4EH1A

Crystal structure of the flavohem-like-fad/nad binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
237
structure length
237
Chain Sequence
b'RDGRTFVVREKQVESAYVTSFVLVPADGGAVLDYQPGQYIGIEVTPEGSDYREIRQYSLSHASNGREYRISVKREGVGSDNPGLVSHYLHNNVKVGDSVKLYAPAGDFFYVERERPVVLISAGVGATPMQAILHTLAKQNKSGVTYLYACNSAKEHTFAQETAQLIAQQGWMQQVWYRDESADDVLQGEMQLAELILPIEDGDFYLCGPIGFMQYVVKQLLALGVDKARIHYEVFGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavohemoprotein
publication title Crystal Structure of the Flavohem-like-FAD/NAD Binding Domain of Nitric Oxide Dioxygenase from Vibrio cholerae O1 biovar El Tor
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
total genus 78
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 1.14.12.17: Nitric oxide dioxygenase.
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4eh1A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4eh1A02
1WDTA 1W87A 1IJFA 1IJEA 1I7PA 1JNYA 1EFTA 3CCEB 3MMPA 3PENA 4M0LA 2QEXB 2AHOA 4ACBA 1TVCA 1TLLA 3QSYA 4YAUA 3WYAA 3WXMA 4P6VF 4B43A 4AC9A 3QE2A 1E62A 3ES9A 2BN4A 1YJWB 4G1VA 4B48A 2PIAA 3JQRA 1ELOA 3WBJA 3ZZ0A 2XNCA 5KSWB 1YI2B 4TMWA 4YAWA 3G6EB 1ZM4A 4FWTA 1G7RA 1B2RA 1KRHA 3CB4A 4LBZA 3WY9A 4IW3B 4U9UA 2DY1A 3CCJB 1QGYA 3ZZUA 5HXBA 2QN6A 3OJWA 5H5JA 1J9ZA 5H59A 1VQ6B 4TMZA 3MCAA 4ZCLA 2VNIA 3WNCA 1D1NA 2J7KA 1JA1A 4RD1A 4B44A 1K8AD 1DDGA 4LBVA 3WBKA 4TMXA 4B3XA 1DG1G 3CW2A 1R5BA 5AN9A 3A1FA 2BMWA 3LRXA 1QGZA 4J0QA 3J81k 3OZWA 2BV3A 3CC7B 5EMNA 5THXA 3E20A 5GV8A 4ZCIA 4M1KA 2BM0A 2VNJA 1A8PA 1QUFA 3U2QA 4TMVA 3W5VA 1JB9A 1VQOB 2CNDA 4C43A 2VNKA 4MYUA 2QMUA 3CD6B 1EP3B 4HE6A 3CMAB 1VQ7B 4M4SA 1TTTA 3W5HA 1QH0A 4PGOA 4B4DA 4FN5A 3AVXA 1VQ8B 1DARA 2ZITA 2D74A 3E1YE 3FPKA 1VQLB 4H9GA 3U6BA 2EIXA 2GPJA 2RC6A 3WNDA 1EP2B 3W2EA 1U2RA 3VO1A 3CPWB 4UAJA 4LBWA 1F20A 3B78A 5TV2A 1VQPB 1H42A 2VYQA 2FX3A 2HDNB 1CNFA 2QTZA 1Q82D 1KK3A 3B82A 2BVNA 2BPOA 4M2LA 3QFSA 1BJKA 1S72B 1BQEA 2PMDA 4RD4A 3CCVB 2BGIA 1F60A 1K9MD 4B47A 4DQLA 4DQKA 1FRNA 4Y7CA 4ACAA 3LO8A 1K73D 3VNUA 3AVUA 4WQMA 2EFGA 5DSZA 1JA0A 1CQXA 2BM1A 1CNEA 1OB5A 1FNCA 1W2BB 3CC4B 2XNJA 1VQ9B 3P27A 1DDIA 3AVYA 5GV7A 1AMOA 1QUEA 3CMEB 4F7DA 2OK7A 1Q81D 1G7SA 1GVHA 1HA3A 2VZLA 3ZBUA 1VQKB 1W34A 3AVVA 1QX4A 4NBSA 3ZC3A 1KD1D 1GO2A 4RD6A 1B23P 1EFUA 4RD3A 1N0VC 3CCQB 2OK8A 1E63A 1XB2A 1YJ9B 4PC6A 3CXCB 4ZCMA 3ZBTA 4ZGQB 1W35A 1NJID 3AGPA 3SJZA 3W2GA 1YHQB 5TY0A 1KTVA 1EFCA 2DERA 2OTLB 3B8HA 2DETA 3CRZA 4Y9RA 4PC1A 1KJZA 3MHPA 2OTJB 1KQSB 1R5OA 1VQ5B 1TUIA 4N3GA 1D8TA 1QFJA 1N0UA 3JQPA 2XEXA 1QG0A 3VO2A 4RD2A 3W2FA 1FNMA 1GR1A 2YWEA 4K1XA 4AF6A 1QVFB 4AF7A 2B7CA 1EXMA 3FJOA 3CCRB 1VQNB 4TMTA 1OB2A 1QGAA 1KK0A 1R5NA 1Q7YD 2HCJB 2R6HA 3ZZTA 4R71A 1NDHA 1YITB 1AIPA 1ZM3A 4QFMA 2PLFA 2C77A 4PC3A 2YWHA 1VQMB 3OZUA 4PC7A 3QFCA 3CCSB 2B7BA 3CC2B 1EWYA 4P3YA 1GAWA 1YIJB 3OJXA 3WNBA 4BPRA 4EH1A 1FDRA 4ZV4A 1OGJA 2GQFA 4C0SA 2CRVA 4YHBA 2NPFA 2BF4A 3AVWA 3CCMB 1FNDA 4RJLA 3LVBA 2YWGA 4TN1A 1KK2A 3OZVA 4G1BA 3V76A 1YJNB 1IB0A 1UMKA 1JJ2B 5JBQA 4RCZA 4N3NA 1D2EA 1Q86D 4RCYA 1N8RD 4YAFA 4G5GA 1QFZA 4ZGNB 1XE1A 1QVGB 1BX0A 1GJRA 5FA6A 2QA4B 4LC0A 1G7TA 2RC5A 1KC8D 1H85A 3QFTA 3LYUA 3VNVA 4FK8A 3W5UA 5TR9A 4YAOA 2C78A 3I1FA 3JQQA 3VMFA 4NCNA 1QFYA 4MYTA 4M53A 2B5OA 1SKQA 2QDXA 1FRQA 2YWFA 3CCLB 1ZUNB 1E64A 1KK1A 2X3UA 3AVTA 3I56B 4PC2A 4Y9UA 4YALA 1VQ4B 4Q7JB 3CCUB 4QHYA 1FNBA 2HMAA 3P26A 1S0UA 2E1RA 1BX1A 4RD0A 1G7CA 1OGIA 2QTLA 3QFRA 1GAQA 1SM4A 4LBYA 3G4SB 1M90D 1M1KD 4HE5A 1ZM9A 3AGQA 3G71B 2BSAA 1ZM2A 2DCUA 3OW2B 3W2IA 3U6KA 3W2HA 2DEUA 1EP1B 3I55B 2VNHA 2BGJA
chains in the Genus database with same CATH superfamily
3FG9A 1TIBA 3DVRX 3GNTA 4EELA 4AI6A 1IY2A 3UB3A 2Q5QA 4PNZA 4G5SA 4G84A 2NVWA 3AEQB 2WICA 1O7JA 2G9RA 5LZ2A 4H6VA 4A8TA 1GGEA 3TJZA 2IS1A 1J33A 1QXSA 5LQRA 2BSXA 2B1GA 1VE6A 3EHEA 3EXFA 4NZ9A 1Z0IA 1AKMA 4M1YA 4OQPA 1FU4A 1QHIA 1J2UA 4O59O 4RFSA 4KITB 4C78A 1OQAA 4CKWA 3ZIAA 1C7EA 3OT1A 5L6MB 4M60A 4B2YA 4RQBA 5G1NA 3A8JA 3CUYA 4HB3A 3OQIA 3GVIA 4ZHSA 5CAEA 3KYIB 3QVGA 4Z9XA 1IN5A 2NPOA 4QYTA 3HVKA 4W6QA 5AKXA 3RTDA 4YUAA 2XNCA 4OQMA 4QGAA 1XA3A 4QPNA 4PR3A 4NHEA 4NV0A 2IV7A 3ZS9A 1MQSA 5KX5B 2D7JA 5LD2B 1Q0LA 5KAPA 3AY3A 2ZGVA 2RBEA 3EXIB 4YJ2A 4XRGA 2QP3A 1CZRA 3EFOB 2X6QA 3ZLTA 4CGYA 1D1SA 2AD5A 1OWPA 2QN8A 2OBSA 3QEMB 4FLEA 4DKJA 1QP0A 4G5RA 3LT5A 1R6BX 3IR6A 1DFHA 2FP3A 3DF7A 5CIWA 1BVHA 4HGRA 1POXA 1JLKA 1W0KA 1RVV1 4LCJA 1N5IA 2LR0A 4GT1A 4MR9A 1S4QA 1GNPA 2IUEA 1WKCA 1ZD3A 1E3WA 2O7NA 4OPOA 2XXJA 4LS3A 3I2IA 3V55A 3W3ZB 3NBKA 1H9CA 4ZCLA 3OLWA 2ST1A 4NDAA 3WK7A 2WHYA 4BP9A 2Y9PB 5DNCA 1NVUQ 1ZEJA 5ICEA 1U1DA 1J0AA 3KFVA 4BMXA 1PDOA 2DHCA 2JLRA 3T3HA 3MMSA 4FZJA 1RQLA 4HBGA 1CF2O 2JGLA 4C2BA 5JD4A 1NF8A 5LP6A 4MZDA 2R7KA 1KH1A 4DYHA 1U65A 2UXBB 2HI0A 1UDRA 3PUWA 4TL7A 1T0HB 3EEOA 3A1FA 4YP5A 3N3AC 1OTYA 4N9QA 4ZVOA 4GOND 1D0IA 3SBDA 3PHJA 4XB6B 2GZMA 1RDFA 4S3MA 3JQ8A 1T1JA 2MSEB 3LVQE 3UJBA 4L9SA 2FEMA 3U7QB 5C5EA 1AZSC 4FFBB 2R68A 2WJWA 2PQ6A 3FPFA 3I5MA 4OQZA 2H5IA 1E3XA 8GPBA 2MIIA 1DC4A 2Y0DA 4MQFA 1XA0A 2BM0A 1P4GA 3SBOA 4ZAZA 3PDIB 4BLWA 3I61A 1DLJA 2IW3A 5IYZA 2VDOB 1UINA 3PTZA 4TMVA 3RV3A 4Z4HA 1G5QA 2WV9A 4X6YA 1AVTA 5L40A 1NVVR 2D7CA 2Y77A 3KD2A 3TRJA 2YIMA 4A8JA 3SFZA 1K08A 2QTBA 4DDUA 3IDOA 3TKYA 4M86A 1VE1A 4B76A 3I76A 1XZKA 4M89A 4D25A 4FYVA 3F6PA 1PAUA 3I53A 4X3PA 4TQGA 1MOZA 4KLCA 5AKYA 1VQ7B 4XOPA 3LBAA 3FETA 1XZFA 1HZZA 2AG0A 2R5FA 2Y1WA 1S7GA 3EF1A 4XYGA 1KAEA 1L1QA 1GUBA 1GRRA 2DAPA 1Z17A 5TLSA 4UM9B 3QIVA 1XWFA 4PG5A 4AS3A 3BK2A 1CQPA 3PFCA 4QRHA 4QYXA 4DV6B 4Z1OA 1NRJB 1YRQA 5C31A 1VSVA 2P1DA 1D2GA 4Q1EA 3L93A 1GPH1 4J0KA 5A89A 3SF8B 4DC1A 3CLTC 4YCCA 3KJGA 5IABA 1ECFA 4D0SA 1H4SA 3PJFA 4YJ3B 1F2VA 1X1QA 3KHTA 2CXRA 1M2OA 1ADGA 3IQFA 1I0IA 5JTTA 1EGQA 4M9CA 3AYXB 1ZISA 1ORRA 1V71A 2HWXA 3IKVA 4MS4B 5ALXA 3I01M 5FBLB 3V8VA 2IYSA 1DIGA 2GPJA 3WNDA 3DBOB 1U8TA 2W98A 2WU3A 1O58A 3FYHA 4IIJB 3RU7A 4CHTA 3BYZA 5G3ZA 1U2RA 1B41A 1RWPA 1XTUA 2GM5A 3QVMA 4N8SA 2W0MA 2XMZA 5K0NA 2RD2A 4BRUA 4X7FA 4JA0A 1NUSA 4DLPA 1Z88A 2ODPA 4DIDA 5FBKA 3NHYA 1T6NA 3DBVO 5C1OA 1BH2A 1B93A 3KJQA 3HHEA 2W2TA 1J5EB 2PBFA 5LQSA 3F6EX 2H1SA 1USIA 5EIWA 3QFSA 4HY3A 4E5VA 2CMGA 5IKXA 4PGHA 1OXXK 1XVVA 1KAOA 4UUAA 3WL6A 3T4PA 1XELA 2RGYA 1ZSYA 2O3QA 1GQFA 1WDWB 2BGNA 1JG1A 5FV4A 2R9VA 3CCVB 1PL6A 4M76B 2BGIA 1EM8B 1Q5PA 1ZA1A 3CPEA 1WL8A 2FZKA 3KELA 4R6WA 4GMDA 1P17A 3ZGXA 5KWEA 4DB2A 2AXQA 4D5EA 4P98A 4WL0A 2QMQA 1Z4IA 3VR6D 2R751 2OHXA 2ZAGA 4JFAA 3FH0A 4LYFA 4EYQA 4YMUA 2HF9A 3EZLA 5KMGB 5EE1A 4H7JA 1I1NA 1UAYA 2R6R1 4JJ7A 4ZT6A 4AIIA 2QL9A 3UK1A 3ZW9A 3FXAA 1C9NA 3OM9A 5D1NA 4OYRA 4B6JA 3HEMA 5AUOB 2VJLA 1EFPA 2GM9A 2YICA 1V43A 4MWDA 1EE9A 2QW0X 3GRKA 3ITKA 3KHSA 3RY8A 2FV8A 2JVKA 1K7FB 3HWWA 3NBFA 2J3LA 3P52A 1B8UA 3PE3A 4M0KA 3WYGA 1BNCA 1V8DA 2GNPA 2XCIA 2CVOA 3RWBA 3TOVA 2VSOA 4KKTA 1JYFA 1SHZA 2ZG6A 3DHNA 3E03A 4EVIA 5A9SB 4P3OA 3H0CA 4XVHA 5E1MA 2I3GA 1CUEA 2R8XA 4HC4A 4NE7A 3WK9A 2ODBA 4GBED 3NM5A 4ZHQB 3PDCA 4GL2A 2YJGA 3U5TA 1JG3A 1P0PA 1FQWA 3LL4A 4HUJA 4HX5A 3H16A 4J7UA 1Y89A 5G0WA 5HCNA 3ASQA 5CA1F 1RJGA 3AETB 3PA2A 1I6WA 4KQHA 2AI2A 5DO9A 1QDEA 2XWJI 3GFPA 4DIKA 4BO5A 1CDEA 1TEXA 6REQB 3B7GA 1F7VA 2NXWA 1OZ0A 3RFUA 5B7PA 1L2TA 3F98A 1A50B 1LB1B 2PSDA 3STVA 3V46A 1XK7A 2WT8A 3N0XA 3TFQA 5MFZA 5JAOA 3PUIA 4AUNA 1JI0A 4MYSA 5EKTA 3RK1A 3JQ9C 3SD7A 1IMOA 3U7GA 2GHQA 3IMCA 2WPDD 4E09A 1H2HA 3BGDA 4HYEA 5FD8A 4BMDA 2PX3A 4DJDC 3BXGA 1GNLA 1TPYA 2BDEA 1DFIA 2IQIA 1YIDA 1I6MA 1XYYA 1R50A 1ZK3A 3TNJA 1Z3IX 3JSAA 1ZRMA 1D8AA 4LWZA 2PX4A 4P4LA 4CFSA 1O95C 1Z28A 3C8HA 3MLAA 4Q03A 3AU8A 1TVMA 4X6LA 3GJ7A 5JCXA 2YJ6A 2P2CA 1A98A 4NBTA 2OK8A 3Q1KA 2NM0A 2NZWA 3AEKB 4OQEA 3ROQA 1YJ9B 4X1OA 4B80A 2XQFA 1ML4A 4WZBB 5LBTA 4PCVA 4FDTA 1SY7A 3DBRA 1UEIA 5CUQA 2B3TA 4D0LB 4KFCA 4DCJA 5F3DA 2I7XA 1ZNZA 2HC9A 1GZHB 2CYCA 3AGPA 2FPPB 3DE7X 4L3OA 5KTTA 1EUCA 4X7DA 2AC2A 1EE2A 4Q1AA 1YHQB 1B14A 2XMDA 2VHJA 1Z8HA 3ZWOA 4YRAA 3IERA 2EXXA 2FZGA 1UBEA 4YMTA 1AUQA 4KGDA 2X41A 2YASA 1W36D 2WIFA 5EPEA 2B1IA 1V9CA 2PFSA 4I8DA 4XRRA 4Y6OA 2HD4A 4AUKA 2DU8A 3CHYA 3EG5A 4FCCA 1J1IA 4JMQA 4INZA 5AW3A 4U9HS 2IHZA 1A96A 4ZVMA 4DKXA 2E85A 1JLLA 2ZSHA 1I2MA 3MIZA 5I9SA 2NO9A 1N9ZA 2Q3JA 4NYIR 1QWSA 4PO8A 3GAAA 3ZVMA 3M9XA 4YJ2F 1Z45A 5IN5A 3OU2A 2O0MA 4FC6A 4HTFA 4XIYA 6CHYA 4EHAA 4ZQEA 4EB6B 2EG5A 4PLPA 2AFHB 1A71A 4XIFA 4D1YA 4F1JA 1YVUA 2A35A 3VO2A 3AESB 3NYIA 5LKAA 2O8CA 1K4KA 2ZVDA 2W4IA 3QI7A 1WXQA 1GGJA 5CDUA 1CEQA 1H9AA 1TM4E 3AFHA 3UQYS 3GVCA 3AL0C 3RUHA 5L95A 4JEHA 3CLRD 1MG5A 2YWEA 5K3OA 2PJRA 3F6YA 5AK3A 3KXLA 4HQOA 1H2FA 1C7QA 2CHFA 4GLLA 4L4UA 1EXMA 4XM3A 4RHEA 3U7EB 2RHRA 1QHHA 3SY8A 1FVOA 2WJZB 4L5JA 1N5KA 2KPOA 1X9GA 4WA8A 2ZAYA 5LP6F 4FGKA 1I9GA 4KOAA 3ROEA 4OCZA 1QYCA 1G21A 4DLZA 1R16A 1VIAA 4BMPB 2V59A 1RBQA 2PKRA 4YASA 5JXHA 1CUJA 3TRKA 4URZR 3BDIA 1HLDA 1H2ZA 1KQOA 3BE4A 4BJ6A 1N6OA 2D2VA 2Q0SA 4PQYA 4BNIA 5A2GA 4BGDA 2WMOB 4KMRA 4KQXA 1KHTA 1WBJB 2VT2A 4RVUA 5KWVA 2Q27A 1VQMB 5FB3A 4J1TA 4TTPA 5FH9A 3L9WA 3OFJA 3DLAA 4ETWA 5CIYA 2RGXA 2DXIA 2UUCB 4IO1A 4V24A 1SQ5A 1DPGA 2IIPA 3CUVA 1U7HA 1W2HA 2XYVA 4H15A 1CS0B 4B0PA 5K0JA 2B4AA 1UD3A 4WZKA 5IYZF 4BPRA 3OT4A 3WOHA 4WOPA 3QYAA 4BNUA 4IIGA 1T5TA 1WPXA 4KB5A 2B2XA 4FD3A 1AF7A 3ASZA 3IESA 3KWJA 5JH7A 5K0SA 1PEKE 1EVIA 3C5HA 3D3QA 4XYEA 3KKMA 3X1JA 4H6XA 4XCQA 2QZ9A 4IXMA 3DZDA 3CF4G 3MUNA 3RQSA 1X7ZB 1EE1A 3CCMB 1Y3AA 1XGKA 2I2FA 2ZKLA 2VDMB 2XVYA 1RZ3A 2VG8A 3CXRA 4XZ3A 2EP7A 1BXZA 1XBTA 2RI1A 5AKKA 2IIBA 1CUAA 1M1UA 1MCZA 2P3OA 3CX3A 1U6JA 3C0KA 4RLQA 5FLKA 3V76A 1JEDA 1RTKA 3RVBA 1EK0A 1H4QA 2F90A 1U2QA 3A1NA 3B1FA 1DEKA 2IP1A 2ZUFA 3C5CA 5CEEA 1QIHA 4RCZA 2ZVPX 4LXQA 1ETHA 1D6SA 4KWHA 1WPGA 4N9WA 4MI6A 3CFYA 2O50A 2PZGA 3UEOA 2QP4A 3IRVA 1J7KA 3L8ZA 3RTBA 3ZWYA 4G5GA 1RTTA 2FTKE 1U8XX 2VN8A 1DELA 3BXOA 4R01A 4Q3LA 4ZGNB 3QKTA 3LCUA 1XE1A 5IDWA 4FDLA 4JFRA 4FZVA 3ML1A 1BX0A 1ZQ9A 3R3JA 4DMKA 5JZBA 3TN7A 1WBBA 3R5HA 4XTRA 4NFLA 3ZJVA 3IBSA 5FA6A 1NATA 1B73A 2XT6A 3EARA 3OVMA 2BHRA 1IBSA 1NC3A 5JWHA 1KFKB 4YUWA 2FMIA 3PE4A 4C4PA 4IXNA 4PLVA 3YASA 1JAHA 3IDSA 5EKSA 3NC4A 3K09C 3K20A 4M9XA 3W5JA 4NZMA 4BX2A 4DY4A 2CBGA 3C3PA 2LZ0A 5EUQB 1VG0B 3CSDA 4D7AA 5G53C 2IODA 4EA7A 2A2ZA 4HDMA 5CFLA 5KU1A 4BUZA 1DAKA 3TR5A 1HG0A 4BLPA 4DZZA 3CRNA 2C78A 5M29A 5KOHA 5AI9A 2D54A 1NN5A 1UZMA 3D8UA 1P2BA 3EZYA 4ZI2A 3H9UA 5JXJA 2R60A 1N5DA 1C41A 5ARDA 1E6EA 1XTJA 2ATEA 5J4KA 4LXUA 1T5LA 3Q38A 3V1UA 3MCUA 3UW3A 4FGUA 4X7BA 4NEHB 1LPPA 2QDXA 3ZW8A 3FNGA 2I65A 1DI0A 3IOYA 1R64A 2Q3HA 3EOBI 3C5VA 3IJEB 4FN4A 4KXFB 1XXHA 3HKDA 3GRAA 3WDKA 4LYAA 1GTZA 4Y8VA 4DSOA 4X65B 3TLBA 1QWOA 2J6HA 5AW6A 2DH5A 1QO9A 3FPGA 4LJ7A 3SU8A 5LXTB 1Z0SA 4UMDA 2YNMA 3Q8LA 1VQ4B 1KYZA 4Q9NA 3I52A 2ODEA 2DY0A 4CEJA 4J4BA 1S2GA 3ETEA 1ODSA 4G97A 2HXYA 3T95A 1YHNA 2IELA 1W88A 3A8KA 5HOEA 4YQFA 3EIUA 2Y6UA 2HF7A 4D43A 2AG8A 4N8DA 1RZUA 2FN9A 2HMYB 4PLFA 1K5GA 1H94A 1U7DA 3PPXA 3U40A 3L7BA 3GHYA 1E1RD 2ZSAA 4AWXA 1MH1A 3Q12A 1Y0YA 1QK5A 4FDUA 1FFWA 2VBIA 4OQLA 5KOYA 2ODAA 3FCOA 5PNTA 4BWVA 3D3EA 1P7WA 5D5QA 4OI1A 1RPJA 1NLYA 3IEPA 3AY7A 4YHHB 3GFVA 4G67A 4X64B 1WA5A 3HXLA 1DG3A 3ANNA 5FEMA 2DEUA 2OD7A 3D31A 2PK3A 3TB6A 4LZLA 4UHHA 4NZYA 5EP1A 4DV0B 3QX3A 3MINA 4B3GA 5BSFA 4CDNA 4P2NA 4P12A 1C9DB 1C4KA 1QF7A 1U28C 3GV0A 1NM5A 1U1EA 2NOAA 3TPZA 1DVRA 2O2CA 3KB8A 4WY2A 1JIXA 3D2AA 1BMDA 1LFDB 3LF2A 3HP1A 4I9NA 4J49A 4O2BB 1O2DA 2IPOA 2ZAMA 4ACBA 3BA6A 4FGLA 4QPPA 4JLJA 3W9YA 5J2UF 3I04A 1N33B 1VCMA 4L0DA 4ZOCA 1E2PA 2GEUA 2G80A 1VPDA 3BMQA 4EUSA 3FPSA 3WLJA 5THKA 3WYAA 4Z4ZA 2BOVA 4B4WA 3L8EA 1XA4A 4GW3A 1OWMA 4E6EA 2H17A 5AXBA 2C9MA 1Z22A 1JAXA 1RLJA 1UXJA 4Q3DA 5LMUB 2BJVA 1QCYA 1A4XA 4H1UA 1QH8A 2VK4A 3N59A 3OD5A 1UBUS 5BWNA 4PNPA 3NDJA 3MT7A 4MJXA 1BOFA 4TKZA 3GJ8A 5U4QA 3BN3A 3QBVA 5DK4A 3W06A 3W3AH 5I7WA 3F5MA 1FRVA 4I1YA 5EHXA 5C34B 1R9GA 2IYRA 1OGYA 1OBFO 3NBYC 1QKKA 4M99A 4NYMQ 2PIAA 4DC0A 2JLCA 3SKXA 3QVUA 2EV9A 4B8YA 5AHXA 1P0IA 2G4VA 2FMUA 3EBLA 5HJ7A 4UUMA 3NOQA 1Z7YA 2W6JA 3P2EA 5DCUA 5AXCA 2MSLA 4RAQA 2AN9A 2BFDA 1G8GA 2BGLA 3PB3A 4WKNA 5DJ5A 1JTFA 3TD6A 3P9CA 4BVJA 3FCSB 1U2PA 3U7JA 2QE7A 1ABEA 2JHGA 2O2YA 2Q8NA 3BGWA 5K03A 2B4KA 5AYVA 1VLZA 1WORA 2P3MA 1I4TD 5J23A 1QDLB 4OQFA 4HP8A 5C51B 1ZN8A 3TQOA 3WGIA 3G0HA 1CUDA 3AR8A 4KYIB 4C7OB 1T3ZA 4OBEA 2P90A 1SXJC 5DEIA 3PFKA 4HGQA 4W63A 4PNEA 1TW2A 1QX3A 3UAOA 8AT1A 4WHMA 2FLVA 5DWQA 5DN6A 4AMYA 3ZWCA 1TU0A 1B8PA 2A0UA 1W76A 3PQ4A 3NV7A 1FSFA 2IZ6A 3AHGA 1YQWA 3ETHA 4UMVA 4GIBA 4GPZA 4BB9A 2J7KA 1O3YA 1O9GA 2VF5X 1UBMS 2WTAA 2Q4EA 4PZDA 1RWOA 2Q4OA 3M4YA 2BTQB 4J1NA 1JDSA 2BFAA 1UM9B 2ZCUA 4H1TA 4LHYA 4OJKA 4PWYA 5BW6B 4R9NA 2PA0A 2JGFA 5A6VA 2PH3A 1ZFNA 1XAJA 1RM4A 2DQSA 3DZFA 3P9KA 2A92A 1J2JA 5DOZA 5B36A 4F84A 4EZBA 1Y6FA 2JAWA 3RSSA 3U9LA 1U90A 2GBLC 5ERGB 3G2IA 2GBFA 2AOVA 4IYJA 4CM8B 4O63O 2NUPB 4TT3D 2BTOA 2XLBA 4YRIA 4G8JA 1CYEA 5EYPA 4IQFA 2NG1A 5J47A 3KSUA 2X13A 1WZ2A 2QT1A 1TM7E 2AF3C 1NJ6A 3HN2A 2XD9A 1Q7BA 3T1VA 2O8DB 4IX1A 4ZAGA 3OMWA 1TCAA 2JGJA 3H4VA 3IJRA 4O02B 1XRNA 1JEYB 1WMFA 1U2GA 3G5MA 5BPHA 1XZPA 2R1UA 4QQFA 4WBSA 2H7VA 4PONA 4F93B 3B1JA 4JBIA 1A8SA 2GESA 1NQ5A 1JR3A 2XRFA 1E2NA 3IV7A 4LHSA 1M2NA 4F46A 4IDBA 1WPRA 4BIIA 3B9BA 3CZRA 2AS0A 1CY0A 1Z39A 4U2KA 3RVQA 2Y68A 1W47A 1KIAA 5JH7F 3WRXC 2C0CA 2XR1A 2C03A 1WB4A 1JXQA 1XLTC 4WZLA 1KSHA 2EJBA 2HJRA 1QPGA 3DD5A 2LDXA 3KK0A 3N0WA 4OJYA 4W1RA 1JSZA 2JJ1A 1UAGA 2LP4Y 4F85A 3DOOA 1LWNA 2CSUA 5A2QA 5CFOA 2GCOB 3KQSA 1N7HA 2V7GA 3FZNA 1MX5A 3KVOA 3V4LA 5DU2A 1PZGA 3IKMB 4LX0A 1Z0DA 1NJ5A 2VOEA 3ODPA 4KQEA 2QW1A 1PUXA 1AS3A 4JJ6A 4OXNA 2RCNA 3EWAA 2EC5A 2Q4TA 2UYOA 1NLUA 2FU5C 2Q4DA 3KHKA 3JD4A 3LJKA 3OJLA 4LOIA 4V03A 5DISB 3R20A 4K03A 2IPMA 1MX3A 1RYZA 1WHTB 2I6QA 4EDFA 3EXEB 1ZJZA 3IX7A 1E1YA 2HWYA 2HPHA 5FCDA 4JP5A 1VPLA 4RY8A 4GOXA 3UAYA 3C3MA 3KV3O 4K88A 3LRTA 1Z4LA 1W85A 5LKRA 5LU8A 1YACA 1PWHA 1BXGB 2OXEA 5K4GA 5EZYB 2DKFA 1IIBA 5FBQB 4L51A 1J8DA 1OIXA 1WV0A 3RRYA 2C92A 3NC1C 4KFSA 4DCOA 5JFGA 2HDNB 1QGUA 4D42A 4OX9B 4JN6B 3UXYA 1ZR2A 4B34A 4EM6A 4R1QA 4RLHA 1J1ZA 2AOUA 2IDMA 3N70A 4B6PA 2O2SA 1RHUA 4XWYA 1YB2A 2DH6A 5AI4A 1YB1A 3NIFB 2MSDB 2E5FA 4NCAA 5BOSA 1JDBC 1KR2A 3T7JA 3K1AA 2PUTA 3L7LA 421PA 5IJ0A 1QSGA 2NZVG 3TE7A 3CBGA 3PYXA 3SPXA 1L8AA 2IWRA 4N0DA 4UUBA 3RREA 1WF6A 1RQPA 2IYFA 2R3SA 4IS2A 1H1LA 1D4ZA 4OUDA 3JQ7A 5DSZA 3DCYA 4KXXA 2WHEA 1CHDA 3DBHA 3BORA 2XIQA 1TUBB 4OHKA 4E5SA 3D7SA 1N05A 1XTTA 1OAOA 1QKIA 4Q05A 1OHHA 1GT91 3E58A 2EZ8A 4X7RA 2O5EA 2GPAA 1RKBA 3FUWA 1G9TA 3IB3A 5F76A 3B52X 4V1CB 5DASA 1OILA 2QL5A 2VBFA 4J6EA 3V2UA 3FNIA 3VFDA 1ESDA 3ZWKA 1MOQA 3S27A 4B7UA 2PSSA 3VR3D 3W0LB 1MR3F 3WRYC 3HU1A 3SLKA 4LKOA 2I5PO 2DECA 4HLUC 4I5DA 5M04A 3OFNA 1OKKD 3RAJA 1GTRA 1NQOA 1V47A 3NRCA 3ZUGA 3RF7A 2WF6A 3LV8A 5TGTA 5HPYB 2PEYA 5DB4A 5ALQA 3H1TA 1DCTA 3R7AA 3I4CA 3OEEA 1PJ3A 3ORFA 3AH8A 3VAYA 1G5PA 3FSEA 3LDGA 4YP1A 2FFRA 3O74A 4DJ5X 1HI9A 4EG8A 4KRFA 1YNOA 1LPSA 3WIVA 2BFBB 2MYNA 5EMMA 2GDZA 3O2NA 1UJ5A 3ZI0A 2WUEA 3QX7A 2MCFA 4JC8A 4B79A 3VYSB 2L19A 4B40A 1GU1A 4NBSA 4RGYA 2Q3FA 1GL6A 2C04A 2OZLA 3N7UA 1N9GB 4CODB 4M8KA 3QEAZ 1IWPB 2B4TO 3QH4A 4CFYA 3CESA 2R86A 2WKWA 2A84A 3LP5A 4Q48A 4XQEA 4ZV9A 3RM3A 4X66B 2JKYA 2Y1CA 1M8JA 3AUXA 3QEBZ 2XT9A 3CIFA 2OV8A 3ER6A 4GRAA 4F96A 1G3UA 2XEDA 3MCTA 4ZGQB 1ZNXA 4H16A 1JP7A 4JU8A 1RQGA 3EK2A 1JJIA 3IUQA 1NBAA 5IT9A 1W7AA 2ORWA 2GAJA 2EJTA 1BMFA 2CLKB 3D9QX 4QUEA 1SKYE 5EEHA 4GQNA 3RUPA 3RUFA 1VA4A 3UA3A 4HEQA 4DY6A 4URHA 4ZJPA 3SC2B 4YIKA 2O2IA 2PVCA 2DERA 3BRWA 3H97A 1HMYA 2H57A 5CHYA 4EA8A 4HYYA 4LV6A 4IOJA 5EWMB 4Z54A 1KP2A 1QIGA 1ZK4A 1WTAA 4J2TA 1UXHA 1GITA 4PC1A 3JZDA 3ORYA 5B2FA 1N6KA 4C89A 1RYNA 1V5IA 1Q2UA 1BEEA 3E7PA 4ARSA 5IKEA 2IOYA 3RYIB 5B3JC 5IFKA 3M2PA 3H05A 1UFOA 3HXPA 1ZXLA 3WFZA 5HVNA 1LUAA 4M7PA 4RDHA 4PAOA 4U7TB 5DI3B 2G5TA 3EEBA 4MX8A 1C14A 2QI9F 2ZSJA 4BL5A 4DW8A 1TLTA 1FYVA 4R2MA 3HDGA 2QSYA 5FNVA 5ES4B 5KHOC 1PVVA 1JPNA 4AWBA 2A7XA 4ECAA 3TQQA 4Y9TA 5E4JA 3ZWXA 1IJBA 2CCJA 3H5TA 1REQA 1VPEA 4FR2A 4QU5A 4WBXC 1Y4ZA 3V8PA 4MS3A 4AX8A 1R15A 1YGYA 4X1IA 3VU3A 2IA5A 2GJAA 2ZSIA 5IBPA 1XE3A 4Z4TA 1F51E 1UBFA 2J6BA 3KZOA 3T7KA 3ZQJA 1NUUA 5JCJD 3NYQA 4JJ4A 1MHPA 2CGEA 4YONB 2WZDA 3R4VA 5C1IA 3UK2A 4E21A 2GPWA 1NVWQ 2VWPA 4MWOA 2XVMA 3WYEA 1VPVA 2XLCA 2PXXA 2GAFA 3ZH2A 1QF9A 2VT6A 1WKVA 2WWRA 1F2UA 2WJIA 3MG9A 5A7HA 3UK6A 4D46A 3I3OA 2IH5A 1X2EA 1E7RA 1ZCJA 2E89A 2QUBA 4YI5A 4H08A 4D4KA 1OV4A 4DMRA 1R5NA 1HDYA 6NULA 2GN1A 1XPUA 2DBQA 4D9BA 4UVGA 4HWPA 4X24A 4BQSA 4HNAB 4KYUA 1PJZA 4PQRA 3A9VA 3DL2A 2CZCA 3LP8A 2FRVA 4N4AA 4EFKA 3WL4A 3WWYA 1A9RA 3A6ZA 3QUAA 1NJFA 4F3TA 1VZ2A 4G56A 4JOQA 4W5TA 4CG3A 1COWA 1E9FA 5BN4B 1JHXA 1XLVA 3KQLA 2Q1SA 2ZB2A 2FZ4A 4P1VA 2ZUTA 1TK2A 2CMFA 3B3FA 4GX1A 2OL4A 4HSEA 1FVXA 4YXWD 3PICA 3DUFB 1DDOA 3PQ2A 4NZPA 1KJYA 5LYJB 4J75A 5ER6A 5KOJA 2I87A 3E9NA 2PRSA 3ESDA 3HVRA 3VKWA 2ZXIA 2OOKA 4JI1B 4GMFA 1NVKA 1Q15A 3H4MA 3UGKA 4LYDA 4YO8A 4OA5A 3GOQA 1Y7HA 3S1AB 4MW4A 4DR4B 5HZBA 2F9FA 2I3ZA 3CN7A 2ECKA 1JAIA 4F9GA 4YHBA 1GTG1 2ZI9A 4DUYB 1TAHA 3W90A 2CLOB 3VXKA 1EESA 5B12A 2JANA 1ULZA 1A95A 3SOPA 3R3UA 3DQQA 1M66A 5CT6A 1R0XA 2PGNA 5M3BA 3DHVA 2DWPA 1S3FA 4QDZA 3U48A 2GCIA 3DDHA 5H4HA 1NXPA 5TRTA 1U0GA 1YJNB 2VYND 4O4JA 3U3OA 2BFPA 2PRYA 3A9TA 4P3KA 2W70A 1PT8A 3SAJA 4X00A 2XUAA 4CI0B 4K9MA 1X1BA 4YAFA 3B13B 4PGMA 3ZIUA 4EUFA 2I6GA 3AOEC 1UPFA 3IO5A 4M37A 4NFYA 1DRKA 3RD5A 1FP2A 4KIGA 3HR8A 1J90A 4GL4A 4R31A 5A5FA 3USCS 1C8KA 5TMDA 1O96A 1CD5A 4BWFB 3UCEA 4PFSA 1PVDA 3D54D 5GM2A 3LC0A 1FBNA 2WSYB 4NQRA 3C6KA 3WV4A 3K70C 1M5RA 2ZTLA 3PP8A 3GGGA 2E5WA 2H3EA 4HSGA 4O25A 5JZMA 1L1EA 5IAGA 2CNWD 3UHPA 3K0AB 4PLYA 1T10A 2HHHB 1R4MA 4J0EA 3DDSA 2FSVC 3EJ6A 3NKVA 1J0XO 1CCWA 4HWTA 4BNWA 4JQOA 1OYWA 2WUFA 1AGYA 4P3XA 4WKPA 5AHWA 2NTYC 5NULA 4KO3S 2AMVA 3O4FA 3VR6H 1JR6A 3E70C 1V7CA 2BMJA 2ZTGA 4LMRA 3BHJA 4PHHA 3KT6A 2QLFA 5EY5B 1H8ED 4YV1A 2VTBA 3SMVA 4B33A 5LD2C 4NCNA 3CUWA 3NJ8A 3NWJA 1SHLA 1W9HA 1XIVA 3UW1A 5ITWA 4B83A 3TFWA 3GN2A 1E3ZA 5H02A 4QT4A 3C1AA 2IBMA 3FFBA 3A31A 1YZTA 2VT7A 3PX3A 5C3UA 2PWBA 1RJ9B 1T26A 5IYWA 1HDXA 1WDMA 2Z8YA 2GMWA 2RGNC 4JVNA 4GPEA 2GHRA 3RVJA 1GRNA 2Z98A 1D0SA 4FHFA 4NFHA 2NNLD 2ZQ5A 4OTZA 4TLCA 1ZJ6A 5LQKA 1PEYA 2IXDA 3N6XA 2Q50A 1LDGA 2Y1XA 3H1FA 3I4LA 3KLPX 1KPGA 2ISCA 4WFKA 3M5DA 4B3SB 4WOKA 3SM9A 2IX3A 4FJ0A 3K2BA 3JVDA 5A4FS 1OH5A 3MD0A 4QULA 1O9BA 1G3QA 3FKSD 3V7YA 1K75A 2GZ3A 3WBBA 4QTZA 4Y2YA 3H5AA 4GKBA 4R2HA 1R8XA 5ECWA 4NVRA 4CT4B 3O8RA 1NFFA 3EGDB 1THMA 2RAFA 1NF2A 1U0LA 2BFCA 3MBIA 4ZAXA 4DRYA 2X23A 1RE0A 2AOTA 2YMQA 4RNCA 1RYMA 1JDTA 1IEVA 4DM3A 1XRRA 1N57A 4R3WA 5FLYA 3WJ1A 5I9LA 2A9QA 4I2NA 4QL3A 4QOJA 4XQCA 5EOVA 2BR3A 1VJRA 3FTPA 3L7MA 3OTIA 3FVVA 3B6MA 3L7AA 4A0SA 1XF9A 1DRUA 2JFXA 4ND2A 1Q3TA 1ZM2A 2DCUA 2VIIA 4INPA 3O1HB 4NATA 4MRNA 4ZT7A 4B2PA 1GGMA 4AYTA 4UXIA 4CIAA 4XIGS 1NAIA 1QB7A 2C58A 2ZT8A 3TECE 3LNTA 5MGNA 3AHIA 4S2UA 2FDCA 1ILWA 1WMEA 2FFHA 4ZAYA 2VHZA 2WWHA 1XHEA 2CLCX 2EYUA 4EL5A 1D2CA 1F6WA 2HQSA 4UFPA 4KQKA 1C1XB 5BSRA 3P9QA 4H35A 4ENUA 3LKZA 3TLAA 1MQ9A 5J4HA 2NAPA 2H1OA 3HACA 1KDPA 1XQ6A 1BKSB 2JK1A 3N87A 3LIIA 4OYYA 3IQDB 4L5YA 4PIMA 4WA7A 4BQPA 3PENA 4QODA 1W4RA 1JHOA 3E9QA 3EVBA 1TVCA 1I51A 3H8SA 5JAIA 3B6ZA 10MHA 1WBDA 4GBGA 2VOJA 1TLLA 1TMOA 4TWBA 4HEA6 1IHOA 1GXSA 4WAUA 1G8HA 2EKQA 2RI6A 2WVHA 3GWGA 4GH5A 4RA6B 3ZHCA 1Y5MA 3R4CA 5G4KB 5DLPA 4MVYA 2YWRA 5EMHA 2X1LA 4B84A 1IXYA 2YZ2A 4EA9A 1U8AA 4QBHA 4DHEA 1R4NA 2WHQA 5D3KA 3BH6A 3MRSA 3NOXA 5B1HA 4EPRA 1TKRA 4QUKA 3BXHA 4MDHA 3T3DA 1HZJA 1FNSA 1DSSG 4NBVA 4EWLA 1G5FA 1U0HC 2IYZA 5D00A 1S2DA 4HQNA 3DAHA 4KU4A 1VG8A 2FPRA 1KSGA 2HT1A 3TAUA 4D0GA 3CVOA 5K0ZA 2QT0A 4ZALA 5EWLA 1YB5A 2YYZA 5KTRA 3HDVA 2EOAA 2Q28A 2I9PA 2VO1A 2CD9A 4NOLA 3ZXYA 5C5DA 4UQLA 3EX7C 1C9EA 1KF0A 1W0KD 1ZGGA 3PI6A 1BYUA 5FRDA 5TB5A 2EJWA 4C6TB 3CEHA 3NHUA 3LBFA 3E5NA 7MDHA 3TOZA 1PJSA 3T51B 1NKTA 3GPDG 4W82A 3T5TA 3HYSA 3NONA 1Y3CE 1WULS 5FNVF 3KQNA 5FOSA 1GV1A 2AWNA 5CVTA 1BDJA 4A15A 1GCOA 4EKYA 1Q84A 4MCAA 3EAFA 1LTKA 2EKDA 2WAAA 1XHLA 3NP7A 4RORA 4XEHA 2IYWA 3ILXA 4OA8A 5F9FA 3J7AC 4L57A 4XVRA 2ZS8A 4RVNA 1QHSA 1CUBA 3Q72A 1XLWA 4TMYA 3SICE 1CC1S 5HQTA 1D0VA 1G6Q1 1U0JA 3PKIA 1D4AA 3PFIA 1N7IA 2HK6A 4JT2A 3CW2A 4QNNA 3OESA 1Z8DA 4LN1A 4RYDA 2AXEA 1XJWA 3BQNB 5AN9A 1PJ8A 3AR7A 2PH7A 2MSCB 1N34B 2VR1A 5L3QA 3R9XA 2VJMB 3QV1A 1XNRB 2G88A 3OSZA 2ZVJA 5CW1A 2XVZA 1IZ8A 6Q21A 1RXWA 4WZAB 1N8KA 2GVDC 3EMDA 1FVHA 3VH3A 1XTKA 4RVSA 5BP7A 2R6JA 3ZUPA 5JU6A 5JVDA 1MG0A 3BQMB 2ODWA 1S3GA 3HGTA 3QKRA 4M0CA 4KHPB 2JARA 4ZP1A 2OFXA 1DIAA 5FFNA 4FLFA 1SGWA 2IE8A 4CQJA 2ZR8A 3ROZA 3V34A 2AK2A 2WI8A 3LPLA 4G63A 2BFFB 4B73A 4DAEA 5ICMA 1ZGJA 1DXOA 4B8WA 1I4LD 1CUVA 3JWGA 1JEEA 4M8IA 2VNJA 3TW8A 5IM4A 3JQCA 2VHCA 2D5CA 4FOPA 2I8CA 4MDYA 2HWKA 3KLNA 1W46A 1BROA 4JBGA 5HIJA 1G21E 1O8CA 3MS2A 3RUDA 3V97A 1ORIA 1LPAB 1M6YA 2ZDGA 3H5VA 4L5BA 4TTSA 3TMKA 5B1DA 2O8NA 5F4OA 1F17A 1GUYA 2YZ7A 1PSZA 2F43A 2PLNA 1V11B 2YUIA 4FDAA 1ZIDA 5F64A 4DLXA 3SE7A 2E7ZA 4KG7A 4MJ7A 4E5UA 3VSCA 3LTNC 2J9ZB 3E7FA 1V9SA 3KXIA 1KZ7B 3NAGA 1G6KA 5C81A 4OOVA 4U8GA 4BO8A 2DLCX 4XUGB 3HZZA 2AN1A 5ADHA 1WSBA 4CG0A 1P29A 5EXSA 3L2OB 1OY1A 1XOIA 3EEIA 1TGVA 3QKSB 3JASB 1OZHA 2B6NA 3MXTA 5IH7A 1SOUA 1NLZA 4R8KA 4V2IA 5E2AA 4OHYA 1EUZA 1GAEO 2G40A 4I1PA 2IS2A 1CB0A 1XWIA 2ZREA 4AG3A 3ASSA 2G9UA 4QYIA 2VCEA 3C3CA 1L0BA 1NMEA 2CNKA 3RC7A 1GPDG 2BISA 2WKQA 2JF0A 4YELA 4O4JF 4BVAA 1VQLB 1MUUA 3ANSA 4XM1A 3BTSA 4WVFA 4OXYA 2IPLA 3NNDA 2WJVA 4QDKA 1K3UB 3LSTA 4PBRA 5E6SB 1DRWA 2CN1A 3HLYA 4IM7A 4Q3KA 4WLVA 4CEHA 5LVAA 1SUEA 4HRVA 3GMSA 3T0FA 1LLUA 1YR7A 3LC2O 1G17A 2PBLA 1VJCA 2IJGX 3P2OA 3OF2A 2Q7OE 4JHXA 3HJCA 2FZWA 1F4VA 3BMNA 4CR6A 1PR3A 3BE8A 4D26A 1NMZA 3EC7A 3DMTA 4BRSA 4V0QA 3CINA 2BLNA 4DWWA 1OREA 2XZOA 1OMOA 2IXGA 2P2YA 2VJKA 4OG2A 1AM4D 4BQRA 4Z4RA 2BVNA 1K1EA 3VHLB 2PZJA 1QYIA 3C6QA 2WT9A 4MKHA 3WGLA 1BJKA 3W8DA 1IUOA 3BHMA 3H9GA 1YTLA 3QXGA 4DL9A 2X8KA 5JSZA 2C94A 2OPBA 3LYAA 4W1SA 3GUYA 1Z5VA 3WGMA 1Q3KA 1N2JA 5E3JA 1SEPA 1OA0A 2HSEA 4AJHA 4N5DA 3N8GA 1OIWA 1E0SA 1JLSA 4XGKA 1J06A 3PKJA 4PM4A 1PQUA 3NHSA 2VBSA 2AXPA 3AKCA 2HZ7A 1PV4A 3TAXA 3V42A 1Z4QA 3CMMA 1QP8A 1GZ5A 1WS6A 4FXPA 2GJ9A 4AJLA 5GIPE 3HBFA 3TW0A 1MVOA 3PWZA 4JP2A 2DCMA 4L22A 2HV8A 1M0TA 4KMSA 4DWVA 1T3HA 3RBXA 2B82A 1PJ6A 1O77A 3O26A 4NOKA 2P4HX 3MF4A 1LDMA 1Y1QA 4LTNA 4MS1B 4DG5A 3WLSA 4IILA 5ERYA 3INYA 1QNLA 1T9ZA 3ABOB 3OWOA 4Z4YA 1MAVA 1UEXC 5T8KC 1K88A 3PJDA 2H4XA 1RBMA 3V7WA 3U7FB 4BX3A 2OC4A 2VBUA 1DDIA 1XXHE 1T9BA 4EJSC 2A94A 1AMOA 2XMSA 4OSPA 1B8NA 1W44A 3JQ6A 4K6GA 3WKEA 5JNVA 1EVEA 1NRWA 1U0RA 2Y2UA 3T1OA 1ZL0A 2BIFA 2GPBA 4DM4A 4ITVA 4CIYA 4IRMA 2HMSA 4MUXA 3GQBA 3T1QA 5KCZA 1TEVA 2FW1A 1J70A 3JCZA 1JVSA 3O9ZA 4R9SA 3HE3A 3IOEA 2DULA 3LOUA 2BKEA 3ZBUA 1SB8A 4DDTA 1PNRA 2IY7A 3DBLB 3PUKA 5HKBA 5LLDA 2QTRA 4I2VA 1KO4A 1QOPB 4RXMA 3PCRB 3IDZA 2GPNA 1Z2CA 2REBA 4E1VA 3ANLA 1XU9A 1JAZA 4MGZR 2ZYUX 3CP8A 3WAKA 5CM8B 3CS3A 1JFRA 4LRQA 1F2DA 1CFJA 2H5EA 1XD8A 3EXHA 3A1TA 3E2IA 4EUNA 2ZZNA 2HB6A 4K0KB 5EQTA 2WAXA 4UJ5A 4U7FA 2GXQA 3ROKA 4UZUA 1HEYA 4DLNA 2VJJA 4PLTA 4UATA 1T36A 1NW6A 3L49A 4UOZA 4LY3A 4KO8A 2QU8A 4A1OA 2B2CA 2V54A 2W11A 2AA3A 1G63A 1G4UR 4XUEA 1BKYA 1EX7A 2FWIA 3UHJA 3P0RA 4JJGA 4U6QA 4IR7A 3VR5A 1ZOLA 1W35A 4Y6RA 3VSDA 1SN7A 2YY7A 2ZXFA 3PVCA 1E5TA 1Q0QA 2JFBA 5DM4A 4YUVA 1NIJA 2VDRB 3ELYA 1GPBA 3UAZA 1X80B 2VWHA 2PFKA 3INGA 1DOAA 2GZRA 2XGOA 5AKJA 3SKYA 2CJWA 2GKOA 3M3PA 2NUTB 1NWHA 2V7QA 4REOA 1W9MA 3B8HA 1Z0JA 2G72A 4ZTBA 1DO2A 2P77A 5CXQA 2R96A 3GLHB 1C7ZA 1UKYA 1E1NA 2Z2XA 1OXUA 4YR9A 5KS2A 5KTPA 4GYKA 1S1MA 2OM6A 1Y7IA 2P30A 3H04A 2D1RA 3LS2A 3MJCA 4KZPA 1RS0A 4TXJA 2F55A 3P2YA 4L76A 1TPZA 2UYGA 3QKIA 4NCKA 4A73A 2V0CA 4C2UA 1DJMA 3ESXA 4L95C 1VTKA 5AM4A 5EIFA 2D8AA 4Z4CA 4JI3B 1LI5A 3TRFA 2RDMA 4C9BA 3O4VA 1JWAB 3H8WA 4DREA 1CP2A 4O2AA 2R44A 4MB0A 4LUCA 3WLKX 1PLJA 4C4YA 4QIHA 5FWYA 4EVRA 3NORA 4WSOA 3F8WA 1AU9A 3C43A 1M5UA 4ZRMA 2PMCA 3AUAA 2QLJA 3FIJA 3S99A 4UCXA 1EVZA 1FB5A 2XWSA 3ZD7A 3VPDA 2ZZQA 3OLXA 1EX6A 1W0CA 3N39C 4O33A 4Z7OB 2QZPA 3DOHA 3GRVA 1R7RA 3L0SA 3GIRA 3DOEA 4I1SA 3RANA 1QPZA 1E3MA 4AF7A 3UJ8A 4E07A 3C4QA 1QM5A 1RHKA 2XOXA 3LLSA 4JKOA 4KQ9A 5AVZA 1XQXA 3K05A 4ZO7A 1XJQA 1U4SA 2CXTA 5ALRA 2ZROA 3SM3A 3ZWQA 4AULA 5LSAA 1C8VB 4RTRA 4O4HA 4LJ8A 1EXWA 3FBTA 3A2KA 3DFFA 1FJHA 2YZKA 1YZFA 3DDCA 4DLAA 1M73E 2X14A 3I0ZA 2WWVD 2PGXA 4FZ3A 2P3LA 3D0OA 3D6TB 1GRQA 4UDXX 4E1BA 2CXUA 3PRKE 4WDQA 3UMRA 1O89A 5AUNB 1HX7A 3FZQA 1G98A 3W2TA 3D1JA 3IIEA 4H60A 4KUGA 5G0SA 5ECGC 3WG9A 4C6RA 3I1YA 3BK7A 4XA8A 2WDPA 5TSDA 1C0EA 1KWGA 1ZM3A 4J2HA 4KVGA 4OQ4A 1LBQA 4QOEA 1ZKDA 3QWBA 4EHNA 5DOVA 1IRXA 4EP1A 1E79D 1GFWA 1GRCA 1UMCB 2HXGA 5JVDF 1FJ2A 3I83A 2I7TA 5JDIC 1NB9A 1U28A 4ND8A 2X15A 2IYTA 4XYMA 5F4BA 2ZIXA 2V03A 3K1TA 1Z5NA 4KHZA 4OHZA 3WKBA 5IM4F 4LVOA 5C7YA 4DZTA 3PC8A 1KZGB 1UPBA 4E7PA 5IJWA 1Y1RA 2EATA 5DHSA 3SSOA 1EJ2A 2HXSA 2XA9A 5CJ2A 2XCRB 1D07A 4MQEB 1MABA 1JQBA 4C0SA 2CFRA 2SBTA 3CJTA 4B17A 3DOCA 2HNAA 1MNAA 5K8VA 1BCSB 2ATXA 3EGWA 2FEKA 4EHHA 3BFJA 4RF3A 3AVWA 4OM8A 1RMYA 4DPKA 3D4NA 1AQUA 1J8QA 2XY4A 3CZ4A 2A9OA 2ZT7A 1PYOA 2IYAA 2C2ZA 2WIJA 4R1OA 1KNXA 4ARZA 1OW3B 1KEVA 5T3UA 4G1EB 3ZWNA 2C4UA 5IANA 2R6CA 1JR3E 3A35A 1UP4A 3D0KA 7AT1A 3LZDA 1YTUA 2ZRIA 2Z5GA 4QXAA 4RCYA 2CKMA 1NY6A 3ETNA 2HRDA 4MV8A 4DPLA 3E18A 2RSLA 3O8QB 4B0OA 3SHTA 3DEFA 1S7CA 3DHYA 4CZ2A 16PKA 3F74A 4LSWA 5B53A 3QKUA 4XAQA 4L6IA 4ZI5A 4DSUA 1KZ9A 1QRDA 4O4IA 3O9MA 4M7WA 4OI0A 2Q45A 1J0CA 2Z1DA 3IOBA 3B53X 4FMDB 2FN7A 2GNAA 3EGCA 1JS1X 1Y7TA 3W77A 2R0QC 2VJIA 1N6HA 3WK5A 4I50A 2QG6A 5DM2A 5KNCA 2IPAB 1JDVA 1K2WA 3KB1A 1U7UA 1V8ZA 1O94C 3GJZA 1CUCA 4G8DA 4YFYA 4AZSA 5JATA 3N8NA 2ALJA 5HDQA 4BBZA 1U3FA 5CYFA 2QUKA 3Q2IA 2IS6A 5A6SB 4XTCS 3M4ZA 1M8FA 2OORA 4G5OA 4AQDA 4H27A 4JL5A 4WK6A 1T2AA 3DHEA 3N53A 4LWQA 2XVXA 1VHJA 3RVOA 4GYYA 3R3XA 4IQ8A 3CZCA 3B5JA 3FOBA 3WJ7A 3PE6A 3K70D 2BT4A 3STHA 1IHXA 3COJA 4FFPA 1ZL2A 3FUUA 2ZS9A 4LV8B 3G6KA 4EG0A 2P5SA 1NYRA 5EPOA 1DX4A 4IZIA 4EG6A 3DA8A 3V33A 2WJYA 1Z6PA 4D56A 4I81A 3ICQB 1N2CB 2Y1GA 2G9QA 4JV5B 2HQ1A 1ZBQA 2ZRMA 1H69A 3EGOA 3CVXA 3E4DA 4BO7A 1SCKA 3IMEA 4FFWA 3VRHA 3GLGA 3UH0A 5IMBA 4QVGA 5AUQA 1B6SA 4AS1A 3QW2A 1P5FA 2Q6OA 4YALA 1RWBA 4C30A 3ASTA 2FWBA 4HH3C 4WNIA 4E03A 2IHKA 1OWNA 4ZT2A 4M1MA 1RT9A 5GONB 1EWQA 4CV2A 1T0JB 1ECGA 4KE6A 5CGQB 3A4TA 1TCBA 5JZSA 1S8AA 3UVEA 4ARAA 4EITA 3AP2A 4ERXA 2VUTA 2DTEA 4ZXPA 1FUIA 4PYQA 3WJ2A 1WR8A 1XX6A 4UD6A 4HEHA 2H1IA 3LCMA 3NBAA 4ARUA 1CUGA 3BFKA 2CLSA 3U9SA 3V4ZA 3MGCA 2YIJA 1K28D 3AZOA 1SWVA 2CHGA 3GBPA 3WQQA 2OHFA 4MPDA 2DE0X 3CUKA 2VYVD 2CEAA 3CKMA 3OEHD 1XQVA 3DE0X 2XWPA 5LQJA 4WD3A 2XOEA 1ZSNA 1P4RA 2JCVA 3D02A 2LCFA 3BMXA 3KDSE 1SBCA 3Q8WA 3R40A 4RKYA 5BURA 2I8AA 3DBIA 3DZHA 5JQGA 5LP1A 5LB4A 2OVFA 2W90A 4P7FA 5FPKA 4YP0A 3ET4A 3I32A 2QXUA 2GZ2A 4ZT4A 3G17A 4RHFA 4R8LA 4LXTA 3E35A 3TB4A 3TMAA 1O54A 3WNVA 5K01A 4UVDA 1EAYA 3QF4A 4TWIA 4QBIA 3KT0A 1JQKA 2D1SA 2JC3A 2UUOA 5DP2A 1OLUA 2B4RO 3T38A 2HJ9A 2OGTA 4KQIA 3U0VA 1ZMBA 2WD9A 2WYWA 1KL7A 3KG2A 1K0FA 3ONVA 1BYIA 1IDOA 3N05A 1IM5A 2WWWA 2BDTA 3L4EA 4AYWA 4J7AA 3GOHA 3L4SO 1J5PA 1N2GA 3OE4A 4GZ3A 4TKVB 3GLFB 1M1YA 4HZGA 4BLQA 4E15A 3ETCA 3KZMA 4NARA 1ZRNA 2AHOA 4UC0A 3IOMA 5EG5A 4AXXA 4BVKA 4FHEA 1DTEA 2VJNA 2I2WA 4LX8A 3V6MA 4YAUA 4I5IA 3OZAA 1Q1QA 4YCJA 4G0VA 5HEKA 4LW8A 5JUWA 1QIEA 2IDZA 4E12A 1F4LA 2RHMA 3OQ6A 2HEIA 3OQVA 3P9SA 1NBHA 2WNHA 2NVUA 3MW8A 1PS8A 1E62A 2HJHA 3GYBA 2IGBA 2Z2ZA 1I30A 3A7EA 4PAAA 5I9MA 4C0AC 2WYIA 2LUOA 2YVAA 3FJ1A 3RU3A 4ECEA 1TK3A 2PVSA 2QQ0A 3AHHA 1FOEB 2WZBA 1Y8QA 2C2XA 4IDNA 3SG0A 1HDOA 4AUMA 1TX4B 1RFLA 5FO1A 1BFKA 1S3IA 2QE7D 4UCWA 4XOUA 3GNLA 3EPPA 2H1LA 3BD8A 3DXXA 3LPMA 3QVOA 4G4SP 3UTDA 5BR1A 4MRPA 1VHOA 1TJYA 2B37A 2DUUA 1M34B 4OHCA 1EWVA 1AMUA 3UMYA 2V9PA 3I9V1 4AJNA 4E5YA 1FFAA 2HLPA 4KAAA 1FQKA 1R8YA 1LRLA 2EW2A 3PCXA 2PUDA 1B1AA 1ZRSA 5DN6D 2QN6A 3H1PA 2OXTA 4E4TA 2QRUA 1IZ7A 1LZLA 3HVUA 4O2AF 2H1RA 2XOKD 4LGVA 1H0KA 2YFKA 2NNWB 1XZIA 3H2YA 3DDOA 3LUFA 1M6HA 1T2UA 2IHBA 3KJZA 1QMGA 4S05A 3PPIA 1OZGA 1JIUA 4OPVA 1OAAA 3MSXA 4M0FA 2OO5A 1EM6A 2DYIA 3RADC 2B7LA 3I12A 2ZSDA 3HXMA 1P1IA 3OECA 5AJHA 4KBFA 4LBVA 3PC7A 5JT1A 1YJ8A 3CWQA 5HBGA 4QBTA 3WRYA 2DC1A 2J0QA 1GY8A 3IEXA 4RESA 3MILA 2C5HA 1L5NA 2ONJA 3ZU5A 3JYHA 2FW6A 1QOZA 3PWKA 4AECA 5DNEA 5B1EA 1VCIA 1G6HA 2V74B 2WG2A 3B8EA 4J0QA 4O4HF 1I01A 1M10A 2YKGA 4QPDA 3O8DA 3PUHA 4MUKA 4ZGWA 5HK9A 5IWCA 4KDRA 5JYDA 2QN9A 3IV9A 3LM8A 4HPXB 5EJFA 3TBFA 5LA6A 4X1YA 2UVPA 2YHIB 1KS9A 4XMYA 1YL7A 2B8WA 1DQSA 2L42A 1JJAA 3DPSA 1HDIA 2HSZA 3MGBA 5IPFA 5JZOA 5BSGA 1UBTS 2XDWA 2FW0A 1RRPA 5FEUA 2WIKA 1XPOA 1N3YA 1M2JA 4OMDA 5KQGA 2O4CA 3V4OA 2QRHA 1YQDA 1VGVA 3AG6A 1QUFA 2QR5A 3IDFA 4B35A 4DANA 3FPAA 2G09A 2GDJA 4W5HA 2VSYA 4P5EA 4P4GA 1ENYA 2G70A 1Z2NX 2Q1WA 1E6LA 3VH4A 1PG5A 1SURA 2WWGA 3IQHX 2B8NA 1NHWA 4JL6A 2QUJA 3FUVA 5DI9A 3DKPA 2AW3A 1T5OA 4JROA 1EQ2A 1L5FA 1U4OA 1X1DA 2C54A 5AKEA 2QLLA 4IUBS 2WNSA 4O29A 1QYVA 3Q9LA 5K05A 3F4LA 1EFRA 2BDUA 2VC2B 3T35A 1I2ZA 1XEXA 2PZLA 3W5HA 1QH0A 2XKAA 3ZG6A 4JQYA 2CHUA 4AJOA 4BBJA 5LYYA 3RU9A 1DMRA 4ZI7A 4JMLA 1GUDA 7GPBA 2EKPA 2YFYA 1MC4A 1Z4KA 1VDZA 3DR3A 3IEKA 4UUOA 2CJFA 3JZMA 4PRYA 1L4BA 1LS6A 2ZITA 3ZNPA 1BGWA 2I9KA 1L1RA 4QJIA 1AA6A 1N1DA 2MSWA 4B6SA 1J7JA 3ORHA 1BDHA 2ZTSA 4MO2A 4GVXA 4CM4A 3SXUB 1E32A 4ZO6A 3VU9B 3DNMA 2P4SA 3HLTA 3F3KA 1OOEA 1HDEA 4C7KA 1Z35A 2HSJA 4WZTA 3NWEA 3R74A 1YB4A 3C3WA 4O4IF 1HSOA 3H11A 3ZHOA 1FVFA 2JAHA 3T15A 3GB9A 3BWDD 2O20A 3KUXA 4FX5A 5BQOA 3A6KA 3IS3A 1OC2A 3MCVA 5HKKA 4MQLA 4MHSA 2A58A 4NS4A 4I50F 5K0EA 5A0TA 2IXEA 4KXNA 4EW3A 3PEEA 2PUJA 3CPHA 1XZJA 2DUNA 2ZB7A 3HKBA 4HXYA 4U4AA 5BUZA 1G8SA 3DH0A 3GLFA 3FJYA 5JR3A 1ZP6A 2G28A 3F4KA 3L6OO 5BQXA 4D0NA 1KIFA 3K6RA 4XDZA 1OPXA 3AERB 3REQB 3CWZA 5L7WA 1SIUA 2Q9UA 2COEA 2HT6A 2OKGA 3S2ZA 3SOZA 2Q1XA 2QPAA 3KE9A 3AEUB 4ND3A 3R5XA 4FU0A 5CB8A 1VB5A 5K8IA 1F60A 4RU1A 3ZBQA 3N2NA 2ET6A 4TYMA 4HDRA 4BFWA 4B47A 1NDUA 3G02A 3JRWA 3JYQA 4GOOD 3RWOA 1KC3A 4EY5A 3SJCA 2I3DA 2IHYA 2MMCA 1KDTA 2PANA 3WWDA 5BSUA 4EKEA 3Q6QA 2VHVA 3FRIA 1KJIA 4MR8B 1OHHD 4KLZA 5CHEA 3GEGA 1H2AS 4Q4JA 3L0DA 4KODA 2CV1A 2Z8YM 4RL4A 4WXEA 3FNHA 2C9ZA 4WLEA 4JGGA 3VBCA 3I62A 3TQCA 5GY7A 5IUKC 1JKJB 1QHNA 1W0JA 1N2BA 5FX2A 1L3CA 2WP8J 4P84A 1NMSA 2SCUA 4NJEB 4NHOA 1FNCA 4BJ5A 2F8TA 3UJDA 5AOCA 1G2IA 2NXNA 4L8WB 4GZMA 1UKZA 3D3KA 1H1TA 3PEFA 4TL8A 3U4MA 2EHDA 4UASA 3ZI7A 4TMFA 5CR9A 5BT9A 1LC0A 1WM1A 1NZFA 2C7RA 2VSFA 5GV7A 4KAXA 3GBSA 4WNAB 3F71A 1R6VA 1VP9A 3CC8A 3BG5A 4JT8A 4BFUA 3OEED 4MQ4A 4DLTA 2EU8A 5DBFA 1V8PA 1JG6A 1YC5A 1HG1A 4ZYWA 2W42A 1MB4A 2MHCA 2ZBFA 1BEUB 5DNAA 4OKSA 3CNOA 3R8CA 4KTVE 3OWXA 1WW2A 2GO1A 4V1CI 1V8FA 2HSWA 3N86A 4MLCA 3W4IA 4CLOB 5JQGF 3OQPA 4TXMA 3COYA 4PYJA 5FO0A 3H6GA 3HB7A 5A62A 1TO1E 1GZUA 3A9WA 1XQBA 1Y8RB 2Q5IA 1QCDA 1NBEA 1P2SA 2D3TA 3AEQA 3F7NA 3GMDA 5DSXA 3R09A 4A03A 2NAFA 5DE3A 3G0OA 4X7CA 1U3CA 5IHXA 4N41A 1HTTA 2R8PA 3C8ZA 1U8CB 1RYDA 2Z09A 1Y1LA 3GEPA 2N47A 3KB2A 3QEJA 4J3JA 5G0UA 3Q0IA 1AN9A 1ZOPA 5JC8A 2E18A 1BMQA 5DYIA 1BO6A 5GADl 4XORA 3UT6A 2CDRA 4AUEA 3R24A 3KHUA 4TWAA 1V7ZA 2HPVA 2EBWA 3BRWD 3Q5DA 4CM9A 4LJKA 3WA7A 1MAWA 4YAGA 5J59A 1VFNA 2JASA 3SMQA 2Q5JA 5GPBA 3GLIE 4DA9A 2PMFA 2QORA 3EQ9A 4URYR 5KX5A 5CH5A 3HGQA 4OFXA 5DNYB 2IQ5A 1RSZA 4Y30A 2DETA 1L8LA 3IVMA 1T9DA 3Q0TA 5BNZA 3EXIA 4HXFB 4KQ2A 5BQ5A 1CZHA 1LJLA 1VIDA 3MHPA 2PR7A 2ZJAA 3EFOA 1X0VA 4FI3F 5K8LA 3CEPB 3Q7PA 4HDQB 4KQMA 4ZC1A 1ZINA 1MC1A 3QEMA 1IAVA 3WKDA 3EH2A 3OCJA 4UVIA 3Q5EA 1R8QA 1KVQA 1RPAA 4OV6B 3D6NB 4CIXA 4FM9A 4JITA 2ZQYA 1YNSA 1X15A 4BKQA 1IPEA 3ABQB 5CBPB 4PG7A 5AR1A 2FMTA 3A6PC 4ZOLB 3LQFA 3UHAA 3TEJA 4FW8A 5K0LA 1BA3A 2WJGA 1PUJA 3I5AA 3JQPA 2WIGA 2NV4A 5E6RA 2F8MA 2P1RA 2LWIA 4J43A 3SKBA 2B1JA 3CEMA 1AMNA 4RWZA 1CY1A 3SXJA 4YAEA 1W30A 3ANTA 3NKFA 3T41A 4LPKA 3FW1A 2FHSA 1QH1A 4HGPA 1ZRHA 3E9MA 1KXZA 1PCXA 1PNVA 2JGNA 4R1SA 5AFSA 5CXUA 1R5JA 3MT9A 4K2AA 4Y0VA 1E9DA 4BFVA 3TLEA 4Q9LA 2VCHA 2XSZD 4OI4A 3GJRA 1Y1PA 3V9AA 3FJOA 3W6NA 3LUKA 3NIGB 4PG8A 2G1JA 3RCBA 1T3GA 3GGPA 3O03A 4S1WA 1W52X 1E3EA 4AYXA 5KYYB 1VHDA 2XNSA 5K6AA 3C98A 2ILTA 4ZTUB 5TF4A 3TPCA 1A9XA 5E2IA 3U7QA 1GTJ1 2QTAA 3VV3A 5KNDA 2HCJB 4FFBA 5E6TA 1IH8A 3SLGA 4E33A 5A9TA 1COWD 3MJHA 3OQNA 3PEUA 4JODA 5DMXA 1KDRA 1RPZA 2XBMA 3WLRA 2C2WA 2CV2A 2XNDA 1PZFA 1SVUA 3PDIA 3MHTA 2WIDA 2J3JA 4X45A 4ZVQA 5I7AA 3L7NA 4NU8X 2C57A 5LA6F 4EHIA 1GTMA 4XPIB 2EQBA 2FX5A 1Z68A 3IE1A 1JWLA 3P96A 3TIVA 4Z7NB 3OFKA 4FUQA 3VZQA 4B7AA 4GI2A 2B7BA 1IPFA 3LOPA 3MTIA 4KRGA 1K92A 1KO5A 1Q92A 3HUUA 1QYXA 2V5AA 2CDBA 2OAEA 3DCIA 3OT5A 5L7TA 3IUYA 1TMKA 2WFMA 4MUFA 1A9ZA 2F1OA 1LH0A 1AXRA 2HYDA 2WE8A 2VJAA 1UD5A 3B51X 4ROSA 2EWMA 4XYBA 3NUQA 3ER9A 3GX1A 1E1QD 4K9RA 3F6SA 3K7EA 1Q7CA 5KTSA 3ND6A 3IBCA 3O94A 1WXEA 5KYTA 1PFYA 2KW5A 4OP3A 2IBTA 2YXDA 3Q3AA 3LLUA 3RWMB 5MN5A 2RCYA 1QIIA 3OCVA 1U04A 4BNFA 1FNDA 1YA6A 4RJLA 4W5NA 3A26A 1JQJC 5DX1A 4LNUA 3TLGB 3HYLA 3KE8A 3SF8A 3ZCSA 2DWCA 4TN1A 3A4VA 4GC5A 4TQ9A 1XCMA 4G0QA 3R3SA 4HADA 4YJ3A 4LJAA 4ZQIA 5EESA 5K20A 3T3PB 4ZI7F 3ZEIA 3EISA 4MS4A 5KNLA 2REQB 1L4MA 4A23A 4JOSA 3M70A 4PAWA 4UOQA 4YDRA 3AV3A 3UJCA 4BNDB 2HTFA 1N75A 1UC4B 3CQ9A 3GSIA 4IIJA 3LCCA 2QZSA 1GKYA 1KMQA 3IBYA 3HKEA 5E7MA 4DMLA 1UUFA 5ECDA 3HBJA 3RJTA 4YYEA 5JEEA 4QUZA 1P2VA 2CYAA 3PITA 3ESYA 4KXMA 4C5AA 3LNNA 4DV3B 1LGYA 2I33A 2C5LA 4HWKA 4XM2A 3NV9A 1YLOA 2CF4A 2B4QA 3F5DA 3A1EA 1VKJA 1EDDA 2NIPA 3G9XA 3H6HA 3R7FA 1PZEA 4BVLA 1JEQB 4AVYA 2Z57A 2IEYA 5A4IS 3VHRA 4WJKB 2MOKA 2PMWB 4GEGA 3SZMA 5TMPA 2C4MA 4KJZA 1YKFA 1GYPA 2XCQA 1NPTO 4YAOA 3R6JA 2HJVA 4MV5A 3CUUA 3HJBA 3RSQA 5JG7A 4BO1A 1EM8A 3L1VA 1NPDA 3DE5X 3RI3A 5IF3A 5M5BA 1SU7A 3U9TA 2IX9A 4ALMA 3AVQA 1UK8A 3ONUA 3GIDA 4BO6A 5J3JA 1RC8A 2ENWA 2PQ0A 2HHAA 2AJ8A 3KPUA 3L7KA 4C87A 1VMIA 1YHYA 1Y8AA 4EGQA 2ZJ7A 3KQKA 5ALUA 3MT0A 1PT7A 3K1JA 1O94D 1PQPA 5HOQA 2Q21A 2W2MA 3FVWA 4KR6A 1CIPA 1OFIA 4PABA 2WTEA 3C6XA 1S3SA 2ZJ6A 1T9AA 1JNXX 3WL3A 3LE8A 1WOPA 2GFHA 4M1SA 5F7XA 5TPWB 3EVZA 3EDMA 3PNPA 1K6IA 3IO3A 2CWWA 1HVXA 4QVAA 1ZVQA 1KFCB 4RSHA 1PFWA 3CZAA 3GUHA 4KXWA 1JV2B 3TRIA 4DPMA 3MWFA 5A9SA 4HNHA 3CCUB 1B8VA 2OFWA 4LVUA 4ZHQA 8OHMA 1JHDA 3R0VA 1V96A 2IPNA 3AT1A 3P26A 3EY9A 4TKUA 4ZA2A 3OHSX 3ZGNA 4RKWA 5SYMA 2ID4A 2P2NA 2WWFA 4TV9B 3QVSA 2W0SA 3AETA 3LFUA 3RYFB 4IVRA 3U44A 4ABYA 1CR6A 4C3UA 6REQA 5CM9C 1J42A 2KX7A 2GI4A 1K6EA 2O0HA 2Z83A 2JBAB 4RAOA 2BP7A 4FINA 1M90D 1Q19A 3MWKA 1TTQB 1YC2A 2GAIA 1JMVA 2OCKA 4IGAA 4MB6A 1K3TA 2O1SA 3GO4A 4DDHA 1Z6ZA 3OW2B 2GEBA 2PGAA 4MCIA 4P25A 4TYQA 3JQAD 3K6JA 4TS4A 4W7SA 3S6JA 4P22A 4F5DA 2H7CA 1NOKA 2QJFA 3KU1A 3IP1A 1Q17A 5CGZA 2RHCA 1QTNA 5L3RA 4KUHA 1DT3A 3PBKA 5DHFA 3KOMA 3L41A 2CFCA 4HUQB 4QUHA 2WC1A 4P54A 1QB8A 1BLIA 2O05A 4WH0A 2XGGA 1V0FA 2EERA 5K3CA 4U7WA 1HUQA 1IJEA 1C4WA 1Y3HA 3JAKB 4J16A 2A4MA 1ECCA 1Z0AA 3AEKA 1Z4OA 3AMVA 4W1PA 3MMPA 5ECYA 3WTBA 5CFNA 4TRRA 5BSTA 4I99A 1DBQA 3PA6A 4KOEC 2RJOA 2QN3A 2D8MA 4UNPA 1GWNA 3DMRA 5JFTA 3KDAA 1XEWY 4X8IA 2FPPA 4KX3A 5KU7A 2FEAA 5IDQA 4Z5XA 1T5BA 5AIAA 3EBOA 3KXKA 1MB2A 1X38A 4CEIB 1BCRB 2JDID 5DZSA 4TL9A 5I51A 1VL5A 1RM0A 2LVBA 1FUEA 1Z18A 4IX9A 1R0YA 2OZVA 1TZKA 4G37A 4KR3A 4ER0A 2PKEA 4MKZA 2B4YA 4IOLA 5E95A 3SIWA 4AY2A 2ZRGA 3F78A 5KX5F 3DXYA 1CJMA 2J0UB 1N8TA 3RG2A 2AEFA 2I6SA 1N8SA 4KGVA 3R1IA 1BWRA 1FDOA 1USVA 5J2UA 1FJGB 4PE5B 2EKBA 1JRLA 2XMBA 4KRYA 4AZ3A 1XL0A 4U2DA 1WCYA 4G5FA 4URWR 5CFMA 4IIFA 1ECJA 4RNDB 4ZOBA 4NZNA 4EB6A 2AFHA 4MRVA 1ORHA 1E92A 1OX4A 3DYIA 4LHWA 4Y18A 5CITA 4KR9A 2XE6A 2LW7A 2HOQA 4JUAA 3E8MA 5IYNA 2A14A 3T3MB 5F7ZA 2GH1A 4EW1A 1NW8A 3FWPA 4TTVA 4UVEA 3ZHBA 3KZVA 3J80A 3RS7A 5I9BA 3D8NA 4F91B 1DCKA 4G6IA 2NVOA 3F47A 3ZHQA 4Z7QB 3AJ8A 2D00A 1LPOA 4H2DA 2DR0A 3HXKA 2VNIA 3KUCA 3G5AA 5D86A 2A9PA 3BL6A 3IEUA 4HATA 4F3RA 1OB0A 2HO5A 1JVNA 2DTXA 4POOA 1ODLA 2K4MA 1YVDA 3IHTA 3OA0A 5KHLB 3WGKA 2CK3A 2C7BA 4PNHA 4ZYVA 1TD9A 3WWEA 3OPNA 4BAGA 1U80A 3VSEA 2ZCJA 3OI7A 2PPLA 1Z4NA 2RHLA 3M6MD 4OXRA 2RHOA 4EDHA 3BJEA 5A88A 3HABA 2E4VA 1Q0ZA 4AFNA 3LRXA 2H16A 3R77A 5LU9A 3J81k 2BF7A 3OZWA 1QIKA 5AM1A 1Z63A 2FFAA 4ZQFA 1L7EA 1U9IC 2X1MA 2X0JA 3QX9A 4OP1A 1SA0B 2DF8A 2JBWA 3T0GA 2WMNB 1W8DA 2DOGA 2Q0HA 3E20A 4NSNA 5EMKA 4AXBA 4BY9E 3PC3A 1OLSB 2YZMA 2LCQA 4EHFA 5JYEA 3W5DA 2Z58A 4AJPA 4NEGA 3TLJA 2YMLA 4ER5A 4KQ6A 1YZHA 1GQSA 1F4PA 1CS0A 4UE6A 1E9EA 5B5SA 4Y2UA 5IAOA 2A78A 2GR9A 2FPOA 2GVZC 2D1FA 3W5VA 1RADA 2ZSUA 1ZLXA 3N0TA 1VLHA 3ZOZA 3K9FC 4AY6A 1LBEA 3C8UA 1NXOA 2W2VA 1NI3A 3QLVA 4MV3A 3L1UA 3LBNA 3IPRA 1AA9A 2OP0A 3BPSA 1BIFA 3R6DA 1X7ZA 2ZRPA 4BFTA 3GEHA 3NT4A 3UWDA 4DNXA 6YASA 3BWEA 2QW8A 3F5SA 1C2TA 3M8KA 1D1QA 1NONA 3GG9A 3QPDA 1H8HA 4URVR 3CVWA 1NI4B 3WMXA 4MA0A 4HWRA 3BE6A 4TLBA 1XEAA 1NJSA 2HHCA 2PX5A 3SN6A 5FJIA 5I3CA 5IMSA 1A5SB 2ORYA 4AWAA 1E0KA 4HX9A 2UVDA 3WL5A 4F4FA 1WXHA 3DZ8A 3L1IA 5TT0A 5JC1A 1J9EA 4TVBA 1D7AA 3FB1A 3ROPA 2QUZA 4YJ3F 3VTZA 3UJ6A 1OLXB 3T9FA 3IL2A 4V3BA 3D3NA 3N2LA 4QTUB 3AR4A 3IDAA 3LT2A 3WAJA 2B1QA 2CF6A 1C5KA 3U4CA 2RG7A 1YJAA 3FGOA 3IQXA 4NCXA 2CE2X 5C46F 3N7AA 1Z47A 2H18A 4K05A 3U37A 3RIGA 3ZGZA 1XNHA 2J09A 3FAZA 3IOCA 4IIJF 4AW9A 5A0VA 4I3GA 4MUAA 1AS2A 1SD5A 4GVPA 4ENSA 3VO1A 2GASA 4QGHA 3C3AA 4LBWA 4Z3DA 2WUGA 2QUHA 3WDMA 1T4DA 1S2OA 1DXHA 3KZKA 5TQVA 4L6AA 1H42A 5EUBA 4A8PA 5CLJA 4O1IA 4GD3Q 4RX1A 3NTQA 5GGXA 1HEUA 4XX0B 3WWPA 1E0JA 2EFHB 4BX8A 3DTVD 2ZIEA 5JE8A 3NBXX 4F2PA 3MIIA 1DQPA 2VEDA 4D3SA 4F60A 4N40A 3BFXA 1TAUA 5CB6A 4FE3A 1LVHA 3P1JA 3K2QA 2NU8B 1S72B 3RYHB 1LSUA 3OIDA 3O3OB 2YV5A 4NBUA 2RE8A 1VP3A 4YQEA 4BNJA 2HRQA 4MDEA 3A05A 2I2CA 3S5JA 2D5BA 2OQVA 1M6NA 1OWLA 3GLRA 3MT8A 4DNOA 1QJCA 5I7UA 3OQHA 5LXTA 4RF2A 2GLUA 3QE9Y 1KZHA 1CP3A 3AVUA 4L3VA 5ETJA 3TW4A 2OHIA 3GDHA 1T8WA 5EMLA 1WCWA 4BFSA 4TYWA 1Z34A 1JA0A 1P5HA 1RCUA 3WBFA 1NOJA 2Z1MA 1VG9B 4KXVA 1LVUA 5HX7A 1VL8A 2Z95A 3LSYA 3U61B 5LBUA 2PUBA 2FZ5A 4IIEA 5I01A 1W36B 4PCLA 2O2XA 1BGVA 2PV7A 3NTUA 3U80A 4IUDS 4GEKA 1XRJA 4REMA 4ZHQF 4XDGA 2C3UA 4UAUA 3PQCA 2FVYA 3BCDA 3RS8A 1XJ5A 4CNQA 5CM2Z 4F4JA 3O3NB 1E3SA 3WGJA 3TQFA 1J22A 4F2WA 4L7VA 4OQDA 3KUUA 2IT1A 3VPSA 3DZBA 3GLGE 1XPJA 3B5EA 4X95A 2IDJA 1ADYA 3UWPA 2LKCA 3WXBA 2ZBPA 2BGWA 4AL4A 3KWFA 1YI0A 2XQIA 4FFMA 5U4XA 1J0DA 1Y4AE 4R9UC 5GP1A 2GA8A 1TJ4A 1Y42X 1GKIA 1GVHA 3NALA 1HT3A 1J8VA 3OZFA 4D8XA 2G1UA 3MMNA 5LOVB 1O4WA 3VTFA 4I4TB 3OUZA 3G8BA 2IYYA 1P0FA 4LWPA 1YR1A 3OX1A 1RLTA 2ISSD 2J5RA 1C9MA 4HN2A 1HE3A 3AVVA 1G8PA 4BMNA 1GQRA 2XDYA 1NL3A 2WABA 2ZK7A 1DT5A 2P2DA 4Q7KA 5BXYA 1EUYA 4O2BA 1HXHA 1QNFA 1K3FA 1UP6A 1V5WA 4JDUA 1ODIA 1Q6ZA 1IATA 3HYRA 4J94A 3VR2A 3F97A 2XMGA 3FCUB 5EHIA 1R9MA 2RAPA 1BHO1 2VPTA 5ENDA 1TNDA 2E1PA 3GBVA 4JLVA 2YR0A 2GWHA 1L7RA 4I66A 4Q4LA 2P5UA 3Q8MA 3TG8A 4N5MA 1LNSA 3NWBA 3OIGA 4URXR 4DNFA 4PZ0A 3D7RA 1ZN9A 4QAQA 2CMHA 1TB4A 2P5YA 2V7QD 1N78A 2Z4SA 4LZOA 2HCFA 2A5FA 1GKKA 2PGIA 3BF7A 4LKRA 4DMMA 1FA9A 1CJTC 2GZHA 3I9MA 2CLDX 1H6CA 3AWDA 1FC0A 3CF2A 1G20A 3C3XA 4RMGA 1II8A 4ZEOA 1EHIA 1Q74A 1GL7A 3AI7A 3ZBPA 1M1YE 5TS3A 5EJ4A 2AE2A 4YEDA 5THQA 3N2KB 4IWXA 4GMKA 1WSAA 4R16A 5EAIA 4L75A 3VQTA 3JVVA 3LA8A 4OGKA 1YRHA 3O5AA 1U9ZA 2P4UA 3LQKA 1Y5RA 5A9RA 3IVGA 2OMEA 1W2WB 3L79A 3HM2A 4KDFA 4ATNA 3LQRA 2IXTA 2XNHA 4FYYA 1N1MA 1ZKMA 2A1UB 1Z62A 2H5JA 5LMZA 1TUIA 4C7OA 1I2DA 2ZWPA 2ZBDA 3QVVA 4HVLA 1MNQA 4ROXA 2C7OA 3L7IA 3O0TA 2YYAA 1DE0A 2BM8A 3HADA 1QC5B 3HSYA 2A6PA 3QBJA 5ULLA 1H65A 1ONNA 2KLBA 2OB1A 4I1IA 4O08A 5DNWA 2WAYA 4CMJA 1PDWA 5FKJA 3ZCQA 4AS2A 4OL9A 3CRRA 1DUSA 2BEVB 3NEAA 2GKSA 3LCJA 2JLSA 2BTQA 4DS3A 4E0BA 2XB6A 4G86A 3M2TA 4Y2VA 5JPIA 3OZSA 4TN5A 4A7PA 2JLYA 3ZE9A 2TS1A 2REXB 2FLWA 1QGED 3OLCX 3R6WA 2IGTA 5A0FA 4D3FA 4EPTA 1ZI9A 1CZKA 4N0PA 2XB2A 1FPMA 3KQWA 3U3MA 4J4TA 3UUGA 4F2GA 3LXXA 3X1DA 4G9BA 4KYTA 1MA3A 5CVVA 2FP4B 4OLAA 5ALLA 4CM8A 5F2KA 1JQDA 2NUPA 1LRKA 3K3PA 5I5GA 3ZDEA 2QZJA 1W5TA 2ID9A 3ZE2B 1A1VA 4H77A 1DV1A 2R6HA 1N6RA 4ZK2A 5C3MA 3KKZA 1BDMA 2WA2A 4JB8A 1Y6RA 5AK5A 2FPGB 2CB9A 2UU9B 3HV2A 4FNGA 4HNGA 5CDFA 1LWOA 5DULA 3VI3B 2O8DA 1V3QE 1JEYA 3IXMA 1TLFA 2QSZA 3CXUA 4QWMA 2HHJA 3AG5A 4BX9A 5FI3A 4PVDA 3IAFA 5HS6A 4E5MA 1FCJA 2B5VA 4C04A 2OMKA 4EHLA 4A0GA 3GGCA 4FGWA 2HA4A 3GLIB 1W8IA 5KTMA 3WGHA 3IODA 5HRCA 4LHZA 4GUAA 2FI1A 1Z38A 3L04A 3MOIA 3AHFA 3IAM1 1GEGA 4IG9A 2HJGA 1EUDB 1TO6A 1PJLA 4OOFA 3REOA 1XQ9A 3IBGA 4L50A 2PUFA 3CA8A 2NT4A 3BGOS 2OYCA 1O8BA 2CSXA 5H8WA 1EXNA 5J5AA 2M1ZA 2VKQA 4ZU6X 1DOHA 2PAAA 3MWDB 4JKIA 4F56A 1VLOA 1A5ZA 1FPQA 2BEUB 5FR2A 4L4ZA 1Q21A 4Q82A 5IARA 1NA5A 2MMGA 2O0KA 4UBOA 5D87A 5COBA 1JJ2B 3D0QA 2WM3A 1RJFA 2QN2A 2IYOA 3FLAA 3OKCA 3EG9A 2R48A 5DPMA 4L07A 4C1NA 2R8OA 4YRZA 4KKXB 3BTOA 3FSRA 2GK3A 3A27A 3SYNA 3W7BA 5JD6A 3DTNA 2JIMA 2I2BA 4N1AA 5LN1A 1YQUA 3MXOA 3Q41A 4F06A 1Z8NA 3VPCA 5KNCD 2HTEA 2OE2A 4PZYA 1XMJA 3ID6C 3HYNA 1T6BY 4KQGA 4JXZA 2H0AA 4NBWA 1BXGA 3QPUA 4B46A 5F9MA 1HNZB 4WXHA 2QX9A 3FE2A 2PBZA 3HY6A 4LC0A 4IV5A 3WLIA 1MXHA