4EHMB

Rabggtase in complex with covalently bound psoromic acid
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
327
structure length
325
Chain Sequence
QKDVTIKSDAPDTLLLEKHADYIASYGSDDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Psoromic Acid is a Selective and Covalent Rab-Prenylation Inhibitor Targeting Autoinhibited RabGGTase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 122
structure length 325
sequence length 327
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4ehmB00
1W6JA 4LNVA 5AGDA 1KZOB 1FT1B 2H6GB 1FT2B 2V3NA 2WIIB 3DSXB 3DSUB 4ZH1A 3PZ4B 3KSQB 1TN8B 3DSVB 3PZ2B 4MU9A 3SQCA 2NOJA 1O6RA 1N9AB 4YDOB 3G6JB 4GTOB 1TN6B 4LNBB 3K7XA 2BEDB 3CU7A 5FO8B 4ONTA 3EU5B 4BOJA 1N4RB 4ZRPA 2B39A 2XQWA 4GTQB 3PZ1B 1TNOB 4M76A 1N4SB 1NL4B 1HZFA 1KZPB 4D4CA 1LD7B 3Q73B 1R76A 1GHQA 1GXMA 4GTVB 1H35A 3SFXB 2H6IB 2G02A 2BB6A 1GSZA 1O1RB 1O79A 4L9PB 4MBGB 1H37A 4V1SA 4YDEB 3RJ3A 2PMVA 1TN7B 3Q78B 1FPPB 2ZIRB 3Q7AB 1TNBB 4KKIA 4GTPB 1TNUB 1GXNA 2V8IA 1W6KA 4EHMB 3DSTB 2I07B 5JPMB 1QBQB 3HXCB 1H39A 3DSSB 3Q79B 3HXDB 3D5RA 4FXGB 2WY8A 2BB5A 1N94B 1SA5B 2A73B 4KKJA 1QSJA 1GXOA 2WY7A 3OXUA 3PZ3B 3EUVB 4ZRQA 1SQCA 2H6FB 1H3AA 2XWJB 5FO9B 3KSLB 1N4PB 3OEDA 2G0DA 3KLSA 3KQ4A 1X81B 1O6HA 1NI1B 1TNYB 1O5MB 1JCRB 1C3DA 4C1SA 3E33B 4GTSB 2ZISB 5JPNB 4BOKA 3HXBB 4V1RA 1JCSB 3E30B 4GTRB 3Q75B 2H6HB 4D4BA 2R2LB 1LTXB 1H3BA 2PN5A 3DSWB 4D4DA 4GTMB 1H3CA 5FO7B 2V3PA 3Q7FB 1QQFA 3E34B 4FXKB 3C72B 1O1TB 1O6QA 1S63B 2F0YB 3D5SA 1D8EB 1JCQB 3SFYB 3HXFB 1TNZB 3E32B 1H36A 2IEJB 1LD8B 2V8KA 4D4AA 4D94A 5FOBB 3DPYB 3E37B 1D8DB 1UMPA 2XWBB 4GTTB 1S64B 1SA4B 3HXEB 1N4QB 2BBCA 1DCEB 2GOXA 4LNGB 1N95B 2WINB 2SQCA 3DRAB 1O1SB 2V8JA 1MZCB
chains in the Genus database with same CATH superfamily
3M72A 1L2AA 2H6GB 1FT2B 2WIIB 3DSXB 1K72A 3W7SA 1TN8B 5ILJA 2BRWA 1KSDA 2FUZA 1RWFA 4EL8A 1AGMA 1KRFA 4MMIA 1X9DA 4YDOB 5GY3A 3M7LA 3CU7A 3EU5B 1N4RB 4YCRA 5IL3A 1N20A 3AFLA 3N0FA 1NL4B 1KZPB 4D4CA 3W7TA 3QT3A 4GTVB 1G87A 4LIXA 1NXCA 4RNQA 3SDTA 4ZH5A 4V1SA 3GZKA 3T33A 1TN7B 1FP3A 1OJMA 3SDQA 2E24A 3Q7AB 1GAIA 1ULVA 1N7PA 1TNBB 4GTPB 1GXNA 3GT5A 3S4AA 1W6KA 4GL3A 3N0GA 3RX7A 3E80A 1QBQB 3Q79B 1H39A 2DRSA 3DSSB 1HV6A 3QRYA 4FXGB 2J5CA 3E73A 2BRPA 4WVCA 1SA5B 3W7UA 2WY7A 2VN4A 3EUVB 1WZZA 2Z07A 5FO9B 2G0DA 3KLSA 2YIKA 1O6HA 3M01A 1JCRB 1N22A 4L6XA 3W7WA 3M78A 5JPNB 2A8ZA 4J5TA 2DRRA 4KTRA 4QT9A 3SDVA 3HXBB 1OJOA 4GTRB 3RRSA 3M7BA 1N23A 4D4BA 5CA3A 3DSWB 1GA2A 3M75A 1J0MA 1UG9A 3VSMA 1QQFA 3E34B 2CQTA 3WIWA 1O6QA 3EQAA 3AFJA 1IS9A 1L1YA 2WDAA 3QG0A 2OKXA 3DPYB 4Z4JA 2RI9A 3G4FA 3ANIA 4E1YA 2D8LA 1WU5A 4CE7A 2BBCA 1DCEB 2EADA 4LNGB 4OZVA 2GZ6A 1W3YA 1KZOB 1FT1B 3PZ4B 3X17A 3E7JA 3KSQB 1GAHA 3DSVB 4MU9A 3WKHA 2NOJA 1H14A 1GLMA 2AHGA 2EABA 3K7XA 5FO8B 3QXFA 5IK9A 2P0VA 4BOJA 2AHFA 1FBWA 2DRQA 1HX9A 4M76A 4DODA 4GAXA 1R76A 1GXMA 1H35A 1KREA 2WCOA 2JG0A 2FBAA 3ACSA 1LXMA 2EAEA 3CIHA 4XUVA 1GSZA 1O1RB 4L9PB 1H37A 3RJ3A 2ONGA 1LF6A 1FPPB 1DL2A 3M71A 2CQSA 1N1BA 2ONHA 3S4DA 1G9JA 5GW7A 2I07B 3HXCB 1X1IA 1RWCA 3HXDB 3D5RA 1KFGA 5DHKA 3SDRA 5GZKA 1N94B 3RX8A 3WUXA 3QSPA 4ZRQA 4WVAA 1H3AA 2XWJB 1N7NA 1N4PB 3OEDA 4F13A 3KQ4A 1IA6A 1NI1B 1TNYB 4FNVA 3M74A 4C1SA 2FUQA 2FV1A 2ZISB 3RENA 1IA7A 4OJZA 4BOKA 3E30B 1RW9A 3G4DA 5IM1A 2R2LB 5ILHA 1H3BA 3H3KA 4FUSA 5DGRA 3M76A 2RI8A 3SDUA 4OK2A 4FXKB 4KTPA 3C72B 1FAEA 1S63B 3WIRA 2ZZRA 1CB8A 1C82A 3S9VA 2V8KA 4D94A 5FOBB 3M02A 1FBOA 1TF4A 4JJJA 3HXEB 3WKIA 3WKFA 5ILKA 1CLCA 1N95B 2RGKA 1FMIA 3DRAB 3SAEA 1KSCA 1G6IA 5ILDA 5IKHA 1W6JA 4CJ0A 3A3VA 5CD2A 3RX5A 1RWHA 5IK6A 3S4BA 1HMWA 3PMMA 2X03A 3PZ2B 3W5MA 2FV0A 5EATA 1FCEA 1N7OA 1O6RA 3G6JB 4GTOB 4LNBB 5E2JA 4ONTA 4ZRPA 5EAUA 1N21A 1HCUA 5M7IA 2B39A 3PYBA 3PZ1B 1KKTA 1TNOB 1HZFA 1LD7B 3PYAA 3Q73B 1FO2A 1RWAA 1GHQA 2Q1FA 3SFXB 1O79A 5ILIA 5JMFA 1F9OA 2PMVA 3Q78B 2F6DA 1V5CA 3EU8A 4KKIA 1TNUB 2V8IA 3QFZA 4WU0A 4F10A 3DSTB 1KS8A 4AYRA 3M7CA 4Q88A 2WY8A 1HM3A 3M7EA 2A73B 3P5RA 1OJNA 4KKJA 1QSJA 1GXOA 2E22A 3ANKA 1SQCA 2H6FB 3KSLB 1RQ5A 2EACA 5IL8A 1RWGA 1O5MB 3VSNA 4WVBA 1N24A 4Z4LA 1C3DA 3W5NA 4CJ1A 4GTSB 3M00A 1H54A 1HXGA 3Q75B 1XW2A 2H6HB 4OZWA 5KKBA 1UT9A 5FO7B 2V3PA 1EGUA 2QNOA 3LZ9A 2NVPA 5ILZA 3WIQA 2BRVX 1JCQB 3SFYB 1J0NA 3HXFB 1TNZB 1H36A 1N7QA 1LD8B 4D4AA 1XWQA 3E37B 3W7XA 1D8DB 4GTTB 1CEMA 2DROA 2JJBA 1SA4B 1N4QB 3M73A 2WINB 2SQCA 1HXAA 1O1SB 1MZCB 4LNVA 5AGDA 3RSYA 2V3NA 3DSUB 4ZH1A 1LXKA 3QPFA 4TXTA 3SQCA 1F9GA 1NC5A 1N9AB 1HN0A 3ANJA 1V7WA 1TN6B 2BEDB 3E6UA 2XQWA 3WKGA 2D5JA 4GTQB 3M77A 1N4SB 4AYOA 1QAZA 1HXCA 4L0GA 4DOEA 4DI5A 3QT9A 1F9DA 1WU6A 3A0OA 2H6IB 1OJPA 4FJQA 2G02A 1V7VA 2BB6A 3GLYA 4OK4A 4MBGB 4YDEB 3QFYA 2WYNA 1LF9A 3NFVA 1G9GA 5EASA 5MEHA 2ZIRB 2B4FA 3P2CA 5C05A 3VXDA 1F1SA 4EHMB 1V5DA 1X1HA 3S4CA 5JPMB 1N7RA 5DHIA 1LOHA 4NEIA 1V7XA 1AYXA 2ZBLA 2BB5A 4TF4A 3D3IA 3OXUA 3PZ3B 4ZG8A 5JMDA 3H2WA 3H7LA 1X1JA 3P5PA 1X81B 1H13A 2JF4A 1HM2A 5ILYA 5IK0A 3E33B 1XWTA 1KWFA 3QXQA 3QDEA 4V1RA 1JCSB 5DGQA 1LTXB 3NNBA 1I8QA 2PN5A 5IKAA 5CZLA 3EZ8A 4Q2BA 2XFGA 4D4DA 4GTMB 1HMUA 1H3CA 2VN7A 3Q7FB 1H12A 2AFAA 3WC3A 1O1TB 1JS4A 2F0YB 5M7YA 3D5SA 3VW5A 1D8EB 3K11A 4MMHA 3TF4A 3E32B 2IEJB 4AYPA 2GH4A 4AYQA 2FUTA 1UMPA 2XWBB 3QWTA 1WU4A 1FO3A 1S64B 1N1ZA 1VD5A 2GOXA 1DOGA 3ACTA 3ON6A 2V8JA
chains in the Genus database with same CATH topology
3M72A 1L2AA 2H6GB 1FT2B 2WIIB 3DSXB 1K72A 3W7SA 1TN8B 2FUZA 1KSDA 4EL8A 1AGMA 1KRFA 1X9DA 4YDOB 5GY3A 3M7LA 3CU7A 3EU5B 1N4RB 4YCRA 1NL4B 1KZPB 4D4CA 3W7TA 3QT3A 4GTVB 1G87A 4LIXA 1NXCA 3SDTA 4ZH5A 4V1SA 3GZKA 3T33A 1TN7B 1FP3A 3SDQA 3Q7AB 1GAIA 1ULVA 1TNBB 4GTPB 1GXNA 3GT5A 3S4AA 1W6KA 4GL3A 3RX7A 1QBQB 3Q79B 1H39A 2DRSA 3DSSB 3QRYA 4FXGB 3E73A 4WVCA 1SA5B 3W7UA 2WY7A 2VN4A 3EUVB 1WZZA 2Z07A 5FO9B 2G0DA 3KLSA 2YIKA 1O6HA 1JCRB 4L6XA 3W7WA 3M78A 5JPNB 2A8ZA 4J5TA 2DRRA 4KTRA 4QT9A 3SDVA 3HXBB 4GTRB 3RRSA 3M7BA 4D4BA 5CA3A 3DSWB 1GA2A 3M75A 1UG9A 1QQFA 3E34B 2CQTA 3WIWA 1O6QA 3EQAA 3AFJA 1IS9A 1L1YA 3QG0A 2OKXA 3DPYB 4Z4JA 2RI9A 3ANIA 2D8LA 1WU5A 4CE7A 2BBCA 1DCEB 2EADA 4LNGB 2GZ6A 1KZOB 1FT1B 3PZ4B 3X17A 3KSQB 1GAHA 3DSVB 4MU9A 3WKHA 2NOJA 1H14A 1GLMA 2AHGA 2EABA 3K7XA 5FO8B 3QXFA 2P0VA 4BOJA 2AHFA 1FBWA 2DRQA 4M76A 4DODA 1R76A 1GXMA 1H35A 1KREA 2JG0A 2FBAA 3ACSA 2EAEA 3CIHA 4XUVA 1GSZA 1O1RB 4L9PB 1H37A 3RJ3A 1LF6A 1FPPB 1DL2A 3M71A 2CQSA 3S4DA 1G9JA 5GW7A 2I07B 3HXCB 3HXDB 3D5RA 1KFGA 3SDRA 5GZKA 1N94B 3RX8A 3WUXA 3QSPA 4ZRQA 4WVAA 1H3AA 2XWJB 1N4PB 3OEDA 3KQ4A 1IA6A 1NI1B 1TNYB 3M74A 4C1SA 2FV1A 2ZISB 3RENA 1IA7A 4BOKA 3E30B 2R2LB 1H3BA 3H3KA 4FUSA 5DGRA 3M76A 2RI8A 3SDUA 4FXKB 4KTPA 3C72B 1FAEA 1S63B 3WIRA 2ZZRA 3S9VA 2V8KA 4D94A 5FOBB 1FBOA 1TF4A 4JJJA 3HXEB 3WKIA 3WKFA 1CLCA 1N95B 2RGKA 1FMIA 3DRAB 3SAEA 1KSCA 1G6IA 1W6JA 4CJ0A 3A3VA 5CD2A 3RX5A 3S4BA 3PMMA 3PZ2B 3W5MA 2FV0A 1FCEA 1O6RA 3G6JB 4GTOB 4LNBB 5E2JA 4ONTA 4ZRPA 1HCUA 5M7IA 2B39A 3PYBA 3PZ1B 1KKTA 1TNOB 1HZFA 1LD7B 3PYAA 3Q73B 1FO2A 1GHQA 3SFXB 1O79A 1F9OA 2PMVA 3Q78B 2F6DA 1V5CA 3EU8A 4KKIA 1TNUB 2V8IA 3QFZA 4WU0A 3DSTB 1KS8A 4AYRA 3M7CA 4Q88A 2WY8A 3M7EA 2A73B 3P5RA 4KKJA 1QSJA 1GXOA 3ANKA 1SQCA 2H6FB 3KSLB 1RQ5A 2EACA 1O5MB 4WVBA 4Z4LA 3W5NA 1C3DA 4CJ1A 4GTSB 1H54A 3Q75B 1XW2A 2H6HB 5KKBA 1UT9A 5FO7B 2V3PA 2QNOA 2NVPA 3WIQA 1JCQB 3SFYB 3HXFB 1TNZB 1H36A 1LD8B 4D4AA 1XWQA 3E37B 3W7XA 1D8DB 4GTTB 1CEMA 2DROA 2JJBA 1SA4B 1N4QB 3M73A 2WINB 2SQCA 1O1SB 1MZCB 4LNVA 5AGDA 3RSYA 2V3NA 3DSUB 4ZH1A 3QPFA 4TXTA 3SQCA 1NC5A 1N9AB 3ANJA 1V7WA 1TN6B 2BEDB 3E6UA 2XQWA 3WKGA 2D5JA 4GTQB 3M77A 1N4SB 4AYOA 4L0GA 4DOEA 3QT9A 1F9DA 1WU6A 2H6IB 2G02A 1V7VA 2BB6A 3GLYA 4MBGB 4YDEB 3QFYA 2WYNA 1LF9A 1G9GA 5MEHA 2ZIRB 2B4FA 3P2CA 3VXDA 4EHMB 1V5DA 3S4CA 5JPMB 1V7XA 1AYXA 2ZBLA 2BB5A 4TF4A 3D3IA 3OXUA 3PZ3B 4ZG8A 3H2WA 3H7LA 3P5PA 1X81B 1H13A 2JF4A 3E33B 1XWTA 1KWFA 3QXQA 3QDEA 4V1RA 1JCSB 5DGQA 1LTXB 2PN5A 5CZLA 3EZ8A 4Q2BA 2XFGA 4D4DA 4GTMB 1H3CA 2VN7A 3Q7FB 1H12A 2AFAA 3WC3A 1O1TB 1JS4A 2F0YB 5M7YA 3D5SA 3VW5A 1D8EB 3K11A 3TF4A 3E32B 2IEJB 4AYPA 2GH4A 4AYQA 3QWTA 1UMPA 2XWBB 1WU4A 1FO3A 1S64B 1VD5A 2GOXA 1DOGA 3ACTA 3ON6A 2V8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W6J A;  4LNV A;  5AGD A;  1KZO B;  1FT1 B;  2H6G B;  1FT2 B;  2V3N A;  2WII B;  3DSX B;  3DSU B;  4ZH1 A;  3PZ4 B;  3KSQ B;  1TN8 B;  3DSV B;  3PZ2 B;  4MU9 A;  3SQC A;  2NOJ A;  1O6R A;  1N9A B;  4YDO B;  3G6J B;  4GTO B;  1TN6 B;  4LNB B;  3K7X A;  2BED B;  3CU7 A;  5FO8 B;  4ONT A;  3EU5 B;  4BOJ A;  1N4R B;  4ZRP A;  2B39 A;  2XQW A;  4GTQ B;  3PZ1 B;  1TNO B;  4M76 A;  1N4S B;  1NL4 B;  1HZF A;  1KZP B;  4D4C A;  1LD7 B;  3Q73 B;  1R76 A;  1GHQ A;  1GXM A;  4GTV B;  1H35 A;  3SFX B;  2H6I B;  2G02 A;  2BB6 A;  1GSZ A;  1O1R B;  1O79 A;  4L9P B;  4MBG B;  1H37 A;  4V1S A;  4YDE B;  3RJ3 A;  2PMV A;  1TN7 B;  3Q78 B;  1FPP B;  2ZIR B;  3Q7A B;  1TNB B;  4KKI A;  4GTP B;  1TNU B;  1GXN A;  2V8I A;  1W6K A;  4EHM B;  3DST B;  2I07 B;  5JPM B;  1QBQ B;  3HXC B;  1H39 A;  3DSS B;  3Q79 B;  3HXD B;  3D5R A;  4FXG B;  2WY8 A;  2BB5 A;  1N94 B;  1SA5 B;  2A73 B;  4KKJ A;  1QSJ A;  1GXO A;  2WY7 A;  3OXU A;  3PZ3 B;  3EUV B;  4ZRQ A;  1SQC A;  2H6F B;  1H3A A;  2XWJ B;  5FO9 B;  3KSL B;  1N4P B;  3OED A;  2G0D A;  3KLS A;  3KQ4 A;  1X81 B;  1O6H A;  1NI1 B;  1TNY B;  1O5M B;  1JCR B;  1C3D A;  4C1S A;  3E33 B;  4GTS B;  2ZIS B;  5JPN B;  4BOK A;  3HXB B;  4V1R A;  1JCS B;  3E30 B;  4GTR B;  3Q75 B;  2H6H B;  4D4B A;  2R2L B;  1LTX B;  1H3B A;  2PN5 A;  3DSW B;  4D4D A;  4GTM B;  1H3C A;  5FO7 B;  2V3P A;  3Q7F B;  1QQF A;  3E34 B;  4FXK B;  3C72 B;  1O1T B;  1O6Q A;  1S63 B;  2F0Y B;  3D5S A;  1D8E B;  1JCQ B;  3SFY B;  3HXF B;  1TNZ B;  3E32 B;  1H36 A;  2IEJ B;  1LD8 B;  2V8K A;  4D4A A;  4D94 A;  5FOB B;  3DPY B;  3E37 B;  1D8D B;  1UMP A;  2XWB B;  4GTT B;  1S64 B;  1SA4 B;  3HXE B;  1N4Q B;  2BBC A;  1DCE B;  2GOX A;  4LNG B;  1N95 B;  2WIN B;  2SQC A;  3DRA B;  1O1S B;  2V8J A;  1MZC B; 
#chains in the Genus database with same CATH topology
 3M72 A;  1L2A A;  2H6G B;  1FT2 B;  2WII B;  3DSX B;  1K72 A;  3W7S A;  1TN8 B;  5ILJ A;  2BRW A;  1KSD A;  2FUZ A;  1RWF A;  4EL8 A;  1AGM A;  1KRF A;  4MMI A;  1X9D A;  4YDO B;  5GY3 A;  3M7L A;  3CU7 A;  3EU5 B;  1N4R B;  4YCR A;  5IL3 A;  1N20 A;  3AFL A;  3N0F A;  1NL4 B;  1KZP B;  4D4C A;  3W7T A;  3QT3 A;  4GTV B;  1G87 A;  4LIX A;  1NXC A;  4RNQ A;  3SDT A;  4ZH5 A;  4V1S A;  3GZK A;  3T33 A;  1TN7 B;  1FP3 A;  1OJM A;  3SDQ A;  2E24 A;  3Q7A B;  1GAI A;  1ULV A;  1N7P A;  1TNB B;  4GTP B;  1GXN A;  3GT5 A;  3S4A A;  1W6K A;  4GL3 A;  3N0G A;  3RX7 A;  3E80 A;  1QBQ B;  3Q79 B;  1H39 A;  2DRS A;  3DSS B;  1HV6 A;  3QRY A;  4FXG B;  2J5C A;  3E73 A;  2BRP A;  4WVC A;  1SA5 B;  3W7U A;  2WY7 A;  2VN4 A;  3EUV B;  1WZZ A;  2Z07 A;  5FO9 B;  2G0D A;  3KLS A;  2YIK A;  1O6H A;  3M01 A;  1JCR B;  1N22 A;  4L6X A;  3W7W A;  3M78 A;  5JPN B;  2A8Z A;  4J5T A;  2DRR A;  4KTR A;  4QT9 A;  3SDV A;  3HXB B;  1OJO A;  4GTR B;  3RRS A;  3M7B A;  1N23 A;  4D4B A;  5CA3 A;  3DSW B;  1GA2 A;  3M75 A;  1J0M A;  1UG9 A;  3VSM A;  1QQF A;  3E34 B;  2CQT A;  3WIW A;  1O6Q A;  3EQA A;  3AFJ A;  1IS9 A;  1L1Y A;  2WDA A;  3QG0 A;  2OKX A;  3DPY B;  4Z4J A;  2RI9 A;  3G4F A;  3ANI A;  4E1Y A;  2D8L A;  1WU5 A;  4CE7 A;  2BBC A;  1DCE B;  2EAD A;  4LNG B;  4OZV A;  2GZ6 A;  1W3Y A;  1KZO B;  1FT1 B;  3PZ4 B;  3X17 A;  3E7J A;  3KSQ B;  1GAH A;  3DSV B;  4MU9 A;  3WKH A;  2NOJ A;  1H14 A;  1GLM A;  2AHG A;  2EAB A;  3K7X A;  5FO8 B;  3QXF A;  5IK9 A;  2P0V A;  4BOJ A;  2AHF A;  1FBW A;  2DRQ A;  1HX9 A;  4M76 A;  4DOD A;  4GAX A;  1R76 A;  1GXM A;  1H35 A;  1KRE A;  2WCO A;  2JG0 A;  2FBA A;  3ACS A;  1LXM A;  2EAE A;  3CIH A;  4XUV A;  1GSZ A;  1O1R B;  4L9P B;  1H37 A;  3RJ3 A;  2ONG A;  1LF6 A;  1FPP B;  1DL2 A;  3M71 A;  2CQS A;  1N1B A;  2ONH A;  3S4D A;  1G9J A;  5GW7 A;  2I07 B;  3HXC B;  1X1I A;  1RWC A;  3HXD B;  3D5R A;  1KFG A;  5DHK A;  3SDR A;  5GZK A;  1N94 B;  3RX8 A;  3WUX A;  3QSP A;  4ZRQ A;  4WVA A;  1H3A A;  2XWJ B;  1N7N A;  1N4P B;  3OED A;  4F13 A;  3KQ4 A;  1IA6 A;  1NI1 B;  1TNY B;  4FNV A;  3M74 A;  4C1S A;  2FUQ A;  2FV1 A;  2ZIS B;  3REN A;  1IA7 A;  4OJZ A;  4BOK A;  3E30 B;  1RW9 A;  3G4D A;  5IM1 A;  2R2L B;  5ILH A;  1H3B A;  3H3K A;  4FUS A;  5DGR A;  3M76 A;  2RI8 A;  3SDU A;  4OK2 A;  4FXK B;  4KTP A;  3C72 B;  1FAE A;  1S63 B;  3WIR A;  2ZZR A;  1CB8 A;  1C82 A;  3S9V A;  2V8K A;  4D94 A;  5FOB B;  3M02 A;  1FBO A;  1TF4 A;  4JJJ A;  3HXE B;  3WKI A;  3WKF A;  5ILK A;  1CLC A;  1N95 B;  2RGK A;  1FMI A;  3DRA B;  3SAE A;  1KSC A;  1G6I A;  5ILD A;  5IKH A;  1W6J A;  4CJ0 A;  3A3V A;  5CD2 A;  3RX5 A;  1RWH A;  5IK6 A;  3S4B A;  1HMW A;  3PMM A;  2X03 A;  3PZ2 B;  3W5M A;  2FV0 A;  5EAT A;  1FCE A;  1N7O A;  1O6R A;  3G6J B;  4GTO B;  4LNB B;  5E2J A;  4ONT A;  4ZRP A;  5EAU A;  1N21 A;  1HCU A;  5M7I A;  2B39 A;  3PYB A;  3PZ1 B;  1KKT A;  1TNO B;  1HZF A;  1LD7 B;  3PYA A;  3Q73 B;  1FO2 A;  1RWA A;  1GHQ A;  2Q1F A;  3SFX B;  1O79 A;  5ILI A;  5JMF A;  1F9O A;  2PMV A;  3Q78 B;  2F6D A;  1V5C A;  3EU8 A;  4KKI A;  1TNU B;  2V8I A;  3QFZ A;  4WU0 A;  4F10 A;  3DST B;  1KS8 A;  4AYR A;  3M7C A;  4Q88 A;  2WY8 A;  1HM3 A;  3M7E A;  2A73 B;  3P5R A;  1OJN A;  4KKJ A;  1QSJ A;  1GXO A;  2E22 A;  3ANK A;  1SQC A;  2H6F B;  3KSL B;  1RQ5 A;  2EAC A;  5IL8 A;  1RWG A;  1O5M B;  3VSN A;  4WVB A;  1N24 A;  4Z4L A;  1C3D A;  3W5N A;  4CJ1 A;  4GTS B;  3M00 A;  1H54 A;  1HXG A;  3Q75 B;  1XW2 A;  2H6H B;  4OZW A;  5KKB A;  1UT9 A;  5FO7 B;  2V3P A;  1EGU A;  2QNO A;  3LZ9 A;  2NVP A;  5ILZ A;  3WIQ A;  2BRV X;  1JCQ B;  3SFY B;  1J0N A;  3HXF B;  1TNZ B;  1H36 A;  1N7Q A;  1LD8 B;  4D4A A;  1XWQ A;  3E37 B;  3W7X A;  1D8D B;  4GTT B;  1CEM A;  2DRO A;  2JJB A;  1SA4 B;  1N4Q B;  3M73 A;  2WIN B;  2SQC A;  1HXA A;  1O1S B;  1MZC B;  4LNV A;  5AGD A;  3RSY A;  2V3N A;  3DSU B;  4ZH1 A;  1LXK A;  3QPF A;  4TXT A;  3SQC A;  1F9G A;  1NC5 A;  1N9A B;  1HN0 A;  3ANJ A;  1V7W A;  1TN6 B;  2BED B;  3E6U A;  2XQW A;  3WKG A;  2D5J A;  4GTQ B;  3M77 A;  1N4S B;  4AYO A;  1QAZ A;  1HXC A;  4L0G A;  4DOE A;  4DI5 A;  3QT9 A;  1F9D A;  1WU6 A;  3A0O A;  2H6I B;  1OJP A;  4FJQ A;  2G02 A;  1V7V A;  2BB6 A;  3GLY A;  4OK4 A;  4MBG B;  4YDE B;  3QFY A;  2WYN A;  1LF9 A;  3NFV A;  1G9G A;  5EAS A;  5MEH A;  2ZIR B;  2B4F A;  3P2C A;  5C05 A;  3VXD A;  1F1S A;  4EHM B;  1V5D A;  1X1H A;  3S4C A;  5JPM B;  1N7R A;  5DHI A;  1LOH A;  4NEI A;  1V7X A;  1AYX A;  2ZBL A;  2BB5 A;  4TF4 A;  3D3I A;  3OXU A;  3PZ3 B;  4ZG8 A;  5JMD A;  3H2W A;  3H7L A;  1X1J A;  3P5P A;  1X81 B;  1H13 A;  2JF4 A;  1HM2 A;  5ILY A;  5IK0 A;  3E33 B;  1XWT A;  1KWF A;  3QXQ A;  3QDE A;  4V1R A;  1JCS B;  5DGQ A;  1LTX B;  3NNB A;  1I8Q A;  2PN5 A;  5IKA A;  5CZL A;  3EZ8 A;  4Q2B A;  2XFG A;  4D4D A;  4GTM B;  1HMU A;  1H3C A;  2VN7 A;  3Q7F B;  1H12 A;  2AFA A;  3WC3 A;  1O1T B;  1JS4 A;  2F0Y B;  5M7Y A;  3D5S A;  3VW5 A;  1D8E B;  3K11 A;  4MMH A;  3TF4 A;  3E32 B;  2IEJ B;  4AYP A;  2GH4 A;  4AYQ A;  2FUT A;  1UMP A;  2XWB B;  3QWT A;  1WU4 A;  1FO3 A;  1S64 B;  1N1Z A;  1VD5 A;  2GOX A;  1DOG A;  3ACT A;  3ON6 A;  2V8J A; 
#chains in the Genus database with same CATH homology
 3M72 A;  1L2A A;  2H6G B;  1FT2 B;  2WII B;  3DSX B;  1K72 A;  3W7S A;  1TN8 B;  2FUZ A;  1KSD A;  4EL8 A;  1AGM A;  1KRF A;  1X9D A;  4YDO B;  5GY3 A;  3M7L A;  3CU7 A;  3EU5 B;  1N4R B;  4YCR A;  1NL4 B;  1KZP B;  4D4C A;  3W7T A;  3QT3 A;  4GTV B;  1G87 A;  4LIX A;  1NXC A;  3SDT A;  4ZH5 A;  4V1S A;  3GZK A;  3T33 A;  1TN7 B;  1FP3 A;  3SDQ A;  3Q7A B;  1GAI A;  1ULV A;  1TNB B;  4GTP B;  1GXN A;  3GT5 A;  3S4A A;  1W6K A;  4GL3 A;  3RX7 A;  1QBQ B;  3Q79 B;  1H39 A;  2DRS A;  3DSS B;  3QRY A;  4FXG B;  3E73 A;  4WVC A;  1SA5 B;  3W7U A;  2WY7 A;  2VN4 A;  3EUV B;  1WZZ A;  2Z07 A;  5FO9 B;  2G0D A;  3KLS A;  2YIK A;  1O6H A;  1JCR B;  4L6X A;  3W7W A;  3M78 A;  5JPN B;  2A8Z A;  4J5T A;  2DRR A;  4KTR A;  4QT9 A;  3SDV A;  3HXB B;  4GTR B;  3RRS A;  3M7B A;  4D4B A;  5CA3 A;  3DSW B;  1GA2 A;  3M75 A;  1UG9 A;  1QQF A;  3E34 B;  2CQT A;  3WIW A;  1O6Q A;  3EQA A;  3AFJ A;  1IS9 A;  1L1Y A;  3QG0 A;  2OKX A;  3DPY B;  4Z4J A;  2RI9 A;  3ANI A;  2D8L A;  1WU5 A;  4CE7 A;  2BBC A;  1DCE B;  2EAD A;  4LNG B;  2GZ6 A;  1KZO B;  1FT1 B;  3PZ4 B;  3X17 A;  3KSQ B;  1GAH A;  3DSV B;  4MU9 A;  3WKH A;  2NOJ A;  1H14 A;  1GLM A;  2AHG A;  2EAB A;  3K7X A;  5FO8 B;  3QXF A;  2P0V A;  4BOJ A;  2AHF A;  1FBW A;  2DRQ A;  4M76 A;  4DOD A;  1R76 A;  1GXM A;  1H35 A;  1KRE A;  2JG0 A;  2FBA A;  3ACS A;  2EAE A;  3CIH A;  4XUV A;  1GSZ A;  1O1R B;  4L9P B;  1H37 A;  3RJ3 A;  1LF6 A;  1FPP B;  1DL2 A;  3M71 A;  2CQS A;  3S4D A;  1G9J A;  5GW7 A;  2I07 B;  3HXC B;  3HXD B;  3D5R A;  1KFG A;  3SDR A;  5GZK A;  1N94 B;  3RX8 A;  3WUX A;  3QSP A;  4ZRQ A;  4WVA A;  1H3A A;  2XWJ B;  1N4P B;  3OED A;  3KQ4 A;  1IA6 A;  1NI1 B;  1TNY B;  3M74 A;  4C1S A;  2FV1 A;  2ZIS B;  3REN A;  1IA7 A;  4BOK A;  3E30 B;  2R2L B;  1H3B A;  3H3K A;  4FUS A;  5DGR A;  3M76 A;  2RI8 A;  3SDU A;  4FXK B;  4KTP A;  3C72 B;  1FAE A;  1S63 B;  3WIR A;  2ZZR A;  3S9V A;  2V8K A;  4D94 A;  5FOB B;  1FBO A;  1TF4 A;  4JJJ A;  3HXE B;  3WKI A;  3WKF A;  1CLC A;  1N95 B;  2RGK A;  1FMI A;  3DRA B;  3SAE A;  1KSC A;  1G6I A;  1W6J A;  4CJ0 A;  3A3V A;  5CD2 A;  3RX5 A;  3S4B A;  3PMM A;  3PZ2 B;  3W5M A;  2FV0 A;  1FCE A;  1O6R A;  3G6J B;  4GTO B;  4LNB B;  5E2J A;  4ONT A;  4ZRP A;  1HCU A;  5M7I A;  2B39 A;  3PYB A;  3PZ1 B;  1KKT A;  1TNO B;  1HZF A;  1LD7 B;  3PYA A;  3Q73 B;  1FO2 A;  1GHQ A;  3SFX B;  1O79 A;  1F9O A;  2PMV A;  3Q78 B;  2F6D A;  1V5C A;  3EU8 A;  4KKI A;  1TNU B;  2V8I A;  3QFZ A;  4WU0 A;  3DST B;  1KS8 A;  4AYR A;  3M7C A;  4Q88 A;  2WY8 A;  3M7E A;  2A73 B;  3P5R A;  4KKJ A;  1QSJ A;  1GXO A;  3ANK A;  1SQC A;  2H6F B;  3KSL B;  1RQ5 A;  2EAC A;  1O5M B;  4WVB A;  4Z4L A;  3W5N A;  1C3D A;  4CJ1 A;  4GTS B;  1H54 A;  3Q75 B;  1XW2 A;  2H6H B;  5KKB A;  1UT9 A;  5FO7 B;  2V3P A;  2QNO A;  2NVP A;  3WIQ A;  1JCQ B;  3SFY B;  3HXF B;  1TNZ B;  1H36 A;  1LD8 B;  4D4A A;  1XWQ A;  3E37 B;  3W7X A;  1D8D B;  4GTT B;  1CEM A;  2DRO A;  2JJB A;  1SA4 B;  1N4Q B;  3M73 A;  2WIN B;  2SQC A;  1O1S B;  1MZC B;  4LNV A;  5AGD A;  3RSY A;  2V3N A;  3DSU B;  4ZH1 A;  3QPF A;  4TXT A;  3SQC A;  1NC5 A;  1N9A B;  3ANJ A;  1V7W A;  1TN6 B;  2BED B;  3E6U A;  2XQW A;  3WKG A;  2D5J A;  4GTQ B;  3M77 A;  1N4S B;  4AYO A;  4L0G A;  4DOE A;  3QT9 A;  1F9D A;  1WU6 A;  2H6I B;  2G02 A;  1V7V A;  2BB6 A;  3GLY A;  4MBG B;  4YDE B;  3QFY A;  2WYN A;  1LF9 A;  1G9G A;  5MEH A;  2ZIR B;  2B4F A;  3P2C A;  3VXD A;  4EHM B;  1V5D A;  3S4C A;  5JPM B;  1V7X A;  1AYX A;  2ZBL A;  2BB5 A;  4TF4 A;  3D3I A;  3OXU A;  3PZ3 B;  4ZG8 A;  3H2W A;  3H7L A;  3P5P A;  1X81 B;  1H13 A;  2JF4 A;  3E33 B;  1XWT A;  1KWF A;  3QXQ A;  3QDE A;  4V1R A;  1JCS B;  5DGQ A;  1LTX B;  2PN5 A;  5CZL A;  3EZ8 A;  4Q2B A;  2XFG A;  4D4D A;  4GTM B;  1H3C A;  2VN7 A;  3Q7F B;  1H12 A;  2AFA A;  3WC3 A;  1O1T B;  1JS4 A;  2F0Y B;  5M7Y A;  3D5S A;  3VW5 A;  1D8E B;  3K11 A;  3TF4 A;  3E32 B;  2IEJ B;  4AYP A;  2GH4 A;  4AYQ A;  3QWT A;  1UMP A;  2XWB B;  1WU4 A;  1FO3 A;  1S64 B;  1VD5 A;  2GOX A;  1DOG A;  3ACT A;  3ON6 A;  2V8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...