4EH1A

Crystal structure of the flavohem-like-fad/nad binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
237
structure length
237
Chain Sequence
b'RDGRTFVVREKQVESAYVTSFVLVPADGGAVLDYQPGQYIGIEVTPEGSDYREIRQYSLSHASNGREYRISVKREGVGSDNPGLVSHYLHNNVKVGDSVKLYAPAGDFFYVERERPVVLISAGVGATPMQAILHTLAKQNKSGVTYLYACNSAKEHTFAQETAQLIAQQGWMQQVWYRDESADDVLQGEMQLAELILPIEDGDFYLCGPIGFMQYVVKQLLALGVDKARIHYEVFGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavohemoprotein
publication title Crystal Structure of the Flavohem-like-FAD/NAD Binding Domain of Nitric Oxide Dioxygenase from Vibrio cholerae O1 biovar El Tor
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
total genus 78
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 1.14.12.17: Nitric oxide dioxygenase.
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4eh1A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4eh1A02
1Q86D 4QFMA 3WNDA 3AVXA 2B5OA 3CRZA 1EXMA 1N0VC 5DSZA 4RD0A 3AVTA 4AF7A 1DG1G 3E1YE 2QTZA 2BPOA 3PENA 1CNFA 1QGAA 3FJOA 2YWFA 3QE2A 3CCVB 1GAQA 2OTLB 4PC7A 3CB4A 1Q81D 1I7PA 2QEXB 3CCMB 1E63A 3ES9A 1R5BA 1CNEA 4N3NA 4YALA 4YAFA 4N3GA 1N8RD 3B8HA 2VNHA 3W2GA 3W2EA 1G7RA 1YJNB 1F60A 4TMVA 2EIXA 1QGYA 2BGIA 1DDGA 3OZVA 3ZBUA 1A8PA 1VQMB 4YAUA 1Q82D 1F20A 3W5VA 4TN1A 1W34A 1QH0A 4FK8A 1YI2B 3AVYA 1KK1A 5HXBA 4M0LA 1QUEA 3P26A 3G4SB 2BVNA 3W5UA 3JQRA 3B82A 1FNDA 3W2IA 1VQPB 1N0UA 1YITB 3I55B 2FX3A 4LBWA 2X3UA 1KK2A 1DDIA 3VO2A 3QFSA 1JB9A 1EFUA 4C43A 3WNBA 2NPFA 1VQ9B 2QTLA 4NCNA 3V76A 4ZGQB 2HDNB 4ZV4A 4B47A 1BX0A 1OGIA 1ELOA 1GJRA 3CC4B 2XNJA 3QFTA 1TTTA 4FN5A 3MCAA 3OJWA 4P3YA 5H5JA 3G6EB 1W87A 1EP3B 1CQXA 3LVBA 3AVWA 4TMTA 4PC6A 3MMPA 1XB2A 4PC2A 1S72B 3W2HA 3CMEB 1IJFA 4TMWA 4LC0A 1E64A 3MHPA 4B3XA 4J0QA 2BGJA 1J9ZA 3CMAB 4R71A 3JQPA 3CW2A 3QFRA 4FWTA 1JJ2B 2QA4B 4UAJA 2HMAA 1YJWB 3QFCA 2B7BA 1FRQA 3ZC3A 2VNIA 3AVUA 3A1FA 1QUFA 4Y7CA 1GAWA 1QG0A 1KJZA 4DQLA 3CCEB 3WXMA 1AIPA 4ZCIA 1NDHA 2B7CA 2DERA 1VQNB 2GPJA 2VNJA 2OTJB 1NJID 2QDXA 1M90D 2AHOA 2R6HA 5TV2A 2E1RA 4M4SA 1YIJB 1K9MD 4AF6A 1QFZA 1KTVA 1G7TA 1SM4A 3VMFA 2PIAA 1ZM3A 4Y9UA 1BQEA 1TUIA 2VYQA 5GV8A 1BX1A 3WY9A 4WQMA 2YWEA 3G71B 3CCQB 3ZZTA 4YAOA 1G7CA 4EH1A 3CCUB 3AVVA 4H9GA 1DARA 4G1BA 1YJ9B 4G1VA 1S0UA 3OZUA 1EFCA 4Q7JB 2XEXA 4RJLA 2BM1A 1BJKA 4MYTA 4G5GA 4M2LA 2DCUA 2ZITA 1TLLA 1ZM2A 2OK8A 3CCJB 4U9UA 5H59A 1WDTA 1OB5A 2BN4A 3CXCB 2J7KA 3CCRB 1K8AD 1D1NA 5KSWB 1R5OA 2RC6A 2BM0A 3U2QA 2DEUA 1Q7YD 3W2FA 1JNYA 1R5NA 1B2RA 4MYUA 1KK3A 1FNCA 1KK0A 5THXA 1U2RA 3SJZA 3ZZUA 1KRHA 4B44A 3U6KA 3WYAA 1H42A 2QN6A 3I1FA 3LRXA 3CCLB 3U6BA 1FNBA 3CD6B 1JA0A 4HE6A 1VQLB 2CRVA 3LO8A 1VQKB 2BSAA 2OK7A 4PGOA 4M53A 2QMUA 2YWGA 1QFYA 1ZUNB 4DQKA 3OZWA 4RCYA 3FPKA 3VNUA 3JQQA 2DETA 3WBKA 1VQ7B 2C77A 3AGPA 1QFJA 5JBQA 3CC7B 1B23P 3LYUA 1H85A 4M1KA 2D74A 1W35A 2PLFA 4YAWA 4LBVA 3I56B 5GV7A 1KD1D 4B4DA 1GR1A 2XNCA 1VQ8B 5TY0A 1GO2A 2BF4A 1K73D 1FNMA 5AN9A 1VQOB 1IJEA 4Y9RA 2RC5A 1GVHA 4LBZA 4TMZA 4AC9A 3WNCA 4QHYA 4PC1A 1EP1B 4PC3A 5FA6A 1SKQA 4F7DA 1QVGB 3ZZ0A 1VQ4B 1D2EA 2BV3A 4RD6A 1UMKA 2CNDA 4BPRA 1QGZA 1EWYA 4B48A 4TMXA 3B78A 1FRNA 1VQ5B 4K1XA 2YWHA 4RD1A 2C78A 1ZM9A 1G7SA 2VNKA 4C0SA 1D8TA 3W5HA 1OGJA 4RD3A 1E62A 1VQ6B 3WBJA 4ACAA 4RCZA 3ZBTA 2PMDA 1YHQB 1FDRA 3VO1A 4P6VF 4ACBA 4IW3B 2GQFA 1TVCA 1M1KD 4RD2A 2EFGA 2VZLA 3P27A 4B43A 3E20A 1KQSB 4HE5A 3AGQA 4ZCMA 1EP2B 3J81k 5EMNA 3CCSB 4RD4A 3CPWB 4ZCLA 1QVFB 1ZM4A 1HA3A 1XE1A 2DY1A 1W2BB 1EFTA 1QX4A 1JA1A 5TR9A 2HCJB 4ZGNB 4YHBA 4NBSA 3OJXA 3CC2B 2BMWA 1OB2A 1KC8D 3QSYA 3OW2B 3VNVA 4LBYA 1AMOA 1IB0A
chains in the Genus database with same CATH superfamily
1QOZA 5BN5A 3ASSA 3ZLTA 1UP6A 1G98A 1XZEA 3LH5A 2G5PA 3ASTA 2SKEA 2ZWOA 4ZQCB 1AQ6A 3T41A 3TZCA 4GT1A 2QJFA 4WACA 5LYJA 1J2UA 4CM9A 3H9UA 3KVNA 1VHJA 3AVTA 4GICA 2P2SA 4DV0B 3O4FA 1OWLA 1X92A 4HTAA 4PZDA 4PXAA 1WTCA 4HWTA 4LC9A 2BPOA 1G5RA 1U0OC 3WLPA 4ZEOA 1KSHA 3QWAA 2JI8A 4OOSA 1LDEA 1RAAA 1RPNA 2ZFUA 2CHUA 1LNZA 1Q1EA 2ZVJA 4K86A 3DDCA 4PG5A 5BW4A 5LLSA 5B7NA 1G0OA 1TYEB 3O4JA 5F78A 4YIKA 4FFBA 3QZUA 2HJRA 4E4RA 4ZYLA 5FI1B 2QN1A 3AHCA 1C3OB 3BGSA 3DVRX 4O33A 1TEZA 2WB4A 1SQ5A 6PFKA 1PRYA 3W77A 3NYRA 4IYRA 2UUAB 3CO5A 4GAEA 3LYLA 4RL6A 2FR1A 3WTCA 1AJEA 1PG2A 2P9GA 5A05A 4OJTA 4OI0A 1AH2A 2B4QA 3QPCA 3SLRA 1TJ5A 4UQPA 2AZMA 4ID3A 1UBCA 3FCOA 1K9VF 4E2FA 5HYVA 1PVVA 1W4CA 2WP0A 2B3TA 5HCNA 1RW4A 1ZCBA 2XW6A 1T10A 5EY5B 4CIAA 3X1ZA 2NO1A 4RSGA 4DNRB 2M9MA 4S1TA 4DLAA 4FDAA 1T8TA 4EMSA 4D8UA 3KFVA 3PJGA 3WIEA 1SUFA 1ADCA 2I2CA 3HDJA 5FYQA 4XPZA 1VZ2A 3MRTA 3E70C 1RABA 1H8EA 3BEOA 3GRKA 4QUZA 1N6OA 4J7AA 3ZKAA 5CVUA 2PRKA 1UT6A 1GZUA 2N0SA 4MUGA 5IYZF 4F6RA 1JFLA 4I3GA 5T8KC 1O6GA 5AOCA 1YQ9A 1SUPA 4ZOBA 3M81A 3UAVA 3TN7A 4G5OA 4PN7A 5KO2A 2FWAA 2QVZX 2A5GA 1LK0A 2X41A 4X20B 2H4XA 2O2YA 3HJRA 2VJYA 3UYKA 1JVBA 2OHJA 2WJ4A 2BONA 4M0LA 4MV4A 4YUVA 4F5WA 3OZSA 2IY8A 3P26A 2FFQA 2QZSA 2I7VA 2VQ3A 3ZKWB 4JV5B 5J58A 1MC5A 1PHRA 2BJWA 2HD4A 2NVWA 3HBNA 3LKVA 3ZE2B 2GO7A 4DABA 1VL8A 4DQUA 1OZFA 2QA5A 4REOA 1VQPB 1LDBA 1X1QA 2A5LA 4QDOA 4YJ2A 1S4MA 2A92A 5FPKA 3AP3A 5HOQA 3ND5A 4QUJA 4BGIA 2XODA 5B64A 5B58C 1XELA 4AX8A 3RUDA 4E70A 1H93A 5EQTA 3KYDA 4RLHA 3RBVA 4WBNA 1K88A 2NU6B 4DWVA 5C5CA 3FHTA 1QOQB 2XGGA 1G6HA 3W06A 3CGWA 4EHFA 3SIXA 2VDWB 1XFOA 1YXMA 1WOYA 3WNBA 1W8IA 5JAZA 1JLSA 2X3YA 3TBKA 3VH3A 1DWUA 1Z08A 1YR2A 2ZTNA 3UWSA 4Q9DA 2WAXA 4XIYA 1XMPA 1OH7A 1H6DA 1GADO 2HUPA 2PRYA 3DMRA 1ZESA 3LY9A 3PXUA 4KQIA 2W8BA 2ZIVB 1Z83A 2JCSA 4WVFA 3UFXB 3K2IA 4G5RA 5AUNB 1BVUA 1ABFA 3DCNA 1SHZA 3IVCA 4RLZA 4YCNA 4BFLA 4Z9BA 1IXZA 2XWBF 1U0LA 2W00A 4C14A 4CIBA 1JFRA 4ND8B 1KZGB 4BHTA 3I2KA 3ZXXA 3PA1A 4QQNA 4ZOLA 2NVOA 4AUNA 4CEIA 1GPWB 3PXAA 1L5OA 1D2NA 1MV8A 4BMXA 3CGGA 4GX5A 2NSYA 3SJPA 5K0ZA 4HDSA 1DNPA 4TTAA 2Z6BD 4PGMA 5IVHA 2IZ5A 1PTKA 2WV9A 2YIVX 4I4TF 1A8QA 1C41A 2MSNA 2J5RA 3ANTA 4DSUA 3NHWA 2Q21A 2P2LA 3CF4G 3GFVA 4V02A 1NLFA 3VR4D 1WKBA 2XNDA 2G5GX 2VS1A 4GF5A 3KIPA 3REGA 1EG2A 2C1XA 5BYKA 3FFBA 3QW2A 2OD9A 1BG6A 4IEEA 4ZEWA 1QVVA 3BICA 2E9SA 5A4IS 1TQ4A 4AK9A 1Z88A 1Q7CA 1E0JA 2Y92A 4FWTA 1ONPA 3OURA 5CA1A 4XMYA 2DM6A 1GNRA 1CT9A 1X3LA 1S7CA 5LCXA 3U4AA 4A0HA 2D0OB 1PL6A 4PTLA 2JVKA 5L53A 1XTSA 1F06A 2IYSA 3EZ7A 3FHJA 4IDOA 3G9ZA 3P9SA 1PNQA 3L49A 3LM8A 3LPAA 3L2OB 2REXB 3R0JA 3TUIC 2VRNA 4YUWA 1NOJA 3WQRA 4HLDA 4MWSA 1PGJA 2CCKA 4ZYYA 3HU3A 1UBKS 4KP7A 4PZPA 4YRJA 3TFWA 3EGOA 4R2JA 2O2JA 3DLAA 3RM3A 3WQQA 1QDEA 1PX0A 4M1OA 1PR5A 1QUFA 4A8PA 2JLRA 4Y7CA 4EHDA 3WK8A 2NGRA 2VRCA 2V9PA 5D2CA 5DTMA 4HJXA 5BQOA 5DGTA 4EKGA 2R8EA 2VRBA 3KWMA 1BEUB 4ZGGA 2MSEB 3FUTA 1QYXA 3JTEA 3WRXA 1VQNB 5JZBA 3ADKA 3GGJA 2OTJB 3B3JA 1PN3A 3ECSA 1RVV1 3O8RA 1NJID 1M90D 4KQGA 4RANA 1L8LA 3RVPA 5HUQA 2ZKIA 1NMEA 4F91B 2E1BA 1RJGA 2F59A 3DZDA 3NH9A 2VWQA 1Q6ZA 3O94A 3PDJA 1QU3A 4HK4A 4UNPA 4DLXA 2I3DA 3L40A 4Z4HA 3UBTA 2ZVPX 3CWZA 2HIGA 2X5KO 3QU9A 1FTNA 4K26A 1UQUA 3LT0A 4PLVA 1LBHA 1A5AB 4D4MA 2EBWA 4UCFA 1JFTA 5TSDA 1J2YA 1N5KA 2ZP1A 2C5BA 4KQ9A 4C0QC 2FPWA 4GLJA 5HIAA 3FWPA 1TM7E 2QLTA 3ASQA 4IJUA 4HQOA 4M0MA 4BO5A 1LDYA 4UNIA 1WRBA 2P67A 4JBIA 4RBNA 5DPMA 3G0HA 1C1HA 1CJVC 3C5WP 1UXOA 4FNOA 3BGIA 3TLXA 2HGSA 2YV3A 3AIOA 5FQOA 1CJBA 4NONA 1OIXA 4MP3A 1FPMA 1UOQA 3IKLA 1HRKA 1YWGO 2LW7A 5EIBD 5K8UA 5FOWA 3V1MA 4BWFB 5KYYB 1L3IA 2B1GA 1GFSA 1B4DA 3D7NA 4KGZA 4H9GA 3OJCA 3EDRA 1Q7EA 1QORA 3KJQA 3PC8A 2O05A 1KOJA 4GG1A 3RHTA 1LPNA 4B4VA 1L5WA 2ZETA 4LDRA 4UD2A 5GJVC 4RFVA 1IJBA 3JZDA 4EPTA 3ZPXA 2FVXA 5DXFA 2H4ZA 4HXFB 2VSNA 5KS2A 3RYCB 1XAIA 4DBLC 1SOUA 2QJOA 2GJ9A 2X8WA 3OAAD 4B4KA 4EPXA 1UBNA 4QM6A 3D4NA 5EP2A 1OU4A 1UJ2A 3EAFA 1U6IA 1K7EB 1TNDA 2VJMA 5EJ9A 2QRNA 3DV0A 3L6RA 2PFSA 3I9JA 4JI7B 1T6BY 3K9LA 5EEGA 4KGXA 1CZNA 1Q0LA 2H7CA 2BM0A 3U2QA 1BMTA 1Y4AE 3LLMA 3WK5A 5DHSA 4EHHA 5BUZA 3CN7A 4JUIA 2AXNA 5ICFA 1DUVG 4E08A 1EVEA 5I3CA 5HF8A 3U7IA 1WD5A 3E1KA 4M55A 2GK7A 4ZRNA 2QGZA 2GLUA 2YY5A 4FVTA 3HACA 3GP8A 2JZOA 2J3LA 2X9VA 1MNAA 1X7ZB 1QCDA 1AKTA 1NNLA 1O57A 3FWKA 2ZUUA 4KQJA 4EZIA 1CERA 1CG6A 1QKIA 1DKRA 1LV8A 3OZIA 4XDGA 2J0VA 5EE0A 4H7IA 3S2UA 1CUAA 1PV1A 4B2IA 3EEFA 2B6NA 4AJLA 2C2MA 4WZBB 3B6EA 5KJCA 3R3WA 2BR5A 3DDWA 3F9RA 5TQ0A 4Z4SA 1TUBB 4L2IB 4YAJA 1EA7A 3TTWA 1DX9A 1YBVA 1PUIA 3L8DA 4L0MA 4CT0A 4L8VA 2BM8A 4MCAA 1T9KA 1IQPA 5HQJA 4Q18A 2BH2A 2W2TA 4D3YA 2EW2A 3B3AA 3UGQA 2WJZB 4NBWA 1YF3A 4PO3X 2O14A 4IJVA 3U81A 4N03A 1L7OA 2PR2A 2P3LA 3OLCX 5C5IA 1H4VB 3MCTA 1N0IA 1U9CA 3MYYA 3QYAA 4I5IA 1ZINA 4HFJA 3K1JA 2HLNA 3R4VA 5DV9A 4CLOB 2XV1A 2QJTA 2ET6A 3CH5A 3OU6A 4DIDA 1KU6A 4QJ3A 2V7WA 1PU2A 2D5IA 3WMGA 5F5LA 2J31A 3M4ZA 2W58A 2X13A 4PRYA 3Q1KA 1UBMS 2NXJA 3AESA 2O3QA 3NWBA 1YACA 4OQFA 5AKJA 2J3JA 1YNSA 2D0IA 3T7SA 4B6PA 3PUKA 4BFWA 1EK1A 3DXXA 3E9MA 5A3SA 4HSEA 2O3UA 3H1TA 1ZXLA 3N2LA 1LRLA 4B6RA 1H0RA 2L0XA 3H83A 3Q7SA 2WMDA 3QPDA 3DV2A 3V2HA 1ICIA 3A4LA 3VNAA 1W29A 4ALJA 2IHBA 2NAPA 2RHRA 3OZAA 4AB1A 3FJ1A 2DFNA 2D74A 3LA8A 4IIJB 2D7DA 1SAYA 2J46A 2NYRA 1PR4A 3AERB 1E66A 2WFMA 5IAKA 3VU3A 1SXPA 4JLPA 1IBKB 4KQXA 4DYHA 1WZIA 5CYPA 3OCYA 2YN4A 5MFZA 1ATIA 4AY2A 4ERXA 4DRXB 5CFZA 4Q21A 3NLLA 3R6GA 4UZSA 1YOVA 3UC5A 2IX3A 4D0LB 1W36B 1KJ9A 1GKIA 1NG9A 1DEHA 3MUNA 1P1JA 2O5RA 4HN4B 1SG6A 1ZKMA 2EDAA 1VIYA 5IDQA 4XIIA 3ZZMA 3SEZA 4IZOA 3T3PB 4I5DA 4P2NA 2OG1A 4NYIQ 5JQGB 4P5EA 1J07A 2GF0A 2VSXA 4PZEA 4RV9A 1C8LA 3H9BA 5JD5A 2JVJA 3NBAA 3OTGA 1OT3A 2VDMB 4MCIA 2EYUA 1R4NA 4Q15A 4KR6A 4C76A 2FK8A 2DR3A 2L82A 3K15A 4BNDA 3PQ3A 1OI4A 1TF5A 4I46A 1GZ5A 1L4NA 2HF9A 1Z8NA 2EIHA 3I6QA 4TV8F 3RYIB 3BA1A 4G97A 4Q6BA 3NM4A 5EQJB 4DCOA 1WBJB 4LIPD 3DGFC 1EA5A 1EK5A 1VLHA 2ISCA 4YDSA 4ZV9A 4LOJA 5K2OA 4WZZA 1R74A 3BAFA 3M9WA 4R05A 4YN3A 2F4NA 2F3TA 1VLYA 3HCBA 2DFLA 1J5PA 4RH0A 1PNRA 1PNTA 3PUYA 4G1FA 2R8YA 3F47A 1FUEA 3HXTA 3KVYA 3O31A 3VGPA 2XMZA 4IIVA 2EFYA 5CURA 4KQMA 4NPCA 4W4TA 3DLPX 3E15A 4C21A 3AR7A 4PPNA 1XRMA 3NRBA 1Z4IA 4QG3A 3RYHA 1HE3A 1PVDA 2RKBA 2EFCB 3GVCA 4GUAA 3NV9A 5AKKA 4CXMA 3TI7A 1Y4DE 2O7QA 2W48A 1B15A 3AXSA 4TX1A 3DUWA 2A0YA 4MWBA 1YS6A 3G8CA 4HDQB 4K6OA 4B6OA 1ZI9A 4BKPA 4RD3A 1AOXA 1JLRA 2BE9A 1SZPA 1M74A 2MSDB 3ID6C 3MLEA 4LPSA 5SZKB 5CB8A 4C3UA 5A4MS 5HQ3A 1SG0A 1NP7A 4ACAA 2VK8A 2BD0A 2FWNA 4UTOA 5DLEA 1OWPA 3L8FA 5LLDA 4CM8B 3T35A 4D3XA 2QAGC 1EGMB 3TMYA 4E33A 3RHFA 3DOJA 2EJUA 2VEDA 1T6XA 3OE7A 4HRAA 1X7GA 5AJZA 2PKQO 2V5AA 1JKFA 1E3TA 1YU6A 3L7NA 2JLWA 2GBLA 3W8DA 1U8EA 3HBFA 4IS2A 5KOYA 5HUJA 2M2IA 4CLHA 3RABA 1FLNA 1ZEMA 4X54A 5LOVB 1YUNA 2PJZA 5GZ3A 4BEVA 4EP1A 3AEUA 3VBEA 4NOMA 4Y6GB 4CFSA 5FUBA 4KO8A 4ZOAA 1W0CA 1UOOA 1MTZA 2GHTA 3GY0A 3PNOA 4IJ6A 4I5GA 2C5AA 3FUWA 5KJ1A 4ERNA 3DFZA 2DT8A 4TV9B 4BO1A 2Q3JA 4FOLA 5CJPA 1S6YA 5J43A 1P9OA 1R4MB 5E6SA 4PG8A 4I1PA 2FW8A 5DMHA 2PGDA 4C0KA 3UOAB 1EP2B 3FCYA 3J81k 5G1OA 1EBFA 1I9GA 1NI5A 3TX6A 3CPXA 3CWQA 1A77A 3UGTA 4JP1A 3SQWA 4M8IA 1E2QA 1WDWB 2H5LA 1CQJB 4X0EA 1NY6A 1EM8B 2WNHA 1PP4A 3DLIA 1N9KA 4UU7A 5EMKA 1DBPA 1R16A 1C3EA 4AJJA 1XE1A 4UTNA 1XD9A 2C9DA 1QIEA 1NA5A 2QPOA 3D7SA 2WTAA 3FPHA 1NJ8A 2Q2VA 3JWEA 3WDSA 4MUIA 5BMOA 2J3EA 4EI9A 1Q77A 3BCUA 1ZUD1 2WJWA 4OHWA 4TXMA 5CNMA 3RNOA 5KNBD 9MHTA 5IC4A 4JELA 1EG7A 4INJA 2PRSA 3L77A 2OVFA 1PK7A 2NLOA 3GRUA 3OX4A 3OBBA 2BFFB 3FPGA 4MIKA 1N4DA 1KI3A 1AMOA 5AIAA 2WQZA 4U5XA 1OKKD 5E6RA 1Y8AA 3BFKA 1F8GA 2MJLA 1NE7A 4PLPA 1LDNA 1W581 2A9FA 3D7MA 3JAKA 5LB4A 2CBZA 2QD3A 4EA9A 5BQ3A 1T2NA 3Q3GE 5FO1A 2YJ5A 3S2IA 3SYLA 2AFVA 3Q85A 1E2UA 3TW0A 2ZCUA 1LSOA 5EKUA 3ENZA 4RLSA 3RUPA 2QTZA 3K96A 2IYQA 4O2BF 1I2BA 1NN1A 2ZYRA 4XQGA 1LDMA 4PAMA 5K05A 2QRGA 2D8AA 2BYTA 1A0OA 5JV5A 2GTPA 2NTEA 2BKVA 5DIFA 4AKIA 2EDCA 1YULA 2QSYA 3BWXA 3B3GA 2BBOA 4YMSA 5T3UA 3IDSA 4FUQA 3U3RA 3KR1A 2DHDA 3QE0A 1Y3HA 2OBRA 1NUQA 2FN4A 1QIHA 4M54A 2X40A 4U0KA 5IKXA 4QLBA 4QEDA 4GMGA 3BE6A 5HFJA 2EYQA 1T9GR 2FEWB 4LHWA 1JEQB 4A10A 3IIEA 4CZ2A 2VDPB 2P69A 3CJRA 1IHYA 2RD2A 4YCDA 2F4VB 5KYXB 2FPIA 3BWVA 1GGMA 3NV7A 1P3JA 5CM9C 3AFHA 2XUOA 3L6UA 3NHUA 3T94A 3ZXIA 4Z4TA 2QM8A 3Q3AA 1I3OA 5DSXA 2G07A 5BW8A 3WQBA 4TRJA 2VLBA 3MLBA 4QO7A 2BHRA 4HDMB 3ROPA 3ZTTA 2LIPA 4I66A 5AFSA 3GAAA 1FYDA 4IJMA 2UXDB 2MT9A 5SYMA 1SFRA 2CNWD 2P9JA 2BSXA 5CTAA 4YP7A 1ULHA 4HHEA 4MB0A 5FLKA 2JGMA 1KC1A 2I9PA 3QLEA 3UENA 2WSSD 4QFCA 1ZHFA 3UCFA 4Q3NA 2WUEA 3LC0A 5B58T 4L8GA 4I1SA 2GHQA 3ESCA 3TL2A 1KPIA 3BTSA 2VYVA 3IILA 3Q88A 5J2TA 1PDOA 3ASUA 1QIJA 3KFXA 2UU9B 1MRZA 4RV4A 4KLNA 3L43A 3UQYS 4X1KA 3E2PA 3FUCA 4NJEA 4W9NC 1BMFA 4RAQA 3WWZA 1J1ZA 1RP7A 1P3Y1 4IHJB 4YJHB 1J7JA 1MO3A 2FSPA 1N06A 2IOQA 5FA5A 5C35A 3H9EO 4O4LB 1OYWA 1W94A 4FD3A 3VO2A 5BN3B 3PX2A 3T5PA 1Z06A 4QUEA 4V2IA 2QRKA 1RWOA 3BH7A 4OHPA 1Y5MA 4EW2A 1FK8A 4OHVA 3UWKA 2B8TA 3E22B 1AS2A 2XRYA 3I72A 3K70C 3AM1A 2EJWA 2XWQA 1U0JA 4OHUA 3CESA 3KWFA 1WTHD 4JXKA 5DMXA 4F2PA 2WW8A 5I7SA 1VPLA 5DLDA 1M1XB 1W5TA 3IMFA 1VG8A 5L4NA 3V3KA 4W9MC 1T34A 4QUGA 4OB6A 4BVEA 5FBVB 4X61A 1SC3A 2G0NA 2R1TA 1XHFA 3JWJA 5KI6A 4DR2B 2XNJA 4L85A 4X97A 3JD2A 3HN6A 1JHOA 1E3XA 3AQ4A 3DJYA 3AF0A 3JQDA 3OJWA 3KLMX 3PBKA 2C5SA 2R8PA 2HA2A 3PWKA 2Z9BA 3KKMA 4RE6A 4BVBA 1M3SA 3V6LA 5KNCD 4KQ2A 1M1YA 1YCFA 3W6NA 4PRLA 5JSZB 5IJ0A 1N78A 4H3KB 1C30B 3JRXA 3QY0A 1Q5PA 4FE4A 4WNAB 5I8PA 1C9DB 1V35A 3KQHA 1T9DA 1DO0A 3KVRA 3PHIA 4PVDA 5J4VA 1H2HA 1YMQA 3VHXA 1C9JA 2HDHA 5LOVF 3PD0A 4RACA 4UTVA 1YA6A 2HU5A 3F9IA 4GI7A 1T5EA 1YAHA 3LYHA 4J0QA 3A9CA 1M6YA 1R2QA 4M8LA 5BSMA 2OZLA 2FLKA 1NUSA 1QG6A 4NEHB 2WQ6A 1NVWQ 1NN5A 4B17A 1PGQA 4WN9A 4GVLA 2I2BA 4OOFA 1MBZA 1TCBA 4WKOA 1JYSA 3BK7A 3ER9A 5KHOC 1BKSB 3NRJA 1A4XA 3WAKA 2B4KA 5COBA 1G0NA 3IAHA 1P31A 1SA0A 2P6MA 4DBLE 3PNSA 1QK5A 3DEYX 4B3BA 3N0XA 2VPYA 4BNGA 2RIPA 1K98A 1VCHA 1I7SB 3WKCA 3MQ4A 1HORA 3NBXX 4KYTA 1IVNA 2TMYA 3HJNA 3JQ9A 2ZT5A 3UOWA 2IDMA 5EI5A 4MB6A 2AOVA 4MLCA 3IS3A 3Q87B 4J90A 4JI1B 4RGQA 1YR8A 1H2YA 1EFAA 2BFOA 3LRTA 2ZI4A 4X3PA 3CVOA 3D6VA 3OD1A 4MRNA 1PQPA 2PJUA 2WIJA 4MVJG 2NIPA 2RGYA 3ZYZA 1EUCB 4Q24A 4FFPA 1XZAA 2Q8QA 3I1IA 3LLCA 3NT4A 4XCXA 3V8RA 2I7TA 3ZW8A 2C58A 2V3CC 5DNYB 1WETA 3SLKA 1S9DA 2OO3A 2O8NA 1I6KA 3S55A 4DN6A 4OBEA 1O5OA 1Q84A 4C9BA 4ZANA 1GLVA 5FPPA 3JYQA 4Y67A 3PCXA 3RIHA 2ZSBA 3NC1C 3UMVA 3GJ8A 5EXSA 2IP4A 3K0SA 1VJ1A 1BS2A 1R3UA 1MAAA 1XNGA 4ER5A 1Y48E 2MCFA 2GRJA 1RLJA 1IG3A 4ZK2A 2QYOA 4B4UA 2K2QB 2EX0A 1THTA 1Z4MA 4XAQA 5HK8A 2I6FA 5HIIA 1YBHA 4UBKA 3TKLA 2R62A 3RANA 2JGDB 3ZCRA 3G1WA 1OX6A 2RAVA 3D64A 5EJ6A 4UE3S 3S81A 3HGQA 1DMRA 4HRYA 3V33A 4DZZA 1AQJA 1FL9A 5AK3A 1WUHS 1YQXA 3AOEC 4HVCA 4D44A 4TKOB 4GM0A 4ALIA 2Q49A 3VC3A 1H66A 2HX1A 2FSVC 7YASA 2IPNA 5CT9A 5AHRA 3DNPA 2PSFA 3HBAA 1FW6A 1SIBE 1BJTA 3WA7A 1M6VA 5GV8A 2ZKLA 3VHRA 3G88A 4F4JA 2JLYA 1QH8B 2YKGA 1YK0A 3DW3X 4ASUA 1LI4A 3MIIA 1NFQA 2QTHA 2XY4A 3FFAA 1CZOA 2ZJ7A 3JRWA 4HH4A 4IOLA 1M6HA 3DKRA 3O38A 2FEKA 4G85A 3CCUB 3FMVA 3GVHA 3CU5A 4RF5A 1E9VA 1AUQA 2Z5LA 3V8EA 1J1IA 2FFAA 1SIUA 1NC1A 2CLEB 2EZ8A 3EMVA 1RHJA 3I23A 1UBTS 1QGOA 2UZ1A 1X9HA 3F96A 3ICEA 1IAVA 1LTHR 1C1DB 5UKDA 3C6ZA 2GD6A 2P41A 2OCGA 3U09A 1D4AA 3F3SA 3GJZA 1ZLYA 2RBKA 4YRTA 4E5PA 1K75A 1V5IA 1PL8A 2E85A 1MDBA 1Y1LA 2OK8A 1Z17A 2BKLA 2IYLD 3S7ZA 1CEQA 2ECFA 3U40A 2CLKB 4ND7A 4YV7A 1MOQA 1JLKA 3L01A 2UKDA 2YXPX 4FCWA 3A05A 5KSPA 2AG1A 4KQKA 1UKCA 2FDCA 1LWNA 1V5WA 4W5NA 1P7WA 3V4RA 4AROA 2HAEA 5AI6A 3DZGA 2R1UA 3QK7A 1DP4A 1WORA 1O03A 1TTHA 1SXHA 3W2FA 1XHEA 2Q0HA 5J40A 3N76A 3O0TA 3PR3A 2C0CA 1QQ5A 3Q6RA 4U8GA 1O97D 3JCZA 4Q3KA 1Y34E 1H5QA 1HFKA 4RKYA 1JVSA 1XVIA 1BFDA 3G5AA 4ZT7A 3GU3A 3U3OA 2E1PA 1W19A 4QHTA 1Z2AA 3BJZA 3ELYA 2G9UA 3MILA 1XD8A 1AU9A 1Q91A 4FC6A 4C2AA 5K45A 2O6LA 1T1JA 1JN0A 2C7QA 2WKSA 1NE2A 2YJGA 2ZT6A 4URZR 3RVOA 1GSHA 2WTBA 3WL3A 3BD8A 4LSMA 2BP7B 4U3JB 2OORA 5E0OA 2JIPA 1Q3HA 3LE8A 5LU8A 1V3VA 1FS6A 1YB1A 5L7YA 3NKVA 3L0PA 5HMMA 3R7WA 1KL7A 4XJTA 4XGRA 4GI2A 1UBLS 4NQZA 1BN7A 4Q1CA 3FTEA 3CTPA 5T6BA 3OQMA 4EYKA 2R6CA 1ZBQA 4D3DA 3L82B 4E5NA 3U3MA 3ITDA 3SC2A 1RCTE 1Y1KE 1GA1A 2A2ZA 2C2YA 2P4UA 3QVWA 1C1XB 2IUYA 4PR3A 3KC2A 1PEKE 4QDUA 3DTNA 2IVFA 1P0QA 3PRYA 1ZUNB 5FOQA 2VA8A 1SK8A 3NIGB 4O25A 3EC2A 4BLQA 1XF1A 3O7WA 1W4LA 1DBWA 5CA0B 5K3EA 4WWHA 1CQWA 1KAQA 2H1VA 4MQFA 3BT7A 4EUKA 3L0IB 1ZQ1A 4PLTA 3FI9A 3HKCB 5L3SB 3MJDA 1YZHA 2P90A 3TSAA 3TTUA 4RU1A 1LF0A 2JHCA 2OG2A 1X1EA 2XQKA 3HADA 3AR3A 4EB8A 3NETA 5FUYA 4EJFA 3LP8A 3EH1A 4CNQA 3HR4A 1FYVA 1GQYA 2E4WA 2P0YA 3GAMA 1E3SA 3GBVA 3GJQA 3NKLA 1PT8A 2N1MA 2VF7A 3OHPA 2VH2A 4I6EA 5FUVA 1DQZA 1XHLA 3TNLA 2G76A 3I2IA 2VZ9A 2W2MA 3OIDA 4JP2A 4KTTE 5DWQA 4A15A 3WYGA 4W7IA 1C7IA 4DVGA 2P6RA 1BXGA 3H5LA 2QWXA 1UD3A 5HRCA 2XNCA 1OLOA 4MO9A 2HA6A 3HB7A 1V47A 2PS9A 4OF4A 4UVIA 4CKZA 1JALA 1D09A 3D31A 3DUFA 1WY5A 1K89A 1TQDA 4FZVA 4O29A 4D4JA 1H6AA 4RVCA 5BQPA 3QKSA 1AQUA 1W0KD 2I34A 5JR3A 2RC5A 1Z8DA 3K8QA 2PNJA 4ZAFA 1GVHA 1NQXA 1VDZA 2VDVE 4O63O 3R5HA 4RADA 3TVTA 2F43A 4IDQA 5BR1A 5M29A 5LFAA 3F67A 5IT0A 3SS8A 2AMYA 2PJDA 4DNXA 4D56A 3LDUA 1HDIA 4PC1A 1T2DA 2ZI6A 4V3CA 2Z3VA 3UT5A 3G2HA 3I5XA 3ISXA 2J5XA 4L6IA 2X5JO 1OXKB 3WL5A 3VTZA 1CRZA 1ODLA 4MUFA 4X7FA 4YXWA 4ETIA 5JVDA 3C5VA 2VC2B 4NMHA 2XA1A 3JAWA 4HDRA 4EPVA 1UMKA 2D1TA 3ED1A 3KFLA 5JSYA 2QW1A 1KI9A 4IH1A 5A71A 2OP1A 1EWYA 3WLSA 4C4SA 1QF7A 2C61A 5CDGA 1VQ5B 4UTXA 3WGZA 4G23A 4ZQEA 3QUBA 2YUTA 2DZDA 4QNMA 5EZ5A 3S6JA 1UMCA 4XKVA 3E3OA 3C3KA 3V1NA 4PX2A 1DAGA 2CDBA 1A2QA 1A7UA 4EFLA 1BFUA 5KYKA 1D6NA 2B2NA 2AG6A 2H63A 2LXNA 4IKEA 2I67A 3A37A 1I7QB 1EB8A 1X7DA 4B2PA 221PA 1X39A 4EG5A 1FU7A 2X6YA 3CSDA 4GDFA 4F1KA 2IGTA 1AKNA 1O9BA 1XP5A 3PNMA 2P9CA 3IKJA 4ZREA 5HE9A 1IEXA 2KS6A 3RVMA 4IPTA 3H16A 3EHEA 3NHYA 2HQBA 4AJ2A 821PA 5LQRA 1W0JA 2OCLA 1YZVA 4I8XA 4FWBA 4OYRA 4Z4ZA 1K6MA 1ZN8A 3CSSA 4NH4A 2AJBA 2OOKA 3E3LA 3HKBB 1YHQB 2EL9A 3IDFA 1T15A 1FDRA 2G28A 2V8OA 2DLCX 4LSGA 5TPZA 1HNZB 2PWYA 4X7EA 2BRUC 4DJAA 4FXUA 3EF3A 1M34A 5HZGA 5WRFA 2ATIA 2HM7A 4OK5A 1Y33E 1TKBA 1I01A 2YJ6A 3UICA 3BY1A 2ZTMA 3OM0A 4ZT6A 4BFCA 2B9VA 2GN4A 4RNDB 2FQ1A 1AMUA 5DGIA 1HFJA 1NYTA 4H3VA 2AJDA 1KE1A 2VQFB 1VYUA 5BORA 421PA 4RK4A 2FRDA 4GQBA 2A14A 4I1UA 4QXQA 3IEVA 1GXSB 2D5BA 1RRFA 2A8YA 1N32B 3HB0A 4L5CA 1ZK3A 4E88A 5CYGA 1X7YB 1ZK4A 2RBGA 2P1RA 3FHLA 4PFSA 3PLNA 3ZWDA 4X5OA 4AZ0A 4ZCLA 2ZEJA 2ZJ1A 1JQEA 3QEBZ 1Z07A 1A4IA 2P4HX 3ZXSA 4CG0A 3UM9A 3CPEA 2JKYA 1UZMA 1DEKA 1TKRA 2GB4A 2VHJA 4J6EA 5F2OA 3OX3A 4P0QB 1JA1A 3EUFA 1JR3E 3AF6A 4NTZA 3G1TA 4E11A 4H3HB 1DUIA 3LHFA 5EHGA 3D5TA 1E32A 2RGNA 2YHIA 1XP8A 2DKNA 2J9FB 2PXXA 2WFAA 3E35A 3MERA 2DWCA 4OXRA 5FQNA 3QXJA 3RJTA 3C45A 4ZOQI 1UKAA 4FDMA 3VPFA 1I24A 1PAUA 2RGWA 3EGDA 4OKNA 4R1UA 2QVXX 3F6RA 3KT0A 2Z95A 3MS7A 2LPMA 1BPLA 2YMLA 3BCRA 5HA5A 5B12A 1ISRA 3MWDB 4QXOA 3GFPA 1JT9A 4XFKA 5J4YA 3LDAA 4O2LA 5DN9A 2V9ZA 5E9AA 1ETHA 2RHHA 3LNNA 3F97A 3IAUA 3TW8A 4EL0A 5I47A 4F6LA 1B6TA 2Y6UA 3E0XA 1GGVA 4JBWA 4AKHA 4OH1A 1IY1A 1YR1A 2GAOA 2HKIA 2YR0A 5B4TA 1T5LA 4N40A 2PZEA 5KYUA 3GD7A 5BYBA 2BAGA 1H22A 4K6KA 4NBLA 2CL7X 1O8BA 3G9QA 3OQPA 2G36A 1TLTA 2P3OA 3FJOA 4KN9S 5FF9A 2YWFA 2JFVA 3WYDA 3LBAA 1ZH8A 3WV4A 2CZGA 3PFFA 3AR4A 1VBNA 1GAQA 4GMFA 2AN3A 4PC7A 4LV8B 4Q3DA 1FXWF 4TLLB 4Z86A 5AI9A 3RC7A 4E5VA 5E1MA 2Y1CA 8ATCA 2F8TA 5EIXA 2V4ZA 2FPOA 4R0MA 2AW3A 1Q44A 4PYQA 3AW9A 1N05A 5DEOA 1EVJA 3G0DA 4TSFA 1KR5A 1WZEA 3DT9A 3L5OA 1UUFA 3C3WA 1I1OA 4CIWA 3CCFA 1ZFNA 3KV1A 4N9QA 3UHPA 3L04A 4QODA 3WB0A 2UV8A 5KWSA 4X95A 3RT1A 1XZIA 2ILVA 3K3PA 1E89A 3B85A 5H83A 4KDRA 4WZAA 1KHHA 1SZDA 3JAMA 2FKAA 1E9AA 2AFIB 2F00A 4CR7A 5E95A 3AHGA 2W0MA 5C0OE 4DQXA 1Y0RA 4ZI5A 4H0NA 5HZAA 2EHJA 4K9DA 4CKEB 1CU1A 3BQ9A 1U7ZA 3KCNA 5JNUA 3CZAA 3D1JA 1ESMA 1QTQA 2B5VA 5AJVB 4CM5A 1F7VA 3KELA 4KOAA 2CHGA 3AUAA 1WV1A 4LXXA 3C3AA 4UVDA 2P2YA 5HS6A 4O5OA 4MZDA 3GLHA 4Q1VA 1TD9A 2GMWA 3IUQA 5GVSA 1IXSB 1DBRA 4UTRA 5CG2A 3NANA 3Q39A 2PUEA 4A6DA 1V0FA 2EEPA 3MCWA 2C59A 4FILA 1G6OA 4R1SA 3BWMA 3RVSA 4FK8A 3IUJA 1E3IA 2V03A 1XFAA 3MTGA 4F93B 5FBZA 5TIIA 1V8BA 4J2HA 1ISPA 1NUTA 3PB3A 4QASA 4QGAA 3MG9A 2M98A 3IEUA 1KDTA 4QSHA 4D8WA 1DB3A 3LQEA 2QLBA 5TPWA 3IUBA 4KYUA 1SU7A 1MDFA 3LX4A 3LXUX 5HILA 5IBQA 1CF9A 3VH4A 1R10A 3JPYA 3P0EA 4IRXA 3HA7A 2HW8A 2I6UA 2IYUA 1Z2EA 1W1WA 2IPAB 2IYEA 2ONJA 3Q5GA 3CJTA 4Q3AA 3D6HA 4LBWA 4HNAB 4YGXB 1F3LA 1X7WA 2NYAA 3DAHA 1CIJA 3EGXA 4M89A 4BLUA 5E3HA 4YRRA 3TLAA 1KI1A 4C43A 2L42A 3M4YA 1JVNA 4PPQA 3CY6A 3KOOA 4GGMX 4LSZA 1EUZA 1EFLA 3TM5A 3MGAA 1KU0A 2JGRA 4NCNA 2WIDA 3PUHA 4FDLA 2R2AA 3BRCA 2NXEA 2Y1KA 3KKPA 1TC2A 1OMOA 4C7MA 4HT3B 4BXOA 3Q3IA 4NOLA 3AKDA 3JYHA 2VSQA 2QUZA 4NYMR 1F6WA 4CDNA 2W2KB 2FPLA 1G2OA 4U1RA 1T4BA 3FOBA 4I3FA 1RFLA 2HDOA 4P7FA 4K5QA 1Q95A 5CXXA 3H1PA 3PPIA 5TX7A 4R1OA 3USES 3ZDRA 1J1UA 3JQBC 2D2XA 4UUPA 3QVOA 3BMOB 1J56A 1O6CA 4MS1A 1QANA 2O8CB 3C24A 1SBNE 1NMSA 2OXTA 5HZBA 1IN5A 5D3ZA 1EP3B 3NIDB 2ZUEA 1CQXA 4J9VA 2DFVA 1VPVA 2UXBB 4FFWA 4KXWA 4MQEB 3RVJA 4E1AA 2YZ7A 3QXXA 5LZ2A 2O3TA 1F9EA 2P6UA 2PT9A 1QG2A 1S72B 2NQTA 5C18A 1KIAA 2XVYA 3PIDA 1XJCA 2C00A 2IXGA 2XKBA 2Z08A 3DEJA 3INNA 4WCFA 4MVJD 3O8QB 3TOCA 3PTAA 4WLNA 3LSYA 1JEDA 3FOAA 2PG3A 4PQEA 3DE0X 4YCMA 4RLFA 4R1MA 3B5EA 2ZYDA 4TKUB 3LBFA 3QOFA 3ZK8A 4LC0A 1N9GB 1YRLA 2GZMA 1ZP6A 4BUZA 4RTRA 2ZL6A 4HH0A 1VGRA 5ESDA 3FDZA 1XWFA 1G20B 3EXIB 1TMKA 3ZNQA 1GQQA 3CEHA 1CR4A 3GELA 1L5RA 5LZ5A 3EXHA 2DG2A 3N5KA 4UUOA 3WIVA 2FY8A 4HL6A 3NBUA 2OC9A 3FFXA 1FUIA 3K1ZA 3TLMA 4DARA 3U4CA 2DQ4A 3SF8A 1YS7A 3P2IA 4A92A 3AT1A 2BEWA 2NOAA 3V34A 2DQZA 3C3DA 4C1NA 3VTKA 1M7BA 3IBGA 2QRVA 2DBVO 1Q9SA 1WOMA 1WZNA 2NPOA 4ZYVA 2NWQA 3E9CA 4B73A 3CW9A 1GUBA 4BB6A 5A6SA 1D3AA 3OCXA 4LY9A 2PVCA 3OKXA 3IUNA 3FHOA 3K9CA 4FIDA 4JJ4A 1THGA 4JYPA 1IOWA 4P92A 3VPGA 4BASA 4UEQA 3DEIA 4JR1A 3R0IA 4ZZ2A 3ZQJA 2EQ5A 3C3YA 2C20A 3C48A 3UB4A 2QRPA 3AVUA 3UT0A 4TPKA 5ITZA 2PZ8A 1TT5B 5JMTA 1Z6XA 2C2GA 4P98A 1MD9A 1IEQA 2Z4SA 3SYKA 5AW6A 1XNRB 5EE3A 2I6GA 4EO4A 1KP3A 2RFLA 3C7CB 4RJJA 2XGJA 3E0QA 1T0UA 4RIHA 3B1FA 4G1EB 1W2GA 1Z5WA 2WILA 2W6ZA 2PU7A 1FVFA 2BELA 5DLQC 3OE7D 3KSDO 4PYRA 4UFOA 5TF4A 4MW6A 3H19A 1CUFA 5CDFE 4F12A 1WUIS 3FNFA 3K72B 3L0DA 2RCNA 3PXEA 4MUYA 1TT7A 2X9GA 2YZGA 1VFNA 2EEZA 4GPBA 4M4SA 1LNQA 2AW5A 5F1YA 3VX4A 2C04A 3IEIA 3N87A 1Y7IA 1UFQA 4K87A 4ND4A 4NP6A 1NONA 3ZGVA 4L3OA 2J67A 2OBTA 1DAFA 2Z8XA 4NCHA 3R5TA 1UPUA 1SM4A 2GJRA 1PNOA 1RHUA 1SN7A 3IT3A 4RW0A 2H08A 1KHTA 4ZVPA 4TYPA 4PWZA 4WESB 3Q40A 4LVOA 1KNXA 1A9RA 3PHBE 2ZB2A 2L2QA 1PFGA 1QB7A 3K0FA 1U63A 3QE4A 1RJ9B 3VZBA 4Z6KA 4J75A 3KPWA 3CX4A 5C3MA 1Z12A 1CVRA 3P9ZA 4Q01A 3WVNA 4N82A 2OFFA 3CBGA 3IPAA 2WSIA 3OLWA 3TLZA 3GA0A 5HTOA 1PJ4A 4ZVNA 4W7SA 1W8DA 3WHKA 4ESHA 1RXWA 1PEAA 1CRWG 3CNBA 1P4RA 1HI9A 4NY1A 2OILA 5CLLA 3LP6A 1A5ZA 4LF4B 3SX4A 1K7YA 1MJGA 1RXUA 1KYTA 2F6RA 3TSZA 3RB8A 2ZL7A 2P0EA 1AKEA 2AG5A 1V96A 3U26A 2EZ9A 4KAFA 3OJ0A 4Z4RA 4F84A 3LHSA 3CE6A 4FIZA 2B7LA 3GP3A 3R76A 2OGWA 3EFEA 3LAWA 4E51A 1H2BA 2FUKA 4JXXA 2O8VA 4LMRA 3QG5A 5DH9A 2QTVB 4HP8A 3NTRA 3VOSA 2IFTA 1OB5A 3MFQA 3PX7A 4QU5A 5I01A 3NUGA 4GRAA 2WHPA 3QBTA 5SZIA 3CRMA 4OPSA 3JASA 3CCRB 4HJRA 2C3MA 1ZW6A 5J2UA 4YK7A 1A8UA 5JI2E 4X65B 4YYEA 1IQUA 2FG7C 2DEUA 3OMLA 4I4NA 2V6IA 1Q7YD 1V43A 5B1DA 3P5BA 5E9WA 1VLVA 4TWZA 4Y2QA 2UYYA 4GKBA 1ZI8A 2AKYA 4LJ5A 5EMLA 1DCTA 2EOAA 3ESAA 1IFXA 1NW8A 1UJBA 1LV7A 1SVOA 4KPUA 4U2CA 4WN3A 3MRSA 2VYFA 1CUWA 2ZYTX 3R6DA 4BNXA 1L4HA 4RS4A 3SJZA 3D3QA 3G8BA 1MQSA 2ZZQA 4DY4A 5JMWA 2GBPA 3BSSA 3T15A 3B2NA 3LUDA 5JCPA 1KMHB 1WMAA 4JAVC 1CEEA 1JAIA 1SO8A 3MMXA 1BZYA 3VAZA 4ER0A 3KTFA 5I9BA 3DAOA 2VSOA 1USGA 2DWPA 1Z4KA 2QM3A 1YRAA 1JIJA 4TTIA 3NH6A 4U4AA 4B3HA 1XTIA 4BO4A 2YL2A 3NUQA 1FIUA 4JX8A 1JA0A 3TO5A 4E14A 2REBA 1UCFA 1V48A 2BZ1A 2FN9A 3JARB 3LMKA 3O3NB 4TL8A 5KVVA 2PAAA 1FS5A 2Q29A 1A69A 4C4OA 1ATZA 4KFCA 1VKJA 2ZRQA 5EUCA 4BJ3A 4E6EA 2IHVA 1E4EA 2VPXA 2PD4A 2YW9A 1R6AA 3EBOA 3IE0A 4RH3A 4S04A 3IAM1 3L7LA 5SY9A 3EZYA 3NFYA 4CVNA 3R5KA 3TD2A 2H7VA 2O0MA 5BOVA 5A3RA 4OATA 4KO3S 4WKCA 3K0BA 3JQQA 1JNXX 3L7MA 1T36B 4P4NA 3N53A 5TJHA 4PGGA 3ZCUA 1Y8QA 2QN9A 4GW3A 2HV8A 3H3XA 4FQ7A 1P7PA 4HH1A 1R0BA 4AJ1A 2QVBA 4JI6B 3WXBA 2NO5A 4ZYXA 2HPVA 4ER3A 2PUDA 4EHAA 4Y2RA 2PUHA 3M6AA 1HFWA 2H29A 2BE7A 3LYUA 5JZSA 3HB1A 1GTL1 3F78A 3LUFA 4E32A 5LQCA 3GL9A 2IYVA 1ZVVA 2VPPA 4C4PA 4GC9A 1N08A 2YUIA 4DSTA 5DHTA 2Q8PA 3ONVA 3TD9A 1XK6A 2VTBB 5EHXA 1W4RA 1JQJC 2AOTB 1VIMA 4O4HA 2WF8A 2Z58A 4YT4A 2ESRA 2O1XA 2P9ZA 3K2BA 3LCCA 2PANA 1BU5A 1RJWA 3UC9A 1GO2A 1EH5A 2BF4A 2VDUE 3JQ7B 4OP1A 5IF3A 4BFYA 2XZTA 4J7CA 3FCSB 2RB5A 1X9GA 4IDPA 4RZ3A 1P7ZA 1JEAA 4J7UA 1X8KA 3KZVA 4ML3A 4OL0A 3C4VA 2OBMA 4LBZA 3ACCA 4QJIA 1L7EA 3CIOA 4FMCB 3WRYC 4Y30A 3LNTA 3WNCA 1NVEA 3UWDA 2GPSA 4Q37A 3HUFA 5ARDA 1SG9A 1DIGA 4N12A 5FI3A 3RGGA 2PUFA 1U3GA 1BKDR 4BP3A 4YDQA 4OHYA 2Q1WA 5EXXA 2VJOA 4FZRA 1OTHA 1M33A 3U37A 4YMLA 4Y2UA 4U2FA 3ODGA 4AT1A 3HFRA 3I8OA 4XXHA 5LKAA 3ZWAA 3G17A 2VHVA 4E7PA 1VLMA 5FBQB 2WR8A 1KJQA 1PZFA 1KVUA 1WXWA 4PLZA 4HQ6A 1XLUA 1DBIA 3EVAA 3LZDA 4HEQA 3HDQA 2WY2D 3ESYA 3RRFA 4P3XA 4AMZA 2FZVA 2Q62A 1K7FB 5JFGA 2WF9A 3TLYA 4K6MA 4FB5A 1WABA 5F3RA 1KH1A 4L78A 4GYKA 1M2HA 4MTCA 4F46A 4PN3A 3GSIA 2H1WA 3I30X 2C78A 3DB1A 4JJAA 4NMMA 2QROA 2O2SA 3TYXA 4D4IA 1NKTA 3W5HA 1MIHA 4H77A 3QHPA 1NJ2A 1OIWA 1MNQA 1PLLA 1TEVA 2CJWB 4LRYA 2AFHB 5F2EA 5BV1A 3K6SA 2A5JA 5E2AA 4TKVA 4YHHB 2QIPA 3HV0A 4HQLA 4NX2A 4CMCA 1TO2E 3ZJYA 4D3FA 1IHPA 4URFA 1CY4A 2BDTA 1ARZA 2ON6A 3DBRB 2C7VA 3MWEA 4HGRA 4ARIA 2NV2B 1VI2A 1EQAA 5H0IA 5I7UA 2FEOA 1ZH0A 4NBKA 2NUTA 4KR2A 2J4DA 5REQA 3A8TA 1U3DA 3RE1A 1H2XA 4XTRA 2ZG6A 5KCMA 4R8SA 2C1EA 4I1VA 1OGYA 5ERGB 3WRWA 1KZ4A 3UJBA 2JAHA 2QZJA 5HG0A 4HV4A 3EYAA 3S8MA 3V8QA 3EZNA 3B52X 3IALA 4PNHA 3U7RA 3O8CA 2C4TA 1QO7A 4ZVTA 1CUJA 1RMTA 4F3KA 1KAOA 1KZ7B 1WDMA 1LSJA 3PRHA 1J49A 1UPAA 1QYCA 2SNIE 4BO9A 1BO6A 1QGED 3WA6A 2GCGA 3SU8A 4MOWA 1OUMA 5EWLA 1U5AA 2WWVD 3UKJA 4LWPA 4DXDA 1SUAA 2G8LA 4HZUB 1Z5VA 1SCNE 5AJUA 4BBJA 1AS3A 1ZYUA 4CM6A 1CV2A 2OO7A 4JYMA 1XVLA 3C3EA 4OHBA 5TRDA 4MCJA 2OCXA 4RL4A 1DEAA 1YI8A 4D82A 3P0IA 2GBIA 1OQAA 2W37A 4GBJA 4YP6A 1PWHA 2EW8A 3RARA 4MULA 1UBHS 3W5AA 3RS3A 1ZJWA 1JAZA 2W2LA 4GP9A 1QVFB 3DL2A 4K3UA 5DLYA 3ZOZA 1R9GA 4QBKA 1W4ZA 4TZ6A 1W9XA 3OF5A 1QZUA 5L45A 3D8HA 4MKHA 2X53S 4AYTA 6REQA 1G19A 1JPJA 2GGSA 3QXGA 3TQHA 4YHBA 4KCGA 1RI4A 3OSZA 4UM9D 1P39A 1NIPA 1OB2A 2MINB 5EP4A 1Z36A 4E1BA 2NV4A 2ECOA 2WAAA 4GPAA 2W6NA 3GOQA 1JYFA 5ALSA 3UJCA 1NMZA 3QYPA 2A1IA 4L5BA 1J33A 4ZVVA 3UKOA 1U9JA 5EGNA 4DMMA 9LDBA 1N5LA 2LDBA 4H31A 1O1YA 1Q86D 4JR0A 5EMJA 1DO2A 3I3OA 2I1LA 1LLDA 2A94A 2QZZA 2VVTA 1EUQA 4F0JA 1N2EA 4EJ2A 5LYJB 3GPDG 2HA4A 1NVVR 7ADHA 1YCHA 4D9CA 3WR5A 3HJCA 2IRWA 4RFSA 4OLBA 1DG1G 2IT1A 1IQ0A 2I4RA 4XD2A 4DMFA 4EDHA 4BV3A 3HJUA 5A9SB 2QE7A 4KH1A 4YI5A 3PGJA 4ZKEA 2O54A 5LR6A 3PC2A 4FINA 3ENKA 5DCWA 5J4LA 2DC1A 3AQIA 1J2TA 2YJ3A 3IBCA 4D42A 3BTVA 5K8TA 2WD7B 3GZNA 5AM0A 2IE8A 1I7PA 3RK0A 3WFIA 3HFSA 1QZZA 4DMCA 2CNKA 3QOWA 3NC0C 2A67A 1Q1ZA 3V8MA 1DZ3A 2BI4A 1YH3A 2EERA 1QIKA 1DBVO 4WY5A 3HR7A 3SMQA 4EHKA 1R5BA 4IUBS 4Q48A 1AGXA 2OYCA 3PXDA 4CCYB 5LPNA 3CLRD 1UR5A 3NTVA 3PNVA 3OP4A 3TZEA 2OBLA 1TW2A 4PYOA 1CK4A 4N3GA 3G0BA 4HQ0A 4B1FA 4WIAA 1KFKB 1W5BA 4NZPA 2P6OA 4IDEA 1J42A 1Z4NA 5DIZA 1ISGA 3T7DA 3VV2A 3HCCA 1G21A 3ECAA 4L4ZA 3LF2A 3SZOA 2DJ5A 4E5SA 1XQWA 3G7SA 3F5QA 2Q9CA 3MW8A 1VSBA 4NABA 2B0CA 2CLOB 4XLLA 2B99A 1VKNA 2PLWA 4UXIA 3PC4A 1COZA 10MHA 1P2SA 8MHTA 2PAFA 3I01A 4G86A 4NBNA 4WLOA 4GZLA 3OW7A 4AI6A 1MABA 3QPBA 1UC5B 1WCYA 3CH7A 4KHPB 4IHAA 1Q82D 5JO0A 1F20A 1FZTA 3W5VA 5AOAA 2JI4A 4IGIA 2P79A 4NEQA 4R01A 4P3NA 2WLSA 2FP3A 2SBTA 1U8AA 2TMKA 1Y6ZA 3TNDA 4OOXA 5F21A 4D8XA 3UWPA 1ZD1A 1WD7A 3JZFA 2CVQA 5TGTA 1IHMA 1FYXA 2JW5A 3C7DB 3EAQA 2OHIA 2WT9A 3P0JA 2ZQZA 4A0RA 5E8JA 1I1HA 1CY2A 4DIMA 2PE3A 2VT2A 3RTGA 2DFKB 1FNDA 1CS0A 3TUJC 3H2BA 1KSJA 3PNBA 1OV6A 1J5EB 4KI0A 2BZ0A 3RG2A 3EK2A 3RG8A 2DMRA 1EWTA 2H1CA 1VA4A 3DDOA 3GUUA 4JMPA 1A76A 5D84A 3OCWA 3RSCA 4CMIA 1TF2A 5IF9A 1O9GA 1U7WA 3GBPA 5BP7A 1GFWA 3IV9A 3OEHD 4ER7A 2A1TS 1JUDA 3LA6A 3OQJA 3KEQA 3Q7EA 1DIRA 3P94A 5JJIA 4OQNA 1C4KA 2PXAA 3F7TA 3REQA 1CCWA 3WGVA 2I2WA 1WQ1R 1XVVA 4AIIA 3LVRE 3J7TA 5TS2A 3T06B 1YZFA 3CZQA 1WIWA 1E3LA 5CVVA 4CF6A 3L0ZA 1UBUS 4S1PA 3T0FA 2AA3A 1DOAA 3QW4B 5IN5A 3C6QA 1QLWA 3CC4B 1ZOOA 1RC0A 2GCIA 5ER6A 2ACEA 3KJNA 1LX6A 1PUJA 3R3XA 3P2YA 2RGRA 5A06A 4P3YA 4P3KA 1QO0D 1W87A 2IXAA 1QHYA 5IBRA 1KIFA 1IM8A 3LUAA 1LWOA 1IN7A 4UUMA 4F56A 3FTDA 5E3IA 1HQDA 1GPYA 4OHCA 1T1IA 2ODEA 2Q6VA 1WVIA 2QVCA 2NZJA 3KUKA 4PC2A 4JBHA 4P4UA 2DTXA 1XDUA 2H52A 4UDNA 4NJMB 4OV6B 1ZIDA 2DX7A 2A58A 1GG8A 1AURA 2R85A 5J1TB 3ZE9A 2G0AA 3QWIA 2IU6A 3GLTA 3VDRA 3AL3A 4LF6B 2BFBB 4RWEA 2FZGA 2YBEA 4J9UE 3DAFA 3K35A 2ZIXB 3C5CA 4DLKA 1IB6A 1U0GA 4JEUA 2R7AA 4YLGA 5JCOC 2GX6A 3UXYA 3SM9A 2IPLA 2YIDA 3OIWA 3MINB 2RK6A 4Q66C 4PGHA 3R8XA 1Q14A 1ODCA 3MWGA 4OQZA 2CXXA 3DE2X 5HEKA 1X70A 3NNSA 1K63A 1QLHA 1UZAA 2C99A 2XUIA 4M9ZA 4NYMQ 4PE5B 1GKYA 2AN1A 5DBOA 4RJTA 2B92A 5H8WA 1NATA 2G9RA 1HTBA 4R3UC 3LX6A 4Z8XA 1U2TA 1YKFA 1ZXXA 5G0SA 4QZVA 1GN9A 3L0OA 1O0CA 3KT8A 5CP8A 4BP8A 1T8SA 5D00A 4FGKA 2BDEA 3KZCA 3HDVA 4ZXFA 1ZXBA 4DR5B 3U61B 1YQEA 2QLNA 1I2DA 5AHKA 4LRXA 3KPUA 4IXWA 3TDKA 2YNMD 1CEXA 4MV5A 1JZQA 1VPTA 3FD8A 2JIOA 4QU8A 2ORIA 5FFMA 2REQA 4L57A 1LQUA 1DGQA 2MSKA 2XMRA 3IMGA 3PCTA 2IODA 1T4DA 4AUKA 3GGPA 5F1PA 1Z6QA 3MD0A 1YB6A 1Z34A 1R6DA 3K0CC 2HB6A 3THRA 4BO6A 2V4DA 4IJ5A 4G5XA 3C16C 4M1EA 3UGJA 2PKYX 1A8HA 1QJCA 2JGEA 2PSHA 3FMPB 2XGSA 3QTTA 4CM3A 2HJSA 5L95A 2FPGB 4QGGA 4F5YA 4BMOB 4XPIA 3QU2A 1GNSA 1Q57A 2R00C 3ROTA 3KZKA 2R6DA 2GCOB 1GPDG 2HT6A 2Y3IA 3DLTA 3JX9A 2PS1A 4N39A 1KOLA 4DXAA 4ZJUA 3VRHA 2BFDA 2IP2A 3QPAA 3VTAA 5EQDA 4JHLA 1V9CA 2P9HA 4DV4B 3QVKA 1R3DA 1ENOA 3ZHRA 3KYCA 3I61A 4P3IA 1CUCA 1M0WA 2JCXA 1ESEA 3IPYA 2PRIA 4JP5A 1I2MA 4Q93A 4G4GA 4RULA 4MV9A 3AXTA 4Z51A 2X8KA 1E99A 3MC1A 4MS4B 5JS6A 3KHKA 3GFGA 2YRFA 1Z13A 5IHPA 1ZM3A 3N2YA 3K8YA 1HYBA 4V3BA 3H3JA 2C29D 3CP2A 1XMIA 2Q5FA 5IM5A 4AZVA 2GBFA 5J35A 4B3FX 4IIDA 5F77A 2E55A 2X0FA 3WSTA 4L0QA 2IS1A 1SRRA 3CLSC 4V0LA 4F7WA 5JRJA 2IEBA 5CB4F 3CX6A 1V6AA 5HBGA 3CCQB 1VIDA 5A2GA 4YAOA 2WPNA 1XTKA 5MFPA 3AVVA 4BWYA 2PUGA 3OI7A 2H00A 2Y8EA 1KQFA 2B35A 3HYSA 1MVNA 1HSOA 2CLCX 2WIKA 2WTNA 3NWOA 3SC3A 1HV8A 5FO0A 1TK3A 1FJGB 5HIMA 3W6PA 2XEXA 3QVGA 4UNNA 1BWQA 1ADYA 4DPLA 4H1WA 4PBRA 2PL1A 4AXBA 5SY6A 3BJEA 4KNYA 3N8GA 2G6BA 4LJ6A 2Q27A 3GEGA 2G9NA 3W90A 4JL8A 4XLAA 3WK7A 4D4HA 1NHWA 4JEIA 4KW7A 1PF7E 1ZM2A 6REQB 3B8EA 3JVVA 3NORA 1MA0A 3M6LA 3UJNA 1SEPA 1T8WA 1TC1A 4TMYA 1YOBA 3H86A 5LD2B 2BN4A 1ZICA 2A4MA 3N2GB 3P45A 4UBMA 1DJOA 2V7EA 1L4GA 5EJ5A 4R2LA 3SICE 3B1YA 4B76A 3MGGA 3A9WA 3L7IA 4R2WA 1KVSA 2F9FA 1PJZA 3FPJA 4NCBA 5FFFA 4MQ5A 1ZNZA 2YY7A 2HU7A 2CHVA 3PGXA 4NCKA 4D26A 3GC6A 4NSNA 1FFDA 3R9XB 3OUZA 3A6HA 2UVPB 5KTKA 3PUZA 3MT7A 2J9YB 4KXUA 3F2VA 3EQ6A 3D4LA 1LB1B 2BHNA 3OTHA 4UU8A 3OT5A 2Z2KA 4BNIA 1Z56C 4I4TA 4OBWA 1EHIA 3A1EA 3GUVA 3QIVA 4NC9A 4UE6A 3VYRB 5EMHA 4C07A 5B7QA 2TMDA 6AT1A 2YYSA 2Z5VA 3C70A 3G1UA 2EFJA 3IDOA 5CPFA 5LMNB 1LU9A 3AJEA 4S12A 4LXYA 5E4YA 4HYQA 5FUMA 1XZGA 3TTVA 3IESA 3T1VA 3UJ3X 5IAAA 1QAOA 4HO1X 2CMGA 4NNJA 4A2QA 5K6RA 2RJ3A 3OPQA 1KRWA 2IYOA 1JAYA 3P4XA 3TRKA 4RPCA 3WNZA 2XT9A 1WP4A 1UK6A 4GSKA 3K0KA 4LTMA 1IRXA 1JQ3A 4A8JA 5GAJA 1NBIA 5IPFA 3RAFC 4WPGA 3AF5A 3PEEA 1VQLB 2VAXA 2FSSA 4QRHA 1TD1A 2RSLA 3ESQA 3I45A 3RRZA 1XNQB 3AR6A 3ER8A 4D9KA 1BW9A 3FA2A 4JB8A 2JBAA 5JDIC 4UVGA 2A9KA 1YGYA 2JHGA 5AUQA 3T9AA 3L0BA 2YWGA 2XCRB 3ET5A 4MEAA 4XR9A 1K06A 3D6JA 5EWMB 4D0SA 5KTTA 2EX1A 4L5AA 4UPEA 5AVWA 2WU1A 4G56A 4JQZA 3GVKA 3UJDA 2F1KA 2FH5B 2YZNA 4N7RA 2C3OA 1XPOA 4IWNA 1E2KA 1P4SA 2H3EA 5BSYA 2JA1A 3ACBA 3MUFA 3NHMA 2A57A 4QPJC 5CRIA 3U4DA 4ZHQF 1IUOA 3H87A 1H5UA 4DE5A 5IM4F 1WUKS 1POXA 1T6NA 3ONFA 1EXDA 3PQFA 2F8SA 2KE5A 3OZFA 2WU4A 3E84A 4CDGA 1USUA 2JCGA 3T7CA 3H18A 2VHUA 1V39A 2E6UX 2IOYA 3E8MA 3KD3A 1Q17A 4ZO4A 4Z0NA 3U0VA 3GLFB 4CLDA 4H7FA 3QG1A 1JKMA 3BQMB 2X1LA 3KOYA 5C52B 1TI7A 4P2GA 1JSRA 4QPCA 1P29A 4RK6A 3GARA 4HOYA 3I56B 2YS7A 4UEOA 4BNMA 3NI2A 4EGJA 1Z74A 2OHFA 3AJRA 3UB3A 3LY7A 2G72A 5CXSA 3VOTA 3GLIE 1I3LA 1SCIA 3H6KA 1Y9JA 3X1MA 1S96A 4BNKA 4ZYUA 4LRWA 4LYFA 2RGUA 1EDOA 4HQFA 5JNLA 1ZISA 3LPDA 4C6RA 1WEHA 3GVIA 4ZQHA 5AN9A 2KMLA 3ZHCA 2PIDA 1EK0A 3BL8A 1Y37A 3BFXA 3NJ8A 2PBRA 3VVLA 3R3VA 3K4HA 2DBYA 4GD3Q 4D74A 4OQMA 2I2FA 3LP5A 4EMUA 2X8AA 4XLTA 4PEVA 4ECAA 3AFNA 1R6UA 3UJHA 1TU4A 4DA0A 1O95C 1V16B 4KMRA 1O08A 4QEKA 1ZRSA 3PUNA 5DDIP 1EP1B 2OYSA 3TZBA 1Z0KA 4JC5A 5J5CA 4IBOA 4RENA 1TIKA 1OAOC 3E7PA 4D5GA 2Q5JA 2W90A 4QOHA 4BE4A 3KSZO 1I51A 3LIIA 3ABOB 1JLHA 2VP6A 3L4EA 3KR9A 1ECGA 2GSWA 3A3KA 3FTNA 1G5QA 4ODIA 1JI0A 2JGLA 1N75A 1ODJA 2Q6TA 3CNLA 4NZOA 4YACA 2WICA 3D4PA 2PWAA 3A7EA 5BWLA 1WQ4A 4MRAA 1WXGA 3QEMB 1E20A 3EPKA 1RZUA 1C9NA 621PA 1PFVA 3ESBA 5B5SA 2CFRA 3KS9A 3KOMA 1E2IA 2DE0X 2DWQA 4X20A 4ZEVA 4DLRA 3D2CA 2AF4C 4KR0A 4M86A 2HCRA 2ZU0C 3L1UA 3Q98A 4JLKA 1EB9A 4QG7A 2DWUA 2ONZA 5B2FA 4IF4A 4TYMA 1H8HA 2F3UA 2QHXA 2X86A 2ODNA 1W30A 4JNCA 3ZI4A 1L5GB 1ID8A 1VL2A 1NLUA 3OICA 4ZCSA 3ZQ4A 1UIRA 4ARBA 1XROA 2O19A 3KOUA 4C6TB 2G8NA 4D0RA 4B79A 1J4AA 5FH9A 4Q4JB 2PMDA 3QWBA 3DO8A 1V41E 3R77A 2NU6A 1G3MA 5EHIA 2BBSA 3IP1A 3N70A 3LFHA 4YUZA 2VDWA 2XRFA 1X8JA 4AF8A 1YD7A 1GWNA 1V3UA 5TF0A 2FW7A 2ID9A 1FUUA 1JT2A 1CUHA 1M7GA 2WZDA 2JVIA 5L7TA 5GGYA 5JMPA 1K7XB 1JHRA 1S4QA 2V4MA 1FU4A 1IM5A 3BRSA 3TSYA 3GZ4A 4P33A 1YJAA 4CL8A 1XTUA 3Q72A 4PINA 3E20A 5D6NA 5E6SB 5DBEX 2W2VA 4B2LA 4HWKA 4MYDA 5EHQA 1OPXA 4M1QA 4CDMA 4HG2A 4P81A 2VCHA 3L9WA 3NU1A 2I65A 1TCVA 4G0YA 1M2WA 2G1JA 1UF9A 5FL7A 1TYZA 2Z1DA 5CUQA 1IY8A 2X8JB 1G5TA 4KAXA 4P54A 1EGAA 2HZ7A 3D81A 1NW6A 2BKXA 4B3DA 4EQ6B 2E4VA 3A10A 1KS2A 1QX4A 4G5QA 4MIEA 4D7AA 1OLSA 5KWIA 2JD2A 4NZ9A 5A5DA 4CL3A 1AUVA 4DMGA 4V1CI 3ROFA 1F2DA 1Z0JA 1LVHA 5ALQA 5J23A 3BD9A 2I8CA 1U7DA 4IGKA 1KDVA 3R7NA 4JLBA 1UPCA 3RRXA 3T0GA 3OPYB 2AOWA 2P65A 1JPNA 5LC1A 4YMTA 2B69A 3EMDA 3DOCA 1DWQA 1LC0A 1T0IA 3K5HA 4KFSA 4Q4LA 4XUEA 2D4AA 3G2QA 5AK6A 4GQNA 1NSFA 3JAKB 2OEPA 4BO7A 1GUDA 4EF4A 1OXXK 1N0VC 4O1MA 1U2GC 1MPXA 1QHXA 1EU1A 1UXKA 4P3PA 3ONEA 5T7BA 5KWVA 1RKUA 5AHWA 1RAEA 2VWHA 1OW3B 3DBVO 2HIHA 3VSCA 4X66B 3YASA 2HF8A 1LI7A 4L76A 2EQBA 3GFRA 4S05A 1BVYF 4FB4A 2SHKA 3I9V1 4CQMB 4BMVA 3R23A 1EHYA 3MJRA 1ORVA 2XCTB 2ZM5A 1KZ9A 2GOYA 2WK1A 2OGSA 5AHXA 1OX4B 5EJAA 2ZS9A 4MLZA 4MTLA 3STVA 4Q1AA 4BP9A 2ATEA 5KHLB 2WVAA 2QEXB 1OFGA 5ALKA 3T3DA 5IXYA 3ES9A 1LGYA 1MH9A 4E5MA 3EJWA 1XZCA 4E30A 3DAGA 5FUQA 4I50B 3K9BA 3AHEA 5JBNA 4RSMA 3KTAB 2FOXA 1RWBA 2MSWA 3KXDA 4LJ9A 3VR1A 4V39A 5KEIA 1N36B 4C0AC 1CF4A 1IK4A 3LUCA 1E9BA 4YAGA 2IELA 4Q1FA 1QMGA 3R5SA 2H8GA 3RCBA 1RKVA 1PUXA 3CNHA 4GKVA 1Q0HA 5AH0A 2EJVA 4B75A 5KX5A 4EA7A 3U19A 1JEOA 1NI3A 1U6KA 1GIAA 4Z3KA 3SE0A 3ZHBA 3DLBA 4IEIA 1NVVQ 1C9KA 2PUJA 3AV0B 5JG7A 4OFXA 1FJHA 4JGIA 1ORWA 5I4IA 1GSAA 3W3AH 3CUSA 3BGOS 3ZWNA 2FCRA 5JISA 1VQMB 1A9PA 1U8XX 4PRZA 5C4MA 2I29A 3K2QA 5THKA 3ZGXA 2VDQB 5A04A 2W6MA 3GPIA 3QU5A 3H75A 1AB6A 3QV2A 1ANKA 4PTZA 3VPDA 2GCEA 2Y4OA 3DE1X 4IIGA 4RX1A 1UMBB 1QO9A 4X24A 4MUXA 3GLGB 1CNMA 1V7CA 4FYIA 3GPLA 4GDMA 1V2HE 4R4JA 1A88A 1N1DA 2ZJ4A 4CV3A 3GIRA 4TYQA 2AV6A 1VLJA 2GUWA 3LYAA 5DP2A 2VUHB 3CZ5A 5C7YA 2BVNA 3CUKA 4LGMA 1LRKA 5KB3A 1C7QA 3RKRA 4US0R 2WWRA 2AKEA 2R6JA 1M0SA 2VJNA 1UKZA 2ZRFA 2Z3ZA 5C4GB 4FR0A 2RGCA 1K1EA 3EF0A 1YJQA 1K2WA 4EI7A 5BNIA 4CKWB 2GXAA 3OMXA 4ZJYA 4MDFA 2NU9B 2FX3A 1TYBE 4BVHA 1MW8X 3HVUA 3O2NA 1MXFA 3PT9A 3L8CA 3U4QB 3QFSA 1U3TA 3EXG2 4RDKA 1IONA 2GPAA 4V2UA 3M6MD 1MG5A 4FEYA 4TLMB 1EFUA 1ZSNA 1W4BA 4H6PA 3ZDBA 3OA0A 3D0QA 4ZFNA 5BSTA 1G64A 4P0PB 3DOFA 5CNJA 3UW1A 5BMVF 4INAA 3V76A 3EEBA 3D6FA 3IO5A 1JWAB 5C34B 1FQKA 2ETXA 1J24A 5FHRA 4U02A 1BH6A 1SC4A 3R9IA 3B3FA 4K05A 3CRQA 1MENA 4U2KA 1DCFA 2QQEA 4XR6A 4E46A 2PHZA 4NWIA 1HT0A 4RHCA 3EDQA 3QFTA 2BOVA 3V46A 3N5CA 1MB3A 2I4TA 4FBGA 1ZK0A 4KJZA 4RZ2A 4XYGA 1R0ZA 2V5UA 5ISMA 4NI5A 2IIVA 1HK7A 2B1RA 2GLTA 4ZAWA 2AZXA 1Q22A 1ECBA 2OAQ1 3O1IC 2YRXA 1YR6A 3F5DA 4TLDA 4EB3A 5IWCA 1VBKA 3SSAA 1GPBA 1DQNA 2A7XA 3RJ9A 4OPMA 2G9ZA 1X7ZA 1IJFA 1KDOA 4XFJA 5DLPA 3RODA 2B20A 2IXDA 3DZHA 3VKVA 1AF7A 1OBCA 1TKAA 4AYXA 1CUZA 2R47A 3PDHA 1OJLA 2NYUA 3G0IA 5LN1A 4AKGA 3UAYA 2FB9A 4GMXA 4I1RA 1PW7A 4WZBA 1QV6A 4L72A 3PU6A 4Y2PA 2O0HA 3N28A 1TUBA 1A82A 1GAJA 3MGBA 4L2IA 4MX8A 2VJLA 5IJAA 3A4IA 1WXDA 1B76A 2ZXHA 1Z3IX 2HUNA 4LI0A 5DSTA 2YZMA 3EVDA 4D45A 4JQSA 2E4AA 3QFRA 4LK2A 2E82A 2VDKB 4P5PA 4PW0A 4ZVOA 4YJ3F 1FTQA 1YA4A 2P4EA 3GO4A 4NR0A 1N7JA 1X9IA 1A1SA 4RPLA 5ALUA 1Y9AA 3KM0A 3U4GA 1PL7A 2EQAA 4BLVA 1SHJA 4O2BA 4UNSA 2YN2A 3I0MA 3NE5B 4K46A 4WFIA 4HLQB 5F4BA 3KT6A 3ICQB 1PZGA 2XVZA 2YS6A 3BDIA 2ORYA 4G3XA 4HMQA 3HXMA 3TRFA 3EXEB 1OXUA 3IOBA 4CLOA 3TLJA 4XQFA 1Z39A 3AKEA 4KB5A 1M7HA 3T1OA 1X1DA 1YRWA 2LGJA 3EH2A 1N1MA 2VK4A 3AETB 4P35A 2NU8B 1V37A 1YRHA 1ZCFA 1NRXA 4U63A 4EVSA 1WV0A 1XTJA 3RRMA 4PHHA 3NASA 1UK7A 4IXMA 5FUWA 1Q1AA 1Y9EA 2OM2A 3BCDA 3IX7A 3FYCA 4FYYA 4GX0A 4Q6WA 2W43A 1Z6AA 4JLNA 2AI1A 4IIJA 1J90A 2QLFA 2XUDA 4ZCIA 3PWZA 4QUBA 3ESRA 4WV3A 1XQ1A 5FDFA 3AERA 2DERA 3P4UA 5J5AA 2HQSA 3WGIA 3NO4A 2FUG6 2RMKA 3QTBA 3G6KA 4MS3A 1MJHA 2B94A 2HCTA 3I09A 1NT4A 4DRXA 3BERA 4KPYA 2OYNA 4J4BA 3QEJA 2OFPA 3IMEA 2BJVA 1JDBB 1HMPA 1RWWA 2PMEA 4CEJB 3BOSA 5TXGA 2YMQA 1UBFA 1E1RD 4LY0A 3X1YA 4KBFA 2AXEA 2CMDA 5AK5A 3GMTA 3PD1A 1G66A 2J08A 3AY7A 5K1ZA 2YFYA 5GP1A 5JQGA 1GOTA 5HJ5A 5EVJA 1N2HA 1I0LA 1PQ4A 2C42A 3JQGB 4GHWA 5BQXA 3RFVA 4PZYA 3WSWA 1KYWA 4UM9B 2IUTA 3ZY5A 4YP5A 3JQFA 4C0XA 1ZJ5A 2QX7A 4LW8A 4P2BA 3GRRA 4BZZA 4I50F 4ZKDA 3RYIA 4GECA 2WYRA 3HA3A 2V7VA 2J32A 3H7IA 5DX1A 4BKUA 5ICGA 2C4NA 2H4YA 1WCWA 1Q7GA 4RIEA 4YLEA 1NM5C 4Z54A 2NSHA 1TLFA 3GLVA 2IH2A 2VF4X 4CKBA 1V1JA 4KU4A 3WY9A 5B6JA 1LQTA 3QMPA 1HE1C 4RDJA 2VHYA 2F67A 3DE6X 3Q12A 2ZTGA 1E6KA 1F9AA 4O1IA 3JV7A 5GQSA 3PTZA 1IWBB 3U5TA 2RHBA 1UM9B 3MM4A 3U13A 1P9RA 1ADGA 1KPHA 2XVXA 1ZVJA 3TQOA 4Z4YA 2XBLA 3EX7C 4DPKA 4XDHA 2JAXA 1BJKA 1FRVA 1N2CE 1TOAA 2WUVA 1E79A 4JU8A 4MV0A 3V3TA 1YBAA 4X93A 2UUPA 1BSVA 3CO0S 3WQHA 4BU1A 2ORWA 1TLLA 2Q9BA 3LPNA 4I8DA 5KYYA 4PBTA 4UBJA 3GEPA 1FFHA 4DNPA 1E1LA 3LPLA 3GH1A 2A4KA 1SWVA 3T9DA 1VL1A 2QL5A 4XQ9A 1IZ9A 3TAHA 4H1HA 3PJEA 4L4UA 4GI3A 3RT9A 1H9CA 4CM8A 3VR2A 1R1DA 1A9QA 4OMCA 1OZAA 3H42B 1HEYA 2ZSHA 5EZYB 1PJ2A 2PGIA 3ISVA 2FRVA 1GVNB 3D2BA 3DNMA 5BQFA 4RDHA 1QBGA 1U9ZA 3ZWVA 2QU7A 5AIBA 2ZTSA 4OFBA 5B55A 1UM8A 2I91A 2LNDA 1OX5A 5LOVA 4KOEC 5CCBA 3IO3A 5I7WA 3TEMA 3KG2A 3FCEA 5IEBA 4I0WB 3R7FA 5DJ5A 2A3RA 2I78A 2KX7A 2Z0MA 1GFIA 1YR3A 1W48A 3KAKA 4TV9A 2NVUB 1I2AA 1B26A 2QN6A 3AKYA 1R4MA 3DAPA 3Q7QA 3HO6A 3M8KA 4KIUA 4P7JA 1QHEA 2AMFA 1VCNA 1KOFA 1AXRA 4PLYA 2QAIA 4EPRA 1LJUA 2PX2A 3AL0C 3GAFA 1XZBA 3EOZA 3IXLA 4BUCA 1RM4A 4EUHA 1NR5A 2O5EA 4M8NE 4XR4A 2YWJA 4EI8A 2CKMA 2FR0A 4JLAA 3GMDA 1VQKB 1CQJA 1EINA 2OXCA 1Z5ZA 2R8OA 3FKJA 4MYCA 2AJTA 5HKLA 4BX8A 1GUAA 1NW9B 1CIPA 1WXIA 3JSAA 1QRAA 2HEIA 4MV7A 4CUKA 4ZZ0A 3T3GA 1SOWA 1PEDA 3X43A 5B3JC 5DKFA 1N2JA 3W8EA 3DCIA 4MICA 4HLNA 3C1TA 1P73A 1KS9A 5BW5A 1MC8A 3BGWA 1LPMA 1T1RA 5GWXA 1O2DA 3T8YA 4DDUA 1I5EA 2R11A 1T3LA 1XTRA 2UYGA 2XB6A 2ZAIA 3DC2A 3SK0A 1KETA 1M2FA 2YHSA 3ZX4A 4IQFA 2AEFA 3QJYA 1B8NA 5FPSA 2BFFA 2MR5A 3CW8X 3OOEA 1PKXA 4WZTA 1RKQA 3EIXA 2PFKA 2KVOA 2IUUA 4AZTA 1JR3D 4I1IA 1Q2XA 3PHGA 3WJ7A 4B7ZA 3II6X 3ITNA 2ZUWA 1OJ7A 3LT4A 3PEVA 2VUIB 2COKA 1Q0UA 2PXCA 2I9KA 1DE0A 1E3EA 3JZAA 3BWDD 1R4ZA 4RSHA 4Z5XA 3PHHA 3NOVA 4KMMA 4U39A 3T5BA 1BXGB 1ZGBA 5LB2A 3KETA 2YWXA 1FQWA 1IPEA 4RPBA 3UXHA 1I3NA 2IPXA 1D2GA 4JJ8A 5TY0A 4NPHA 4ARVA 1TQHA 5GJWC 1MRNA 2OQVA 3D2AA 3K70D 3BREA 3OIUA 1XJ5A 3QX3A 3EBPA 2PQ0A 5D1HA 3ZCQA 3IE1A 4IDGA 4OU5A 3W0LB 1OBHA 5HKAA 4OO3A 3QPUA 1VQOB 3WZ2A 3K20A 3QELB 3NWJA 1ZJZA 1I7NA 2LVBA 3FYTA 4L7QA 4DCJA 2HBZA 2FNAA 4CMBA 2N75A 1GPLA 4OLAA 4GC5A 3EVFA 1GZDA 1CR0A 4F7DA 1QDUA 2FA9A 4KRXA 1H3NA 1JZSA 1SVMA 1I7LA 3T9CA 5KYXA 1IN6A 2YZKA 1R15A 5DM0A 3I64A 1OPRA 2AI2A 3GEMA 3FPBA 1MUUA 3O7MA 4XUCA 5AW8A 5IKMA 3J80A 4NU0A 2G1PA 3WGKA 4CEHB 2PO7A 1PJ7A 1O8CA 1ISHA 1K8XB 3VYVA 2FR8A 1G4AE 4YT2A 2GZAA 2J7PD 4HDMA 1E0AA 4RF2A 4EJSB 1L4MA 2B2XA 3L79A 3T4PA 3H4VA 4W8GA 1DKNA 4OQLA 3VU8A 3CBQA 5DHRA 3G79A 4G4IA 4IDFA 3DV9A 4TWAA 1UMCB 4CIVA 2XUAA 4KE6A 4D9EA 3PKJA 2HA0A 1FYWA 3LC2O 1NFRA 2QI9F 1NW5A 1LC3A 2QD2A 4HDOB 4QT0A 4R6XA 4RESA 3FJYA 5IKPA 1AC5A 1OXBB 1HKHA 1T3TA 2W8ZA 3GFFA 4X00A 3W5IA 1WULS 2QSZA 1F8YA 1NSYA 3A0UA 3CF0A 1MJFA 2NTYC 3QVLA 4L9WA 4RM3A 5DK6A 3ZW7A 1RM3A 2DY0A 3QP9A 4BCBA 3QMMA 3NDBB 5JI3E 2X4LA 3DCJA 1I33A 4G6ZA 1A96A 1M5UA 3N6XA 1I36A 2WABA 5CLQA 1HDZA 2FW6A 2JKVA 2JF0A 4Z4GA 4UZFA 2W7TA 1ISSA 4R2XA 3DZCA 2Z4TA 2C9CA 1XDWA 3F46A 1PX2A 3HNRA 3HY6A 3M4JA 5BWNA 1JLLB 1XPJA 2O52A 3IR6A 4IDDA 3WJAA 5FL3A 1U0FA 2IKSA 3ZBTA 2RHJA 2WC1A 1NV8A 4IHJA 4YJHA 4YWJA 3A6LA 5BN3A 3HG7A 5JBIA 3TGPA 4Q3CA 1Q19A 1LDGA 4LOLA 8ABPA 2ZRPA 4PNPA 3CNNA 4KWIA 3GRCA 3ROGA 3E22A 3OLVA 1WSRA 1PT7A 3LQQA 2HK6A 4FLEA 3TG2A 5A4AA 1GL9B 2J0UA 3WLKX 2E4UA 3CMCO 5FJJA 1JBKA 1SURA 1XLTA 1Y5LA 2XXAA 3CLKA 1BD4A 3D0RA