4EH1A

Crystal structure of the flavohem-like-fad/nad binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
237
structure length
237
Chain Sequence
RDGRTFVVREKQVESAYVTSFVLVPADGGAVLDYQPGQYIGIEVTPEGSDYREIRQYSLSHASNGREYRISVKREGVGSDNPGLVSHYLHNNVKVGDSVKLYAPAGDFFYVERERPVVLISAGVGATPMQAILHTLAKQNKSGVTYLYACNSAKEHTFAQETAQLIAQQGWMQQVWYRDESADDVLQGEMQLAELILPIEDGDFYLCGPIGFMQYVVKQLLALGVDKARIHYEVFGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavohemoprotein
publication title Crystal Structure of the Flavohem-like-FAD/NAD Binding Domain of Nitric Oxide Dioxygenase from Vibrio cholerae O1 biovar El Tor
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
total genus 78
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 1.14.12.17: Nitric oxide dioxygenase.
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4eh1A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4eh1A02
5HXBA 3W2GA 4C0SA 4EH1A 1QVFB 3W5HA 3U2QA 2BGJA 2VZLA 4RD3A 2OK7A 1IJFA 1TVCA 4RCYA 3MMPA 1KQSB 2GQFA 1Q82D 1ZM3A 4FWTA 1AMOA 3MHPA 3CCSB 1K8AD 3OZUA 1FNCA 5EMNA 3CC2B 1H42A 1CNFA 4BPRA 1KK1A 1DARA 5H5JA 2EIXA 4NCNA 1D1NA 3CMAB 2X3UA 2C78A 2BGIA 1GO2A 2QN6A 1EP2B 3VNUA 2BMWA 1JNYA 1VQ4B 1ZM9A 3JQRA 3WBKA 4AF7A 3QFSA 4YAWA 2AHOA 4YAOA 1OB2A 2OTJB 5THXA 3P26A 3WNDA 3WXMA 2NPFA 1F20A 1KJZA 1VQPB 3AVUA 4H9GA 4UAJA 4Y9RA 3VMFA 5FA6A 1QG0A 2VNHA 3AVWA 3WYAA 3ZZUA 4RD0A 2YWFA 1VQMB 1N0VC 3CCLB 1QX4A 3I55B 3AVTA 1NDHA 1W2BB 1FNBA 1AIPA 1FNDA 3VO1A 3AGQA 1KRHA 3G4SB 1YIJB 4U9UA 4ZCIA 3G6EB 3LYUA 3JQQA 1G7RA 1JA0A 4B43A 4MYUA 3WY9A 2HDNB 2HCJB 3B82A 3CC7B 4N3GA 1VQ6B 5TY0A 2XNJA 2YWHA 4Q7JB 1VQ5B 3FPKA 1KD1D 4B48A 4LBYA 1G7CA 4ZV4A 2QEXB 3CMEB 4YHBA 2D74A 4DQLA 1G7SA 3AGPA 4IW3B 1QFZA 1YJ9B 1JA1A 2DCUA 1ELOA 4TMTA 4Y7CA 1VQOB 1JJ2B 4B3XA 4AC9A 1U2RA 1R5NA 1UMKA 4FN5A 4QFMA 3VO2A 1QGAA 2DEUA 2B5OA 2YWEA 1Q81D 2BPOA 4P3YA 4PC6A 5AN9A 4B44A 4G1VA 3W5VA 4YAFA 1TLLA 5H59A 2CNDA 1YHQB 1KK0A 3J81k 3MCAA 4RD4A 5TV2A 1K9MD 5KSWB 1XE1A 4ZCLA 1VQNB 4LBVA 1W34A 3CPWB 2PMDA 1QVGB 3W5UA 1B23P 3QFTA 4PGOA 4PC2A 1E62A 5GV8A 1FNMA 3JQPA 3AVVA 2QTZA 3CB4A 1KK3A 1QH0A 4YAUA 4QHYA 1YJNB 2DY1A 1EFTA 4C43A 1W87A 3P27A 3CCRB 2CRVA 4M0LA 1ZM2A 1M90D 4Y9UA 2FX3A 2ZITA 1BJKA 3W2IA 2PIAA 3SJZA 3CW2A 1D2EA 3CCQB 1R5BA 3ZZTA 2R6HA 1JB9A 2GPJA 1Q86D 3QFCA 1HA3A 4G1BA 1FRNA 1OGJA 3ZBUA 3AVXA 2E1RA 3LRXA 3CCMB 2J7KA 3I56B 1G7TA 5JBQA 1OB5A 3QFRA 1CNEA 4RD6A 3E20A 3CCEB 4MYTA 4TN1A 3ZC3A 1EWYA 2OTLB 1DDGA 1GVHA 2XNCA 2YWGA 2DETA 4TMWA 3WNCA 4K1XA 1S0UA 2VNIA 3QE2A 3FJOA 3OW2B 1WDTA 3OJWA 1VQ8B 4RD1A 4ZGNB 2HMAA 1VQ9B 1DG1G 4NBSA 1N0UA 4PC1A 1GAWA 2BSAA 2BN4A 3LVBA 4B4DA 1TUIA 1Q7YD 4DQKA 1K73D 3QSYA 4LBZA 1GR1A 3CC4B 1DDIA 2QDXA 1ZM4A 1N8RD 1EFUA 1D8TA 1KTVA 2RC6A 1GAQA 4G5GA 4ZCMA 5TR9A 3B78A 4PC7A 2BM1A 3WBJA 1J9ZA 3A1FA 1E63A 3ZZ0A 1NJID 4N3NA 3OZVA 1B2RA 4B47A 4LBWA 3CXCB 5GV7A 2BV3A 2PLFA 4J0QA 1BX1A 4M4SA 3W2EA 3CCVB 1F60A 1SM4A 1H85A 2DERA 1FRQA 3U6KA 1KC8D 3I1FA 4RCZA 1YI2B 4P6VF 1EP1B 3ES9A 1QGYA 1TTTA 2BM0A 4R71A 3AVYA 4F7DA 1ZUNB 2C77A 1M1KD 1W35A 1QFYA 1QUFA 4TMZA 1BX0A 1S72B 1EXMA 2B7CA 2B7BA 1YJWB 4YALA 3CCJB 2QTLA 1R5OA 1BQEA 2BF4A 2VNKA 3OJXA 4RJLA 1EFCA 4LC0A 3E1YE 3CCUB 1VQKB 1EP3B 5DSZA 1GJRA 1VQ7B 1SKQA 4FK8A 2EFGA 3LO8A 2VYQA 1XB2A 3WNBA 3ZBTA 3OZWA 1QFJA 3W2FA 4ACBA 4WQMA 3CD6B 2QMUA 3W2HA 2BVNA 1OGIA 4M1KA 1VQLB 2VNJA 1FDRA 4HE5A 2OK8A 2RC5A 1A8PA 3VNVA 3V76A 4M2LA 4AF6A 1KK2A 1QGZA 4TMXA 1I7PA 1IB0A 3B8HA 1E64A 3CRZA 4TMVA 4ZGQB 3G71B 3U6BA 2QA4B 1IJEA 1CQXA 1QUEA 3PENA 4RD2A 4ACAA 4M53A 2XEXA 4PC3A 4HE6A 1YITB
chains in the Genus database with same CATH superfamily
4WINA 2OTCA 3R3WA 4ND5A 4XOUA 1Q7EA 5C18A 1BVHA 4FGLA 2A1IA 2J41A 4OB6A 1RS0A 1Z63A 1E1CB 4IGKA 2WA1A 3KT3A 3MQ4A 4S35A 4B31A 4EDHA 2R68A 4G5YA 1BWRA 3LCMA 5DMXA 2DQ4A 3R0ZA 1OLSA 2E4XA 2DKNA 3HRHA 4MRSA 1SCIA 1W88B 4Y18A 2NU8B 4YR9A 5JASA 5KX5A 2FVXA 2GAOA 2A9QA 2Q1UA 2XH8A 2PDAA 3PDCA 1B2LA 3WGZA 1LW7A 1N2GA 5JNRA 1ZM3A 1X7WB 3FPHA 1SZDA 3LK6A 4BE9A 2J4FA 3FVRA 4M0EA 4KYVA 3T56B 1V43A 2JIQA 3NBFA 2OHGA 5EMNA 4NBVA 4OPOA 5EESA 1NULA 4WOBA 1SVIA 1PU2A 2I2AA 4P3IA 3QHQA 3DC7A 4XLFA 2PSJA 3OO1A 3RRNA 2F6RA 4Q3DA 1NV9A 3AR6A 3PDWA 1NRWA 4RFLA 2J7PA 4XVHA 3DCJA 2FNAA 1KK1A 3GPBA 1A76A 1TZ2A 1ATZA 4JA0A 4XOTA 1Y3FE 2YMLA 4FT4A 5P8WA 5EMKA 4LSZA 3PQDA 1LV7A 1H69A 1PJTA 5EIWA 4P7BA 5TPWA 2YMPA 2GBLA 1C4KA 3F5SA 3GF4A 2C2XA 2OBLA 2I55A 4M9CA 4XX0B 4YLEA 5EAIA 5HEKA 2W2KA 1TX4B 2QHXA 3PR3A 3T9AA 4EHLA 2BGIA 2EF1A 3L0YA 2V1XA 4II3A 2YWJA 2JHFA 4EJ6A 4R2XA 2BMWA 4QAJA 1ZFNA 2FEWB 1RIIA 1XG5A 1W25A 3F98A 1NLUA 1X94A 2EL9A 4X3OA 5TF0A 4DOMA 3Q3EA 4UVDA 4GLBA 2MSWA 2PX4A 2VT2A 2DLCX 5HZAA 4EHFA 2V03A 1BS2A 2XYVA 4D3ZA 3Q8LA 1FX0B 3FB1A 4PBRA 3QITA 1YI8A 3RV4A 1P4JA 5CTAA 4WDQA 3CPHA 4EUEA 3IQWA 3OFKA 1BEUB 4QXRA 4ZALA 1QU3A 1RYYA 1G291 1RHJA 2A0WA 2VJDA 3KD2A 5AK0A 4IVRA 2HLDD 2PL9A 1WHTA 2WU4A 2C97A 1JMYA 4N9QA 4NP6A 2AVDA 4J0EA 4CM9D 1BDJA 4A5SA 4DB2A 4XWGA 3R24A 1Y5IA 4URHA 4IVPA 2AJLI 3BNWA 1NF2A 2DBVO 3HXLA 3PNVA 2WWVD 4ZZ1A 3CLHA 2I5PO 4Q3EA 2I87A 3GZNB 3GRPA 4P0QB 3HS3A 2QI9F 1VRCA 1TCAA 1VJRA 2AIRA 4CN9A 5H3CA 2WU1A 3AR4A 5KTMA 2FEPA 2JGJA 3AVTA 5JMTA 1U6JA 3SOPA 3V4PB 1O6GA 4QREA 3TIFA 2ZJBA 2FFJA 3LVFO 5FBWB 1YJXA 4KC0A 5IHPA 1WLYA 3T3NA 1WKBA 3FNHA 3IIEA 4C4PA 3R77A 2G36A 4F5DA 4FGSA 1L1RA 3BXZA 3KRTA 2I7DA 5DI3B 4F1KA 3QLJA 3TB4A 3UJ6A 3SE7A 4RPIA 4W8HA 3O9VA 4CLOA 4J1NA 4ZAXA 2VTBB 5GQSA 2XWQA 3T51B 3AR2A 1GTRA 2HXSA 5HMLA 3WGUA 2G9NA 2G28A 3CPXA 4DNFA 1I3CA 1NNLA 1B73A 5AKYA 2Z3VA 5ES3A 4MIYA 2BSQA 1R9GA 3DBRA 3TKLA 4AKTA 4YMTA 4DADA 2XPCA 4OXKA 3WV5A 5FCDA 2ZQYA 4K9KA 1EVJA 2OZLB 2Y68A 3GG2A 3LC2O 3TVYA 4BX3A 1RCTE 3C8HA 2PN1A 3PT5A 4EUHA 4QG3A 2C7QA 3A9VA 1DI0A 4G67A 1U7ZA 5EXDA 4J6FA 1MJGA 3MINA 4UU0A 1BTOA 1NN1A 1L5YA 1Y1QA 2ZYAA 5CD9A 5HF8A 2FFQA 1EUDA 3DXXA 3DE6X 3RABA 4QM6A 4XEHA 4LBYA 2VDLB 2AOXA 1V8OA 2O4CA 1IHMA 1SXJD 1YDHA 1XP5A 4OBEA 4X63A 1K6JA 1T25A 4GT1A 2FZKA 4YCAA 5AKGA 3STUA 3TKYA 3X1YA 2VRCD 3AGPA 3PJFA 4FCTA 2DFKB 2I1VB 1BE1A 4LZPA 3U49A 1T0JB 1QP0A 4A8PA 2QGGA 1BDMA 1NBMA 2CUTA 2ZYHA 3CR3C 2QUKA 3EIXA 1HE3A 1U65A 1L5HA 4LXXA 1UBRS 1CY2A 3ZWNA 1BCSA 4D5GA 4DIMA 1WG8A 3OZBA 1NXWA 2YHBA 4RHFA 3OEEA 2L0XA 1M8JA 4YTEA 5AK3A 1B0UA 4WH0A 1DPGA 2QENA 4RXMA 5L6MB 2PKQP 4NR0A 1U9JA 3EK2A 2EGHA 3DQZA 2JJ2A 1DC5A 2QRMA 3FIJA 1QMPA 3T5CA 1E8NA 5U9CA 2PA3A 4IR7A 1GEEA 4R8SA 3TAHA 4DILA 3GIRA 3ZQ4A 4EZIA 1I2AA 1TYAE 5I7RA 1L7XA 1Z62A 3DW1X 2FPIB 1UZMA 4FEYA 3QUAA 1J2YA 3PV0A 4FOSA 2HF9A 1GLVA 4EB8A 4DLVA 4MUXA 2D5AA 2IPLA 2WSYB 3LT0A 3O9MA 4OXQA 3ZHTA 2YN4A 1ODIA 1T2EA 1J21A 1MB9A 1ZN7A 4FB5A 5LIPA 2NUPA 3QF4A 4R1TA 3DAGA 4C2BA 3HSYA 4DK0A 3QYAA 1E79D 2AFHB 2BMVA 5LLDA 4EVIA 3KOYA 4PPQA 4JI3B 5KC9A 3QMVA 4YP5A 3BXHA 3Q4GA 4B09A 1RYBA 5HFNA 1FDVA 1VQNB 5EIHA 1G2IA 2NZ8A 5F12A 4AUEA 4L51A 1W34A 1T8YA 4TS1A 3P9YA 4RM3A 3RNOA 1J8VA 1Z0ZA 3SMVA 3GRYA 1XA3A 2RI0A 4NJMA 3ED1A 5JWHA 3TLAA 4M0UA 1N6HA 1XQXA 3BWXA 4JYPA 3F46A 3IUNA 2FUCA 1SBYA 2F8TA 4A2QA 1FFDA 1JW9B 1CLEA 1SQGA 3D2BA 3EXG1 5AJVB 4DZTA 2O52A 5ES4B 5ICGA 3K2IA 1PQYA 3B5JA 3VU1A 2O1SA 5A0VA 3O1IC 4H7IA 1VE5A 2XCIA 1C8BA 1LJLA 3NASA 2CHGA 2MYPA 4G1UC 4HGRA 4MROA 3U0VA 5HTOA 2ZIVB 1Z9BA 2I2CA 1SGWA 1GZ6A 2HF2A 4EPXA 4XSVA 4JFRA 4NATA 2J33A 2QNIA 1AF4A 3CE9A 3LJKA 2MYUA 4PYMA 1I3NA 5ELMA 2F90A 1T0HB 1GSIA 4KIGA 3ILYA 3QBTA 3NU1A 5CB4A 4PXAA 4R8RA 1Y3IA 4G8CA 5LSAA 2WTUA 1LPOA 1M73E 2EX1A 4FMBB 1R6AA 4RMGA 1E2MA 3LBAA 4HGPA 5C46F 5CAEA 4FMCF 3C45A 1NBAA 4RJIA 4QIHA 1GGHA 4M1OA 2RGGA 2PWYA 3AY0A 4MPPA 2HOQA 2Y9PB 4MTCA 4MUIA 4PQRA 4C6SA 5EXEA 2J6BA 2ODPA 1JB9A 1ZN8A 3TIGA 5DI9A 1CE8A 3DT8A 1C1DB 2C7GA 5ABPA 3LZ6A 3IUJA 1ORTA 1U7DA 1VLYA 2JCYA 3OPXA 2WPDD 5G2OA 2E4WA 3NBYC 2WWIA 3TG2A 1O6BA 2C92A 1CQJA 2JGAA 1O0BA 1LW6E 2BIFA 3P9QA 4HS9A 5JBQA 1CULC 4K6CA 3MWDA 4KVGA 1Y33E 4L22A 4TV9B 3TQTA 1XZCA 3QXJA 1T3GA 3CM0A 5BYJA 1Y9JA 1XJCA 3NV7A 1SUWA 4OJKA 5AESA 2QAGB 3DFFA 1E0JA 3GNLA 3P0RA 3LT4A 4NHEA 2XNCA 4WXEA 5HKLA 2O2IA 1V96A 1Z4IA 2AI2A 2I8LA 1FQJA 2WVJA 1I33A 2DETA 1LY1A 4IQ0A 3TZBA 3OQ6A 3DULA 1YE5A 3H4MA 1JB1A 1CR2A 3Q2IA 4L0CA 5CCXA 4DR6B 1GFSA 2JIBA 1AS0A 1YQWA 2D0IA 1KEVA 2PLWA 1OYWA 1VMIA 3BJIC 3F4LA 4J16A 4Q05A 4DCUA 4HDNB 3OWOA 4CTJA 3V8RA 3QI7A 4IAOA 4Q1VA 4OF4A 1E2KA 1LDNA 3KOWA 4WERA 1EUQA 1FMJA 1RACA 3RBAA 2M6LA 4CFYA 1Q7GA 1AS2A 4LX0A 3F7OA 4CDMA 4OATA 5B12A 1PR5A 1V9CA 1WMEA 4F85A 3ZXUB 4RJ2A 2ZXFA 3AI2A 4OEHA 5B7QA 3IALA 1WDTA 1P4GA 2LPMA 4R41A 2WAYA 5CHYA 1M1YE 1CUZA 2XWBF 3FLBA 2E2WA 1KU0A 1KAMA 1N5LA 2N1BA 3LGAA 1N6PA 5IDQA 5JXWA 3KYDB 2A2ZA 2P2LA 3ZWAA 4NBSA 1IJBA 3M8KA 2Z30A 4EF4A 4R1NA 1UBSB 1VI5A 2ECFA 5JS1A 1YWGO 4WKPA 1F0NA 3TUIC 3LHKA 1L7OA 3WZLA 2GK3A 3Q5EA 5EJ6A 4AJ2A 2P3LA 1NWCA 2ZSAA 4IDCA 4TT8A 4TX1A 2AZXA 4OXNA 3U7QB 6ABPA 1W581 2QDXA 1DJNA 5DISB 3WGOA 5IH7A 4MVYA 4H6PA 2E4AA 2W11A 4X20B 5PNTA 3H0KA 1GG2A 3SF8A 3H0EA 1J0CA 2FLKA 4XNFA 1KTVA 1NQWA 1KYVA 1T5IA 1UJ6A 3O1HB 3VX3A 2P9FA 2FWMX 2ZSJA 2MIIA 4UARA 3VOTA 5LP6B 5WRFA 1L5KA 1QS0B 4JLKA 1Z7BA 1NPTO 1XKXA 3CEJA 3T7JA 2ZKIA 2FRDA 3ECCA 3PNYA 4J0CA 2AH5A 3S8MA 3L4JA 1Q83A 3ILVA 1C4OA 3VMMA 4EI2A 2RD2A 2OAGA 5LBTA 4X7FA 2Q27A 2G1AA 3HVHA 2W8BA 1UFVA 2CE2X 1FU8A 2NYVA 4GLLA 1JG7A 4X1IA 5CGZA 3I72A 2ZL5A 1XZ8A 2ZJ3A 5E6RA 5H83A 5J40A 2IDKA 2DQZA 3UB2A 3WQRA 5IYZB 2O5EA 1XTKA 1V3UA 2EKDA 5FTJA 3WLPA 2FUEA 1WU7A 1E6EA 2GF0A 3M6IA 3NT5A 1ZI9A 5AIBA 2OCBA 1DUVG 4F96A 2WPNA 2FEOA 1R9NA 1V7CA 3ONDA 1TTQB 2PT9A 4G26A 1VJCA 2F1MA 3KEWA 3EGDA 2CLSA 3F67A 1PGOA 2V4ZA 1MR3F 1Y8AA 2ZI6A 3N6RA 1IWOA 2ZROA 1XN1A 1NVMB 1OI3A 4W6QA 3WWYA 2PLAA 3IEPA 3BQJA 1UBFA 2WTXA 4QO8A 5KX5F 4UD2A 3V4FA 4DLKA 1HEYA 2VTDA 3FHCB 4IUDS 3TD2A 4Q9IA 2CF6A 4Q4JA 4GMGA 2W42A 1RNLA 1N1GA 1VGVA 2HA3A 1CUVA 5TQ2A 3UBMA 5LFAA 3W9UA 3UW3A 1JSCA 3RHFA 3E9ZA 5LUBA 1D1TA 2JK1A 1E9EA 2WZBA 2B0JA 4M9SA 4HHEA 1Q0UA 1OX6A 3HEMA 4N49A 1KI3A 3QEJA 4JNKA 2C2BA 1VHLA 4D46A 2ATCA 2F1IA 3NTXA 5DM0A 1PD1A 4OG2A 3UOAB 1QZXA 4D81A 3HN6A 2CYCA 2YN0A 5FLEX 1CXZA 3AHGA 3K6SA 5JSZB 2GJPA 4B4VA 4TL7A 5CA0B 5EZ5A 1Z0AA 2VJAA 4FOLA 1QNLA 3GP8A 1YGYA 1I4TD 1M67A 2HLDA 1MB2A 1N25A 1ZD4A 2QUBA 3DMYA 3MJSA 4NHOA 9ABPA 2Q3FA 2WUVA 4TTRA 3E2PA 5K3BA 4CM9A 2NNLD 4BOYA 1RHQA 2G1KA 1KR2A 2BFEA 3DDHA 4EBFA 2QTLA 5KYVA 4RC9A 4PQYA 5I9LA 1EVKA 1ZJWA 1JS1X 1XYYA 2NYAA 2ZATA 3LY9A 3RREA 2NSDA 4ZCPA 1CX9B 2ZRFA 5H9VA 2Q6TA 3WA6A 1JL3A 3OJXA 1I9CA 5DX1A 5C4GB 1YRBA 4BNYA 1P2DA 1MTOA 1HURA 4V0KA 3COSA 1LDEA 1TXGA 3E9RA 1KO1A 1P1IA 5LOVB 1EP3B 1E7WA 4ZCTA 3GJYA 2GK6A 3CXRA 2FRDC 1B74A 3LPCA 4TLEA 3SZRA 3GELA 3FYCA 3GCXA 1BEEA 1UBJS 1VBNA 1M7GA 3CZRA 3T34A 4UM5A 3DKVA 3SLKA 3EJWA 4EUNA 3N58A 2IYSA 4KX3A 1U7PA 5FA5A 3UVEA 2FMUA 1IBLB 4ZCRA 3QVGA 2R97A 5KVCA 3L0SA 5E6SB 2XQIA 2PH5A 1KJWA 4JB0A 4LZZA 3FCUB 3GLQA 4ZXFA 3ODGA 4D3YA 3UMCA 2YTZA 4PPNA 1QH1A 3R6GA 5DYTA 4ZHQA 5LQKA 3AJAA 3SNHA 4DZZA 5IHXA 2IP1A 3B8EA 3R5JA 4IMJB 4P80A 2X1MA 4B3BA 5HM8A 2A9JA 2BVNA 1I24A 3H5RA 1P1KA 2YKGA 4HWRA 4KUGA 2GHRA 3BMOA 5DNDA 2VNJA 2DBQA 2HI0A 3FRIA 4N41A 3IIJA 2Q4OA 4C9BA 5AM0A 2REOA 3DUFB 1YB7A 3FTDA 3L1UA 1SBHA 3E70C 4GI3A 5IKOA 3IPRA 5DK4A 1HOXA 3DLAA 4QGSA 1A8PA 1WRBA 1RKUA 5GOZA 1L4KA 1YULA 4Z4WA 2AX3A 2P9BA 4XD7D 2RJOA 4DJJA 2OSVA 2P9HA 3V8QA 4X1OA 1ML3A 1I7PA 3E15A 4L8LA 3CN7A 4B4KA 1GSOA 5EYPB 1SXJA 2Y3IA 3DCIA 1N2CB 5GOTA 3VRHA 2VRCA 3WMWA 4GMXA 4HZGA 2XUHA 3IFSA 1NL3A 3G59A 4FFSA 4L8YA 4N01A 4LUCA 5IH3A 4F12A 1NU8A 3I12A 3OUZA 3L8ZA 2B9VA 3IV9A 3THWA 1S8FA 2B8EA 3HXPA 2BFWA 4HFJA 4HFNA 5FPHA 3S2YA 4BO9A 2CNWA 4CTMA 3A70A 3HEBA 1WVMA 1H6AA 3IVRA 3V8EA 1UC4B 4YRLA 2NIPA 2REQA 4NU5A 2H1WA 6CHYA 2FMTA 3MRTA 2PZFA 4BKMA 3L79A 3TQOA 4K03A 2OD9A 2QE6A 4XORA 3HVKA 1H93A 3BDIA 4R0NA 4JQCA 5G0WA 3RFVA 3F8SA 2ZRIA 4CGYA 3W5HA 1JRLA 4MA0A 4LE0A 2L19A 2R85A 2VZLA 1L5SA 2B21A 2ZIUB 3EFOA 4E13A 1JBQA 1XA0A 2PNJA 5F5LA 2FGKA 5FOWA 3L0OA 1Z83A 5F78A 1JSLA 4CKEB 2B1IA 5GGYA 4XDHA 5F2OA 4NJEB 1U8YA 3TCXB 2WU3A 1I7DA 1K28D 3MHPA 1HLFA 1H05A 1O96A 3AESA 3F9RA 4N5DA 3ZWXA 1H1LB 3NORA 2GO1A 1RR6A 1P5ZB 1P2UA 1YQUA 2HLNA 3H16A 3NIFB 1Z2OX 3ZHQA 1R4NA 1YZKA 4DM3A 1SU4A 2NVWA 4N12A 3V46A 5HKAA 5T3YA 4CQLA 1HE1C 1UDWA 4BQSA 1Z2NX 4IXTA 4F9EA 2FSGA 2OSBA 4UM7A 4R1PA 3UUEA 2OXRA 3H97A 4BASA 3V6LA 4D5EA 1A77A 2IYLD 3N2IA 3L46A 1E5QA 3NKLA 4QICA 2JKVA 4FFRA 4P82A 3UMYA 2X6QA 3CMAB 1NSTA 1PZMA 5I9IA 1SA0A 3MAAC 1KE1A 4AIIA 4Z51A 2I80A 3NHAA 4UU7A 2DPYA 3A6EA 4JOCA 3W6OA 1OBVA 1UPTA 4R81A 4CTOA 3LBYA 1QZZA 1ZM9A 2HBYA 3E2MA 2QMOA 4XTCS 4ZYUA 1EJ0A 1Y6GA 2L17A 2YV4A 1L5GB 4P3PA 3MLBA 3YASA 5BVHB 4MV1A 1BCRA 1TTHA 4PXYA 3V1UA 3JRWA 4ENUA 2D13A 1CUUA 1GNSA 4ATNA 1SXJC 5JCOA 1OB0A 1DC8A 4ZIRA 1SVSA 2P1RA 3SJCA 1T5LA 4RDCA 2WVHA 4C06A 3LXMA 4JVSB 3TR5A 5H7XA 4Q7MB 4RACA 5FKJA 3ZE7A 3G5LA 1BMTA 5KYNA 1EEXB 2F17A 3G5AA 4PYLA 2GN1A 2A3NA 1GADO 3I76A 4GGPA 2GJKA 1QGED 1Y5NA 1W59A 3D3WA 3SX2A 3RG2A 2NO6A 1RFGE 1TMKA 1Q9SA 1LPSA 1NT4A 4ND6A 3SIPA 3GT4A 3T9DA 1KYXA 2BFCB 1JMVA 3EA4A 3NUZA 3LNCA 2WPDA 4R5MA 4RVUA 4XB1A 1R88A 3MWLA 4M36A 3AX6A 3CUSA 3CWQA 5KYYB 4DIFA 1UXKA 4G6IA 1JWLA 3ZD8A 4HLDA 2Z43A 1PR6A 4X7PA 5KSZA 1FNBA 1VXRA 4IWNA 3SS8A 1S2LA 1ZGCA 1G8MA 3LQ6A 3H1BA 3KAJA 3ROGA 5FI5A 4BWGA 4WESB 4XIJA 1J5PA 3GFSA 4I4TF 1VDZA 3ASTA 3KKEA 4KQ9A 5FFNA 3G0IA 3G0BA 1GTSA 3P2OA 1C4XA 2WTAA 4KPGA 1K5PA 2ZJ7A 3CONA 1YE3A 3DTVB 3MQ2A 5TF4A 3NJRA 3CZCA 4BXOA 4G7XA 1SQSA 3TE7A 4RH3A 4C76A 3AP1A 5JFOA 3EY9A 4DRXB 1OBOA 1GFZA 4RE6A 5BV0A 3C1OA 3PE6A 4GI5A 1PNVA 5DX0A 3EWAA 5IK2A 1QWOA 3OPYB 1F6WA 4HB3A 2V4DA 4NMHA 2VYND 1PFKA 3P94A 3CRMA 2D1TA 4I2NA 5IP5A 2X6WA 2QRQA 4QUKA 3ZS8A 5KU1A 3UAZA 5A5DA 1IN7A 1G9TA 2YYSA 1YXMA 3JWEA 3KD3A 4EFMA 4BMVA 1BHQ1 5LU8A 2POQX 2JIOA 2HIGA 4D96A 4F4HA 2WU0A 4C6TA 4LSWA 2C3YA 3TX6A 1VQ5B 2HYIC 5JRDS 5CGQB 4V3BA 5DYIA 4PX2A 3ZHXA 2ALJA 5DNAA 3EZFA 2VPIA 1SK9A 1BDIA 1FFEA 2BLLA 2P6MA 1RQNA 1TEXA 2X2FA 3MYRA 3NIGB 4KQGA 5L4SA 3OCCA 3CMEB 1YH3A 2XMSA 3NEPX 3QHAA 4AD8A 3ZDAA 2DT5A 1KDTA 1R27A 1JQAA 4KXYA 3N2GB 4WE3A 5FWDA 3ETNA 5L7TA 4OAPA 1BD4A 1XAIA 3QW2A 4AMVA 3GLIA 1Y6FA 4X8IA 2PX2A 2OE2A 4TMTA 1IHUA 1NOKA 1ZESA 4I6GA 4MJ3A 3RVRA 3RBXA 2D1QA 3T12A 1JU4A 1TLTA 4JJZA 4M1SA 4DBVO 5BNWA 2GZAA 1WDLA 1FB5A 1G19A 1Y63A 4OYRA 5FNVF 4CKCA 4EMUA 4A6XA 3KTDA 1MO2A 1M2GA 4J4TA 1S8OA 1SJ9A 3UHAA 4AUMA 2MDTA 1T1SA 1YBVA 5ALUA 4G0NA 5D84A 4DWJA 1D0SA 3I1YA 1EFHA 4UUNA 2FYTA 5BSGA 1PJBA 2M5SA 2B9EA 1FJXA 2Y0CA 4P3YA 5AVKA 3WGLA 2HA2A 4WFIA 5KIAA 4FMDB 1FDOA 2HJRA 2IOYA 5JDIA 3NHFA 3EVNA 3Q0EA 2H4YA 1UP4A 1V5WA 5C8YA 4AJPA 2V7BA 2IYFA 1ZRHA 3BGSA 2A0FA 2QP4A 4YUWA 4X61A 3KLPX 1CYEA 1UFQA 4HH3C 4D6XA 1GUBA 3EC2A 5CVJA 2YRFA 4YFYA 5IAKA 5K4AA 3RTCA 5J2TB 1UDXA 4KJZA 3FZGA 4ZKEA 1JIVA 3O93A 4I81A 3SQLA 4CCSA 5T57A 2OHXA 1KIFA 1HR0B 2RONA 4H17A 4DANA 4BHTA 3NW9A 1L5VA 2OHVA 2XKKA 1OHHD 1WW8A 5H9WA 4C7MA 4PGOA 2HEGA 2XOKD 4IOKA 1FQKA 4MVCA 4HB4A 2C9CA 2QM7A 3DDNA 3S1LA 1X7YA 2QMHA 1JR3D 3EE6A 3OE5A 1UD4A 1VF7A 1HWYA 1UBLS 1YMQA 4NYMR 2ZIGA 2Q21A 4YXWD 2H2DA 2ZZQA 3EH2A 3T52A 3VPGA 1WHSB 2QM0A 5F9MA 3ZWDA 4YHHB 4TL9A 2BAGA 4Y30A 2ZRKA 4Y98A 5GAJA 1MIOA 1UZUA 1ODJA 3THYA 2VCYA 4I55A 3ETLA 2CHEA 1K8YB 5KQLA 2DY1A 2JKYA 1ICEA 1CFJA 5EJEA 1G3MA 5A71A 2JAQA 4GXQA 1RMTA 2M9MA 3HN7A 4RMHA 4PX3A 4Z9XA 2IUUA 1H2WA 1ORWA 5EMLA 5LB4A 3PXEA 4A9AA 4RTSA 4WLFA 4BYMA 5SICE 4M0LA 3CF4G 4MH0R 4CQNA 2F4NA 3ODPA 3K8ZA 2F4VB 2R87A 2RHGB 1LVGA 4G4SP 5CH8A 1P1HA 2DUWA 1U98A 3B2QA 3TLCA 2O07A 3HRIA 4L8JA 1O5TA 1ZXLA 2X3YA 3KDSE 4B34A 1P0IA 4B33A 1R5BA 3SC2A 2C5AA 3IQIX 2C1ZA 1JLLB 2P4QA 3BH6A 2XT6A 4Q9JA 4Q66C 4WI1A 2GERA 3GPLA 3F73A 4DAOA 2Q0XA 5L7WA 3ZVNA 1Y3BE 4U7PB 1OYOA 2YIVX 4WWVA 4YMWA 2I4LA 4DJAA 3LWBA 1SKYE 2KPOA 3CF6R 4QWWA 5FV4A 2J7KA 2BRUC 1JAXA 3FGPA 4R9SA 2C00A 5KCMA 3UMSA 2OUKA 3NJ8A 4HRXA 4B79A 3IKMB 3SLGA 5CCEA 2ZSBA 1PZXA 1QHHB 1NATA 3DE7X 3MB5A 5M5BA 1EM6A 2Q46A 2ZE7A 3DE0X 5AVRA 2VAXA 3ZQKA 4FILA 1ZA2A 4JV5B 3M3HA 1GVHA 2J3LA 2YVUA 1C9JA 2DPXA 3BZBA 4GUDA 2FF7A 4MR8B 4YLGA 4CM8A 3ZIDA 2VJPA 3C3XA 3IVXA 2Z8YM 5LR6A 5KYUB 1I7QB 2VJNA 1LVHA 1QIMA 2XTAA 4YLYA 1LLUA 1ZH8A 4ZRDA 3W5AA 4YI3A 5LP1A 3CUEF 4UDYX 4ARBA 3PLNA 4UAGA 2VWPA 4IIGA 2WM2A 3D2LA 4PR3A 2YS7A 4PHGA 1DAKA 4XUCA 1SVLA 4G0MA 1BO6A 3UA3A 2B6NA 3AUKA 4QBHA 2F3UA 2HHJA 2HCFA 3GGCA 2Z6BD 1I36A 3CX3A 1CUYA 3MJHA 3HZOA 2AWNA 2CJFA 5K0SA 4I1UA 4UULA 1KMQA 2XWSA 4XD7A 2OQVA 3G5TA 3X1KA 1MA0A 3BXOA 3LWDA 4ZT4A 1R5JA 5KHLB 4G0QA 2F7SA 3PL1A 1YSCA 2W58A 4LPSA 4UPVA 2GN2A 4ZHQF 1N0UA 4B17A 2H08A 3Q87B 3LQ4A 5ECDA 5BN3B 4W5QA 3RAJA 2VHWA 2UVPA 1NHGA 2ZUCA 3LVBA 2QY6A 3PDHA 4HQLA 4MR9A 4X1YB 5HE9A 3WRXA 1Q7YD 1QIHA 4DQKA 2QR3A 3I4CA 5KQGA 3T06B 1HYEA 3A4IA 5KKAA 3TEMA 4AKSA 1OMOA 2HK8A 5FBQB 1D1SA 2V4UA 1TEZA 1EZZA 3JQAD 3ZHOA 2GJ9A 3EMBA 4KXMA 4UJ3A 3TW6A 4RSGA 2AKAB 2AMFA 4L50A 4DSZA 5J4KA 3AETB 2CVFA 4JBGA 3L9WA 3K0SA 2CXNA 1ZLYA 1SPBS 4BNXA 1ARZA 4QNNA 2IWHA 3BXGA 4MRRA 4BV8A 2I7CA 1MEJA 4H08A 3F9CA 1HNXB 1FJ2A 3AM3A 3R6KA 2IUTA 4EJ0A 5LQRA 3JU4A 1U3VA 2AJBA 4CN8A 2DR2A 1EAYA 4F4FA 3L1VA 4ZZ0A 1U3FA 4DG5A 5C1BA 3J7AC 2PQ2A 4J49A 3ZWMA 1NJID 3OZVA 4FZ5A 4MQEB 5D3MB 4DQXA 1WV1A 3ZV3A 5KQPA 1LH0A 4G24A 3DLHA 2PT6A 1KRXA 2XCTB 5IUJC 5BWBA 1PSZA 2WAOA 4G65A 3ZGOA 5K0JA 1GTG1 5TPZD 5GV7A 1REQB 3ONFA 4YA6A 4RKRA 1K2VN 2Q99A 5MN5A 3WSVA 1B8PA 1T8PA 2W8ZA 2DUNA 4YMVA 2WSMA 2J87A 1XEXB 1TTPB 4XLEA 4E88A 5JSKA 5IAAA 4LF4B 1HG1A 1Z4PX 4EY6A 1U5AA 2M1ZA 3DL7A 3REQA 4WKOA 4PNEA 2O20A 2QTCA 3E7PA 4ITRC 4BKPA 5ECWA 1TE2A 4UTPA 3KUCA 1J49A 1N2BA 3W9BA 1PIWA 5B4TA 2I1LA 3I1FA 2D9RA 2CYAA 3BEOA 3HYSA 3CPJB 1DOHA 1FJGB 4ARCA 1DADA 5IJXA 1TTTA 1V4NA 2YJGA 3DWFA 1E1CA 4IMRA 4MYRA 5JE8A 5B3AA 3BJMA 3LL4A 5YASA 4X8HA 4EECA 4BNZA 4Q39A 3UQZA 4D4JA 1ZCZA 3Q6NA 1HM5A 4KDFA 2NU8A 1W88A 5KNBA 2HQ1A 1P7PA 2J85A 4Z7OB 2C0QA 1Q3HA 4NYIR 1ULZA 3F90A 4HYYA 1EVQA 1X7WA 1H2RS 2Q5QA 1QP8A 1CUXA 4UQPA 4DV7B 1VKOA 4P25A 1E4YA 4I08A 3QVVA 4WY5A 1S72B 3JPWA 1V16B 1ZH0A 4OV6B 4DEYA 4GX2A 1I0IA 2YICA 3WRXC 4J0GA 2BI4A 3D5QA 1L7NA 4LRSB 4RY8A 2PMEA 3A3GA 2VUTA 3GDOA 1EGVB 4JP1A 5KOYA 3E4DA 3HJNA 4MLPA 1RPAA 4NTZA 3HL0A 4B5LA 2HRZA 3KQNA 1YFJA 4YALA 3CCJB 1CTQA 2N9UA 2O0HA 1AZLA 3SLRA 3OLWA 4RPHA 4YRJA 5F51A 3NM5A 1R0SA 1MKYA 1OLXB 4CM7A 4DARA 4DGQA 1QHNA 5CUQA 3LPDA 2VSOA 1JR4A 4XX0A 1QH9A 1QNFA 3ASPA 2GQ0A 2CL5A 5E1OA 3LECA 3ASVA 4G0PA 2AN5A 4GHWA 4XFDA 3U1VA 1OV6A 4H7EA 5CLLA 3O73A 4AX8A 3L82B 4V2UA 5DSZA 1WEKA 1EFVB 2H9AA 2OWEA 2G5PA 4Z1OA 4HX2A 2H0AA 3LBHA 4HQFA 4PIMA 1WP6A 2F1HA 3U26A 4YRZA 1JG2A 2N1MA 3QU4A 5A9TA 2QEQA 3D6VA 1J4AA 3HNRA 3D3NA 3P9CA 1ZONA 2F8LA 5KB3A 2EVWX 4MO9A 4JK3A 4TXNA 5FOXA 4B75A 2FN7A 3PGXA 4EYGA 5ICMA 2R2GA 3H5TA 1FX0A 1MXHA 2F64A 1GRCA 2J3KA 4QE3A 1THTA 3KQUA 2XD4A 2YDXA 3TFWA 3BCFA 2FY8A 3AHEA 3HFSA 2ZTSA 3KO8A 1DCTA 2XB2A 2IHJA 2GCIA 1N6KA 4C0XA 4DSNA 1RBMA 1H23A 3IT0A 1MCZA 1F6DA 1MAWA 3ANXA 1INLA 1LU9A 1NQVA 2DWPA 4RY2A 1EAMA 2M6KA 2C58A 3E8SA 3M6WA 4RK4A 4ZCQA 5JZOA 2JEYA 2R4UA 3B53X 3GZNA 3KJFA 1T4GA 5KDOA 1FFCA 2EKQA 4KE9A 5DMHA 4U0JA 5FI3A 2QTFA 4DKXA 4XLTA 4JLBA 2O3JA 4FCCA 3D7KA 4R8MA 5EIAA 1IB0A 3B8HA 2TSYB 2XVYA 1P0PA 4YK7A 1WCWA 1OBFO 4ZV7A 1E2IA 2HAEA 2QXTA 1JLKA 3H2YA 4J0IA 5DI3A 5T8KA 4JNCA 4C2AA 2V0NA 5G4LA 3BSYA 2ONJA 3T3MB 4JI1B 2CHQA 2WDPA 2K4MA 3DOIA 1F0YA 3VKWA 4ERXA 1TFRA 2R4TA 4M7OA 3EGVA 1NW4A 4BEVA 1J5XA 3CNBA 4UXIA 1YC5A 1J0AA 2K2QB 3W2GA 1YZQA 4OCZA 3ZGZA 2V5AA 3HY4A 3D3JA 3UGKA 3C8ZA 3RS7A 4UHHA 1E3DA 1XZLA 1FOEB 1Q17A 1Z4OA 2NV6A 2OZLA 3VZRA 5EWMB 4B7CA 4D9NA 5JRJA 4N7BA 5A3SA 2QD5A 3UMGA 3U4DA 3KALA 3DVQX 2EC5A 3RUPA 4NXNB 1D1PA 1L8XA 1YI0A 3ZCPA 4LQLA 5B4UA 5HUJA 3DB2A 4ID3A 3PFWO 1Y4SA 4HH0A 1O94A 1RHRA 4N0PA 1P33A 3QXSA 4ZOLF 3ZWVA 4FJ2A 2XBUA 5KNBH 2K2WA 1SXJE 1EG7A 3ZBPA 3AKDA 4JB2A 4R54A 3SIWA 2FV8A 2COUA 1RCFA 1PV1A 3AIIA 3D6TB 4R83A 4OJQA 3LQ1A 4TL8A 3NTVA 3WSWA 2X7JA 1UPUA 1OIVA 2A6PA 3P9RA 4U5QA 3ZWWA 1JPUA 1VP3A 1V5IA 2JS7A 4JBHA 2YOGA 2A0UA 2H9YA 2XOKA 4KACA 5EE3A 3EDCA 2DG2A 4NL4H 3EPRA 3WWZA 1OWLA 4A0FA 4N3CA 3S7TA 5E3JA 5EZSA 3OIFA 2RCYA 3QUSA 1RKXA 3R3YA 2WR8A 4FFMA 1GGFA 3BRCA 2G4LA 3G7SA 2ZM6B 3NVKI 4G4GA 1GO2A 4OMFG 5KKCA 1RABA 3MTBA 5A06A 4XE5A 3G6WA 1VRVA 4OGLA 3ZV5A 4ZVVA 1U4OA 2FPIA 4XQ9A 1D6MA 1QB8A 2PZGA 1SHTX 5HQTA 3KJIA 3PSAA 2FI1A 4NFHA 3DOHA 3LCVB 3HJHA 5JT1A 2CCGA 4OM7A 4RZUA 1FU7A 5JFGA 2IH2A 2OQRA 3ZCUA 4JBNA 4DM7A 4L78A 3EEYA 3U61B 2QPAA 2A58A 3PX3A 5CVTA 3LO5A 2RI1A 4F4CA 1P4AA 1LEHA 1KTIA 5FUBA 2AFHA 1DBWA 1NX6A 2MMGA 5T8KC 4WLEA 1RWWA 2AV6A 3S3TA 4DGSA 4C4OA 4L9WA 5IM5A 1GPLA 2OOKA 1RKQA 2C29D 1XE3A 5GWXA 5JY6A 4RTRA 4CEJA 3N8HA 4O2RA 3O1LA 4V02A 1NI5A 2D0PB 3RVMA 3H17A 1ZK4A 4DSTA 5B3LA 3VMFA 1PJLA 2WDZA 1X87A 2YWBA 3KVVA 1QG0A 2IYXA 3L7DA 3N0TA 4QDKA 3BZUA 5HCUA 4L6AA 3EPLA 2Y76A 3HCPA 4NYMQ 1ULBA 2Z83A 2ZJYA 1N0VC 4HNGA 1K8XB 2FFHA 2H2AA 1YZGA 2X4GA 1NUUA 1EK0A 2C4TA 3EASA 1PW7A 4ZYTA 3M70A 3JSAA 5F35A 4Y6GB 2VYCA 4ZMRA 2NT3A 4IIDA 3A1PA 1J97A 2L69A 1MNQA 3CY6A 3ESAA 1AY0A 1KXJA 4G3XA 4TVOA 2E85A 1U1CA 1UQRA 2O7VA 4KQWA 1Y7IA 5DN9A 1PZHA 3EEBA 1U9IA 4O8ZA 4Q37A 4BVEA 4C5BA 4DRYA 5K8IA 5KKNB 4CVNA 4KWHA 1RTTA 1T9AA 3NUGA 2DOGA 1QGOA 3E58A 5F21A 1YQGA 1QFSA 3F4KA 4TRMA 1EVYA 4DA7A 3COJA 4QTTB 4R7ZA 2VAVA 2AZ4A 3NX4A 3MG9A 3V4LA 1ZJJA 2NSHA 1J90A 3G82C 2VSQA 4FQ8A 5CNKA 4CM5A 5CA1B 3MTIA 4CT0A 4D4MA 3V1KA 1ECGA 3IR7A 5HYVA 4IM7A 2ZI9A 3RT1A 3GP3A 5IYQA 2IC5A 5JTTA 5HMMA 3S2GA 4D0RA 2D5BA 1AT1A 3QBJA 3V5NA 1GQQA 3M4JA 4E5SA 5HM6A 3E5MA 3A3KA 4G5SA 5AM5A 3OZCA 3CIFA 2GN6A 3V32A 1TQ4A 1VQ6B 1MPTA 2DYKA 1C1DA 1L5MA 2J46A 2R751 3KVOA 4MTLA 5AHRA 3VYSB 1KJQA 2YV2A 3I5UA 3FPKA 4JJAA 1OUMA 3L0CA 3KZOA 3LUKA 2ZB7A 1XC7A 2V98A 5ED0A 4QG7A 4AY5A 5J1SB 3KL4A 1P8JA 1FUKA 4WXHA 4BP9A 5KTTA 1K2WA 1OVGA 4QQKA 4YHBA 1ZOLA 2FOXA 4TV9A 2D74A 1GCGA 1QZ3A 2B36A 4FEAA 3TQHA 1C8KA 3W8NA 1YB4A 3WLQA 4KXXA 3M6VA 4IQGA 1JQEA 2GZ2A 3IBCA 4DQVA 3WMRA 1CHNA 2XB6A 3HZHA 3SHOA 5H8WA 4U8GA 2QAGA 3PVSA 5T4EA 4JKIA 2R3SA 3M6MD 4ID9A 3PDUA 1U0BB 5B2ZA 5KQMA 3F8WA 3BXXA 2DKOA 4V03A 2L42A 5JRZA 1KR5A 2F62A 3ZHYA 4PVDA 2OWDA 4QOGA 4W99A 3X44A 2HT1A 3F6EX 3H19A 5KJCA 4HDNA 1T4CB 2P9TA 8LDHA 2CL7X 2O0KA 5LDDC 1RXVA 2J5QA 2VJLA 4RDJA 1C41A 2RKWA 4HX9A 1EIWA 3WQBA 3KYCB 4RK1A 1W5TA 3QE3A 1XPJA 2YH2A 4C7XA 1TLFA 2CFIA 3LNNA 3UUGA 2XHEA 4GMKA 4M9ZA 3MCZA 5AR1A 4KFSA 1JILA 3DW3X 5SZKB 4H4EA 4H7PA 1JF8A 1WDMA 5BSYA 2O2DA 3NONA 4KBGA 1MJ5A 3OZAA 4LXTA 1YHQB 1I3OA 3ELDA 3HUFA 3KYDA 1JQ3A 4MZXA 1GEGA 4R1OA 5FI1B 2BWJA 3EWIA 3ZU3A 3AFIA 3IAS6 5K3OA 1XUOA 2VWQA 2XLBA 4ZICA 4B2IA 1E66A 3K0EA 2C88A 1HLPA 4OKNA 2YHSA 3FZEA 1V4BA 3KT0A 1FYWA 2NOAA 4XQ0A 4B6SA 3A25A 1Z5PA 3CVWA 1IWBB 2YXNA 3GLIE 3U7QA 1U11A 3AL2A 1VMAA 2XIQA 3OOJA 4BJ6A 4P9NA 2RGCA 4OYYA 3CRW1 1TEHA 1VSQA 1G98A 3EIQA 5HBGA 3S2IA 1FNMA 1JWAB 4L4YA 4B4UA 2GVNA 4GH5A 4R1UA 4EI7A 3N8KA 1OQAA 5LP6A 5HOEA 1YBHA 3H4TA 2H07A 1QS0A 2HGZA 5BQFA 2PV7A 5NLLA 3CU5A 1LVUA 2XXBA 3HVUA 4NZPA 2CV0A 1SKUA 4W7HA 4NU0A 4Y0NA 1IZ8A 1VZ2A 1KQOA 1ZINA 3JD2A 2ZSHA 2QRKA 4ZOCA 4BQEA 2FX2A 3GOHA 4IHQA 4ON9A 3PCXA 3AIMA 4XARA 3VQTA 5IYZA 2WJ4A 2I54A 3PXUA 3LDAA 1MJFA 4JLDA 4MS3B 1P9WA 1R6BX 1B15A 2WE7A 5FRDA 4XDYA 2H1FA 4BB0A 4BMYA 2Z2ZA 2ZITA 1UD2A 2P6OA 2D1FA 4AULA 2H5LA 1BJKA 4YCBA 4E07A 1QOZA 4DIEA 3FOZA 3LX6A 1G6OA 1WV0A 3L7BA 5E2IA 1ZOSA 4ESEA 2VH1A 2VPQA 4FE3A 2B3TA 4P31A 4S1OA 4TT3D 5LCXA 4PYRA 4LY6A 2ORWA 1LNZA 4O4HB 4X7MA 2WG2A 1D6SA 2VBFA 5FEMA 4GXNA 2I4RA 1HYBA 1S4QA 4WZ6A 4CYMA 4EQ6B 3HA2A 1G3IA 2OYNA 3KZCA 3NHZA 4JP5A 2VDPB 2SHKA 2QLNA 4E4YA 2AI1A 2JW5A 5MFZA 4X95A 4QRHA 1GGKA 3NBZC 5TT1A 2QN1A 3FIUA 3UG6A 4D57A 3L7MA 3FG9A 4MYTA 4NYIQ 1EWYA 3HJUA 2A9FA 2EFYA 3PNBA 2YCLA 3ENKA 4LYHA 3ZBQA 3E7DA 3ZQJA 4Y6SA 4J7XA 1OLOA 5JSZA 1P5JA 3FPEA 4OJYA 3MUOA 5CA0A 2UYQA 1QR6A 4FHDA 1Y5LA 4YX9A 5TMDA 1VE9A 2OZVA 1VXOA 4HADA 2X4LA 3EYAA 3Q7IA 3S70A 5KREA 4P5DA 4YQEA 3ZYCA 3TLBA 2E89A 3WO0A 3DAHA 4BAGA 4Y3UA 1NB0A 4LDPA 5A89A 1FMCA 4LYYA 3W34A 3RUIA 3I52A 5C8XA 3R6TA 4TXHA 4PLVA 4YRIA 5KYWB 4W8OA 4Q7EA 1NJGA 2QLBA 2VHCA 3GO4A 1AN9A 2Q8PA 3RD5A 4NMMA 5JCPA 3TIIA 5E2BA 1F06A 5HZKA 1JDBB 1DFIA 1G6HA 2VHEA 2JFQA 1XDBA 3FNGA 5LOVA 1FDUA 4EGFA 2JEOA 4P92A 3UFBA 1NRKA 1NT2A 1ZD5A 5SY6A 1HG0A 3KAPA 3PNMA 5BXQC 2Q6KA 4H6WA 4JP8A 4CIXA 4Y2GA 4JVNA 1B1CA 1E9CA 3QF7A 4FPXA 3FMPB 3P0IA 4AJ1A 4YRBA 4GSKA 4MMYB 3X1WA 4I8XA 4FKZA 3RF6A 3A9UA 3GGPA 3OOHA 3QVKA 2BDUA 1ETHA 1Q57A 3LKBA 1GR1A 1PNOA 3LGSA 4ZO4A 5F64A 3RVKA 3GIWA 5E6SA 2I4OA 1U1EA 1NFRA 3BIXA 1XWIA 3GD7A 2RHRA 1ONSA 5JFTA 3OFVA 3QKSB 1K4MA 3DDCA 1XAGA 2V7PA 4FQ7A 5AW3A 2RC6A 1IG0A 1GY8A 3V8PA 2H16A 3GBPA 2PCLA 1AV6A 3H5LA 3F6BX 2Q6VA 3LUHA 4LHWA 3DUFA 1Z4NA 3U4CA 1LQ2A 4KE8A 3AF2A 4JZYA 2BE9A 1P45A 1ZL2A 3D8NA 3E81A 3FRJA 1DO8A 1YDMA 3IXLA 3QW4B 2B94A 3LUFA 3A6KA 1EEHA 3VHXB 3OP1A 4D2IA 2WJAA 2WTMA 4FR5A 1T5OA 2EGUA 3ANLA 4KXUA 1F0PA 3GRZA 2PFGA 3JQ8B 5E9QA 2BR3A 3ZUGA 1ACMA 1SG0A 1Q0PA 3K6RA 3KEOA 4WZBB 5EYPA 1N2CA 2I91A 2E37A 3W1EA 4FNOA 3EMVA 4ROSA 1WQ3A 1U7XA 2FPPB 4XKJA 1HE8B 3Q3IA 3HB5X 4K05A 5A62A 5P21A 5AW2A 2PO7A 4NBRA 3R7WB 3W8FA 2OCPA 2BP7B 1JEDA 4M86A 4QLBA 4WZAB 1ULSA 3VZCA 1TUBA 4LMAA 4OA8A 2LKDA 2AKEA 3HB1A 2X6RA 3L92A 3QBDA 5T5QA 4PWYA 2GJSA 4P36A 1PJZA 2F43B 3GT0A 1ESMA 3KU4A 4TWRA 1EPUA 5CH3A 1IZ7A 1O7JA 1RBQA 2NADA 2PUHA 5CW2A 3ZV4A 3GEIA 1JEEA 2HTEA 1KJNA 1N9GB 3HR7A 1ZUNB 1BG6A 1KFEB 4IXDA 3WGHA 1H2EA 2A33A 4DF3A 4C5AA 3N75A 2RGDA 3R5SA 4CKEA 4DTIA 4ER0A 4M1ZA 4NJEA 2XXJA 2F3QA 4O2LA 1W35A 4BBPA 1QFYA 5FIUA 1F4PA 2A67A 4HEQA 3AXSA 4FHGA 3ZDFA 1H1LA 2QTVB 2GFIA 1LI4A 4EL0A 2VBIA 2B7BA 5JSFA 3RGGA 5IFLA 4MDEA 3EXG2 1ZWKA 4Z9BA 3DWEX 1WEHA 1LUAA 5D6NA 4IP0A 3BIOA 3QIAA 3NEJA 3MUEA 1ZWLA 1F0KA 2RH4A 3D7RA 1X6VA 4C0HA 3KS9A 1XCPA 3ONWA 4WCFC 5EZYF 4RIGA 3ZJTA 2VNKA 1CRLA 1EWRA 1K68A 3X2FA 1T29A 2QMZA 1G2OA 1YB2A 4EA6A 3DDSA 4OP1A 5F4JA 1NE2A 3P9ZA 4M8KA 2JAOA 3FKSD 3VVMA 1Z07A 2A9RA 5JYBA 1GUYA 2LIVA 4KO8A 3RRBA 2C9MA 5FUQA 4EAAA 2ZSEA 2PQ0A 5D85A 2ZYRA 4DRZA 2H4XA 2IIBA 1W48A 2C20A 5DYYA 3FJYA 3PE3A 4UBLA 1SKQA 2V8BA 1Q95A 5FF9A 1WTHD 1JDJA 3Q7SA 5BVHA 3UTCA 1XU7A 1ZSYA 2ZIXB 3ACBA 1AUPA 4JLUA 1R6XA 3Q7EA 4U9IS 5EMJA 1YJ8A 4F11A 3RVBA 4HRAA 1AQ6A 1KDOA 1LPMA 1OH8A 3OZWA 3D5TA 2ZR7A 4P5PA 2H2WA 3I53A 4LHVA 3TX2A 1VIVA 1Z39A 3F1LA 1W47A 1DAIA 3FD8A 4QXAA 4XMYA 1OFTA 1QYDA 3UH1A 1YFZA 3K5HA 2UZ3A 3FHOA 3KAQA 3VU9B 5CP8A 1DG9A 4EITA 1FYFA 2VT3A 1QFMA 2C4NA 3KTAB 5DHTA 1YGPA 5JISA 3NBXX 2GJ4A 4L1KA 2Y8EA 2AMYA 4LWPA 4OSOA 4RJJA 3G49A 3Q2OA 4BNUA 4Y9DA 1WORA 1SIOA 4KU4A 4UUQA 1FTQA 1T35A 2QL7A 3LKDA 2BFCA 3QKTA 4FR0A 1DIHA 5C8VA 4ITVA 2JASA 5K01A 3QI2A 4E30A 3INYA 5KYYA 3R3ZA 1RPZA 3CMCO 1S2DA 3LLSA 3ZU4A 1DEHA 1O95D 2FMXA 5EP4A 3CCFA 3ZDDA 2R7KA 4KP7A 5CXSA 4WESA 1CUIA 3WK4A 3I9V1 3KELA 4Z0PA 4EW1A 2RCNA 3LP6A 4K81B 3EPJA 2ZBGA 2PGJA 1VJ5A 3DTVA 4DSAA 4PZEA 5JJBA 3TQIA 3I5AA 2VF7A 1U3TA 1BX3A 4K3VA 3ZW8A 2IU0A 4DRXA 4I14A 4B82A 4HE6A 2JLRA 2NTVA 1T6ZA 3HJAA 5CK5A 3A28A 3CURA 3OPYA 2H7XA 1BHO1 2FRXA 1ABEA 3DTTA 1QYVA 3EC7A 3EGWA 1QOPB 4ER3A 4IIVA 1F8FA 2NZXA 1HPLA 5F1YA 3AOGA 4PZZA 2XWJI 3EVGA 4QJ5A 5I9SA 2X85A 1BA2A 3IP3A 3U3XA 3VR4H 3W2TA 1ZQ1A 1Y82A 4PU0A 4TV9F 2JGNA 4S2UA 1IJFA 1CQIB 1SD2A 2VEDA 3VH2A 2IEZA 3FLEA 2QAIA 3LI2A 3DPIA 3NHPA 2B2NA 1L5RA 5DXAA 4IDEA 4BGDA 3NHLA 5B5SA 1Q0LA 3BOSA 5CBPB 3JQCA 2R1VB 3RUHA 1UD3A 3H9BA 3AR5A 4KQHA 4EG0A 2Q41A 4PG5A 3ZQUA 4XWAA 1SB8A 4K9DA 3ABOB 4RA6B 3I1JA 4BNFA 2HRDA 4TXMA 4D43A 4EFNA 5KCZA 3N2GA 3LQEA 1Q0TA 2BUCA 2YJ5A 2WTNA 1M6HA 4Z1MA 4MA5A 4NC9A 1IZ9A 1HE2A 3UWPA 1QTRA 4R8KA 2KVOA 4BZWA 3I61A 3AB3A 2IBTA 1Q1ZA 3DT6A 2A5DA 4IGIA 4OHMA 3RAFC 2RG7A 4B3GA 2R7NA 3H13A 3LCUA 4X94A 5EINA 3OAAA 2CLDX 3HJBA 4QXQA 1LC3A 3HWSA 3KJNA 1MG0A 2GDZA 3V48A 2RHDA 5ALFA 5G3YA 4DIDA 2RHCA 2ACWA 3LBNA 3A2NA 4U63A 4EGQA 2OC4A 1RQGA 4JT2A 3NKVA 4CF3A 2JBAB 1COZA 1CZHA 1JEJA 1H94A 3AW8A 4FCVA 4EKGA 7REQB 5L40A 4DA4A 3ET4A 2W5UA 1EDZA 1PD0A 2C5FA 2JIRA 2WF8A 3BWBA 5C81A 2P0YA 2PZAA 3KKKA 3V4OA 4B45A 1XLWA 1QRUA 4UATA 1PFVA 4DXHA 5A4IS 3GCWA 1LD3A 1EWTA 2QVGA 3BJEA 4YRGA 3HY6A 3SIXA 5J2TA 2VHVA 4FB4A 1NUAA 2JRLA 3HK2A 2GN8A 4F92B 3I9MA 2R5WA 4QUEA 2ICAA 4RXUA 4BLPA 4JDPA 4P54A 5AKHA 4ZI5A 5LP6F 1KBQA 3UJ7A 4B73A 2YIDA 1ZUHA 1V0EA 1VB5A 2B1GA 2H1LA 1KEEB 3GCZA 2PXCA 2QPOA 4RIHA 1QTIA 1Q19A 2IVZA 3CLSD 3OESA 4QFCA 1NNI1 1JI0A 5T6BA 4A82A 1BYIA 3B20A 1WO8A 1JR3E 2GLUA 1PNTA 1I1QB 1W29A 3DLTA 3QTBA 4JC0A 1I8DA 2HMTA 1XQBA 2LW7A 5J2UB 2H1RA 2O5VA 2O59A 1HNNA 1PVDA 1WHSA 2PH1A 3CPEA 2Y67A 2AYZA 4TKUB 5AKKA 5IYZF 3K1JA 4EHKA 5LQJA 1W2GA 1DHTA 1IXRC 1MVLA 1VBKA 3PLAE 1LK0A 2QZZA 1GRRA 1NMSA 3KHUA 1VKNA 4HYQA 4HMQA 4MB2A 3ZHSA 4DXAA 1S9DA 2Q1WA 4YV7A 3AGQA 2ADOA 4R84A 1I4WA 2WP8J 4U2BA 4EG6A 2H51A 1JLHA 3QJYA 4N5IX 1XCLA 4BFZA 2A14A 1PZEA 4BZXA 4G5QA 3WISA 2AT1A 2EEPA 5K5EA 1NN3A 3OW7A 4R9NA 3JQQA 1C7QA 4OI1A 3KQKA 3SF0A 2O8EB 1FP1D 1WXHA 2Y1FA 1A96A 3MK31 4OQFA 1O6FA 3ONYA 3BAFA 3G9ZA 5EVJA 1EFPB 5K0NA 5CLFA 5IX8A 1YT5A 3VTZA 3H2SA 5BNIA 4H0CA 2WB4A 4IO0A 3RV3A 2CXRA 4W9NA 5E3HA 2PZMA 3CC7B 1JLLA 1ATIA 3FPCA 1FSGA 1SUFA 1IOWA 3QYJA 2RKBA 4ZZIA 3EOZA 2ZT6A 5DOZA 3RM3A 4ZYLA 1OV4A 1AKTA 2XNJA 2WMDA 4F4IA 2A59A 3EIHA 3PI6A 4HH1A 1KDVA 5JYCA 5CDFA 1J1UA 1C3XA 2W93A 4Q7LA 3E53A 3ULKA 2QEXB 1CZUA 1T9BA 3L8CA 1XZBA 4MOWA 1P0QA 1D1QA 4GEKA 1N08A 3OFND 1QHHA 4OPSA 2WKQA 2C2MA 1QKKA 4IW3B 1YJ9B 1XDSA 3R9KA 4XYEA 4DCNA 1XZIA 2DCUA 1LWOA 1ELOA 2O1WA 3T3PB 4BMXA 4EGJA 3Q1LA 4DR7B 4NYJR 3PNOA 4UC0A 4MR8A 3UY4A 1C0EA 1OIXA 4JQZA 4HEA1 2X8BA 3VUEA 5KYUA 4YYEA 4AC9A 1U8EA 4C1NA 3A37A 2JRCA 2FN4A 3IIIA 3OJ0A 3ZTTA 4D80A 4PINA 3B38A 5KTRA 3TZKA 2BC9A 1AN0A 2AQKA 2EWVA 3HGQA 4MDHA 2B8TA 5D87A 4KUHA 3UPDA 1RXCA 3VKFA 3GFRA 3B7GA 3ZHUA 1NVVR 3U1BA 4F86A 2PL5A 2HIHA 1J39A 3LXXA 2IOQA 1QBGA 1AG9A 1EJ6A 2QUHA 2X5NA 2DBRA 3JVDA 3B6JA 5HCIA 4AURA 1G6KA 5KOJA 1MZPA 1KQ3A 3H86A 3E3OA 4OHZA 1UK7A 2FQXA 4HB2A 4QOHA 4D3XA 4Q9NA 2Z98A 4RU1A 3RFXA 1W5SA 4FXPA 4GWGA 2YCBA 4ZOBA 4D25A 3GQVA 4NBUA 1TIBA 1W8DA 3J81k 2SNIE 4K9LA 3RS4A 3ZTWA 2JAXA 4BLRA 5LZ2A 1FF9A 1QO7A 3C24A 2WVGA 4A6DA 5BN3A 3CT4A 1PYDA 2JLCA 2YN2A 4JDUA 1E99A 4PYIA 2ZTUA 4X1YA 3ZWYA 4C3ZA 5D1HA 4UUPA 1CZKA 3WGMA 4M0MA 3TYXA 4WECA 4H3SA 3WMEA 4AICA 3JQBA 4MVJG 4MVXA 1SXGA 3V3TA 1PWHA 3ICQB 3BVPA 4F5WA 2GR9A 3AETA 3SE0A 1IHPA 4OQEA 2Q29A 1N3LA 4ZT2A 4W5RA 4OHVA 2LCFA 1GLNA 1E1KA 1XKLA 2AFRA 2L82A 1NTOA 3VR0A 3NRCA 1FDIA 4B71A 1NIJA 1FRZA 4LIPD 5HJ7A 3T0GA 1VE6A 1GD1O 3QEKA 5BN4B 1QPBA 4TSKA 2FVGA 2W2NA 2Q4RA 3UKDA 2I3ZA 4COOA 1GL3A 5F1OA 3VYWA 4QJ3A 1YJNB 4OOSA 1Q3KA 4RFSB 1YVPA 2PSHA 3FW1A 4MQEA 5D3MA 1CUHA 2BGRA 2FEMA 2FEAA 3HDTA 1Y42X 1YZYA 1L5NA 4KR9A 3V55A 4AKIA 1NLYA 1RAAA 2C5LA 2YWXA 5DGCA 1Z18A 5AVVA 1NMXA 3ZI7A 3DKIA 2VXOA 2Q2NA 1REQA 4HR7A 2J07A 1ZM2A 1K4KA 1ZU4A 3RJ9A 4AMZA 1EWQA 4CKBB 4EB3A 5C37A 2NXEA 4PCLA 4BWVA 3ZHZA 4AG5A 3A2LA 3FCYA 1QHXA 4LDQA 2HDHA 1O08A 1XEXA 3W2IA 1D3AA 3AJ9A 5AJTA 4BVLA 3MSXA 4D9GA 2GILA 1DNPA 4UU1A 4E7PA 1SB9A 5DKFA 1KP3A 2OO5A 2B4RO 4DMKA 4H35A 1EM8B 3NG1A 1SU6A 3DS8A 4MYSA 3REOA 3RYHA 1CJVC 3OQIB 2D7DA 3HU2A 4JJ6A 2JNWA 3UJ8A 2BMAA 5ESDA 1L8OA 3GVPA 4EUFA 2CVZA 2QN8A 4FW9A 5J35A 1NLFA 1GLGA 1KEZA 1OSNA 1US8B 2BGKA 1Q0SA 5DK6A 3TW8B 3WZMA 4ERNA 2SKDA 4J9VA 5I48A 5MN4A 1KOFA 3IUPA 4ETIA 4KPFC 1SCDA 4Q4CA 1RJEA 1OB5A 4MS1B 4XVUA 2VS1A 1X14A 4DCGA 1H3EA 1D03A 2QTBA 4QOJA 3SXPA 3C2QA 4GRDA 3RADC 2Z4SA 3P5SA 5KU7A 3CVXA 3G85A 3OH8A 2W6ID 1H66A 1L7BA 4FYXA 1JHZA 5EKXA 3ZWOA 1Z33A 2L18A 2DFLA 3OUTA 4RGBA 3NDJA 1ZGJA 3OZDA 3L8HA 3TW4A 3ZGLA 1YONA 2Y1DA 3JQBC 4JLSA 4BATA 2X2OA 3BRWD 4K1XA 1LC0A 3OQPA 1A72A 1G8HA 1XDZA 3DXYA 4X90A 4F9GA 3TTSA 4EP1A 5JD5A 3K96A 1MEOA 1LS1A 1P2VA 4L0DA 3T3EA 2P7IA 2ZL7A 1U9CA 1OLXA 3KK0A 4IEIA 2JN9A 4N7MA 2GX6A 4PCVA 4ONEA 3G0OA 3ZE2B 3PTLA 5JSUA 3UFXB 1GP2A 3IHTA 3RSCA 3SVLA 2B34A 1X7ZB 3B3AA 2HXYA 4F6CA 1SHJA 3B51X 3I01A 2PSDA 4KTVE 5KC8A 2WJJA 2FPOA 2CCKA 4I6EA 5AKZA 1EFVA 1L5LA 3QX8A 3RHZA 4QHTA 4C4AA 5L3QB 3ZLUA 1XTZA 1Y9DA 2GD0A 2JL1A 4E09A 2IE8A 4BNTA 4C2TA 3FSJX 4DNOA 2RIRA 2W0SA 2JFPA 3G89A 5G02A 3EUEA 3EODA 3KQPA 4ENSA 3ESBA 3U4QB 1D2RA 1NUHA 1Z2AA 2CXTA 2NQ8A 3GJ4A 3UT6A 2PKYX 2OFFA 1E6KA 3CRNA 3JWIA 4EO9A 1A9XB 1WSWA 2IJGX 1L5QA 4PCUA 3IPYA 1V41E 5EERA 1LCIA 2GA8A 1WA5A 4H3VA 1KQFA 1QU2A 1ML4A 2CNKA 1G20B 1CR0A 1EDOA 1BC5A 2JPDA 2DECA 3AU8A 2JEZA 2LKCA 2FWBA 4RF2A 2QG6A 1C3VA 2OO5C 2Q2OA 3FMVA 3A6JA 1DMSA 4M8LA 5A0TA 3EUAA 4DDUA 4UZSA 4DR4B 3B78A 3HH8A 4XB6B 3NOVA 1YE8A 4U3JB 3A1FA 2ECQA 4BECA 2J5XA 2QTAA 3DHNA 4Z0HO 3C8DA 1PDOA 2F00A 4PIPA 3OTWA 1I2DA 4KHPB 1YVRA 1R8YA 2BL4A 3HM2A 3KWMA 2PD4A 1GG5A 1HYHA 3EDQA 4ALNA 4D44A 2WD9A 1S9HA 3GPIA 3QXXA 1QZTA 1U8UA 4MW5A 1GU1A 4W7IA 4JBXA 5TARA 3UXEA 2P5SA 4OLBA 1E5TA 4L76A 1A8UA 3JS5A 1OFHA 3IBFA 1RRFA 4G5FA 2EBUA 4P58A 4GICA 4EL5A 4CM3A 5ITWA 1TO2E 2AOVA 2C5EA 2GWRA 2XAAA 4M4SA 3K09A 3ZDYB 3FUWA 4DWWA 4KKVA 4P7GA 2WFAA 5ALIA 4DDWA 4ILEA 1M0WA 2LWIA 1A82A 2OAQ1 1HT3A 3HDHA 5E7IA 3WGQA 2AB0A 4L5IA 5JC8A 3U44B 1LRLA 1OH7A 2OYSA 2X58A 1KVQA 2YJTD 1XZDA 4I1RA 1ECFA 3EGOA 5EXXA 3RSGA 3WS7A 3EUFA 4FUQA 4MVJM 4YJHB 3COVA 1M0EA 1JVSA 1E2DA 2A9PA 2ES4A 3BHJA 3I6YA 3E9NA 1AK1A 4FI3C 3Q10A 3AHJA 4FZVA 5B2FA 2BGWA 2QRLA 1II8B 3A7DA 3WLAA 2C8LA 1RJFA 5EE9A 3ECSA 4RSHA 2ID9A 1Y3HA 1UZLA 1VQ1A 3G79A 1SVUA 3BL5A 1WOSA 3OKCA 3P52A 1NGSA 2OCKA 3DEJA 5EWMA 3DE4X 1Z4LA 4LRTB 3TNLA 3VAAA 4XM1A 3L7OA 3U4AA 1IRXA 1GCAA 2J8ZA 4UBOA 3MYYA 2RGUA 1DKNA 2YXDA 3FCAA 3U1TA 3ABRB 1Z0IA 1JDZA 1PT9A 2Q5CA 3W5IA 2XTZA 4C4RA 1NONA 1VECA 1W4LA 2XUPA 4RK0A 4E4TA 3ZDBA 2PMBA 2Y0BA 4N54A 4V1CI 1FTWA 1JQKA 1N2CE 4H0NA 2B8WA 2PZKA 1E1YA 2ZRGA 1QWSA 1VSTA 1RRVA 1NQ5A 3CE6A 2NXCA 2UUCB 1L2TA 1P4MA 5AJXA 2BKXA 5LZ7A 3K0KA 4KQFA 4DMRA 3A6PC 2JF0A 3VR5D 4WBNF 1UK6A 3OA0A 1FVHA 3WLSA 1LF5A 3DGEC 4U2DA 4NZOA 2FW0A 5JQGB 5LWQA 5I7AA 2YZMA 3E5RA 3V7NA 1BH2A 2D0OB 1Y4ZA 3AJDA 1W7AA 3IKLA 4R9VA 2H00A 2IVFA 2JHCA 2HW8A 3LT2A 4M7WA 1RAIA 2MR6A 4PQFA 2O5CA 5F4ZA 3ISVA 1A7AA 4MUBA 3TZLA 3UHOA 2A9VA 3HKBA 4ZJYA 4F60A 1X3SA 3Q3CA 1TA9A 1EVLA 4IS3A 1JQDA 4AJIA 2HL6A 1W4CA 4FK8A 2XB4A 2OHHA 3H84A 2EFGA 3OU6A 2YFQA 3N76A 4AECA 5JI2E 2E49A 3FGOA 4OI0A 4HS4A 4U6NA 2VYQA 4IG4A 1N0HA 1UBOS 5ALWA 5AI4A 3WLTA 3JWJA 3HPQA 2H63A 3KQSA 4JJEA 5EE1A 3C43A 4GXRA 3K09C 2R8RA 1WUKS 4PX5A 4KMMA 3VNRA 4ISCA 2HCRA 2VCEA 4Y9TA 1VSBA 4M1KA 2X5JO 4P4LA 4TPKA 2WE8A 2MMCA 1P0MA 4AMBA 4N8DA 5CM2Z 2IRWA 2X3FA 4W1SA 1G63A 2YXLA 1JHXA 1ZMTA 4F3YA 2NMVA 7GPBA 2QW0X 3KEFA 3BBPA 4MA4A 4Z8XA 2YC4C 5HS6A 3X2EA 3U81A 3F5FA 3P0HA 2EARA 2HU5A 5G0VA 1WXWA 3FTNA 2P1ZA 1R12A 3IODA 5D7BA 1IC6A 1KZLA 1XN4A 2UUOA 2ZS7A 2YV3A 2LIPA 3B1JA 3BH0A 1JHRA 1EK1A 3OJFA 3E9QA 3F2VA 2C2GA 2OGZA 2LCQA 3COZA 3ON5A 1FFWA 1MJHA 1RP1A 4S1PA 4S1WA 4CL2A 3QWAA 5HFJA 4PWZA 3RDPA 1FQWA 3E82A 3G0DA 3EZYA 4HZIA 1UEIA 4BX0A 3VPCA 2FMKA 4P26A 3R7NA 3RF7A 4EUKA 4QPCA 2M98A 1A2QA 3O8QB 1C81A 4YPFA 4K0RA 3JRNA 1ADBA 3DZJA 5CA1A 1VPWA 3ZDXB 4WLUA 4XQCA 4JYZA 5FOSA 4F5EA 1IY9A 5FBKA 4AU1A 3CLSC 4G6ZA 2JD2A 2BFMA 4P3KA 4BTVA 3G2OA 1K3UB 5TRDA 1DXYA 1N5KA 1MDFA 2B5WA 2IQIA 3H1FA 3K73O 1C3OB 1GPDG 2C84A 3L5OA 4BCDA 3RUEA 4NFSA 4C22A 3X2SA 3DH0A 4E3ZA 4ZYYA 3RRMA 5BQXA 2VBCA 1AKNA 3HVJA 4ZYZA 1XQYA 1RW4A 1I2ZA 1D6JA 2AN1A 5J5AA 4F56A 1PJAA 2EFEB 3O38A 1PLKA 3SYTA 3ZIAD 4N47A 1OCEA 1T3LA 3C15C 1TU0A 2DMRA 1XCGB 2FWRA 4GPAA 3V1MA 1UMCB 1SOMA 4JJKA 1OKKA 4UMFA 1AE1A 3KKLA 1AQLA 1WP4A 2G07A 2ZUSA 3WFZA 1SOWA 3DYVA 2C96A 2EIXA 1DB3A 2FPKA 2O3UA 4NYJQ 3GEBA 4U7HA 4FGZA 2VXYA 3K2EA 1TDJA 1Q22A 3BFKA 3DBLB 4DIOA 3QLEA 1YHZA 4G84A 3W5JA 2P77A 4KIFA 1D2HA 4AP9A 1JKMA 2ZLBA 5BSKA 1J7KA 2X3UA 1JBKA 4RS3A 5LYJB 1T4CA 3P9NA 3E6AA 3BFPA 5I8PA 3WLHA 3ANSA 3H0CA 1NVVQ 3Q12A 4LQCA 2F55A 1MFPA 4KGZA 1XYVA 3BD8A 3KYCA 2QSJA 5K3AA 2H2HA 5GONB 3ZDQA 2D2VA 3MGBA 4L8VA 3PPXA 5BMVF 1PV2A 2GD1O 2ZGVA 1PO7A 5DASA 2PLNA 2XUAA 4G8JA 5FPTA 5HIJA 4YAWA 4JBWA 1VLJA 3M1IA 3F3SA 2D5CA 2I66A 3JVIA 4X8MA 3QK7A 3OJLA 1TYCA 2QQGA 4I2VA 1XRRA 4LWOA 3URMA 4LHYA 3WHKA 4DR3B 2BMEA 1T2VA 3P2MA 4ZOAA 2NSLA 4OFBA 3RS5A 1AGRA 1HSOA 2HJWA 4LRXA 3TO5A 1U2DA 1AZSC 4BL5A 3A26A 3WXMA 1F20A 1AO3A 1WOPA 4DMMA 1UT8A 4W1RA 3ASSA 4PLFA 1JLRA 1KJ9A 1P72A 5DDIP 5G1PA 4D6PA 1GV1A 2DKFA 3I4FA 1U0RA 4MW0A 1ZK2A 4H9GA 4HVAA 2ZYGA 2V7VA 4MMZB 5E9JA 1ZYUA 2B30A 4FS3A 4MS4B 5A1JA 1GPWB 1F17A 3WA7A 4QRDA 1BKSB 4G41A 3CG4A 3HKDB 3WICA 4Z4UA 3FOBA 1C1XB 4M55A 5K6TA 1VDMA 1OXSC 1PL7A 4WL0A 1H4QA 3SG0A 1RJDA 4CODB 3WVNA 3OO0A 4FLFA 5TGTA 3OX3A 1JTVA 4EIWA 2EJUA 2GFHA 3EWNA 5ILGA 2H5JA 4LWZA 4C4ZA 1USWA 4X66B 1Y37A 2PVPA 3NS7A 1OIWA 1ZRSA 4NV1A 3RC3A 1ADJA 1OI4A 3IKTA 1ENPA 3GAFA 1VC2A 4AQYB 2DH5A 3H7IA 1NPDA 2DZDA 4GP7A 2C82A 3LXRA 1Z47A 2GM5A 3A3PA 3H8VA 3H3JA 4W9RA 4QL3A 1T8UA 2GVZC 1G5QA 5K09A 2IUFA 1Z25A 2GDJA 4OGKA 3BE4A 3ROEA 5IJZA 1XMOB 2HA4A 2R6DA 3K3PA 4EELA 4MS3A 3U56A 4TTJA 1CWUA 1G7RA 1XU9A 2DM6A 2P4EA 3ORQA 3Q85A 1R0KA 3L7NA 3U7IA 4OFWA 3WLEA 1YB1A 2PX6A 3LRTA 4AROA 1JIQA 4HAYA 2ZUVA 3GBVA 4O2BF 1VI6A 4Y7DA 1A2OA 3EF1A 3GL9A 2QL9A 2JFXA 3FNIA 4F4DA 5I9NA 1QIGA 3FB4A 1ZMOA 5JADA 4O4HA 1B93A 5C4MA 4NU8X 4MVJH 5EE5B 4F46A 2P62A 2ZBDA 2FWNA 2IPAB 1K5HA 3BA6A 4Q6BA 3FR7A 4Q7JB 4PY2A 1PAUA 2HNBA 4JR1A 1N2XA 4RPCA 4EQ6A 1R6DA 1DHRA 2V6IA 2INGX 1Y98A 1EFAA 3E3LA 5I3ZA 2Q1TA 3HYLA 2HLHA 3TSAA 4BAUA 4NOMA 4XLHA 1IUKA 1YR7A 4QQ8A 3T15A 3AHIA 3W7BA 5K2OA 5TXGA 1RXSA 3NTLA 3TD9A 4ZJPA 5IWAB 4Z4SA 3HCRA 4CDGA 1BVRA 3FTFA 1G7SA 4LJ8A 1Q7BA 2Y66A 1YO6A 3GFTA 1V8FA 3PXAA 5TMBA 4FC7A 3W3AD 4Q4HB 4X6XA 4IVNA 4XLZA 1JHYA 4XTRA 5IW8A 2IV7A 2QVLA 3UMBA 3QKIA 5JD4A 1GGEA 3JALB 2Z9DA 1U2DC 4H77A 2A1UB 3EZ2A 2WNSA 1N4AA 4C0KA 1LLFA 3AOEA 4NV0A 3F74A 4Q1FA 5FO1A 1LJUA 2NZ2A 1EWVA 2ZR8A 3GGJA 4TUYF 5DCYA 4DA8A 2XQVA 3WLFA 1T6YA 5DF1A 2FE1A 4LHSA 1MC5A 1NN0A 1V0FA 3JRXA 3TOZA 1A5AB 1O0SA 1XZEA 1Q81D 2WC1A 3BIFA 1LF0A 1NUTA 1T4DA 4GYYA 5KYWA 4EF5A 3PRKE 3HWWA 2C03A 5AN9A 5CXXA 3QVUA 3E7WA 2CLHB 4WZTA 1KY3A 2COKA 3A10A 2JHPA 4P35A 1TK2A 2EBHX 4G0ZA 4OU5A 4UEQA 1W85B 5EIFA 2X9LA 3R8CA 4A23A 4A2PA 4CU2A 4JXZA 3P4YA 2EKLA 4QPNA 4BNLA 4LXHA 1KO4A 3MERA 4JIGA 4LVOA 1D2AA 5CDFE 1IIRA 3K8QA 1MD9A 2WRZA 4HN4B 4RD4A 4CMIB 4DUPA 6REQA 5CT5A 3P7MA 3D6NB 2V5VA 3CQ9A 1ZH2A 2IP4A 4LOLA 1RCUA 2VP4A 1ENZA 1BNCA 4XDZA 3OU7A 1NUPA 1NZDA 2FJUA 2PV0A 5FLKA 5JSYA 3P2JA 1OJ7A 1Q20A 2VBGA 5J5CA 3NBKA 2QIOA 2XKBA 1P7CA 1B23P 4ZVLA 2E55A 1N3YA 2IA5A 1JA9A 2WMOB 4M22A 4S0XA 1B3RA 1OF1A 1E62A 4WOJA 3QKSA 2GCOB 2YQZA 3HP7A 4FNAA 1IVYA 3PPVA 4JUDX 4B3JA 1A97A 2VATA 1KVTA 1IIBA 1K88A 3G1TA 3GLGB 2XT9A 5HDBB 3GFBA 1CJSA 1KGSA 3PD1A 2ZIFA 3O90A 2AZMA 3X1ZA 4ESHA 4IXWA 4F0JA 2IYUA 2HC9A 2FR8A 4EGCB 1H2AS 3VHXA 3D8SA 5ALVA 4MHTA 4MQ6A 1KVUA 4WOCA 2XV1A 2F1JA 1J0BA 2WI8A 1WPCA 4INOA 1RXUA 2RMKA 3JQ8A 3IR6A 2GARA 2FX5A 4AUNA 1SOAA 1I6KA 4WZBA 4ZANA 1MV8A 3T3HA 3VPBA 1M90D 2LGJA 2UU9B 2FPPA 1DJMA 5HK8A 2CCJA 4X45A 5ICSA 3R7WA 2WNIA 2WHRA 4KCGA 1CSEE 3K53A 3VR5A 2PX0A 2BP7A 3QVXA 1SVWA 1E18A 2JGKA 4WZAA 4DMFA 1J06A 4UBKA 1J2JA 4XR4A 2X0FA 2QP3A 4YASA 1HDOA 2NV4A 1UPBA 4H3KB 5BV7A 1E9VA 2WYOA 4JMQA 2JCBA 4GZMA 5CCDA 3STWA 2BM8A 4DA6A 3QFCA 1ODSA 5AVSA 4JYAB 3VPXA 3EBOA 2F43A 3R3JA 4HKTA 4M0CA 3FN4A 2JFVA 2F8SA 1BAPA 3T3GA 5CFLA 1E1QA 2WZNA 1DAMA 2QE7D 3NVAA 3UF0A 1L8LA 3F6YA 1F1BA 4UE2A 1DEAA 4EENA 5GZ1A 3K0BA 1Q92A 4RYDA 1N9GA 4CXMA 3G9QA 2CXXA 1CKEA 1MN6A 1JDBC 1ZUNA 3I8OA 4K8OA 4UFOA 5FBLB 4QGGA 3TJZA 1PK8A 2Q6LA 3CCEB 3U7HB 4BY9E 4HEA6 2VK4A 5I7HA 4MRMB 2Y9MB 3LNTA 3SSMA 4IX1A 4Z3DA 2WWRA 4OUKX 4WXYB 3UV6A 3B7PA 3NB0A 5A4DA 1AUOA 4HWPA 1JEAA 1TM5E 3HFJA 2QTVA 3H6HA 1P1BA 3ZV7A 2G5TA 2GZSA 2R2AA 3DHWC 3PWTA 4K46A 2I33A 6NULA 3AEXA 4OFXA 4XCQA 5BQ5A 4DJDC 2KX7A 2IX3A 1S0UA 4OQZA 4KLZA 3U37A 3T3IA 5HK9A 5IJ0B 2OGSA 1YJQA 3STHA 4TZ0A 4F38A 4FHZA 1TCUA 1T1JA 3GRCA 1UEXC 3LVQE 1RXYA 3IQGX 3MMSA 4YRRA 1KMHB 4M8IA 4N8EA 3DONA 2IPXA 1VA4A 4A8TA 1PR1A 3W8EA 2HMAA 4RHEA 1WETA 2K87A 3QGMA 5A6VA 3WWCA 3WL3A 4B35A 1RYEA 3E1GA 3IDAA 1MQ9A 3WB2A 1IPFA 1I2MA 2FR8C 4ZMBA 4KX5A 5A4MS 5E1MA 1Z37A 4YUYA 2V58A 4B32A 1BXGB 3PA1A 5AM4A 2ZIXA 5H16A 3SN6A 3F71A 3BQNB 4B40A 3EGEA 5J23A 4DV4B 5JQWA 5ARDA 1IOVA 2WYUA 3C7AA 4G9EA 3B9PA 5K6AA 1POWA 4IPTA 5K0FA 4C3VA 1C3LA 1EFUA 2XGMA 3KQLA 1KOGA 5IVPA 4Y0AA 1MX5A 5FTKA 1YJAA 2BD0A 3DHYA 4ZQCB 1D2CA 1VOTA 4QUIA 3VU9A 1GAQA 4ZQIA 3T7EA 3KTAA 3AKCA 4QODA 3A6GA 2FQQA 4UAVA 7YASA 3CH4B 3P45A 4FMCB 5B3JC 3IAFA 3WTBA 4IJMA 5EFOA 1SBNE 4KSCA 4XKWA 4NZMA 5IYNA 1OXVA 2P8SA 5EQJB 3MJDA 1T6NA 2H4ZA 2ZIZA 3ZIAA 4H4CA 4EA8A 3AUTA 3FMIA 5LJIA 3BHNA 3ML1A 4D79A 1H1TA 5IDVA 5AKEA 3G8DA 2EDAA 1E2FA 4QGAA 3PXGA 3OOWA 1OX5A 1NJ1A 3UK0A 4MVJF 1K08A 2BHSA 4UNRA 2C8JA 1UL1X 4DAEA 2Z9BA 5DS0A 3DZ8A 5INTA 3BCDA 5THQA 3NOXA 5JXHA 5T41A 4CF6A 1SR8A 2AJCA 3AK4A 1QVWA 1HBJA 3PZBA 1SC4A 1PJQA 3QFHA 1XTVA 1HMYA 1PN3A 1ZJ4A 2QRGA 1P75A 2C0CA 2FU5C 1DU4A 4OMDA 1Z0KA 4TWJA 4Y0VA 4CTNA 4E70A 1BU8A 4QPPA 3PHLA 1W5EA 3R5XA 3SWWA 5EFZA 3SR4A 2BUBA 4PSDA 1WVIA 1OXUA 3FZYA 4GR9A 5AH0A 1KI8A 1P1CA 3GX1A 2K6GA 3JD1A 3K0FB 3N2YA 3NAGA 4LA4A 4YJKA