  1DUX C;  1OYY A;  5AIP A;  1XCV A;  4UV9 A;  3JSO A;  4XLP F;  3QPT A;  5L3G A;  4CDG A;  2GAU A;  3ECH A;  3HSR A;  4G7Z F;  3CJN A;  4N0B A;  1YG2 A;  1T39 A;  2YPR A;  1FZP B;  4KN4 X;  2EWN A;  4RGU A;  1I6X A;  2ADU A;  3L00 A;  3LA7 A;  5D5W B;  5FFX A;  3SXY A;  1CF7 B;  3WE3 A;  2ZJ2 A;  3ABT A;  1YO5 C;  3MZH A;  2GZW A;  4EJO A;  2MA3 A;  1J7K A;  1FYL A;  4R1H A;  1JE8 A;  3KP3 A;  3ZMS A;  3WU1 B;  3RIR A;  3ZPL A;  3WGG A;  2V79 A;  4O6J A;  3WTX C;  3JTH A;  1BI0 A;  3ZQ7 A;  1W5S A;  5D5X B;  2MH9 A;  4WXD A;  3IWZ A;  3H92 A;  2QUF A;  1HKS A;  5FFZ A;  3J80 K;  3FXQ A;  1X3U A;  5LHG A;  1FWZ A;  5HLI A;  4A0X A;  4PZJ A;  3QPH A;  4FHT A;  2DFI A;  4ETS A;  1KYW A;  3K2Z A;  5HVQ C;  4ZYD A;  2A3S A;  2FNA A;  2NNN A;  1FBQ A;  4NQW A;  2RV8 A;  4JQF A;  4KYW A;  4ESF A;  1U5T C;  1R36 A;  5BMZ A;  2FNP A;  4U88 A;  2HS5 A;  3L7W A;  4CIC A;  4N9I A;  3LAP A;  5LEK A;  5JHU A;  2GIV A;  3HSE A;  2E7X A;  3WTW C;  4UUV A;  3LFK A;  2NRA C;  1KU2 A;  1UHW A;  4B8X A;  1IZ1 A;  2WTE A;  4CZZ A;  1C0W A;  4P5O A;  2DU9 A;  5F6F A;  1IN4 A;  2A6H F;  4EJU A;  4G94 A;  4HF1 A;  4YIF A;  1O3S A;  4L9N A;  1S7A A;  1LB2 A;  2ISZ A;  2HEO A;  5LGU A;  1S8N A;  1L0O C;  1FNN A;  3C3W A;  2AS5 F;  3ZMU A;  5DCM A;  3L09 A;  1ZRC A;  3HUG A;  2QYO A;  1EH7 A;  2MH2 A;  4LD5 A;  3G73 A;  2OA4 A;  2DLL A;  4Q4Z F;  2PFB A;  1HKQ A;  5CVJ A;  1J75 A;  3J81 Z;  1D3Y A;  3TQN A;  4BHC A;  3H3U A;  3KP6 A;  2YSR A;  1J9I A;  3OOP A;  2EV5 A;  1YS6 A;  1WQ2 A;  2BEO A;  4KDP A;  3SQN A;  2D2W A;  2VBW A;  4I2O A;  2KRF A;  4UV8 A;  4EGY A;  1TQM A;  5AON A;  4XSX F;  2BE5 F;  2Y48 A;  3Q9S A;  2OBP A;  1HQC A;  3U2R A;  1O7F A;  3IKV A;  1YW9 A;  2OQG A;  2P7V B;  3QAH A;  4DNC A;  1PDN C;  2VE9 A;  5JI6 A;  5K1Y A;  1F9N A;  2ZFW A;  3E97 A;  4ZH4 F;  4LFU A;  4U0V A;  5ICF A;  1S7O A;  4G6D A;  1FC3 A;  3GFM A;  4PGH A;  2H09 A;  1QGP A;  2KJC A;  3WE2 A;  4GXO A;  2P5V A;  2YX7 A;  3HHH A;  5L3E A;  5HDG A;  5IT3 A;  2YR2 A;  4U7D A;  2PI0 A;  3REO A;  3HOS A;  1BBY A;  2HKO A;  3QU6 A;  2IW5 A;  2G7H A;  2STT A;  4LLN A;  1S3J A;  2P7C B;  2VOP A;  1GXQ A;  3I54 A;  1BM9 A;  4A0Z A;  1YFH A;  1TQP A;  3GO5 A;  1XGO A;  4OIN F;  2DK8 A;  2EFQ A;  3K1N A;  1HW1 A;  2M8E A;  2FU4 A;  4KUM A;  3PQJ A;  1G3S A;  3F23 A;  3V8L A;  1KQ0 A;  4RAY A;  3T5X A;  2E1N A;  4UVB A;  3L9F A;  5KK1 A;  3RKY A;  1Z1D A;  2Z9O A;  3SHF A;  2H6B A;  5CLS A;  2H94 A;  5ILV A;  2HWV A;  2EA4 A;  3JSP A;  1IAW A;  2DTR A;  3GEZ A;  4OIR F;  2KIM A;  1WKM A;  1ZN2 A;  5AIQ A;  4R79 A;  1E2X A;  1JHF A;  1G4D A;  3D5L A;  3GFJ A;  2CG4 A;  2DAO A;  3D0S A;  2VN2 A;  3KET A;  3CUQ A;  2LDU A;  3ZP5 A;  2D45 A;  2M1B A;  1QPM A;  1KU9 A;  2FMY A;  3GFI A;  2EFN A;  2YU3 A;  1DP7 P;  1YIO A;  4RAZ A;  2RGV A;  5L3F A;  4P9F A;  3ZN1 A;  3LAJ A;  5CVI A;  4L0Y B;  3EYI A;  2L4M A;  4U0W A;  3O6B B;  4M72 A;  3T1B A;  4LGW A;  4HV5 A;  3R4K A;  2FML A;  2OD5 A;  2E7W A;  4IF4 A;  1OKR A;  4HDV A;  5LHI A;  2ZXJ A;  4I98 B;  2W57 A;  2IJL A;  5F64 A;  5CJ9 A;  4Q5S F;  1B4A A;  1I5Z A;  4WWC A;  5BPI A;  3WTV C;  2QQ9 A;  1IN7 A;  4BAY A;  2DPU A;  1CGP A;  2IPQ X;  4EVI A;  1R1U A;  3PFI A;  1K78 A;  2CYY A;  2ETH A;  5HLH A;  3TO7 A;  3WOD F;  2RVC A;  4HX7 A;  4YFK F;  3F6O A;  5IT9 K;  4A5N A;  3C1D A;  3ECO A;  4ZZL A;  1HW5 A;  3ZMV A;  2P5K A;  3DEU A;  3O2P E;  2VON A;  1MZB A;  1WI9 A;  4EV0 A;  1P6R A;  2XAF A;  3Q9V A;  1UB9 A;  5HLG A;  1ZAO A;  1ZRF A;  2NS0 A;  4RGS A;  3NQO A;  1FY7 A;  1G3W A;  1EH6 A;  2DO7 A;  2HYG D;  4HZF A;  5ED4 A;  4LMY A;  4KIC A;  3VOD A;  4L0Z B;  4HDU A;  3WTZ A;  3WG9 A;  1BI1 A;  1YW7 A;  4HLY A;  1FP2 A;  1LNW A;  5BOX A;  2WV0 A;  3RYP A;  2EFW A;  5ERI A;  1B9N A;  1G6N A;  3CO6 C;  1XCB A;  3TKY A;  4HA8 A;  2GA2 A;  1IXR C;  1PP8 F;  1NHA A;  3RI4 A;  3N97 A;  2O0Y A;  3WTU C;  4HX4 A;  2VT2 A;  5KVR A;  1IRF A;  1MD0 A;  2Z3Y A;  1UST A;  4WX9 A;  1GHC A;  2NAZ A;  5ICG A;  1ZG1 A;  4WK8 F;  3U1D A;  2G7U A;  2H6C A;  1U6G A;  3DF8 A;  2FEZ A;  3Q5F A;  3IHU A;  5D5V B;  4WF2 A;  3IKT A;  2QEN A;  1FPQ A;  2Q8K A;  3BWG A;  2QVO A;  1FYK A;  4XLN F;  2ZME B; 
#chains in the Genus database with same CATH topology
 2RAE A;  4J01 A;  2LH9 A;  4GCV A;  5CKT A;  4OOI A;  2MGQ A;  1TWA J;  2UZK A;  2F6C A;  1J2X A;  1YJ9 I;  1A35 A;  2CWE A;  4M3D A;  4M6Y A;  3LL7 A;  2CQQ A;  3CJR B;  3DPT A;  4BGD A;  3A01 A;  4ENJ A;  5TGT A;  1MMN A;  1OR7 C;  4E7S A;  3HRU A;  4XIC A;  1RUO A;  2WB1 A;  3HBL A;  3VYR B;  2A68 F;  2LP0 A;  2M0C A;  3IUO A;  4Z2Y A;  4P55 A;  2F5E A;  3HZJ A;  3MWM A;  5B5E C;  2VT3 A;  5KHD A;  2B0L A;  2HFH A;  2PMU A;  4JX4 A;  2TDX A;  3HRT A;  2NVT J;  1HKT A;  1IW7 F;  2EV0 A;  2JT1 A;  2JZY A;  3A0B C;  3HIF A;  4CCJ A;  2HTJ A;  1BOA A;  1D0Y A;  3L2U A;  2R92 J;  1JGS A;  1R00 A;  3LA3 A;  1CQT A;  4M6X A;  2A5Y B;  2BY0 A;  3CCQ I;  3E6M A;  2F5D A;  2QBY B;  5FKM A;  3V8J A;  3V8K A;  5J1R A;  5EF6 A;  2XB5 A;  1D5V A;  1UCR A;  2JA7 J;  2FBH A;  4HNU A;  1VQO I;  1BC8 C;  1MBJ A;  4I01 A;  2A6T A;  1TT5 B;  1A5J A;  1YX5 A;  4L5E A;  1G3Y A;  4I99 C;  4D5F A;  2XVC A;  4HSR A;  2EIK H;  2LOO A;  3EUA A;  3S15 J;  4MQV A;  2A6E F;  2HI3 A;  3J7Y J;  3F21 A;  5BPD A;  3I59 B;  1R6R A;  2GBY A;  5J40 A;  3SFI A;  1H9T A;  4DBQ A;  4E7J A;  4DW6 A;  1R1T A;  1I39 A;  3SZG A;  3HKZ A;  2CO5 A;  5D8L B;  2CSO A;  4CH7 A;  3R61 A;  1HSJ A;  2OU2 A;  3F8B A;  1TNS A;  3ZQH A;  2Q0O A;  5DV5 A;  1Y0N A;  3TDU C;  1U0J A;  3V4G A;  3OWT A;  1FMV A;  2YX4 A;  2BYV E;  5IYD J;  1R7J A;  1K7A A;  1I1G A;  1LEA A;  1W5C C;  1VI0 A;  1BR1 A;  1UMQ A;  3I71 A;  3M7G A;  5DCM B;  4D0P A;  1PP7 U;  2GLO A;  5EEA A;  1VFC A;  3HRM A;  1YS7 A;  5DEQ A;  2R3S A;  2IVM A;  1TBX A;  5B1B H;  4AD9 A;  1BI3 A;  1X2M A;  3BTI A;  4PFO A;  2QBY A;  1OR7 A;  1BJA A;  4BUP A;  5ICC A;  1X58 A;  3QOP A;  4CO8 A;  3TW7 A;  4KA4 A;  1BOB A;  1FBS A;  1Z91 A;  4V19 K;  3W6K B;  2EIN H;  3M8E A;  4MTD A;  1Y8Q B;  2C6Y A;  3E1S A;  1ZRD A;  1V4R A;  2FBK A;  4L9T A;  2HZT A;  1T56 A;  2OZU A;  2R7D A;  3QPS A;  1EJ9 A;  1W7P A;  4ZYE A;  4BEH B;  4M71 A;  3MD2 A;  1JUM A;  3JTG A;  2ZNY A;  2HZD A;  2H1K A;  3A4C A;  3BP8 A;  3S8P A;  1N78 A;  5TJJ A;  3K6G A;  5EGO A;  3WGI A;  1L3L A;  2GWR A;  2L9N A;  3HOT A;  4M73 A;  3SZT A;  3FMQ A;  1XMK A;  2CUE A;  4MEY F;  2K86 A;  1B8I A;  2Z33 A;  3DU5 A;  1PUE E;  4CGZ A;  1QHH D;  1SD5 A;  5E1X A;  1PUF A;  2KIF A;  2HPM A;  4DZP A;  2E71 A;  3FWE A;  2Y0S A;  5LLQ A;  1AU7 A;  3ZOB A;  5M3M J;  3K9T A;  1IDY A;  2E19 A;  1ZAR A;  3U1K A;  4EM1 A;  4G6T B;  4BY7 J;  1P4W A;  2KL4 A;  1YRN A;  1MJ9 A;  5B66 C;  4XNF A;  4CCL A;  2KRC A;  5DD8 A;  2Q2E A;  3T0Y A;  5H2F C;  4UHT A;  4MFE A;  1BN5 A;  1S72 I;  4F3Q A;  3P5J A;  1X4P A;  3HB9 A;  2HQ5 A;  2EIJ H;  3CTA A;  3MZY A;  3BR1 A;  3P7N A;  1APL C;  2L4A A;  4RB1 A;  4H0E A;  2CQK A;  3LQR A;  1YE9 A;  2DQR A;  2E35 A;  1SMY F;  2E1O A;  4YFX F;  3I4M J;  1B9M A;  1IN5 A;  2NYX A;  3PIO F;  3QYB A;  1K4S A;  1KU3 A;  2CMP A;  2W4S A;  3HPH A;  2HNH A;  2A05 A;  2AO9 A;  5K5Q A;  3AAF A;  2OTJ I;  4ITV A;  3TOB A;  3BJA A;  3KZZ A;  3ZXS A;  4UB8 C;  4BE0 A;  1SFE A;  3RDI A;  4XOR A;  2B63 J;  4KFC A;  1G3T A;  1P7I A;  4L18 B;  1O3R A;  1YJW I;  2QZ8 A;  2AHQ A;  3FXL A;  2KDO A;  2KHM A;  3DBH B;  4H4K C;  3GBG A;  3G3Z A;  1QU3 A;  2BBY A;  1YI2 I;  1VQK I;  1A6I A;  2IT0 A;  4NC7 A;  2FJ1 A;  1OPC A;  3HOY J;  2KZG A;  2X1C A;  3SJM A;  2J5O A;  4N4N B;  4FT8 A;  4KNY A;  1IUY A;  3UKG A;  2H8W A;  1RES A;  1IXC A;  2R5Y B;  5B3S H;  3BR6 A;  2AXL A;  2GXG A;  1PYV A;  2XRO A;  2BY1 A;  5CPR B;  3BY6 A;  5C4X J;  2ZNZ A;  2ID6 A;  2VKH A;  3M8F A;  4NBQ A;  2ZC2 A;  1DDN A;  3EUH A;  2XHK A;  2ZJR F;  1Z3X A;  4QLC U;  4A69 C;  1XMA A;  2IAI A;  5GPC A;  4IRH A;  4E4H A;  5LFA A;  3TL4 X;  2XC7 A;  3FBI B;  2K85 A;  4HLX A;  1A36 A;  5A2Q Z;  5E18 F;  5LEJ A;  4MHG A;  4Y52 J;  5J6X A;  4Y17 A;  2VPL A;  1X3Z B;  1ZHF A;  1FYM A;  3DWL E;  1IRG A;  1WHU A;  2PEX A;  2KLO A;  2A07 F;  2PJR B;  2QQA A;  4XLC A;  3ULQ B;  3A03 A;  1V3F A;  3ABU A;  1R22 A;  2B7E A;  5KAF C;  1ZLK A;  2X48 A;  5C4J J;  3JR9 A;  3AG4 H;  5H6Q A;  2R7R A;  3H3V K;  1ZLJ A;  3HSF A;  3CUQ B;  3W2W A;  4BJ5 C;  2LBF A;  4OAY A;  4XR6 A;  4L9J A;  5DUI A;  3ZN0 A;  1XGM A;  1LUJ B;  1ZH5 A;  3HOV J;  3QOE A;  2IS2 A;  2IGM A;  2V26 A;  4RBO A;  5E8I A;  4LIV A;  1SD6 A;  3QP6 A;  3W6J B;  3FK7 A;  2MD5 A;  1RUN A;  5CVV A;  3KP5 A;  1IG7 A;  2VJ5 A;  3ASN H;  3FBN B;  1FOW A;  2GA1 A;  5H20 A;  1LE8 A;  3HGG A;  3DP7 A;  3KP7 A;  4MTE A;  2LMD A;  1M1E B;  1VQ4 I;  1HA8 A;  1T2K A;  3GXO A;  2JRT A;  2B9S A;  4BXX J;  1FSH A;  1GDT A;  5IP6 A;  1MDM B;  3OIP A;  2G9W A;  5DTD A;  2XV4 S;  3VYS B;  2RNG A;  2R7U A;  3H5N A;  1LQ1 A;  2FA5 A;  2DQL A;  4M9X A;  3GTJ J;  4LJZ F;  3R0J A;  2JTV A;  1DGW Y;  2DMU A;  1W0U A;  3ZRG A;  3KZY A;  4UVC A;  4PSX A;  5FGM A;  4HV6 A;  2DN0 A;  2L2O A;  4K2E A;  3QOD A;  1DPR A;  3E6C C;  4UNO A;  3ESW B;  5D8K B;  5J8F A;  2FQ3 A;  1D1B A;  1MMA A;  4PDK A;  4OIP F;  4YEJ A;  3WU0 A;  1O4X A;  2VL8 A;  1MBF A;  3W3C A;  4TV7 A;  1ZGW A;  1H0M A;  3R0A A;  1QO0 D;  3GF2 A;  3KEQ A;  3F3X A;  5L3C A;  2LVS A;  3K1P A;  5F1R A;  2OAZ A;  2DDA A;  4M3E A;  1XGN A;  4OU0 A;  4X1E A;  1AWC A;  4XON A;  2RC4 A;  2ZBK A;  2R7S A;  1Y1V J;  3I5U A;  1AKH B;  1ZYR F;  3JRA A;  3CO7 C;  2K9L A;  2DXI A;  4PGG A;  1JI8 A;  3DTI A;  3NEU A;  2Y30 A;  2XGX A;  3H0G J;  4HQM A;  3V7C A;  1I3Q J;  2V7F A;  4B3X A;  3NAU A;  5DCF A;  2LBF B;  4IQJ A;  1MMG A;  1O3Q A;  4CYC B;  3I53 A;  1BC7 C;  3HGY A;  1POG A;  4GO1 A;  5JFR A;  1V5G A;  5A2Q K;  1FTZ A;  3GUD A;  5J4V A;  3L2C A;  4XRS G;  2CJJ A;  1SFO J;  3WHB A;  1DPU A;  1R49 A;  3CCL I;  2K7L A;  1MMD A;  3T8T A;  4BHP A;  2CRG A;  3TP0 A;  4KIF A;  4A5M A;  3WTT C;  3K4C A;  3KE2 A;  1X1D A;  4A3C J;  3M4O J;  2NXN B;  2XAJ A;  2OCC H;  3DBL B;  2HOS A;  4WCG A;  2CUZ A;  1XTA A;  4I02 A;  3LSM A;  3S2D J;  4IX7 A;  2OPT A;  3B6C A;  4EJT A;  3PNT A;  2W82 A;  2FOK A;  2L01 A;  2Z99 A;  5J4Y A;  3HRS A;  5HS9 A;  2DCE A;  1JKP C;  5IP9 J;  1HC8 A;  1RET A;  1T33 A;  1VF9 A;  3E5X A;  1XGS A;  1O7L A;  4F52 A;  4G9Y A;  4UXN A;  2PX9 A;  4HOB A;  1JT6 A;  3KYD B;  4AVZ A;  2L9R A;  2VOD A;  3GTM J;  4D5C A;  3VEP A;  1MGT A;  1IC8 A;  2LR8 A;  5IT9 Z;  2QEX I;  4M9S A;  4XMY A;  3GVA A;  3MAJ A;  2HVR A;  4C9Y A;  3H35 A;  1IO2 A;  4MQ9 F;  2ME0 A;  1ETV A;  3S2W A;  4UVA A;  2QM3 A;  5E1W A;  3X2Q H;  4BJT A;  3P9C A;  2Y69 H;  2WBM A;  2DK5 A;  4IJA A;  3A1Y A;  5CVU A;  1W36 D;  3CMY A;  3VSK A;  2HOA A;  5FLV A;  2JA2 A;  4ANJ A;  3PO3 J;  4P96 A;  1MJA A;  1SAX A;  1TL8 A;  3FXO A;  5ICE A;  3DXJ F;  5K5O A;  2V9V A;  2PBI A;  2JA8 J;  1BJZ A;  1MJB A;  5BQT A;  2PLY A;  3K4L A;  4FQG A;  3E5Q A;  2FRH A;  1OYW A;  2R7F A;  2HYF A;  4LLL A;  3I0T A;  4MFD A;  2QA4 I;  2N8G A;  4Y13 A;  1I27 A;  2FQ4 A;  3M9A A;  2GQQ A;  1RNL A;  4BL0 B;  1XX5 A;  4BH9 A;  1N77 A;  5E20 A;  4ZTF A;  1SAU A;  3OYG A;  1HXD A;  2ZME A;  3TOA A;  4HW0 A;  1VQM I;  4Y15 A;  5FRM A;  4Q47 A;  5F0H A;  3I58 A;  1K83 J;  2IS6 A;  1LFU P;  3RSN A;  3QQA A;  2KRH A;  2FXA A;  4G7O F;  3CC4 I;  4OIO F;  1J59 A;  2LY1 A;  4A3M J;  1R5G A;  4XN3 A;  1B59 A;  3PQK A;  1KYZ A;  4JOM A;  2XF5 A;  4D9J A;  2LNB A;  5LHH A;  4HYE A;  3S3N A;  4CXF A;  4YG2 F;  2H27 A;  3MQ0 A;  1RKW A;  2PJR A;  1ETX A;  5FKO A;  2E1M C;  1JKQ C;  1S9H A;  4LIT A;  2LF8 A;  5M3F J;  4UUS A;  3SEZ A;  3OYD A;  5GAH J;  2COM A;  1VQ5 I;  1QVT A;  2PG4 A;  4KIS A;  3OSG A;  1E17 A;  4XLF A;  1A6Q A;  2X9D A;  3GYH X;  1QZY A;  4S0H B;  2ZCW A;  3ERE D;  1SD7 A;  3BG3 A;  2XKO A;  4EMS A;  4V2F A;  4R8H A;  1FBU A;  2BY2 A;  2F4I A;  4RA2 A;  1XG1 A;  1OCO H;  4G6Q A;  3F6V A;  1IDZ A;  4FE7 A;  4ZDO A;  2JRM A;  1Z6R A;  3CES A;  3RTR A;  2H1L A;  5IP7 J;  3GTQ J;  4D1Q A;  2HVS A;  3J81 K;  4A3L J;  2BHZ A;  1TNT A;  2IA1 A;  2VB6 A;  1LDD A;  3WGH A;  3S93 A;  2QF7 A;  3V42 A;  5CQE A;  3ZGK A;  1ZQ3 P;  2DJI A;  1ZGJ A;  3HPG A;  3LFU A;  5F0C A;  1X2N A;  2CW7 A;  3BR3 A;  1OCR H;  1Z7U A;  3KIO A;  1HW2 A;  5E3N A;  4OMZ A;  2A5W A;  1H88 C;  2CH0 A;  2V1X A;  5HDN A;  1QQI A;  1JTX A;  1YIJ I;  1VQL I;  3E6B A;  3L2V A;  2PN6 A;  2W84 A;  3EDP A;  2UXX A;  3IRR A;  4RGR A;  2HOE A;  3P9I A;  3A02 A;  5D6E A;  3CMM A;  2VUM J;  2KDZ A;  2K3F A;  3FZV A;  2NNY A;  3CCE I;  3OV8 A;  2P5L C;  1MIJ A;  2PJP A;  3OL3 A;  2CV2 A;  5L3B A;  3S1Q J;  1TWF J;  4O5V A;  1VQ6 I;  2XPU A;  4I0A A;  2RKH A;  4NC8 A;  2HTS A;  4XKB A;  3P9K A;  3RYR A;  4XLH A;  4ENK A;  2O8X A;  1SMT A;  1JT0 A;  1HDD C;  2M87 A;  3K69 A;  2ZXH A;  4XM3 A;  1MSE C;  1QRY A;  3QYE A;  3GTO J;  2EFO A;  4M74 A;  4ENN A;  2IA0 A;  3LWF A;  2NS8 A;  5LGT A;  2DA3 A;  3KCC A;  2HDC A;  3OYA A;  1ENH A;  2HDW A;  4AID A;  5K7Z A;  1D8J A;  2CGP A;  4ZYG A;  3C2B A;  1OLT A;  1STZ A;  2R7T A;  3U21 A;  2AXT C;  3CUO A;  1VND A;  5LRR A;  4F91 B;  1ERD A;  2Y75 A;  2KIU A;  2P6S A;  1BI2 A;  3GW2 A;  3H0D A;  2GOM A;  2DBB A;  1MBG A;  2HXI A;  4AYB N;  3K1M A;  3FX3 A;  3PSI A;  2QLZ A;  2WAF A;  1OMI A;  4DJA A;  5FJ8 J;  2Y2Z A;  1IN6 A;  1VQN I;  2IS4 A;  3BR0 A;  4E6K G;  4XOP A;  2FE3 A;  4MIM A;  5HOO A;  4P9U A;  1V5F A;  2XPW A;  5GTI C;  4IRG A;  3FXU A;  5KAI C;  1JHH A;  1T0F A;  2BVL A;  3NRV A;  4A3F J;  3IAS 2;  3E0J B;  2WA0 A;  1AHD P;  4UUS B;  4PK4 A;  2GXA A;  3HKZ N;  2OC6 A;  4CYD A;  1MH3 A;  2W25 A;  1X1C A;  2ESH A;  2WAE A;  4JBA A;  1UHS A;  1XDU A;  5CYV A;  1FOK A;  2XKP A;  3PM1 A;  4BEH A;  2HQN A;  3LOC A;  4ZJZ A;  4BAC A;  5ILS A;  1TTY A;  3EET A;  5D4R A;  1OCC H;  3I9V 2;  1VQ9 I;  2DOF A;  1ON2 A;  3R60 A;  5EEG A;  4BXU A;  2P81 A;  5IY5 H;  1JXS A;  2MG4 A;  1IXS B;  1R58 A;  1TWH J;  3EQL F;  2STW A;  2IRF G;  5DM6 F;  3L2W A;  2E36 A;  2IGN A;  3S1M J;  2IA2 A;  2VQH A;  3NWT A;  2E60 A;  4FX0 A;  2VBY A;  3F8F A;  4A3J J;  4RB2 C;  5D6F A;  3WTY C;  1XMX A;  2DFE A;  1YTY A;  1LDJ A;  5E8G A;  5EG0 B;  3DPU A;  3DTE A;  1U78 A;  3HOU J;  4L5I A;  5E3L A;  4Y33 A;  3GZ6 A;  4KN7 X;  2XB0 X;  4EM0 B;  3NWS A;  1OCT C;  2MFZ A;  3JRD A;  1U8R A;  4M9Z A;  2Q1Z B;  3H5R A;  1E3P A;  3FMS A;  4E7I A;  1FX7 A;  1WI3 A;  2VBZ A;  3QWL A;  4ZTJ A;  1SEU A;  1K78 B;  3BOQ A;  3CC2 I;  4F55 A;  3ISP A;  2VAS A;  2CV0 A;  2EV6 A;  4CZC A;  1K61 A;  1LFP A;  2BY3 A;  4NHJ A;  2RQQ A;  1HST A;  3M1C A;  4I7H A;  4NC6 A;  3CQZ J;  3H9G A;  5GAG J;  4EJW A;  1BR4 A;  2O6G E;  3S2H J;  4XK4 A;  3BDD A;  1XN7 A;  3DKW A;  3MCZ A;  4JP0 A;  4LLG F;  2DOE A;  2E5Z A;  2AQE A;  4GYI A;  3MFK A;  4BE1 A;  2LSO A;  2LKX A;  1REP C;  5HNF A;  1YYV A;  4BNC A;  2YUS A;  2X6Y A;  1P4X A;  3K4B A;  1D0Z A;  3ELK A;  6PAX A;  4E7L A;  2DYR H;  1U5T A;  3OR1 C;  3LST A;  3O3K A;  2KJB A;  2D1V A;  4LB5 A;  1U2W A;  3CCV I;  2Y0S N;  3I56 I;  1TC3 C;  4PJN A;  4IXA A;  4LK1 F;  2COB A;  5EEH A;  1KA8 A;  4BJ6 C;  1K6O A;  3MKY B;  3DLA A;  4C30 A;  1HF0 A;  2M2E A;  3RKW A;  3OL4 A;  3TGN A;  1FP1 D;  5LRS A;  3KLN A;  3R6S A;  3CUQ C;  3FIS A;  4I09 A;  3FK6 A;  1ZG5 A;  1S29 A;  2DMT A;  4IVN A;  2XAG A;  3KP2 A;  2XAH A;  1IJW C;  2ZO4 A;  2MLG A;  5K5R A;  2VJ4 A;  5EGO B;  4CYC A;  2XDV A;  3QRF F;  2K9Q A;  3J7A Y;  3NAR A;  4L9V A;  2D1H A;  2MAB A;  5CVR A;  5DD4 A;  3B73 A;  1B72 B;  1I50 J;  3HTU A;  3HOW J;  1YQA A;  4LB6 B;  2OF7 A;  2XGD A;  3KFW X;  3V7S A;  1W4M A;  1TP4 A;  1ZTR A;  4YFN F;  3KYL A;  5FD5 A;  3OS1 A;  2KP6 A;  5FLX Z;  1WRJ A;  3S14 J;  1BIB A;  4UY8 I;  1I6H J;  3CP8 A;  3Q0V A;  2EA2 A;  4LG0 A;  3CCU I;  4RS8 A;  4XLE A;  3OSF A;  1ZRE A;  2BXZ A;  3F8M A;  1ETW A;  4QPO A;  4MGR A;  4IL6 C;  2OZ6 A;  1F1Z A;  4KT5 C;  2V1U A;  3CCY A;  1UEL B;  4HF2 A;  1R4M B;  1SC7 A;  1RIO H;  2DMN A;  2EZI A;  3HM5 A;  2DOA A;  3CDH A;  3S1R J;  5H6R A;  5DYM A;  4G8X A;  3C18 A;  2WB1 N;  1A04 A;  2W85 A;  3F9K A;  5F0F A;  2IEK A;  2QQ8 A;  3TO9 A;  2PMZ A;  3GTP J;  2M5W A;  4CCM A;  4HQE A;  3DU6 A;  4XL9 A;  3HHG A;  4CUG A;  5LGN A;  3ZQG A;  3IRQ A;  2DT6 A;  4A3K J;  1X3W B;  3F72 A;  4F7Z A;  1TW2 A;  4KIG A;  1JJ6 C;  3VPR A;  2KIS A;  3LNQ A;  3MKW B;  2UXN A;  3MKL A;  1J5Y A;  1YIT I;  3BJO A;  3KYC B;  3T8R A;  5EYR A;  2O9L A;  1EH8 A;  4G7H F;  5JVT A;  1MKM A;  1P9Q C;  2F4O B;  3IH2 A;  4QPQ A;  1WSU A;  4MNU A;  5FB2 A;  3J7Z I;  2FF4 A;  1OFC X;  1DGR M;  1ZR2 A;  2M34 A;  3PUB A;  4B09 A;  4KMU X;  1N75 A;  1N25 A;  4NB5 A;  3RKX A;  3OS0 A;  3BC8 A;  4HEA 2;  3S3O A;  4DQ2 A;  1NTC A;  3M1E A;  1DU6 A;  3HYI A;  2VE8 A;  3HJE A;  3TDZ C;  1T98 A;  4QTR A;  3BRO A;  3JRE A;  2V6C A;  5E3M A;  4CHU A;  1USS A;  1H9G A;  2WAQ N;  1GVJ A;  4C2M J;  5L3D A;  3BG9 A;  4CCO A;  4G12 A;  1LJ9 A;  1ONV A;  4BU2 A;  1IV6 A;  1J09 A;  1BA5 A;  3FF5 A;  3I55 I;  3DLL F;  1W7P B;  4ESB A;  4J19 A;  3I4P A;  2RN7 A;  3IC7 A;  3ABL H;  1IF1 A;  4MEX F;  2EFP A;  3VOE A;  3AKZ A;  1EV7 A;  2ZB9 A;  3O8G A;  1QBJ A;  4OMY A;  2JUG A;  3WG7 H;  1VQ7 I;  5F04 A;  2HKX A;  3I59 A;  4C2T A;  2EBI A;  4IHT A;  2M30 A;  1D1A A;  4YEL A;  2FSW A;  4RB0 A;  3HEF A;  3W2A A;  2F5F A;  3OOU A;  1O57 A;  2VOO A;  4RDU A;  1S5L C;  2XAS A;  5GP9 A;  1A31 A;  3FXJ A;  1I1S A;  2IGK A;  2F5C A;  5FLX K;  4HBL A;  1R5H A;  3GLL A;  5HS8 A;  2MW8 A;  3DTK A;  2VBX A;  3ZCO A;  2L7K A;  2M4G A;  2K9N A;  4A6E A;  3PL8 A;  4IPA A;  1SFU A;  4AVP A;  5FKK A;  4F92 B;  1Z7L A;  4HAM A;  1XSX A;  4RB3 C;  2Y0M A;  2DJN A;  2LF7 A;  3D1N I;  4IHY A;  1AA7 A;  4GRI A;  1WJ5 A;  3C7J A;  2NVY J;  3H3Z A;  2IGO A;  3IL2 A;  4HX8 A;  5FO5 A;  1R23 A;  3BJ6 A;  1DP3 A;  3E7L A;  4RMN A;  3PNY A;  4A3E J;  3ML6 A;  4NNJ A;  1Z77 A;  3LA2 A;  4XSZ F;  4N9H A;  4XRF A;  3E5U A;  1YX3 A;  3DPL C;  2A61 A;  2LTP A;  4JX5 A;  4ZZD A;  3U9G A;  3GZ5 A;  3N4M A;  3MEX A;  4HF0 A;  2EIM H;  4DBR A;  5GAE J;  1F5T A;  1LEB A;  2HXO A;  2BGC A;  4XBF A;  2R7W A;  5JLX A;  1F36 A;  2GXB A;  1YHQ I;  4IEJ A;  3TP3 A;  1T6S A;  2QQB A;  2UWM A;  4EQQ A;  2L54 A;  1GXP A;  3G71 I;  2GOX B;  3BCA A;  1QNT A;  1XD7 A;  3ROU A;  2W48 A;  2MC3 A;  5JR3 A;  4U7B A;  3L2R A;  3KPH A;  2X1E A;  4DYR A;  2NVQ J;  2P4W A;  1U3E M;  4S05 A;  5LBQ A;  5D4S A;  1FSE A;  2F2E A;  3D5S C;  2DT7 B;  4FX4 A;  3RQI A;  2DPD A;  1BW5 A;  1R1V A;  2X4H A;  3OR2 C;  4AWX B;  2MLK A;  1VTN C;  1W0T A;  3GCM A;  4BQQ A;  2ACJ A;  3QU3 A;  4DYQ A;  3B02 A;  4II3 A;  2HYJ A;  3RPQ A;  2TRT A;  5J8C A;  1OYI A;  5HS7 A;  3CLO A;  2P6T A;  2ISY A;  3COA C;  4M3B A;  3IWF A;  1K6Y A;  5E1Z B;  3QPL A;  2EK5 A;  4A2U A;  5KNL A;  3LSI A;  4RM3 A;  3ZMD A;  4AIH A;  1B1B A;  1ETQ A;  3SZP A;  4EAT A;  2LKP A;  2IS1 A;  1WZ2 A;  1LPQ A;  3F0C A;  1Z0X A;  4YII A;  3VDX A;  2K4J A;  2V1D A;  1KQ8 A;  1P4A A;  3F8N A;  1ZEL A;  2ZKZ A;  4IQ4 A;  2VC0 A;  4BHB A;  2JVG A;  1K79 A;  3CJQ B;  3VFZ A;  1IV8 A;  4E70 A;  3HTS B;  2R4G A;  3AG3 H;  4I0B A;  3FM3 A;  2XRN A;  2VC1 A;  2LD5 A;  1VQ8 I;  1ON1 A;  1U5T B;  4A93 J;  1J0R A;  4U0Y A;  4O3M A;  2L5Q A;  2DW4 A;  4RGX A;  1G59 A;  1RPW A;  2XGC A;  3E3V A;  2JPB A;  2CW0 F;  4Z6Y A;  4IO9 F;  2O61 A;  2DMQ A;  1U9N A;  4B4C A;  2JA5 J;  4IHS A;  1W5T A;  3QYF A;  3DQV C;  3TED A;  3LMM A;  3JAM K;  1FLI A;  1GLN A;  1D8K A;  4DZJ A;  1TQI A;  2F4M B;  2L9V A;  3VYT B;  4DYC A;  1T8I A;  1HBX G;  1QZZ A;  1UJ8 A;  2RDP A;  2R5Z B;  1YOV B;  2W7N A;  4HNV A;  1GV2 A;  2JSC A;  2J5P A;  3S17 J;  2ZJQ F;  2P8T A;  1MDM A;  4GGG A;  1KGS A;  2VIX A;  3VB2 A;  3FHZ A;  4BY1 J;  1B6A A;  2X85 A;  2ZME C;  2JQ7 A;  2EZK A;  2L3D A;  2QKL B;  3E6D A;  4IRI A;  4A12 A;  3LQQ A;  1ODD A;  3BPX A;  4LIU A;  3ZMZ A;  1Y56 A;  5BS6 A;  2EB7 A;  4Q48 A;  3J7A O;  3KX2 A;  5D5U B;  3I64 A;  4CCN A;  1WJF A;  2R7Q A;  2EPF A;  5ILU A;  2DT5 A;  4AYB A;  4XQF A;  1GT0 C;  1Z9C A;  1HOM A;  3ASO H;  1ZGA A;  4A6D A;  2HQR A;  5HNH A;  3AFH A;  1TWC J;  4AIJ A;  1AOY A;  4EGZ A;  2ELH A;  3TMO A;  2K02 A;  4ABZ A;  1Y6I A;  1LVK A;  4XLA A;  3D5R C;  3FDY A;  4ENM A;  1WWX A;  2TCT A;  2O7O A;  3WTS C;  2Y9Z A;  4XN0 A;  2LLK A;  1SAN A;  2EJR A;  2KZV A;  4E7H A;  1KQ9 A;  2VXZ A;  3WU2 C;  5J1Y A;  2EIL H;  1ETO A;  2M7B A;  1SD4 A;  2DDB A;  4LOC A;  2IP2 A;  4KMF A;  2JPC A;  2ICW G;  4M3F A;  1KON A;  2K27 A;  2GM4 A;  2GIZ A;  4XOT A;  2BV6 A;  1P2F A;  4B3A A;  2DA1 A;  1UHM A;  4WXC A;  4S04 A;  1UFM A;  3BZ6 A;  1YLF A;  1RR7 A;  4AIK A;  5TRD A;  1MND A;  5EG0 A;  3BR2 A;  2QSG X;  4BQA A;  2XUB A;  3HXL A;  1UAA A;  2XAQ A;  2Z5U A;  4A3B J;  3K7A J;  2KKO A;  4U87 A;  4OIQ F;  1TWG J;  1NG7 A;  1ULY A;  2FD5 A;  3KEO A;  1FJL A;  4L5J A;  2JSP A;  2VQG A;  4ASN A;  4IHX A;  2LK2 A;  1XSV A;  3J80 Z;  3BT9 A;  3HDD A;  5LD2 C;  1WGX A;  4IOA F;  2K4B A;  4KIB A;  1Y8R B;  4PCQ A;  4QSH A;  2VJJ A;  4IOC F;  5FD6 A;  4EJV A;  2X0L A;  3GME A;  4EM2 A;  3BG6 A;  3TO6 A;  3DV8 A;  1JKO C;  3ABM H;  1P92 A;  3GFL A;  5JLW A;  3OS2 A;  2WWY A;  1JGG A;  1FT9 A;  2WC2 A;  2XAU A;  3KLO A;  3JAM Z;  1XSD A;  5E17 F;  1IRZ A;  1F4K A;  1YW8 A;  5K7F A;  4QWQ A;  2CFX A;  1RZ4 A;  3LSG A;  5FKL A;  1V54 H;  2M3A A;  3Q0W A;  3DCF A;  5E79 C;  4WXH A;  4XRS A;  3CCJ I;  1ACI A;  3L1P A;  3BG7 A;  1TLH B;  2R93 J;  3OYM A;  3CDI A;  3K70 D;  3FIW A;  3FKI J;  1SFX A;  4UUT A;  4ZC3 A;  1EF4 A;  2G0E A;  3MVP A;  3DKY A;  2O03 A;  5DUK A;  4I6Z A;  1GUU A;  1ITY A;  3BPV A;  1RI7 A;  2PQ8 A;  4IHW A;  2HGC A;  2Q2E B;  2LY2 A;  2XIG A;  5KCM A;  2EQR A;  1Y0U A;  5FRO A;  1YRN B;  3K0L A;  4BYY A;  3ZQQ A;  1Q1H A;  1W7P D;  1T38 A;  2E1C A;  3I4N J;  5F08 A;  4A0Y A;  1D0X A;  1LVA A;  9ANT A;  3GWZ A;  3GLX A;  1T08 B;  3CMA I;  4B48 A;  1WH5 A;  1BL0 A;  1QA6 A;  1WJD A;  4FET A;  3SYT A;  5FRN A;  4GYG A;  2M7A A;  2HDD A;  3SFZ A;  5GTH C;  1CF7 A;  1BIA A;  2PMZ N;  4X6A J;  3EYY A;  3SDG A;  2L9S A;  1BW6 A;  2OQR A;  2RQP A;  4PUS A;  3F8C A;  1RKT A;  4RLF A;  4BKX A;  3GX4 X;  1JJ8 C;  2R7Z J;  2ESN A;  2EZH A;  2QCO A;  2E5N A;  1MSF C;  1TW3 A;  4XID A;  2QWW A;  1X4O A;  4ESJ A;  1BR2 A;  4ZYH A;  1B72 A;  1OQY A;  1S6L A;  3FXR A;  2DA6 A;  3V7R A;  1DQU A;  2HR3 A;  5HDK A;  2CW8 A;  2ZSH B;  2M45 A;  1RR8 C;  5DDG A;  3TBI A;  1Z05 A;  1ZG3 A;  2O3F A;  2PMH A;  3DFG A;  2QSF X;  5J3L A;  1WJA A;  1MBK A;  1KU7 A;  3ZMT A;  3F22 A;  3H5A A;  3QP5 A;  4JK1 X;  2RNJ A;  2FBI A;  5F27 A;  1NK2 P;  1E3O C;  3FMR A;  3CD6 I;  2MYS A;  3M8J A;  2DI3 A;  2L02 A;  3FM5 A;  4LG0 B;  3KP4 A;  2M0M A;  3JW4 A;  1X1B A;  3H9J A;  2JMW A;  1IN8 A;  1O3T A;  4QIW N;  2W24 A;  1LDK B;  4EEF G;  1MNM C;  1IUF A;  1QVU A;  4ON0 A;  3PSF A;  1XB4 A;  5B1A H;  3RPU A;  4LK0 F;  3OYC A;  3HL2 A;  3CC7 I;  1LKX A;  1XDS A;  1Z6T A;  3CF2 A;  3G2B A;  3RJP A;  2A69 F;  1GVD A;  2MBF A;  1DUX C;  4FE4 A;  1OYY A;  5AIP A;  1XCV A;  4UV9 A;  3JSO A;  3JRB A;  1LFB A;  1HCR A;  2X6X A;  1OCP A;  3OYE A;  5GPA A;  4HST A;  4XLP F;  3QPT A;  2DA2 A;  3FXM A;  3LSP A;  5L3G A;  2ID3 A;  3ABK H;  3H36 A;  3OIQ A;  1MBH A;  3K4M A;  4CDG A;  2GAU A;  5M5Y J;  3ECH A;  3HSR A;  4G7Z F;  3CJN A;  3PNV A;  1SVL A;  4N0B A;  3HOX J;  3H9Q A;  1YG2 A;  3MKZ A;  1T39 A;  1QHG A;  2R7V A;  2YPR A;  1FZP B;  4KN4 X;  2EWN A;  2KQR A;  3OYK A;  2OCE A;  3FHN A;  3W6V A;  4RGU A;  1I6X A;  2ADU A;  3L00 A;  3G1L A;  2QSH X;  3LA7 A;  5D5W B;  5FFX A;  3SXY A;  1CF7 B;  2VPR A;  3WE3 A;  2ZJ2 A;  4C2U A;  3ABT A;  3DEE A;  5FKN A;  3WHC A;  1VQP I;  1FMW A;  2Z1D A;  5JVG F;  1YO5 C;  5DS9 A;  3MZH A;  2X51 A;  3B6A A;  1SFK A;  4YRV A;  2BVM A;  2BOL A;  3C2G A;  2GZW A;  4EJO A;  2CQN A;  4XKV A;  4C3I J;  2MA3 A;  3S16 J;  1J7K A;  3HG9 A;  1WJE A;  3ERM A;  4DIQ A;  3DEW A;  3G4S I;  1FYL A;  4R1H A;  2CUJ A;  1JE8 A;  2R5Y A;  4JYK A;  3KP3 A;  2WV1 A;  4FCY A;  4PJ0 C;  2WY8 Q;  1G8X A;  3OYL A;  1D1C A;  3ZMS A;  3WU1 B;  4A3D J;  2IBD A;  3RIR A;  3TW6 A;  5IPA A;  3ZPL A;  3WGG A;  2DA7 A;  2V79 A;  4O6J A;  3WTX C;  2LG4 A;  1RC9 A;  3JTH A;  4PSW A;  3OYB A;  1S7E A;  1BI0 A;  4W1U A;  2W00 A;  3ZQ7 A;  1DU0 A;  2BW3 A;  1W5S A;  4BQO A;  5D5X B;  2WAD A;  4II2 A;  1Z3Y A;  2MH9 A;  1F43 A;  4WXD A;  3IWZ A;  2HPI A;  2HOT A;  3H92 A;  1JKR C;  2QUF A;  2R7O A;  1Y39 A;  4D7N A;  1HKS A;  5FFZ A;  3J80 K;  3FXQ A;  1X3U A;  5LHG A;  1FWZ A;  5HLI A;  1W1W E;  1SVO A;  1VZ0 A;  2OJE D;  4A0X A;  3OYF A;  3AL0 C;  2IXS A;  3K4N A;  2KPM A;  2M9H A;  2R5Z A;  4PZJ A;  3QPH A;  4FHT A;  4B47 A;  3UR3 C;  2DFI A;  4ETS A;  1KYW A;  3MN2 A;  3K2Z A;  5HVQ C;  4ZYD A;  3BG5 A;  3A01 B;  2ELJ A;  2L7Z A;  3IH4 A;  4YIR X;  2WY7 Q;  2A3S A;  4PJM A;  1GV5 A;  2K5C A;  1ZK8 A;  2FNA A;  2NVX J;  2L0K A;  2V6E A;  4UB6 C;  2NNN A;  2XGE A;  3G6E I;  1U8B A;  1FBQ A;  4NQW A;  2RV8 A;  2E2I J;  2ZXW H;  4JQF A;  2HQA A;  4ESF A;  4KYW A;  2YU9 J;  1U5T C;  3OY9 A;  4Y3O A;  1R36 A;  5BMZ A;  4XKW A;  5IOY A;  1E0E A;  4PJL A;  3DKX A;  1R5I D;  2FNP A;  2DMP A;  4U88 A;  4HNT A;  5E3O A;  2HS5 A;  2MD0 A;  1PVE A;  1WCM J;  3L7W A;  4CIC A;  4N9I A;  3CF5 F;  3LAP A;  5LEK A;  1R4N B;  2EH3 A;  2GIV A;  5JHU A;  3HSE A;  1HDP A;  3HUG B;  4E7Z A;  3LSR A;  5M5X J;  2E7X A;  3IP4 B;  3WTW C;  3RZO J;  4MLO A;  3BCB A;  4UUV A;  1Q1V A;  4A3G J;  2M4K A;  2K9M A;  3LFK A;  2NRA C;  1KU2 A;  4JX6 A;  1UHW A;  4B8X A;  1IZ1 A;  3JCU C;  2WTE A;  2XF7 A;  4CZZ A;  5HOD A;  1C0W A;  4P5O A;  4AUX A;  3IV5 A;  4BBR J;  3RCO A;  2DU9 A;  5F6F A;  1IN4 A;  2A6H F;  4EJU A;  2UUZ A;  3GTL J;  1XPX A;  2O5R A;  4G94 A;  4HF1 A;  3MMY B;  4YIF A;  4XKC A;  1O3S A;  4L9N A;  4NUB A;  1S7A A;  1LB2 A;  2ISZ A;  2HEO A;  2ELK A;  3A2K A;  4KIT B;  5LGU A;  1S8N A;  1H89 C;  1L0O C;  1FNN A;  2FUG 2;  2I10 A;  4P1W A;  1FIP A;  2I5U A;  4OAZ A;  1WFX A;  4ZDL A;  3CP2 A;  3C3W A;  2MC4 A;  4DGW B;  3ONQ A;  2AS5 F;  3BZK A;  1X1A A;  2X1D A;  3HOZ J;  3ZMU A;  4PFP A;  1ORK A;  2XPV A;  2VLA A;  5DCM A;  2MSY A;  3L09 A;  1ZRC A;  3HUG A;  3HC7 A;  2QYO A;  2D5V A;  3S1N J;  1EH7 A;  1NG6 A;  3FKJ A;  2MH2 A;  4B1R A;  3IAM 2;  2KMU A;  5K7H A;  4LD5 A;  2K40 A;  3G73 A;  2Y9Y A;  3C2H A;  2OA4 A;  4KT6 A;  2BHY A;  2DLL A;  3S32 A;  3BTC A;  1JTY A;  4Q4Z F;  2PFB A;  2JWT A;  2X6O A;  1UG2 A;  3Q3S A;  1HKQ A;  1WJB A;  5CVJ A;  1W36 C;  1J75 A;  2V9P A;  1WVR A;  1D3Y A;  3J81 Z;  3TQN A;  4BHC A;  2E1M B;  2NOJ B;  4BDZ A;  3H3U A;  3KP6 A;  2L7M P;  2YSR A;  1J9I A;  3OOP A;  2EV5 A;  3DBR B;  3G1O A;  1YS6 A;  1WQ2 A;  2BEO A;  4KDP A;  3SQN A;  2D2W A;  2VBW A;  4I2O A;  2F48 A;  2KRF A;  4UV8 A;  4EGY A;  1TQM A;  2L7F P;  5AON A;  3CCM I;  1QZE A;  4XSX F;  2BE5 F;  2XRL A;  2Y48 A;  3Q9S A;  5JHF A;  2OBP A;  2VI6 A;  1HQC A;  1XC5 A;  3U2R A;  1O7F A;  2LC2 A;  3IKV A;  1YW9 A;  1MH4 A;  3M3Y J;  3EUH C;  3JRC A;  2OQG A;  2P7V B;  3QAH A;  4DNC A;  1PDN C;  3LSH A;  1UZC A;  2XF6 A;  2CV1 A;  2VE9 A;  2H8R A;  1XS9 A;  5JI6 A;  3W2V A;  3JRF A;  5K1Y A;  1F9N A;  2ZFW A;  3GZN B;  3CDL A;  3E97 A;  4ZH4 F;  4LFU A;  4U0V A;  5ICF A;  1R9T J;  5EDN A;  1S7O A;  4G6D A;  1FC3 A;  1T0F C;  4RM2 A;  3GFM A;  4PGH A;  2H09 A;  1QGP A;  2KJC A;  5IYB J;  3WE2 A;  4GXO A;  4RAG A;  2P5V A;  3ZR8 X;  2YX7 A;  3HHH A;  5L3E A;  5HDG A;  4HRI A;  2XSJ C;  3PUF A;  5BNG A;  2K3P A;  5IT3 A;  4PJJ A;  2VKD A;  2YR2 A;  2CQX A;  4U7D A;  2VXD A;  4AC0 A;  2PI0 A;  2CU7 A;  4B44 A;  5HLT A;  1AKH A;  2Z16 A;  3REO A;  3I3L A;  3HOS A;  1BBY A;  1E3H A;  2HKO A;  2V4J C;  3QU6 A;  3RQ4 A;  2IW5 A;  1MMS A;  4X0G A;  3CLQ A;  4GDF A;  2LYC A;  2ZFU A;  2G7H A;  2STT A;  2RRE A;  3GTG J;  4LLN A;  1S3J A;  2V1N A;  2W1O A;  2P7C B;  2VOP A;  3ZQL A;  1ZKG A;  2P0W A;  4C3J J;  3FXK A;  1GXQ A;  2VKV A;  1FEX A;  3I54 A;  3PFY A;  2F5V A;  1BM9 A;  2ECB A;  4BXF A;  2E2H J;  4A0Z A;  1T95 A;  1YFH A;  3K10 A;  3VYU B;  1TQP A;  2YS9 A;  2JUC A;  3RPU D;  3GO5 A;  5C3E J;  4IHV A;  1XGO A;  4OIN F;  2DK8 A;  4OWR B;  4J00 A;  4A3I J;  4I76 A;  4GFB A;  2EFQ A;  3K1N A;  1HW1 A;  2M8E A;  2OV7 A;  3JRH A;  3PO2 J;  2LKS A;  2VQL A;  2LRD A;  3CJT B;  4RAF A;  2FU4 A;  2ME6 A;  1NK3 P;  3CCS I;  4KJZ A;  2CUF A;  1LE8 B;  4KUM A;  3O8H A;  3PQJ A;  1G3S A;  5IOZ A;  3F23 A;  1D5Y A;  3ZQC A;  1OJL A;  1G2H A;  3V8L A;  1KQ0 A;  4RAY A;  3T5X A;  2Y31 A;  2E1N A;  4UVB A;  3L9F A;  3LSJ A;  1NH3 A;  1PJR A;  5KK1 A;  3VSL A;  3RKY A;  4BS9 A;  3BLY A;  1WPK A;  1KZH A;  1Z1D A;  2Z9O A;  3SHF A;  4IZZ A;  2WAQ A;  2CQ7 A;  1ZR4 A;  2H6B A;  5CLS A;  2H94 A;  5CQG A;  4AU7 A;  2R7X A;  2XSD C;  2AQF A;  5ILV A;  2HWV A;  2NOG A;  1ETY A;  2EA4 A;  1Z21 A;  3JSP A;  1EKE A;  2NS7 A;  1IAW A;  2DTR A;  3GEZ A;  4M3G A;  3K4J A;  4OIR F;  2V9K A;  2KIM A;  1WKM A;  1ZN2 A;  3SEQ A;  4C3H J;  2E2J J;  5AIQ A;  2O8K A;  4R79 A;  3H1C A;  4HPQ A;  2I8D A;  3KEY A;  1E2X A;  1JHF A;  2DOD A;  2KT0 A;  4MO7 A;  1G4D A;  1FOY A;  3D5L A;  3GFJ A;  1QPI A;  4N4O B;  5TIS C;  3ZQI A;  2CG4 A;  1X19 A;  2DAO A;  2JA6 J;  3D0S A;  2KIQ A;  2VN2 A;  3KET A;  3CUQ A;  2ZXI A;  2LDU A;  5GAD J;  3ZP5 A;  1IGN A;  2D45 A;  2M1B A;  4W97 A;  1QPM A;  1KU9 A;  1MNE A;  3OMY A;  2FMY A;  5IYC J;  3GFI A;  2EFN A;  2YU3 A;  3OYN A;  1U9O A;  1R71 A;  1DP7 P;  4V2G A;  1V5E A;  2JK3 A;  3Q0U A;  5EJC A;  1YIO A;  4RAZ A;  4BBS J;  1FOX A;  2RGV A;  5DM7 F;  3JRG A;  5L3F A;  4E7K A;  4P9F A;  3ZN1 A;  2FX0 A;  3LAJ A;  5CVI A;  2DA5 A;  5F1J A;  4L0Y B;  3LSK A;  3EYI A;  2L4M A;  1EA3 A;  4U0W A;  5J1U A;  3JRI A;  3AL0 B;  4AM3 A;  3O6B B;  4M72 A;  3T1B A;  1Y1W J;  4LGW A;  4HV5 A;  4FTH A;  1JUS A;  1B8I B;  3MZ8 A;  3R4K A;  5M5W J;  3KZI C;  2FML A;  2OD5 A;  2E7W A;  4CCK A;  1H8A C;  3VWB A;  1UG0 A;  1MBE A;  5EZG A;  4Y4R A;  4IF4 A;  1OKR A;  2LFB A;  4HDV A;  3M07 A;  5LHI A;  2LY9 A;  1P7J A;  2ZXJ A;  4I98 B;  2W57 A;  2IJL A;  2DFH A;  3EPZ A;  5F64 A;  5CJ9 A;  4Q5S F;  1B4A A;  1I5Z A;  4WWC A;  5BPI A;  3WTV C;  2QQ9 A;  1IN7 A;  4BAY A;  2DA4 A;  2DTZ A;  2DPU A;  4IKF A;  1CGP A;  2BZT A;  2IPQ X;  3PJR A;  2VJI A;  4EVI A;  1R1U A;  3PFI A;  1K78 A;  1JUP A;  2CYY A;  4DOZ A;  4BE2 A;  1FTT A;  2OTL I;  2HVQ A;  3BZC A;  2R0Q C;  2ETH A;  5HLH A;  3TO7 A;  3WOD F;  4XRM A;  2CS3 A;  2RVC A;  4HX7 A;  3OYH A;  1X1P A;  4YFK F;  3RZD J;  1K4T A;  3BQZ A;  3F6O A;  4CSW A;  5IT9 K;  4A5N A;  3C1D A;  3ECO A;  3GTK J;  2BXY A;  2ZSI B;  4ZZL A;  2JN6 A;  1HW5 A;  4CA0 A;  2QGU A;  3S3M A;  1TZL A;  2E34 A;  4D7M A;  2CFO A;  4BQN A;  2DFF A;  3ZMV A;  2P5K A;  1WJC A;  3DEU A;  3O2P E;  1OCZ H;  2Z2S B;  1MZB A;  2VON A;  5J47 A;  1IRX A;  1WI9 A;  3OYI A;  3BTJ A;  4EV0 A;  1ETK A;  1P6R A;  1Z67 A;  2XAF A;  3Q9V A;  3K70 C;  1UB9 A;  5HLG A;  2ZJP F;  1I3A A;  1ZAO A;  1ZRF A;  2NS0 A;  1TT0 A;  1OIS A;  1V55 H;  4RGS A;  3SDB A;  2FOW A;  3CZ6 A;  3PIP F;  3NQO A;  3UNG C;  1FY7 A;  1G3W A;  1EH6 A;  4BDY A;  1RRJ A;  2QKM B;  3N05 A;  2DO7 A;  2HYG D;  4HZF A;  2OUM A;  5ED4 A;  4LMY A;  4Y7N J;  2K9S A;  4KIC A;  1FIA A;  3VOD A;  4L0Z B;  1PUF B;  4M6V A;  4HDU A;  3WTZ A;  4LG3 A;  4FAS D;  5FLM J;  1MW7 A;  3CCR I;  2DYS H;  3WG9 A;  3OIO A;  2UV1 A;  1BI1 A;  1YW7 A;  4HLY A;  3CME I;  1FP2 A;  1LNW A;  2VQC A;  5BOX A;  2WV0 A;  3RYP A;  3AG2 H;  3ZQF A;  2NVU B;  2EFW A;  1YJN I;  5ERI A;  1B9N A;  1G6N A;  5C44 J;  3CO6 C;  1XCB A;  3BQY A;  3TKY A;  4HA8 A;  2GA2 A;  3OYJ A;  2X6W A;  1IXR C;  3G1M A;  2EZL A;  1NHA A;  2KFD A;  4RLQ A;  1WH7 A;  1PP8 F;  2ECC A;  3RI4 A;  3N97 A;  2O0Y A;  3WTU C;  3IH3 A;  4HX4 A;  2VT2 A;  2BW3 B;  2HU9 A;  5KVR A;  1IRF A;  1MD0 A;  4ZYA A;  3BR5 A;  3EUK L;  2Z3Y A;  1UST A;  4NQW B;  4WX9 A;  1GHC A;  1HLV A;  2NAZ A;  5ICG A;  4WK8 F;  1ZG1 A;  3U1D A;  2G7U A;  2H6C A;  2M8G X;  1U6G A;  4NDL A;  3DF8 A;  2FEZ A;  4B43 A;  3Q5F A;  4ZDP A;  2JVH A;  3IHU A;  3K2A A;  3L2Q A;  5D5V B;  3BTL A;  4WF2 A;  4FIS A;  3AG1 H;  2JJ7 A;  4HG2 A;  4F93 B;  2VKE A;  3K4K A;  3IKT A;  2QEN A;  1FPQ A;  2Q8K A;  1SVM A;  3BWG A;  2QVO A;  3RKQ A;  1FYK A;  4XLN F;  5EZH A;  2ZME B;  2LRE A;  3A0H C; 
#chains in the Genus database with same CATH homology
 4GCV A;  4OOI A;  2UZK A;  1J2X A;  2CWE A;  4M6Y A;  3DPT A;  4ENJ A;  3HRU A;  1RUO A;  2A68 F;  4Z2Y A;  4P55 A;  2F5E A;  3MWM A;  2VT3 A;  2B0L A;  2HFH A;  2PMU A;  2TDX A;  3HRT A;  1HKT A;  1IW7 F;  2EV0 A;  2JT1 A;  2JZY A;  3HIF A;  2HTJ A;  1BOA A;  1JGS A;  1R00 A;  3LA3 A;  4M6X A;  2A5Y B;  3E6M A;  2F5D A;  2QBY B;  3V8J A;  3V8K A;  1D5V A;  1UCR A;  2FBH A;  1BC8 C;  4I01 A;  1G3Y A;  2XVC A;  4MQV A;  2A6E F;  3F21 A;  5BPD A;  3I59 B;  1H9T A;  1R1T A;  2CO5 A;  5D8L B;  2CSO A;  3R61 A;  1HSJ A;  2OU2 A;  3F8B A;  1TNS A;  2Q0O A;  5DV5 A;  3TDU C;  3V4G A;  2YX4 A;  2BYV E;  1R7J A;  1K7A A;  1I1G A;  1LEA A;  5DCM B;  3M7G A;  4D0P A;  3I71 A;  1PP7 U;  3HRM A;  1YS7 A;  5DEQ A;  2R3S A;  2IVM A;  1TBX A;  4AD9 A;  1BI3 A;  2QBY A;  1OR7 A;  1BJA A;  5ICC A;  3QOP A;  4CO8 A;  4KA4 A;  1FBS A;  1Z91 A;  3W6K B;  3M8E A;  4MTD A;  2C6Y A;  1ZRD A;  1V4R A;  2FBK A;  4L9T A;  2HZT A;  2R7D A;  2OZU A;  1W7P A;  4ZYE A;  4M71 A;  3JTG A;  2ZNY A;  3BP8 A;  5TJJ A;  3WGI A;  1L3L A;  2GWR A;  3HOT A;  4M73 A;  3SZT A;  3FMQ A;  1XMK A;  4MEY F;  2K86 A;  2Z33 A;  1PUE E;  4CGZ A;  1SD5 A;  5E1X A;  2KIF A;  5LLQ A;  3FWE A;  3K9T A;  4EM1 A;  1ZAR A;  1P4W A;  1MJ9 A;  5DD8 A;  2Q2E A;  3T0Y A;  4UHT A;  1BN5 A;  3CTA A;  3MZY A;  3P7N A;  2L4A A;  4RB1 A;  4H0E A;  2CQK A;  3LQR A;  2DQR A;  1SMY F;  4YFX F;  1B9M A;  1IN5 A;  2NYX A;  1KU3 A;  5K5Q A;  3AAF A;  3TOB A;  3BJA A;  3KZZ A;  1SFE A;  3RDI A;  4KFC A;  1G3T A;  4L18 B;  1O3R A;  2QZ8 A;  3G3Z A;  2BBY A;  2IT0 A;  1OPC A;  2J5O A;  4FT8 A;  4KNY A;  1IUY A;  1IXC A;  2AXL A;  2GXG A;  2XRO A;  3BY6 A;  2ZNZ A;  3M8F A;  1DDN A;  3EUH A;  2XHK A;  4QLC U;  1XMA A;  4IRH A;  4HLX A;  5A2Q Z;  5E18 F;  5LEJ A;  4MHG A;  5J6X A;  4Y17 A;  1ZHF A;  1FYM A;  1IRG A;  2PEX A;  2A07 F;  2QQA A;  3ULQ B;  1V3F A;  3ABU A;  1R22 A;  1ZLK A;  5H6Q A;  1ZLJ A;  3HSF A;  3CUQ B;  4L9J A;  5DUI A;  3ZN0 A;  1XGM A;  1ZH5 A;  5E8I A;  1SD6 A;  3QP6 A;  3W6J B;  2MD5 A;  1RUN A;  5CVV A;  3KP5 A;  5H20 A;  2GA1 A;  3DP7 A;  3KP7 A;  4MTE A;  1T2K A;  3GXO A;  2JRT A;  1FSH A;  1MDM B;  2G9W A;  2XV4 S;  1LQ1 A;  2FA5 A;  2DQL A;  4M9X A;  4LJZ F;  3R0J A;  2JTV A;  3KZY A;  4UVC A;  5FGM A;  4HV6 A;  4UNO A;  4K2E A;  1DPR A;  3E6C C;  5D8K B;  5J8F A;  2FQ3 A;  4PDK A;  4OIP F;  3WU0 A;  4TV7 A;  1H0M A;  3R0A A;  1QO0 D;  3GF2 A;  3KEQ A;  3F3X A;  5L3C A;  3K1P A;  5F1R A;  2OAZ A;  1XGN A;  4OU0 A;  1AWC A;  2RC4 A;  2ZBK A;  3I5U A;  1ZYR F;  3CO7 C;  4PGG A;  3NEU A;  4HQM A;  2XGX A;  3V7C A;  5DCF A;  1O3Q A;  3I53 A;  1BC7 C;  4GO1 A;  5JFR A;  5A2Q K;  3GUD A;  3L2C A;  1DPU A;  2K7L A;  3T8T A;  4BHP A;  4KIF A;  4A5M A;  3WTT C;  3KE2 A;  2XAJ A;  4WCG A;  4I02 A;  4EJT A;  2FOK A;  2L01 A;  2Z99 A;  3HRS A;  5HS9 A;  3E5X A;  1XGS A;  1O7L A;  4G9Y A;  4UXN A;  4HOB A;  2VOD A;  3VEP A;  1MGT A;  5IT9 Z;  4M9S A;  3GVA A;  3MAJ A;  4MQ9 F;  3S2W A;  4UVA A;  2QM3 A;  5E1W A;  3P9C A;  5CVU A;  2DK5 A;  4IJA A;  4P96 A;  1MJA A;  1SAX A;  5ICE A;  3DXJ F;  5K5O A;  2V9V A;  2PBI A;  1MJB A;  5BQT A;  2PLY A;  2FRH A;  3E5Q A;  1OYW A;  2R7F A;  2HYF A;  4LLL A;  3I0T A;  4Y13 A;  1I27 A;  3M9A A;  2GQQ A;  1RNL A;  4BH9 A;  5E20 A;  1HXD A;  2ZME A;  3TOA A;  4HW0 A;  4Y15 A;  4Q47 A;  3I58 A;  2FXA A;  4G7O F;  4OIO F;  1J59 A;  1R5G A;  5LHH A;  1B59 A;  3PQK A;  1KYZ A;  2LNB A;  4HYE A;  4CXF A;  4YG2 F;  2H27 A;  3MQ0 A;  2LF8 A;  2COM A;  2PG4 A;  1E17 A;  3GYH X;  1QZY A;  2ZCW A;  3ERE D;  1SD7 A;  4EMS A;  2XKO A;  4R8H A;  1FBU A;  4G6Q A;  3F6V A;  1Z6R A;  3RTR A;  3J81 K;  2IA1 A;  1TNT A;  1LDD A;  3WGH A;  1ZGJ A;  1Z7U A;  1HW2 A;  4OMZ A;  2V1X A;  5HDN A;  1QQI A;  3E6B A;  2PN6 A;  2W84 A;  3EDP A;  2UXX A;  3IRR A;  4RGR A;  2HOE A;  3P9I A;  5D6E A;  3FZV A;  2NNY A;  3OV8 A;  2P5L C;  2PJP A;  5L3B A;  4O5V A;  4I0A A;  2RKH A;  3RYR A;  2HTS A;  4ENK A;  3P9K A;  2O8X A;  1SMT A;  2M87 A;  3K69 A;  2EFO A;  4M74 A;  4ENN A;  2IA0 A;  3LWF A;  5LGT A;  3KCC A;  2HDC A;  1D8J A;  2CGP A;  4ZYG A;  1STZ A;  3CUO A;  5LRR A;  2Y75 A;  2KIU A;  2P6S A;  1BI2 A;  3GW2 A;  2DBB A;  3K1M A;  3FX3 A;  2QLZ A;  1OMI A;  1IN6 A;  2FE3 A;  5HOO A;  4P9U A;  4IRG A;  3FXU A;  1JHH A;  1T0F A;  3NRV A;  4CYD A;  2W25 A;  2ESH A;  4JBA A;  1XDU A;  5CYV A;  1FOK A;  2XKP A;  2HQN A;  5ILS A;  1TTY A;  3EET A;  5D4R A;  1ON2 A;  3R60 A;  5EEG A;  4BXU A;  1JXS A;  1IXS B;  1R58 A;  3EQL F;  2STW A;  2IRF G;  2IA2 A;  4FX0 A;  2VBY A;  3F8F A;  4RB2 C;  5D6F A;  3WTY C;  1YTY A;  1LDJ A;  5E8G A;  1U78 A;  4L5I A;  3GZ6 A;  4KN7 X;  4EM0 B;  1U8R A;  4M9Z A;  3FMS A;  1FX7 A;  2VBZ A;  1K78 B;  3BOQ A;  3ISP A;  2EV6 A;  4NHJ A;  1HST A;  4I7H A;  4EJW A;  2O6G E;  3BDD A;  1XN7 A;  3DKW A;  3MCZ A;  4LLG F;  4GYI A;  3MFK A;  2LSO A;  1REP C;  1YYV A;  4BNC A;  1P4X A;  3ELK A;  6PAX A;  1U5T A;  3LST A;  3O3K A;  2KJB A;  2D1V A;  4LB5 A;  1U2W A;  5EEH A;  4IXA A;  4LK1 F;  1KA8 A;  1K6O A;  3RKW A;  3TGN A;  1FP1 D;  5LRS A;  3KLN A;  3R6S A;  3CUQ C;  4I09 A;  1ZG5 A;  1S29 A;  4IVN A;  2XAG A;  3KP2 A;  2XAH A;  2ZO4 A;  2MLG A;  5K5R A;  3QRF F;  4L9V A;  2D1H A;  5CVR A;  5DD4 A;  3B73 A;  3HTU A;  1YQA A;  4LB6 B;  3KFW X;  3V7S A;  1W4M A;  4YFN F;  5FD5 A;  5FLX Z;  1WRJ A;  1BIB A;  2EA2 A;  4LG0 A;  4RS8 A;  1ZRE A;  3F8M A;  4MGR A;  2OZ6 A;  1F1Z A;  4KT5 C;  2V1U A;  4HF2 A;  1RIO H;  3CDH A;  5H6R A;  5DYM A;  4G8X A;  3C18 A;  1A04 A;  2W85 A;  3TO9 A;  2M5W A;  4HQE A;  3HHG A;  5LGN A;  3IRQ A;  3F72 A;  4F7Z A;  1TW2 A;  4KIG A;  2UXN A;  1J5Y A;  3BJO A;  3T8R A;  1EH8 A;  4G7H F;  5JVT A;  1MKM A;  1WSU A;  4MNU A;  5FB2 A;  2FF4 A;  4B09 A;  4KMU X;  4NB5 A;  3RKX A;  4DQ2 A;  3M1E A;  3HYI A;  2VE8 A;  3TDZ C;  1T98 A;  3BRO A;  2V6C A;  4CHU A;  1USS A;  1H9G A;  1GVJ A;  5L3D A;  1LJ9 A;  1ONV A;  3FF5 A;  1W7P B;  4ESB A;  3I4P A;  2RN7 A;  3IC7 A;  1IF1 A;  4MEX F;  2EFP A;  3VOE A;  1EV7 A;  1QBJ A;  4OMY A;  2HKX A;  3I59 A;  4IHT A;  2M30 A;  2FSW A;  4RB0 A;  2F5F A;  2VOO A;  1O57 A;  2XAS A;  1I1S A;  2F5C A;  5FLX K;  4HBL A;  1R5H A;  5HS8 A;  2VBX A;  4A6E A;  4IPA A;  1SFU A;  4AVP A;  4HAM A;  1XSX A;  4RB3 C;  2Y0M A;  2LF7 A;  3C7J A;  3H3Z A;  3IL2 A;  4HX8 A;  5FO5 A;  1R23 A;  3BJ6 A;  3ML6 A;  3LA2 A;  4XSZ F;  4N9H A;  4XRF A;  3E5U A;  3DPL C;  2A61 A;  4ZZD A;  3U9G A;  3GZ5 A;  3N4M A;  3MEX A;  4HF0 A;  1LEB A;  1F5T A;  4XBF A;  2BGC A;  2GXB A;  1T6S A;  2QQB A;  2UWM A;  4EQQ A;  2L54 A;  1GXP A;  1QNT A;  1XD7 A;  3ROU A;  2MC3 A;  5JR3 A;  4U7B A;  2P4W A;  1U3E M;  4S05 A;  5LBQ A;  5D4S A;  1FSE A;  2F2E A;  4FX4 A;  2DPD A;  1R1V A;  2X4H A;  4AWX B;  2MLK A;  1VTN C;  2ACJ A;  3QU3 A;  3B02 A;  3RPQ A;  5J8C A;  1OYI A;  5HS7 A;  3CLO A;  2P6T A;  2ISY A;  3COA C;  3IWF A;  5E1Z B;  2EK5 A;  4A2U A;  3ZMD A;  4AIH A;  1B1B A;  3SZP A;  2LKP A;  4YII A;  2K4J A;  2V1D A;  1KQ8 A;  1P4A A;  3F8N A;  2ZKZ A;  4BHB A;  2VC0 A;  1K79 A;  3VFZ A;  4E70 A;  3HTS B;  4I0B A;  3FM3 A;  2XRN A;  2VC1 A;  1ON1 A;  1U5T B;  1J0R A;  4U0Y A;  4O3M A;  2DW4 A;  4RGX A;  3E3V A;  2JPB A;  2CW0 F;  2O61 A;  4IHS A;  1W5T A;  3DQV C;  3JAM K;  1FLI A;  1D8K A;  1TQI A;  1HBX G;  1QZZ A;  2RDP A;  2JSC A;  2J5P A;  2P8T A;  1MDM A;  4GGG A;  1KGS A;  3VB2 A;  3FHZ A;  1B6A A;  2L3D A;  3E6D A;  4IRI A;  4A12 A;  3LQQ A;  1ODD A;  3BPX A;  3ZMZ A;  5BS6 A;  2EB7 A;  4Q48 A;  3J7A O;  5D5U B;  3I64 A;  5ILU A;  2DT5 A;  1Z9C A;  1ZGA A;  4A6D A;  2HQR A;  4AIJ A;  1AOY A;  4EGZ A;  2ELH A;  2K02 A;  4ENM A;  1WWX A;  3WTS C;  2EJR A;  1KQ9 A;  2VXZ A;  1SD4 A;  2IP2 A;  4KMF A;  2JPC A;  2K27 A;  2BV6 A;  1P2F A;  1UHM A;  4WXC A;  4S04 A;  1UFM A;  3BZ6 A;  1YLF A;  4AIK A;  5TRD A;  4BQA A;  2XUB A;  2XAQ A;  2Z5U A;  2KKO A;  4OIQ F;  1ULY A;  3KEO A;  4L5J A;  4ASN A;  3J80 Z;  1XSV A;  2K4B A;  4KIB A;  4PCQ A;  5FD6 A;  4EJV A;  2X0L A;  4EM2 A;  3TO6 A;  3DV8 A;  1P92 A;  3GFL A;  2WWY A;  1FT9 A;  2WC2 A;  3KLO A;  3JAM Z;  1XSD A;  5E17 F;  1F4K A;  1YW8 A;  4QWQ A;  2CFX A;  1RZ4 A;  4WXH A;  1TLH B;  1SFX A;  2O03 A;  5DUK A;  3BPV A;  1RI7 A;  2PQ8 A;  2HGC A;  2XIG A;  1Y0U A;  3K0L A;  4BYY A;  1Q1H A;  1W7P D;  1T38 A;  2E1C A;  4A0Y A;  1LVA A;  3GWZ A;  3GLX A;  4GYG A;  3SFZ A;  1CF7 A;  1BIA A;  3EYY A;  2OQR A;  2RQP A;  3F8C A;  3GX4 X;  2ESN A;  1TW3 A;  2QWW A;  4ESJ A;  4ZYH A;  1S6L A;  3FXR A;  3V7R A;  2HR3 A;  5HDK A;  2M45 A;  5DDG A;  1Z05 A;  1ZG3 A;  2O3F A;  2PMH A;  3DFG A;  1KU7 A;  3ZMT A;  3F22 A;  3QP5 A;  4JK1 X;  2RNJ A;  2FBI A;  3FMR A;  2DI3 A;  2L02 A;  3FM5 A;  4LG0 B;  3KP4 A;  3JW4 A;  1O3T A;  1IN8 A;  2W24 A;  1LDK B;  4ON0 A;  1XB4 A;  3RPU A;  4LK0 F;  1XDS A;  1Z6T A;  3RJP A;  2A69 F;  2MBF A;  1DUX C;  1OYY A;  5AIP A;  1XCV A;  4UV9 A;  3JSO A;  4XLP F;  3QPT A;  5L3G A;  4CDG A;  2GAU A;  3ECH A;  3HSR A;  4G7Z F;  3CJN A;  4N0B A;  1YG2 A;  1T39 A;  2YPR A;  1FZP B;  4KN4 X;  2EWN A;  4RGU A;  1I6X A;  2ADU A;  3L00 A;  3LA7 A;  5D5W B;  5FFX A;  3SXY A;  1CF7 B;  3WE3 A;  2ZJ2 A;  3ABT A;  1YO5 C;  3MZH A;  2GZW A;  4EJO A;  2MA3 A;  1J7K A;  1FYL A;  4R1H A;  1JE8 A;  3KP3 A;  3ZMS A;  3WU1 B;  3RIR A;  3ZPL A;  3WGG A;  2V79 A;  4O6J A;  3WTX C;  3JTH A;  1BI0 A;  3ZQ7 A;  1W5S A;  5D5X B;  2MH9 A;  4WXD A;  3IWZ A;  3H92 A;  2QUF A;  1HKS A;  5FFZ A;  3J80 K;  3FXQ A;  1X3U A;  5LHG A;  1FWZ A;  5HLI A;  4A0X A;  4PZJ A;  3QPH A;  4FHT A;  2DFI A;  4ETS A;  1KYW A;  3K2Z A;  5HVQ C;  4ZYD A;  2A3S A;  2FNA A;  2NNN A;  1FBQ A;  4NQW A;  2RV8 A;  4JQF A;  4KYW A;  4ESF A;  1U5T C;  1R36 A;  5BMZ A;  2FNP A;  4U88 A;  2HS5 A;  3L7W A;  4CIC A;  4N9I A;  3LAP A;  5LEK A;  5JHU A;  2GIV A;  3HSE A;  2E7X A;  3WTW C;  4UUV A;  3LFK A;  2NRA C;  1KU2 A;  1UHW A;  4B8X A;  1IZ1 A;  2WTE A;  4CZZ A;  1C0W A;  4P5O A;  2DU9 A;  5F6F A;  1IN4 A;  2A6H F;  4EJU A;  4G94 A;  4HF1 A;  4YIF A;  1O3S A;  4L9N A;  1S7A A;  1LB2 A;  2ISZ A;  2HEO A;  5LGU A;  1S8N A;  1L0O C;  1FNN A;  3C3W A;  2AS5 F;  3ZMU A;  5DCM A;  3L09 A;  1ZRC A;  3HUG A;  2QYO A;  1EH7 A;  2MH2 A;  4LD5 A;  3G73 A;  2OA4 A;  2DLL A;  4Q4Z F;  2PFB A;  1HKQ A;  5CVJ A;  1J75 A;  3J81 Z;  1D3Y A;  3TQN A;  4BHC A;  3H3U A;  3KP6 A;  2YSR A;  1J9I A;  3OOP A;  2EV5 A;  1YS6 A;  1WQ2 A;  2BEO A;  4KDP A;  3SQN A;  2D2W A;  2VBW A;  4I2O A;  2KRF A;  4UV8 A;  4EGY A;  1TQM A;  5AON A;  4XSX F;  2BE5 F;  2Y48 A;  3Q9S A;  2OBP A;  1HQC A;  3U2R A;  1O7F A;  3IKV A;  1YW9 A;  2OQG A;  2P7V B;  3QAH A;  4DNC A;  1PDN C;  2VE9 A;  5JI6 A;  5K1Y A;  1F9N A;  2ZFW A;  3E97 A;  4ZH4 F;  4LFU A;  4U0V A;  5ICF A;  1S7O A;  4G6D A;  1FC3 A;  3GFM A;  4PGH A;  2H09 A;  1QGP A;  2KJC A;  3WE2 A;  4GXO A;  2P5V A;  2YX7 A;  3HHH A;  5L3E A;  5HDG A;  5IT3 A;  2YR2 A;  4U7D A;  2PI0 A;  3REO A;  3HOS A;  1BBY A;  2HKO A;  3QU6 A;  2IW5 A;  2G7H A;  2STT A;  4LLN A;  1S3J A;  2P7C B;  2VOP A;  1GXQ A;  3I54 A;  1BM9 A;  4A0Z A;  1YFH A;  1TQP A;  3GO5 A;  1XGO A;  4OIN F;  2DK8 A;  2EFQ A;  3K1N A;  1HW1 A;  2M8E A;  2FU4 A;  4KUM A;  3PQJ A;  1G3S A;  3F23 A;  3V8L A;  1KQ0 A;  4RAY A;  3T5X A;  2E1N A;  4UVB A;  3L9F A;  5KK1 A;  3RKY A;  1Z1D A;  2Z9O A;  3SHF A;  2H6B A;  5CLS A;  2H94 A;  5ILV A;  2HWV A;  2EA4 A;  3JSP A;  1IAW A;  2DTR A;  3GEZ A;  4OIR F;  2KIM A;  1WKM A;  1ZN2 A;  5AIQ A;  4R79 A;  1E2X A;  1JHF A;  1G4D A;  3D5L A;  3GFJ A;  2CG4 A;  2DAO A;  3D0S A;  2VN2 A;  3KET A;  3CUQ A;  2LDU A;  3ZP5 A;  2D45 A;  2M1B A;  1QPM A;  1KU9 A;  2FMY A;  3GFI A;  2EFN A;  2YU3 A;  1DP7 P;  1YIO A;  4RAZ A;  2RGV A;  5L3F A;  4P9F A;  3ZN1 A;  3LAJ A;  5CVI A;  4L0Y B;  3EYI A;  2L4M A;  4U0W A;  3O6B B;  4M72 A;  3T1B A;  4LGW A;  4HV5 A;  3R4K A;  2FML A;  2OD5 A;  2E7W A;  4IF4 A;  1OKR A;  4HDV A;  5LHI A;  2ZXJ A;  4I98 B;  2W57 A;  2IJL A;  5F64 A;  5CJ9 A;  4Q5S F;  1B4A A;  1I5Z A;  4WWC A;  5BPI A;  3WTV C;  2QQ9 A;  1IN7 A;  4BAY A;  2DPU A;  1CGP A;  2IPQ X;  4EVI A;  1R1U A;  3PFI A;  1K78 A;  2CYY A;  2ETH A;  5HLH A;  3TO7 A;  3WOD F;  2RVC A;  4HX7 A;  4YFK F;  3F6O A;  5IT9 K;  4A5N A;  3C1D A;  3ECO A;  4ZZL A;  1HW5 A;  3ZMV A;  2P5K A;  3DEU A;  3O2P E;  2VON A;  1MZB A;  1WI9 A;  4EV0 A;  1P6R A;  2XAF A;  3Q9V A;  1UB9 A;  5HLG A;  1ZAO A;  1ZRF A;  2NS0 A;  4RGS A;  3NQO A;  1FY7 A;  1G3W A;  1EH6 A;  2DO7 A;  2HYG D;  4HZF A;  5ED4 A;  4LMY A;  4KIC A;  3VOD A;  4L0Z B;  4HDU A;  3WTZ A;  3WG9 A;  1BI1 A;  1YW7 A;  4HLY A;  1FP2 A;  1LNW A;  5BOX A;  2WV0 A;  3RYP A;  2EFW A;  5ERI A;  1B9N A;  1G6N A;  3CO6 C;  1XCB A;  3TKY A;  4HA8 A;  2GA2 A;  1IXR C;  1PP8 F;  1NHA A;  3RI4 A;  3N97 A;  2O0Y A;  3WTU C;  4HX4 A;  2VT2 A;  5KVR A;  1IRF A;  1MD0 A;  2Z3Y A;  1UST A;  4WX9 A;  1GHC A;  2NAZ A;  5ICG A;  1ZG1 A;  4WK8 F;  3U1D A;  2G7U A;  2H6C A;  1U6G A;  3DF8 A;  2FEZ A;  3Q5F A;  3IHU A;  5D5V B;  4WF2 A;  3IKT A;  2QEN A;  1FPQ A;  2Q8K A;  3BWG A;  2QVO A;  1FYK A;  4XLN F;  2ZME B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...