4EHVA

Human p38 map kinase in complex with np-f10 and rl87
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
337
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Natural-product-derived fragments for fragment-based ligand discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
total genus 111
structure length 337
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ehvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ehvA01
3PWDA 5HX6A 2H9VA 4NH1A 1IEPA 4FKIA 4ALUA 2Q0BA 2OXYA 2C0OA 3ZH8A 4DITA 3NZ0A 2GNGA 3QZIA 4IDTA 4M66A 1ZMWA 2ITOA 2O63A 3UOHA 2GFSA 3UJGA 2QONA 1PXLA 4DEBA 1PXMA 3KGAA 3EYGA 2ZDTA 4S32A 3DNDA 3BQCA 3C0HA 2J5EA 1JKTA 3NGAA 4TNBA 2C5OA 5CSHA 4UY9A 3OVVA 5KBQA 1J91A 4O7TA 3E8CA 4IJPA 4HPTE 2E9NA 4RWIA 3QKLA 1LEWA 1PXIA 4FSNA 4EKLA 2GU8A 4F0FA 4U40A 1Q61A 3FLWA 2UZTA 5DYJA 4JG7A 5M09A 3UVPA 3GEQA 3DY7A 4IAAA 4L00A 4CG9A 5C8KA 3QX4A 4HPUE 3LPBA 4AFJA 1H26A 2B1PA 3HV3A 3MVHA 5EHOA 4WD5A 3NS9A 3VBXA 3M1SA 3JXWA 4DCEA 5EKOA 2VTNA 4LRJA 3TACA 4CNHA 3O8PA 3UIUA 5CF4A 3VRYA 2ITPA 3AC4A 3AMBA 2GHLA 3H30A 3D15A 4BDEA 4QPAA 3LOKA 4APCA 4QP8A 3CQWA 4YHJA 5IQGA 1M2QA 4Y5QA 4BGGA 4M97A 4NL0A 4NTSA 2X1NA 4EK3A 3DLZA 4G6NA 5H8GA 4K11A 3KFAA 4ZLYA 5J7HA 4J96A 5CXZA 4E5BA 4XYFA 5HICA 3WOWA 4DFYA 3GP0A 5IA5A 2B4SB 4EOSA 5JFVA 4O86A 5IQCA 1KE7A 4EYMA 4D1ZA 1U4DA 3COKA 4E5AX 2CKPA 5HESA 4AOIA 4IIRA 1BL6A 5ANEA 5DG5A 4F9AA 5H8EA 1M14A 3C0IA 5J79A 5JGAA 4O6EA 1K3AA 2OZAA 4IZ5A 1MUOA 1WAKA 3QF9A 3ZUUA 4C0TA 3HAVA 3CLYA 1NVSA 2FSLX 4ASZA 4YJNA 2OU7A 1RJBA 5E90A 4MXXA 2G2HA 2UZWE 5DEYA 4AE6A 4M12A 5GIOE 1U5RA 3UZTA 4NSTA 4O2PA 5JH6A 4PDOA 3FYJX 3IOKA 3KXHA 4NW6A 4JBPA 4FTCA 4MQ1A 1GZKA 2F57A 4J99A 4QYFA 1XBCA 2VTSA 1SZMA 5L4QA 4GFOA 3OEZA 3OT8A 5EHYA 4BWKA 4NJ3A 4W4XA 4A9SA 3H3CA 2ETKA 3O2MA 5DRBA 2VN9A 4GV1A 3LFFA 4L3LA 3DV3A 2I0VA 2WEIA 2YM3A 3IGOA 4ZZMA 4FV3A 4E6CA 4EOKA 4FODA 3VIDA 2C6DA 3ZXZA 3R63A 5CSWA 4O1OA 1BKXA 3LFNA 4BHZA 5AR3A 1J1BA 2CNUA 2XH5A 2VTIA 3SHEA 2F2CB 3OCGA 4QMTA 1IASA 3P79A 4FIFA 4ZJJA 3L9LA 4LFIA 4KBCA 1V1KA 4NJDA 3F7WA 4OBOA 5EYDA 4RQKA 4OAUC 3NW7A 4PDPA 3WIKA 4OTPA 5EOBA 3TIYA 5ITAA 5I3OA 1KE8A 2XIYA 1GIHA 3SQQA 1U46A 3NYNA 1Q41A 1AQ1A 4EOQA 1V0BA 2HZIA 4BIBA 3MA6A 4LOQA 1Q5KA 4IB1A 4BCNA 5M08A 3GCSA 4FNYA 4FIHA 4EWHA 4QQJA 3N4UA 5EQEA 4GJ3A 4E6DA 4JNWA 3KK9A 3W2CA 2B0QA 1QL6A 3WZKA 2BAJA 2OG8A 4NK9A 1A48A 4DINA 2QOKA 4YJTA 4PDSA 4DFUA 4C38A 2JEDA 5CT7A 3PPZA 4RLKA 4GG5A 2C0IA 4R8QA 4X3FA 5F1ZA 1SMHA 3VS0A 5IDPA 4X7QA 4RWLA 1WCCA 4E73A 4ALVA 1KSWA 4BKYA 2YJSA 4OBQA 5E8UA 3KVWA 4YJRA 3ALNA 5AP1A 5H3QA 1RQQA 2YHVA 4H3BA 5EDPA 1B38A 2CGUA 3TIZA 2Y6MA 4ANQA 3R9NA 4EKKA 3LJ2A 5CSXA 2R3NA 5AP6A 1IR3A 2VTMA 4MD9E 4AUAA 3FLYA 4BDAA 1Q3DA 2HY0A 3QTQA 3LCOA 1J3HA 4GK4A 4BZNA 4NKAA 4MYGA 4CKJA 4O1PA 3Q5ZA 4GCJA 4MBLA 5FWKK 5GJFA 5KBRA 3WARA 5J9YA 2XJ2A 3OEFX 1JKSA 4BRXA 4OLIA 2Z2WA 4F6WA 3HP2A 4S2ZA 5HORA 5C26A 4YZ9A 4YPSA 1O6YA 2G01A 4CV8A 4I0RA 3R9HA 4UX9A 2I6LA 3Q4TA 4IVDA 2BKZA 3DB8A 4JQ7A 4DBXA 5E7RA 2GS6A 4EUUA 3MFUA 4BGQA 5A4TA 1OUYA 3C4XA 3ZS5A 3PLAE 4WSQA 3O96A 4FR4A 3VVHA 3FSFA 4G3EA 3MVMA 5A14A 4FTAA 2WTDA 4QO9A 1JNKA 2WQNA 4ORKA 3MN3A 3FZOA 3ORTA 5EDRA 3PZHA 3A7IA 3TI1A 3TKUA 4RX5A 2PY3A 5CNNA 1PXPA 3ZLXA 1G5SA 3BLRA 4RJ7A 4BDGA 3KMUA 5AAGA 1M2RA 1RE8A 4C4JA 4C34A 4ANBA 4JOAA 3PVGA 3ZFXA 3PJ8A 2WNTA 2PVHA 1YDSE 4MF0A 5E8ZA 4ZTMA 2XNNA 5IMEA 4CTCA 5LVPA 3V8TA 4GFGA 2J50A 5JZJA 1QPEA 2XUUA 4Y5HA 4QT1A 4I22A 4M69A 4FUYA 5HO6A 3BYMA 5C9CA 4IDVA 1YXTA 3F5UA 4NM3A 4E4MA 4FX3A 5I9VA 2QOLA 5L2TA 4MHAA 4U7ZA 1PMVA 2J4ZA 3QCYA 3ZRLA 2XJ1A 3HKOA 5K4JA 4RX8A 3EMGA 4JIKA 4Z16A 1QCFA 4PPAA 5KMJA 3COIA 4M14A 3KY2A 3ZSHA 3AC5A 3DK3A 5JMSA 2J0LA 3F69A 5FDXA 2WD1A 4OGRA 2OJGA 2UW0A 3T8OA 4CTBA 2GSFA 4IXPA 5GJDA 3AGLA 4H39A 2JIUA 4RQVA 4QTCA 3V6RA 2XBJA 5EM5A 3QTXA 4F7LA 4BCPA 2OJIA 4IX6A 2YCRA 5D9HA 3HNGA 3QC9A 4ZIMA 4AGCA 4HVHA 3CP9A 4GH2A 1E9HA 1XBBA 4RWKA 4BDDA 5A6NA 4DF3A 2WXVA 5EM6A 3WE8A 1XH6A 3I0OA 5CI7A 3V5TA 4X2GA 3UODA 3OBJA 4AZVA 3GNIB 4LMUA 5J8IA 5AJQA 5FLFA 3ZC6A 2BALA 5AR2A 5ANIA 3H9OA 3PSDA 5CX9A 4G5PA 3POOA 3Q60A 4HCUA 1DM2A 3BU3A 4HYHA 5DT0A 4DHFA 4EOMA 3KEXA 4IHPA 3RINA 3UMXA 2FSMX 2W4OA 3NYOA 3QTSA 4R7HA 2R3RA 4IC7A 2YDIA 4FOBA 4NEUA 3QWJA 3P08A 4ITIA 5EQPA 4ACMA 4FV6A 2W1CA 4AWIA 5LJJA 3TL8A 1ZOGA 3TNWA 4M69B 4J98A 4R78A 2GTNA 2J2IB 3GFEA 5JK3A 4FE2A 4R3CA 3OBGA 3ZSGA 4O0SA 4EOLA 2GQGA 3ZO2A 4YU2A 3HVCA 4ZEGA 2XK6A 4XLVA 4KS8A 2QCSA 5IF1A 5FQDC 3C5UA 4V0GA 4O84A 4BWPA 3NAXA 4XMOA 3LXLA 2PVMA 3W2PA 4UWCA 3DXNA 3F7ZA 4IAYA 2WTCA 4W4VA 4U81A 5F94A 4DC2A 3OC1A 4PMPA 3OY1A 4RBLA 4DE4A 3NW5A 3D4QA 3UC4A 1J7IA 1Y6BA 2XS0A 4BYIA 4ALWA 3D5XA 4GU9A 5C1QB 4AS0A 1KE5A 5HNIX 2IZUA 2GHGA 3FKOA 3R8VA 1DS5A 2ZM3A 3GU4A 3C13A 1Q97A 2J6MA 3E63A 2DQ7X 3IW6A 5HLWA 2AUHA 2OGVA 4JBVA 4B6LA 4UXQA 3N4VA 2C3KA 2J51A 4FT7A 4EOOA 4RJ6A 3R02A 2F2UA 4MNEA 3P5KA 1KUTA 2P4IA 4U97A 4YTFA 1R78A 1SYKA 4BCOA 5KKRB 3AC2A 2C6MA 3RKBA 2ZB0A 5DT4A 5CENA 1OIYA 3DZOA 2UVZA 3IK3A 5JRSA 3RBWA 4KIOA 2X2MA 4C2WA 2XM9A 3MBLA 4S33A 4OTFA 4CFWA 4Y95A 3PWYA 4AN2A 5CSVA 5IH6A 2BZJA 5TKDA 5D10A 1X8BA 3UO4A 5AP2A 4QNYA 4QTAA 1O9UA 3CTJA 2P33A 4RVTA 4DH3A 1J1CA 1MRVA 2X8IA 4OTGA 4G31A 4XV3A 1ZOHA 2GS7A 3R9DA 3HMPA 3PRFA 3JY9A 5D12A 5AP0A 3FPQA 3SXFA 4C4IA 3ZM9A 3FMMA 2FB8A 5GJGA 4YLJA 1V0OA 4FTNA 4ACCA 4D4RA 2GPHA 2QOBA 4MTAA 2QO2A 4KUJA 4ZTLA 3LCTA 4UWYA 1T46A 2A1AB 5CU6A 1W98A 3EYHA 3OCTA 4ZZOA 4G5JA 3RVGA 3FBVA 5IU2A 2XK4A 3DGKA 4FV8A 3R30A 4L7FA 2Z7QA 3ANRA 4IVAA 2W1EA 4BTJA 2RIOA 3FZRA 3MTLA 2QLQA 3QRKA 4GYIA 3ERKA 3MH1A 4AN3A 4QMSA 4AXAA 5L2SA 3CKXA 1U5QA 3NPCA 4LG4A 4NM5A 4WBOA 4E20A 4CD0A 3OFMA 3KK8A 3CC6A 3RI1A 4Y83A 4C4GA 3KMMA 3PG1A 4G6OA 1Y57A 1URWA 1WVXA 2X39A 4IVCA 4FNZA 1XH5A 4XCUA 4AACA 4W9WA 3EN6A 4O7WA 2UZVA 4FKQA 2YA9A 4ZS0A 2RL5A 3LFSA 1UNHA 4IAKA 1YWVA 4NIFB 4RSSA 4UYNA 2WIPA 4U44A 4H1MA 4TYHB 3HEGA 4XUFA 5FTOA 1YHWA 2YIQA 4YC3A 2R3FA 1BLXA 3PPJA 3RZFA 3QRIA 4L67A 3B2WA 2UZLA 5M53A 4JG8A 4DH5A 2OXDA 4RX7A 4B0GA 2HWOA 2YCFA 4G16A 2ZYBA 3KULB 3Q6UA 2BAKA 2QOIA 2W1ZA 3H0ZA 4I92A 4J8NA 1SNXA 3Q3BA 1ZWSA 1OKZA 2A4LA 3LXNA 3MJ2A 2ONLC 2WELA 3CEKA 3KXZA 2XRUA 4G3FA 1CSNA 4PMMA 4IX4A 3ZO4A 4MK0A 3TXOA 5DEWA 3VO3A 3NVMB 2EUFB 1XKKA 2H8HA 5I9ZA 3NUXA 3MB7A 3R04A 3ATSA 4EK6A 4ONAA 2R64A 1STCE 1TQPA 4F08A 3CPBA 4YZMA 4F9YA 3QGYA 3PE1A 3SXSA 4FKSA 2DWBA 4ZP5A 5M4CA 4DG3E 4I6HA 4QRCA 4ZTRA 3QHRA 2QLUA 5G6VA 3GXLA 4Y8DA 1WMKA 4IX5A 4UMPA 1OIRA 1PMEA 1VEBA 3W10A 1UWJA 4EHZA 4KSQA 3NUNA 3OG7A 3PIZA 4FL1A 4W4WA 3IS5A 4I5MA 3FMNA 5ETIA 3S3IA 4FKJA 4FSMA 3UDBA 3U6IA 4AX8A 2VWIA 3LM0A 3R1YA 4GVJA 4KKHA 4PX6A 3UQGA 3THBA 1M7NA 3E92A 1XH4A 3I5NA 2BRMA 5ACBC 5IDNA 1KV2A 3NSZA 5EM8A 3NNVA 4EH9A 4P4CA 5BYYA 5JFWA 2IPXA 2BHHA 2BFXA 4WG5A 3UG2A 4DTBA 1IA9A 4YP8A 5KZIA 1NA7A 4L01A 4X2JA 5IQAA 3DZQA 5HO8A 3PTGA 2PUPA 3NUSA 2VD5A 3OWLA 2XEYA 2R3JA 4EBWA 2VX0A 5LWNA 3GT8A 3ZFMA 5KMLA 4Y72A 4YBJA 5J9LA 4L43A 4L6QA 3DK6A 2OXXA 3BZ3A 1H24A 4ZMFA 2GNIA 3LQ5A 5CU4A 1IA8A 5LARA 5JRQA 3E7VA 1Z57A 3FMEA 2XK9A 2IZRA 4PPCA 2GNJA 3FHIA 3FZSA 2RF9A 2VO0A 3Q2JA 2OIBA 3JS2A 3ZBFA 4B4LA 3ZMMA 4CYJA 4DH8A 4RIYB 2IVVA 2J5FA 2BAQA 2XCHA 4FTQA 4MWIA 4XV2A 3GENA 3UIBA 4JR3A 3BEAA 3FWQA 2WOUA 3KF4A 2QU5A 3QTRA 3R7IA 3RK7A 4APPA 3KL8A 4NM7A 3VF9A 3N51A 4M68A 4X2NA 4GSBA 4OTHA 4PTGA 2CDZA 3IDBA 2QG7A 3SLSA 2W05A 3K3IA 3RAKA 2UZDA 4IWQA 3R1SA 4HGTA 3KXGA 3R2BA 1FQ1B 2UVYA 3SW7A 2C3LA 3RPSA 3TWJA 2J7TA 3BX5A 1YOJA 2UW8A 2ZV9A 2EXCX 4HYUA 4EOJA 3TT0A 3HUCA 5EI8A 2JDVA 3MESA 4WBBB 3PZEA 5AM6A 5BVEA 3S4QA 3QA8A 3SG8A 1P5EA 1P14A 3SG9A 4CRLA 5CEMA 3GC8A 3BGZA 3R8LA 1LEZA 1OKWA 2BPMA 2R3GA 3HMNA 2WZJA 3O0GA 3Q6WA 2ONLA 4QMWA 1NT2A 4CFFA 4XH6A 3V51A 2Y4IC 1U54A 4FTTA 3IDCA 3NNXA 4XRLA 5CWZA 2PMLX 2NNWB 4WSYA 3ZOSA 5KCVA 3AXWA 3P7AA 3FY2A 2PVJA 5AX3A 2JC6A 2OK1A 3BV3A 3TNQB 1MP8A 4M13A 4YURA 4FTUA 3R7GA 4EEVA 3CPCA 5M57A 5AV0A 4QMZA 3QC4A 1PXNA 3E64A 5AP5A 2YIYA 3K3JA 2WMAA 2JLDA 2PUIA 3G9NA 2VTRA 4XG2A 3GBZA 4JT3A 1YXUA 4AT5A 1FGKA 3F3ZA 4G9CA 4JAIA 4ASDA 2ITYA 4AOJA 2CLXA 2ZDUA 3G51A 5C4KA 3O7LD 5DIAA 1Z5MA 4XHKB 5J87A 3DKGA 3EN7A 3VJOA 5L6PA 4DEHA 3PSCA 5LMKA 4GW8A 4PWNA 3F82A 2I0EA 4D2RA 3NCGA 2W4KA 3L8PA 2FVDA 5JEBA 4GU6A 4FKUA 3HLLA 4O0TA 1ZAOA 1F0QA 3QQJA 3AT4A 2WGJA 3G0EA 4ANMA 5EKNA 3R7EA 4FVPA 2PL0A 2UZEA 3TV6A 4IC8A 3I6UA 3VBVA 1PYXA 3PSBA 2R7BA 5DR9A 4ACGA 3GCQA 2AC5A 3RJCA 4LI5A 3D0EA 3MIAA 3MY1A 3DLSA 4J95A 2ITUA 4TYEA 3PXFA 3L8SA 4YO4A 3QL8A 3ROCA 2XIRA 3QQGA 5CANA 4HZRA 3VUGA 3R22A 4YMJA 1OPLA 2JFLA 1W7HA 3GU8A 4QYHA 5BQ0A 3ZZWA 5LCKA 4IWPA 2W5BA 2WMUA 3M2WA 2YAAA 2RKUA 4IZAA 4LOOA 4D2TA 2WMTA 1XH8A 3VS2A 4ITHA 2O8YA 4WUNA 5CEKA 5IISA 5IMXA 4FIIA 5HX8A 2C6OA 5JSMA 4GVAA 3UNJA 4RVLA 3BYUA 5HIEA 3VBYA 5KE0A 2YCSA 3RK5A 3ODZX 4QP1A 4YTIA 4FL2A 4L45A 4ERKA 1TQMA 4XOYA 1ZYSA 3NNUA 3HV5A 4GJ2A 3R8UA 3DCVA 2CKQA 4JDKA 2C4GA 4QMXA 4A4XA 4G17A 3UYTA 4M84A 2OI4X 3OXTA 3DBQA 4FF8A 4EQCA 3SRVA 3M11A 3HDNA 3F5PA 2PYWA 3LMIA 5AWMA 4EQUA 3HMOA 2XKDA 3TDVA 4L7SA 4RVMA 4EZ3A 1M17A 5B7VA 1HCKA 3GOPA 4TY1A 5LCJA 3ZDUA 3SOCA 4ASEA 2ZMDA 3DDQA 2YAKA 4EK8A 4M0YA 2V7AA 4M15A 2WMRA 2J90A 3SDJA 3FZPA 3DBEA 3CXWA 3G33A 4FEWA 5AP3A 2XJ0A 3R7YA 5AV4A 3FLZA 2GNHA 3I6WA 4YBKA 5ETAA 4QMYA 2QQ7A 2WO6A 2CN5A 2VGPA 4LGDA 3W2QA 4DEIA 2AYPA 3HECA 4C02A 4U42A 5A4EA 4QP6A 5M44A 3TM0A 1G8AA 4D1SA 3O8TA 1YOLA 1PJKA 1H1SA 1JKLA 2W1IA 3U87A 4DFBA 2R3KA 2VV9A 3A7HA 3FQEA 1WBTA 2CHLA 4CFXA 3A7GA 3SGCA 2PMNX 4G3DA 2EXEA 4ZTHA 2PZRA 2VTJA 5EYKA 2PZIA 3QALE 4OUCA 4E3CA 5CI6A 4BDKA 4HNIA 5IZFA 2PVKA 2V62A 2RG6A 4DGLC 3V8SA 3BHHA 1PKGA 3MY5A 2R3MA 3LXPA 3CGOA 3OW4A 5EYCA 2VAGA 5CVGA 2X81A 4CZTA 2G9XA 1T45A 4FZAB 4FZ6A 5GZ9A 1PYEA 1QPDA 2I7QA 2P55A 3ID6C 3M42A 4LYNA 2YEXA 4CFUA 3OWKA 3NYXA 4JBQA 2DS1A 2IW6A 2ZMCA 1H0VA 4X6QC 4AP7A 4BCHA 4C59A 4CQEA 3OCBA 3QZFA 4ZY6A 3HGKA 4NUSA 2YACA 3ACJA 1OZ1A 5AIKA 3WZUA 5EQYA 3GI3A 3BV2A 3HUBA 5BVKA 3U4WA 4PTCA 4RMZA 3PVWA 1JVPP 4O0YA 4DFZE 3QYWA 4A9RA 2BILB 2VTLA 2CNQA 4QMMA 3NYVA 4NKSA 4O0RA 2JBPA 3DNEA 1SNUA 1OL5A 4I0SA 3P0MA 1JWHA 3E88A 3FV8A 3U4UA 3ENHA 4F4PA 4O91A 5JZNA 3BEGA 5L8JA 3SOAA 3TUDA 3MH3A 5ICPA 4QTBA 2GMXA 1XQZA 4MBJA 3LFAA 1IAJA 4AN9A 4O83A 2PSQA 2HCKA 1YVJA 5GIPE 1JBPE 1KE6A 3FI8A 5M4IA 4YJQA 4Q5HA 3C4CA 5EOLA 4IH8A 4L44A 3CQUA 4WNKA 5K0XA 3BHTA 4NZWB 3LLAA 4GG7A 3EFWA 4YLKA 3AC8A 3V5LA 2I0YA 3VUKA 3CJGA 3S00A 2PVFA 4ZTQA 3UNKA 2BIYA 3MS9A 2PZYA 4QP3A 4F9WA 2OH0E 1Q3WA 3PJ3A 4NM0A 4XX9A 5LVMA 4QMVA 3E62A 3QUPA 4BDIA 3LFCA 2WMWA 1P4OA 3KRRA 4FK3A 4GUBA 5E91A 5AV1A 3BQRA 2J0JA 4LGHA 2F9GA 4QD6A 1ATPE 5GINE 5FXRA 4YNOA 4D55A 2OFVA 1W84A 4LQMA 3QFVA 4M67A 1SM2A 3ZO3A 4BBFA 5CU0A 3EIDA 4QP2A 5FG8A 3QX2A 3GOKA 1E1XA 3FZTA 2W0JA 1VR2A 2YN8A 3OD6X 3AC1A 3P7CA 4UYAA 2JKKA 3LLTA 4ZSGA 4TYJA 3PVUA 4TZRA 3MYGA 4S34A 4TWPA 4YJOA 3OOMA 5I9WA 2CLQA 2REIA 3EKKA 5J5SA 3PFQA 5K0KA 3DK7A 1APME 3PY3A 3VN9A 4PP7A 3Q9YA 4FSYA 5K5NA 3VQHA 3NWWA 4C35A 5CAUA 4CG8A 4WIHA 3SD0A 1S9IA 4FKRA 2FUMA 2OH4A 5HU3A 4YZNA 4BZDA 4BDHA 3DB6A 3V8WA 5KHWA 2PULA 4RFMA 4R1VA 4DEGA 4FMQA 1OMWA 4M7IA 3PG3A 4AA5A 2W9FB 4AW5A 2GQRA 4LMNA 3EL7A 2PVLA 2X8EA 3A4PA 3GB2A 4JXFA 1OM1A 2NPQA 2VU3A 4EJ7A 2BZKB 3RNYA 3OCSA 4WG4A 4MNFA 4D2SA 4M0ZA 4ZZNA 1OI9A 4O0VA 4WHZA 2ZV2A 1H8FA 2VNYA 3C50A 2VO6A 1TVOA 5C27A 3E8EA 1A9UA 3DPKA 3O17A 4OTWA 3R8MA 3EN5A 3C0GA 3FKLA 5DI1A 5IUIA 3F3VA 1YKRA 1JSTA 2B55A 3FMJA 2R4BA 3CTQA 4G3CA 4CGAA 4ARKA 5CF8A 4AZSA 3UE4A 4RIWB 2EVAA 5L3AA 2QURA 3F3UA 2C5YA 5FDPA 2R3OA 4C4HA 4Z55A 3EJ1A 2W9ZB 3DKOA 3RWPA 3VUMA 4UMRA 3GCVA 5HD4A 3AT3A 4FGRA 5CXHA 4XLIA 1MQBA 1FMKA 2LAVA 5BVDA 2I40A 3EZRA 2E9PA 2B52A 3FAAA 4JDHA 2WTIA 5CZIA 4CT1A 1R1WA 4HVIA 1YQJA 3Q9ZA 2UW5A 4XNEA 3GQLA 3KXNA 4CCUA 2SRCA 3FQSA 5L2IA 1UNGA 4II5A 3QHWA 3O8UA 2PE1A 3RM6A 5TF9A 4WT6A 1BI7A 3RHXA 5DMZA 4FIJA 2WPAA 4O0XA 5FBNC 4FSUA 5A3XA 3SW4A 3ZLWA 3DKCA 2CCIA 2YDKA 2RFEA 4FNXA 1GIJA 4B8LA 4KIKB 3V5PA 4FSRA 2CNVA 1P4FA 4R6VA 5HNBA 4GK3A 4V01A 3VHEA 2OW3A 2R3IA 2XK8A 4FTRA 4ANOA 4BCGA 2GDOA 4TNDA 1VYWA 3VW6A 3CY2A 3A62A 3R28A 3WZDA 5CAQA 2HZ4A 4AGDA 2B54A 5AUYA 2UV2A 2ZJWA 4GS6A 3S95A 4FEUA 5IQEA 3P23A 5F4NA 4FT9A 4YJVA 3W16A 5AR8A 5HVJA 4FKOA 4EOPA 4HNFA 1YXSA 1ZMVA 2C5VA 5B2MA 3QTWA 2P2IA 5HVYA 2FGIA 3D7TA 3BLHA 3NAYA 3CGFA 4EH4A 1ZZ2A 3A61A 4IM3A 3ORZA 3PXRA 4A4OA 4QTDA 2PVRA 4XBUA 4JIAA 2GTMA 3CE3A 2JDOA 5IPJA 4X3FB 2IO6A 1QMZA 2BDFA 5CS6A 3TDWA 3QLFA 5KZ0A 4Z7HA 2HXQA 4YSMA 5CQWA 4FC0A 4QYEA 4AG8A 1UVRA 3E87A 4O2ZA 3U51A 4GKHA 2W17A 3QA0A 5E8WA 5L6WL 4CMOA 4FGBA 4O0WA 5M4FA 1PHKA 2UVXA 3PP0A 4CEGA 5A54A 2WTKB 4G6LA 3ZO1A 5L6OA 2VWYA 3II5A 1PKDA 3CCNA 3JPVA 3ZDIA 4AOTA 3ODYX 3OTUA 4B8MA 4IQ6A 5K3YA 3Q9XA 1H00A 3UC3A 4FYNA 3JYAA 4R7IA 4AT3A 5I9YA 3PDTA 4B99A 2R3HA 2WMVA 4X2KA 2BHEA 4I3ZA 3R7VA 4BCKA 2O65A 5J1VA 4Q9ZA 2BZIB 5FUTA 2QU6A 3ENMA 3I4BA 5GZAA 4UB7A 4U41A 5H8BA 4DT8A 5EYMA 3KXXA 3EZVA 3TNPC 3TZMA 3WILA 4ZJVA 4NYEA 4R5YA 5BUJA 3RMFA 3LFEA 3QCQA 4TN6A 3QQKA 4I24A 3TZ8A 4QMUA 4RFYA 2QOHA 5AIRA 3WF8A 4P5ZA 3EKNA 4IAZA 2VUWA 3QRUA 4RJ3A 4Z9LA 4CSVA 2QOQA 2CKOA 1R3CA 2ESMA 4MXOA 5ETCA 3SV0A 5HTCA 5BYLA 3FL5A 2YWPA 3FLSA 2EB2A 4FKLA 4XRJA 3BWFA 4XV9A 3FXZA 3ZLYA 4HVDA 4IM0A 1BX6A 4JL9A 5LQFA 3DS6A 3ZTXA 4CQGA 4H58A 3AOXA 4FL3A 3ACKA 4PL4A 1WBSA 1ZY5A 3PA3A 3PA4A 4QYGA 5AV3A 1ZZLA 5HO7A 2RGPA 3NRMA 4L68A 4XJ0A 2BRHA 5LVLA 4FV0A 4TYHA 1YWNA 4FI1A 4YTHA 4ZSLA 3FEGA 2UW9A 4NIFA 5TE0A 3VAPA 1YHSA 4FV7A 4EK5A 2XNBA 4F0IA 4PL5A 1F3MC 4YHFA 4G34A 1K9AA 2BTRA 4F9BA 3BYSA 2C30A 5T68A 4AQCA 2BKKA 2IN6A 4IWOA 4ZAUA 4I5PA 2R3PA 4ZSEA 3F2RA 2E9OA 4ZS4A 3Q96A 4F6UA 1H08A 5FP6A 3UQFA 2OF2A 3PIYA 3R1NA 2JDRA 5ETFA 5B2KA 3KCFA 4O7NA 4EH6A 1UU8A 2PWLA 3LQ8A 3BRBA 5DVRA 5IQHA 1KOBA 2B9HA 4TKSA 5L8KA 4QMNA 2Y4PA 4FKGA 5AEPA 4OBPA 3HMMA 2FSTX 3E8NA 5HZNA 4CVAA 1WBWA 3N9XA 2PMOX 4IX3A 1OVEA 3BU6A 4MWHA 4ENYA 5KO1A 4X2FA 3HYHA 4LOPA 4BGHA 4GK2A 2F7XE 3K5VA 5JFSA 1TQIA 3UGCA 2WB8A 3AG9A 4FKWA 3ULIA 3R7OA 4U3ZA 1WBVA 3KMWA 5DRDA 3S1HA 3Q4CA 1YI4A 2X7GA 4HGSA 5CLPA 3BWJA 4I41A 1PF8A 5BUIA 4OTRA 1U54B 2H34A 2J0IA 4RJ4A 3W8LA 5KMOA 3UG1A 4J8MA 4BIDA 2CGWA 3D83A 3P78A 4K77A 4WNMA 5JFXA 5AP4A 2OKRA 3TJCA 4ASXA 3JUHA 4CLIA 2YM8A 2BMCA 3FUPA 4H1JA 2I0HA 4LUEA 5IA2A 3VBTA 5DPVA 1WFCA 5HBHA 4KIQA 3KRXA 4MBIA 4EHGA 2CKEA 2P3GX 3ETAA 3C5IA 2W5AA 1UKHA 3Q4UA 5BUEA 5JQ8A 3G2FA 2YFXA 2VRXA 4FTKA 4K1BA 4MNEB 4N70A 2C1BA 3F2AA 2R7IA 2O5KA 4TW9A 3EQCA 5I9UA 5KX8A 3W8QA 3I7CA 2C68A 3FLQA 3R83A 2WOTA 5EDQA 1CM8A 3FMKA 3ZU7A 4OTIA 4F1TA 2QD9A 2Z7LA 3CD8A 4AZEA 4BDJA 2XB7A 3A4OX 2WEVA 1GOLA 5AUUA 4KBAA 2XNMA 5CSPA 4BHNA 4XP2A 5AP7A 1GNGA 4IANA 4DFLA 4Y85A 3BE9A 5DLSA 2W99B 2XZSA 2YM4A 3CIKA 5KMNA 2X2KA 3DJ5A 3AD6A 2O64A 2B53A 3GCUA 4PF4A 4R77A 4USDA 1CKJA 2PHKA 4LGGA 2ZB1A 3I60A 5F20A 3RCJA 3A8WA 3AD5A 3FE3A 5HE0A 1OPJA 4FV5A 4BDBA 3KKVA 3LZBA 4R3PA 3WF9A 2J0MB 3TCPA 4NFNA 4I1ZA 4OTDA 4MCVA 3EN9A 3O50A 3FL4A 2YCQA 3FI4A 3OXZA 5A4QA 2QI8A 4R1YA 2XA4A 4TRLA 5EW3A 4I94A 4HOKA 2JITA 3W33A 2C69A 1W82A 2W5HA 4A4LA 1OUKA 5J5TA 3DKFA 5H2UA 4D4SA 4FVRA 5HLNA 4KKGA 3GC7A 4USFA 4ACHA 4FEQA 3LXKA 1YOMA 4EK4A 4U6RA 4XG9A 5FM3A 3SA0A 1DAWA 3BHUA 2OFUA 3DFCB 3L9MA 3QBNA 4TT7A 5CU3A 2Z60A 1XBAA 3C4ZA 3FMHA 3V5WA 3EOCA 1YWRA 3HV7A 1U59A 4FA2A 1FVVA 1RDQE 1MQ4A 4YUQA 3ZYAA 4DEDA 5I9XA 2HY81 4ZSAA 5CAPA 1FGIA 1YDTE 2XNGA 4Q9SA 4CMUA 4GT5A 4X0MA 3GC9A 4BWXA 4GUEA 4IW0A 5FBOA 2PK9A 3I79A 2XKFA 3EQBA 4FTIA 3R6XA 3RPYA 4C62A 1OL1A 3ORXA 2YWVA 4ACDA 1WVWA 4EZ5A 2C6KA 3Q53A 2WTJA 4QP4A 1H1WA 2JKQA 3QQFA 5HVKA 4D5HA 2GNLA 4AA4A 5JGBA 1AGWA 3C7QA 2BUJA 2XEZA 3COHA 2Z7RA 3F3WA 2BRBA 3BHYA 3LKMA 2HXLA 4UALA 4ZK5A 5A4CA 4GL9A 5HCYA 1Z9XA 4QQCA 2IW9A 4ZLZA 4F7JA 3G15A 4D2VA 1ZYDA 2GCDA 4MAOA 3MPAA 3UVQA 1ZYCA 4PRJA 3BBWA 4A07A 1KOAA 3FC1X 4C33A 4QYYA 4FVQA 2QOCA 4UN0C 2BFYA 2PVYA 4UMQA 3E7OA 5HQ0A 2HWPA 3Q32A 3T3VA 2PPQA 4FTOA 3OT3A 4K9YA 3ZFYA 2V5QA 1REJA 5BVWA 3F5GA 4XP0A 5HE2A 1RW8A 4V05A 1B39A 3F3TA 2WU6A 2BR1A 2GQSA 3UP2A 2Z7SA 4J53A 4WO5A 4ANLA 2QODA 5BVNA 4EONA 4QTEA 1LP4A 4YJSA 3E3BX 4ZSJA 3Q9WA 3S0OA 4EWQA 5G1XA 5IEXA 4U3YA 3F2NA 4RA4A 3FYKX 1O6KA 1ZLTA 3QRTA 5DOSA 5ANGA 2OIQA 2E2BA 1GZ8A 4Q5EA 1PMNA 4ERWA 5IEYA 3DU8A 5AMNA 4J97A 2V22A 5IH5A 3VW8A 4MXCA 4QMOA 3W2RA 3ZONA 3ZRMA 5HTBA 3GCPA 4DTAA 5AR7A 2H96A 3ZRKA 3L8VA 4ANNA 4AZFA 4KINA 3UIXA 4FTLA 4XOZA 5HGIA 4BFMA 4NWMA 4DTKA 2JDTA 3EN4A 3G6GA 3MWUA 5L2WA 3LM5A 4JS8A 3OROA 3V01A 5ACKA 5CEQA 4BTMA 5D41A 3FLNC 4DGNA 2X6DA 3O71A 4CZYB 5BMSA 1UU7A 5FM2A 4U9AA 3GU6A 1DI8A 4FV1A 3R21A 4I20A 2F4JA 4BVUA 3GVUA 2Y7JA 4FG9A 4F09A 3QZHA 3TZ7A 3D94A 4RIXA 2OZOA 3R0TA 5CQUA 5DH3A 4FKPA 2X0GA 3RWQA 3POZA 4UBAA 4EH7A 5JKGA 3QTZA 4DLJA 3D2KA 5EH0A 2A2AA 2R0IA 4RIXB 4TTHB 5D11A 1YI3A 3KU2A 4XG3A 3G5DA 3LCKA 1CMKE 4EJNA 1H28A 3PXZA 4YNEA 3UO5A 3NX8A 1PRYA 3EB0A 3DXPA 5IQDA 3QD3A 5CAVA 2XNPA 4QPMA 3VJNA 4CKRA 2YIRA 4E6AA 2QC6A 2Z8CA 2WMXA 4O7VA 4KIKA 2ITTA 3TZ9A 2ZM1A 2C6TA 5A6OA 1B6CB 1IG1A 1P2AA 2CMWA 2PUUA 3QWKA 5GHVA 4H36A 2BIKB 3NEWA 2X7OA 1KWPA 4K18A 1UU3A 3K2LA 5A9UA 3QRJA 3IPHA 3ELJA 4I4EA 5FD2A 4L3JA 4FICA 5DR2A 4F7SA 4NCTA 1FBNA 5FP5A 3WE4A 4L8MA 3DT1A 2ACXA 4CV9A 4QPSA 3U9NA 4DA5A 3OWJA 3QGWA 2YM7A 3I1AA 4TXCA 3ZUVA 2QHNA 3LW0A 4J52A 1I09A 2UZOA 4MVFA 4PPBA 4GMYA 1V0PA 3QTIA 4V0GB 3LFQA 5L2QA 3JVRA 3V04A 4C7TA 4DFNA 4XS2A 4F64A 3MI9A 3VUTA 2J0KA 2WHBA 2X9EA 4JR7A 3NDMA 4YZDA 1CKPA 3RPRA 3I5ZA 4KS7A 2VX1A 1GJOA 2C47A 2VZ6A 2BDWA 5HNGA 3FC2A 2XIZA 3DBDA 3IECA 3MA3A 3P1AA 3TEIA 1JKKA 3OY3A 1OBGA 1M7QA 1JQHA 4FYOA 3FHRA 4OTQA 3UIMA 2ITNA 2WU7A 3MVJA 2BRNA 1OGUA 1SVHA 5AM7A 4IACA 4QP7A 2WQMA 3ITZA 2FA2A 3HDMA 5I3RA 3U6HA 3ZLSA 3OUKA 1HCLA 4K0YA 3OS3A 1GZNA 3BIZA 4LV5A 5E1SA 3VWAA 3HAMA 4ZY4A 4D9TA 4N0SA 4FV4A 4IE9A 5TR6A 4H3PA 2Y9QA 2QVSE 4JLCA 3NUPA 3ZEPA 4BYJA 3AGMA 2YDJA 3F5XA 4G9RA 4KRCA 4IADA 3VUHA 4N57A 4E93A 4WA9A 4EZ7A 4I4FA 2W4JA 4IB0A 4MH7A 3TUCA 3Q52A 1BMKA 2WKMA 4C3FA 3HP5A 3R71A 2ITZA 4IFGA 2RSVA 4YC8A 4EI4A 3VRZA 3TUBA 3FDNA 5DWRA 4FZDB 3EQRA 5EFQA 4AGUA 1PY5A 4HJOA 3CD3A 4BN1A 2XRWA 5LVOA 3U54A 3H0YA 5LMAA 4EC8A 1W83A 4HGLA 2BZHB 2BTSA 2GNFA 5K9IA 3KXMA 4U79A 1LR4A 3ORIA 4FKVA 2NO3A 4MKCA 5HCXA 1Q24A 4YC6A 2HW6A 5CT0A 4CMTA 4DEEA 3VS7A 2IVSA 3NIEA 1Y8YA 4PL3A 2XK3A 2WQOA 3D5UA 4XG7A 3WF7A 2V0DA 4CT2A 3HZTA 5HG8A 4DH1A 2XNOA 4HVGA 4FZ7A 3I7BA 2JD5A 3QCSA 2W1DA 5C8MA 4CRSA 3R7UA 4P7EA 3CQEA 5HI2A 5FGKA 3SAYA 1WZYA 4H05A 3DJ7A 4QMQA 2WMQA 3GC0A 5JT2A 1ZYJA 2QNJA 4FT3A 3VS4A 2VTAA 3TKHA 4F1OA 4RT7A 5CY3A 4KIPA 4D4VA 2KULA 5I4NA 5KNJA 3LE6A 3R1QA 5HOAA 4O0UA 1L3RE 5CU2A 3PVBA 3R8ZA 3KB7A 2BROA 2ETRA 4XG6A 4BB4A 5AA9A 4CLJA 4TYIA 3Q2MA 2ITQA 4WRSA 2W1GA 4C8BA 4DCAA 4O7YA 4FSWA 1HOWA 3QCXA 3T9TA 1OKVA 3KVXA 2VTHA 3WZEA 4E8AA 5EI2A 1XO2B 4WNPA 2X4ZA 2UZBA 2ERZE 1H1PA 4JRNA 5TO8A 4AU8A 3A7FA 4QQ5A 5ANJA 5E8YA 4IZ7A 1L8TA 3BPRA 4QQTA 1ZMUA 1AD5A 1JSVA 1ZRZA 4QP9A 4UZHA 3A8XA 3RAWA 4WRGA 4MD7E 2A27A 3RPOA 3GFWA 4J1RA 5C4LA 1GZOA 4KWPA 2ZM4A 4ZMEA 3BGQA 3IO7A 4PP9A 2HIWA 2FO0A 2VNWA 3F66A 3LQ3A 4TL0A 4L46A 2HK5A 4RX9A 4DFXE 4E26A 4ENXA 3BKBA 5DGZA 1H25A 3UPZA 2CSNA 3ZSIA 5FEQA 3VUDA 4L53A 4TPTA 5AV2A 5HIBA 4HVSA 3D7TB 4D0XA 5B2LA 3SXRA 2C6IA 4BR3A 2WQEA 3W2OA 2NRYA 2UW7A 3VS1A 2CGXA 4U8ZA 3BGPA 2HW7A 3PJ2A 4AW2A 4BC6A 1O6LA 4F9CA 3MH0A 3DQXA 4ZXTA 3IQ7A 4MD8E 5M55A 4C3RA 4D1XA 4BICA 4DYMA 3WYXA 2YERA 4A7CA 2B7AA 3KQ7A 4NTTA 4D58A 4RZVA 3PYYA 2C3IB 4D9UA 4JX3A 4DGMA 1URCA 1H1RA 4DG2E 4QMLA 1BUHA 1NW1A 2VWBA 5D7AA 4PDYA 3B8RA 5AUTA 1KV1A 2FSOX 3RALA 1ERKA 2Y8OA 4J71A 5T6KA 1REKA 4FG7A 3QQHA 3MFTA 1WBNA 3DOGA 4YO6A 3WZJA 4G2FA 5EI6A 4I6QA 2HAKA 3ET7A 4FIEA 5T3QA 3PXKA 1FVRA 1JPAA 2HENA 3BYOA 3IW7A 3D5VA 4E4LA 2ZVAA 3C4EA 2ZV8A 4ITJA 5DN3A 4E4XA 1NY3A 2IVTA 4AFEA 1JLUE 3OF0A 4X3JA 1GIIA 3MSSA 4D4YA 1OIQA 2CGVA 3UOLA 5DT3A 5AA8A 2XKCA 2XVDA 3DAKA 3QQLA 4EH8A 3W32A 2VX3A 3WF6A 5IUHA 4FTMA 4PQNA 3VHKA 2RFDA 4C4FA 2WTVA 2YISA 3C9WA 4X21A 4EHEA 3HRBA 4AW1A 2XIKA 3U6JA 4K8AA 3IW5A 4LRMA 5K5XA 3NLBA 5HBJA 4RIWA 4BDFA 4BBEA 4BZOA 5HD7A 3ORPA 3LFDA 2VWUA 3COMA 3MFSA 5IUGA 4UWBA 1PXOA 2JIVA 5CZHA 4BIEA 4CKIA 2YJRA 4BCIA 2IWIA 3RK9A 3D2IA 1J7UA 4JQ8A 1Q8UA 3WBLA 3U8WA 3QUEA 1SVEA 4IAFA 4KBKA 2O3PA 1UWHA 3VS5A 5LVNA 3ZC5A 3KF7A 5CAOA 1FVTA 4G1WA 3BLQA 3MFRA 4AT4A 2DYLA 5HLPA 2E9UA 4AA0A 4FK6A 4C3PA 4FV9A 1E1VA 3NUYA 4JJRA 4TWOA 4UXLA 3DFAA 2W06A 4YGAA 4AF3A 3LJ1A 1MRYA 3AD4A 3OXIA 2OZAB 5CALA 3ZZEA 5L8LA 1ZYLA 5CTPA 1ND4A 3HX4A 4KNBA 2CPKE 3KRLA 3VBQA 3FKNA 3UQCA 5DE2A 1BI8A 3OWPA 1M52A 4I21A 3R9RA 3PJCA 3ZHPC 5BX0A 1ZY4A 3VBWA 4XV1A 2QHMA 4R3RA 3WF5A 4BF2A 4PNKA 2C3JA 2JKOA 4O96A 4UEUA 4LL5A 5F9EA 2VTTA 2Q83A 3UZPA 2YZAA 4IB5A 5J9ZA 3LVPA 4GKIA 4C37A 4AZTA 3R8PA 4DT9A 2BVAA 4I23A 3F61A 5IH4A 2V55A 2VTQA 2LGCA 2QR8A 3IOPA 1Q99A 4G3GA 4DAWA 4EOIA 5M56A 2C5XA 3DDPA 5AUVA 3TV4A 4O7RA 4QNAA 5HE3A 1UNLA 2O0UA 2PVNA 4U43A 1VJYA 4L42A 1WBPA 4FUXA 3N4TA 3OUNB 5EW8A 4JI9A 4JRVA 4W8DA 2NRUA 5A46A 3QAME 3MIYA 5LXMA 3DAEA 3LJ0A 3TNHA 4LRKA 3VUIA 2Y6OA 3Q04A 4CCBA 2B9IA 5CVFA 4HW7A 4IZYA 4O7ZA 2UZNA 2HZ0A 2BCJA 1JOWB 3F88A 3L9NA 1NVQA 3ORLA 3EFLA 4K6ZA 5CF5A 2CJMA 2FYSA 4PUZA 2WMSA 1ZXEA 3V3VA 2OO8X 3MGYA 3D9VA 4RA5A 2UW3A 4EL9A 3TNIA 5E8VA 2HOGA 3BI6A 2G2IA 3GGFA 1JSUA 2QOOA 4U80A 4CFMA 2JIIA 2IVUA 4BBMA 5LMBA 3U9CA 4B7TA 3PRIA 4F70A 3Q5IA 4LM5A 4D0WA 3UPXA 4MXZA 5TOZA 4LV8A 2DUVA 2XIXA 5ANOA 2PU8A 5AR5A 5HE1A 2EB3A 3IW8A 3EFJA 4MEDA 5A4LA 4W4YA 1G8SA 2PUNA 1YDRE 4IJ9A 4YJUA 4XP3A 4ANSA 3LMHA 4ZLOA 1DI9A 3FPMA 2IJMA 3O51A 4R5SA 5D1JA 2ITXA 3EHAA 4CYIA 3UVRA 3L9PA 2WAJA 5IKWA 3SX9A 5BYZA 2VO7A 5E4HA 3MTFA 3HRCA 3PE2A 4RJ5A 2AC3A 1H4LA 3FMDA 4RC4A 5D7VA 5LWMA 4M8TA 4HGEA 4DH7A 2QOFA 1OECA 1Y91A 2QO9A 2X6EA 2J9MA 3PY0A 2RG5A 3MY0A 3C4FA 4IBMA 5AUZA 3SKCA 4B9DA 5IA4A 5KHXA 3V5JA 5M4UA 4DN5A 3JR1A 4R7BA 4F63A 2PE0A 3LIJA 2VWVA 3OTVA 4KKEA 1UU9A 2XBAA 3HMIA 2JAMA 5CVHA 5BNJA 4CXAA 2C5NA 4JDIA 5TT7A 1Y6AA 3QXOA 3CS9A 1I44A 1Q8TA 3PXYA 1W8CA 3H9RA 5HG7A 3G90X 4ID7A 2CCHA 3MJ1A 2ZOQA 4UV0A 5ANKA 2XKEA 1F5QA 2JGZA 1FINA 2VO3A 4L52A 4JVGA 1NXKA 2IZTA 2R3LA 4GRBA 3MVLA 5BVOA 3FJQE 3ROYA 2EU9A 4EBVA 1H01A 2X7FA 3RM7A 3UP7A 1IAHA 4I6BA 2X4FA 3D5WA 3HA8A 4EH3A 1SVGA 5IA3A 5AUWA 4RFZA 2YM6A 3LMGA 3KREA 3G0FA 4X3FC 3ZM4A 4RLLA 5BPYA 2XF0A 5M07A 3P9JA 3QU0A 4BCFA 4AW0A 4FEVA 3O7LB 1WBOA 5J95A 2IG7A 3P4KA 4XG8A 5E9EA 4W8EA 1YXXA 2OF4A 3U55A 2JFMA 3CKWA 1G3NA 4XEYA 3RHKA 4C57A 4D2PA 4OAVB 2F7ZE 2WIHA 5CEPA 3EH9A 3RPVA 3G6HA 5AAFA 2W96B 5K4IA 2WTKC 2ITVA 4FT0A 5FEEA 3NVKI 3GQIA 2XYUA 5AAEA 5DHJA 4E1ZA 3DTCA 3A60A 3H9FA 4ZY5A 1YHVA 5IA0A 2HYYA 1CTPE 1EH4A 4BKJA 2X9FA 1XWSA 4YLLA 2G2FA 5AR4A 4HYIA 5HG5A 5C01A 1J7LA 1H0WA 4KABA 2XCKA 4FSQA 2R0UA 3QD0A 3CR0A 3K54A 4H3QA 5EHLA 3SRVB 3VULA 3NCZA 1BYGA 1OIUA 4ZJIA 5CNOA 4A9YA 4OT5A 2VTOA 3MPMA 4RZWA 4FSTA 1YI6A 4JG6A 3SC1A 3UO6A 4A9TA 2YZLA 3P86A 2JDSA 3FI2A 1PXJA 3BYVA 3C4WA 5EG3A 4C61A 3F9NA 5IA1A 5KKRC 4IM2A 4D28A 5J1WA 3PIXA 3ZBXA 5GZ8A 4RWJA 3FI3A 3CSVA 4P2KA 2R3QA 3HA6A 4WKQA 4S30A 3EL8A 3LHJA 3PUPA 1XHAA 3BBTB 4CFNA 3NUAA 3UNZA 3QZGA 3KCKA 3R01A 2XP2A 2YM5A 4E6QA 3Q4ZA 4J7BA 4HCVA 2OJFE 4JDJA 4TWCA 3SVVA 4K33A 3TJDA 2GS2A 2XK7A 3TV7A 3TTIA 5M06A 3H4JA 3G9LX 3ALOA 3UOJA 1H27A 3FSKA 1XH7A 3VC4A 2JBOA 2PZ5A 2VTPA 4F65A 4U5JA 5LOHA 2G1TA 4JAJA 4N6YA 2I1MA 3QTUA 4E7WA 3IDPA 4O7SA 3DBCA 1OITA 4GT4A 3QLGA 1M2PA 2E9VA 4FV2A 2XNEA 4S31A 4GEOA 3V5QA 4WNOA 3PP1A 4RJ8A 4LUDA 4CFVA 1A06A 4EC9A 3OMVA 5KMMA 1VZOA 5EK7A 5E8XA 4CZUA 5I5ZA 1OL2A 4YZBA 4EUTA 2ERKA 4FZFB 1UA2A 3RAIA 5IEVA 5IQIA 3RNIA 2UW6A 4RC3A 3BELA 4F99A 1MRUA 2XYNA 4MQ2A 4YR8A 3CJFA 3BU5A 4WUAA 2V7OA 4DLIA 3L1SA 3UZRA 1OL6A 4I0TA 4XBRA 4XG4A 4OR5A 2IW8A 2BRGA 2A0CX 2JKMA 5HCZA 3NIZA 3QKMA 4W9XA 2C0TA 4IB3A 4DGGA 4KA3A 4BCJA 3QD4A 4RG0A 2EXMA 3PLSA 5FEDA 5FXQA 4HCTA 3VS3A 5IQBA 1GY3A 5BVFA 2OLCA 3ZCLA 2R5TA 3KC3A 4L3PA 4N6ZA 5EW9A 3AQVA 3FXXA 1FMOE 5FXSA 5ANDA 5CYIA 5E92A 3ZEWA 5E1EA 4GFMA 4PTEA 3EQFA 2PMIA 2EWAA 2VWZA 3TTJA 3PY1A 5CF6A 5BMMA 4KD1A 3V6SA 4KRDA 4NFMA 1GAGA 1S9JA 1H1QA 4YZCA 5JN2A 4YTCA 4NW5A 3LAUA 4O82A 1CDKA 4GIIA 3W18A 2PTKA 3KRJA 3HRFA 4O22A 4FT5A 1K2PA 4NCTC 2OJ9A 1NVRA 5FRIA 4FTJA 4NT4A 4USEA 4C2VA 4FSZA 4YSJA 4U45A 4FOCA 4GIHA 1DAYA 3ATTA 4BI0A 3B8QA 4KAOA 3ZUTA 4NU1A 3LCDA 4O6LA 3B2TA 3WYYA 3HL7A 5J7BA 3UTOA 2B9FA 4E5WA 2KTYA 3PA5A 4PMSA 2CN8A 4GT3A 3I0QA 3FQHA 1OB3A 3DA6A 4JQEA 4BI2A 3HV6A 3VF8A 1TKIA 4D5KA 2P2HA 3OHTA 3R00A 4AZWA 4DBNA 2R2PA 4RVKA 4BL1A 1LPUA 1Q62A 2QKRA 1JAMA 4QOXA 3CTHA 4L9IA 4U0IA 2YIWA 3MB6A 4IAIA 5E8SA 4Z7GA 1H07A 2UUEA 2C6LA 3EQDA 3A2CA 5JQ5A 4O81A 3RTPA 2UW4A 3BCEA 1R39A 4TWNA 1Y8GA 4PMTA 2O2UA 3OOGA 5I0BA 3EWHA 4ZTSA 4RIOA 3VNTA 2JAVA 4I5CA 2WTWA 1Q8ZA 3PJ1A 3TN8A 4JX7A 4F0GA 1PW2A 4HZSA 2NP8A 3DBFA 3EQIA 4RIYA 3R2YA 4FG8A 4PNIA 5AFVA 3FMLA 3AMYA 4E4NA 3A99A 1YW2A 5C8NA 3H10A 2Y0AA 3JVSA 3LCSA 5KUPA 1FPUA 4O21A 3A7JA 5DA3A 2IZSA 3NW6A 3L8XA 2OSCA 3IG7A 5HKMA 4WOVA 2ITWA 3ANQA 3ORNA 4A9UA 1UKIA 5HG9A 3D14A 4P5QA 2F7EE 5HBEA 1QPJA 3UOKA 4FIGA 1PXKA 3RZBA 4FEXA 4RRVA 2RFSA 3FXWA 3AC3A 4P90A 3DJ6A 4EORA 2G15A 3E5AA 3T3UA 3JY0A 3R9OA 3TG1A 2W1HA 3VQUA 2GFCA 5DR6A 4DG0E 2PE2A 2YITA 4EH5A 1PMUA 5AADA 2QKWB 4MXYA 4FBXA 4ZOGA 4I5HA 3NUUA 4C4EA 2OJJA 3W55A 3KN5A 1XJDA 2X2LA 2Y4IB 3BHVA 2Z02A 2QO7A 2UZUE 4BDCA 5HU9A 1W0XC 2ZAZA 3P7BA 5H9BA 2YABA 4Q2AA 3W1FA 1R0EA 3E8DA 3IW4A 3KULA 3KA0A 3FZ1A 3NR9A 2WQBA 2H6DA 2WMBA 3I81A 3E93A 3QD2B 2F49A 4FKTA 1Q8YA 2QG5A 4BI1A 5F95A 4BTFA 5AUXA 3RGFA 5HIDA 3EFKA 3PXQA 3PPKA 4K2RA 3AT2A 4UZDA 4BCQA 1XH9A 3RAHA 4EH2A 4AGWA 2WFYA 4EHVA 1Q4LA 2XM8A 4YPDA 3UBDA 1ZARA 4BKZA 2VWXA 2YIXA 1WVYA 3TKIA 3IGGA 2BDJA 3OZ6A 1YRPA 2XMYA 4LL0A 3ORKA 3QYZA 4RGJA 4Z3VA 3DQWA 4HYSA 4IWDA 3S2PA 3T9IA 3IONA 5LMKC 5EM7A 2B9JA 2W7XA 1VYZA 4Y46A 3DAJA 2HZNA 3LFBA 4O7LA 3K5UA 3ZXTA 3MH2A 3KN6A 4AE9A 4IVBA 3CBLA 4MXAA 1BL7A 4UMTA 4X6RA 3EQHA 3MV5A 4C58A 3IKAA 3F6XA 1LUFA 3AMAA 3GU7A 3QUDA 4M3QA 5IQFA 3O23A 1CKIA 5KMKA 3C51A 1ZOEA 5B0XA 3VS6A 1KE9A 4F1MA 2Q0NA 4N4SA 4O38A 4IMYA 1OL7A 4V04A 2YLEA 4EYJA 5CASA 4TYGA 1UV5A 3KRWA 4GYGA 3QQUA 3E3PA 3NNWA 4MF1A 5DBXA 4D2WA 4IFCA 5GNKA 4YJPA 4I93A 4JBOA 3RP9A 4F7NA 1XR1A 3D7ZA 4UMUA 3MW1A 3C1XA 4BTKA 5DFPA 3DTWA 4RPVA 5HEZA 3DXQA 5KMIA 2ETMA 1QPCA 3EQPA 4QMPA 3OW3A 3WIGA 4MX9A 4DEAA 5IG1A 4I6FA 2FH9A 5DNRA 2C1AA 2P0CA 5JGDA 4PY1A 2GHMA 3BE2A 2OIDA 3FY0A 3MDYA 3R73A 4BCMA 2ZV7A 2PZPA 1OPKA 5FTGA 4F6SA 3QKKA 4Y73A 3REPA 3W2SA 1IRKA 5HTIA 1OBDA 3MPTA 4OT6A 3UMWA 1FOTA 4RC2A 5C03A 3UYSA 4FNWA 5FTQA 2OBJA 5AX9A 3HV4A 2RFNA 5HHWA 4DGOA 2VGOA 3ULZA 2VWWA 2QR7A 5E8TA 2OWBA 3QXPA 3GUBA 1R0PA 5CEIA 3GU5A 2C6EA 3ORMA 4OW8A 4AAAA 3NMUF 2HELA 3OP5A 4C36A 2X8DA 2W1FA 4PV0A 4ZTNA 4IEBA 3EQGA 4KB8A 5CEOA 2A19B 2YLFA 3WI6A 4YHTA 3CY3A 4WG3A 4EQMA 5M51A 2OICA 4O27B 4A06A 4BY9E 1OKYA 1YXVA 1Q8WA 3RCDA 4KSPA 2R9SA
chains in the Genus database with same CATH superfamily
3PWDA 5HX6A 2H9VA 4NH1A 1IEPA 4FKIA 4ALUA 2Q0BA 2OXYA 2C0OA 3ZH8A 4DITA 3NZ0A 2GNGA 3QZIA 4IDTA 4M66A 1ZMWA 2ITOA 2O63A 3UOHA 2GFSA 3UJGA 2QONA 1PXLA 4DEBA 1PXMA 3KGAA 3EYGA 2ZDTA 4S32A 3DNDA 3BQCA 3C0HA 2J5EA 1JKTA 3NGAA 4TNBA 2C5OA 5CSHA 4UY9A 3OVVA 5KBQA 1J91A 4O7TA 3E8CA 4IJPA 4HPTE 2E9NA 4RWIA 3QKLA 1LEWA 1PXIA 4FSNA 4EKLA 2GU8A 4F0FA 4U40A 1Q61A 3FLWA 2UZTA 5DYJA 4JG7A 5M09A 3UVPA 3GEQA 3DY7A 4IAAA 4L00A 4CG9A 5C8KA 3QX4A 4HPUE 3LPBA 4AFJA 1H26A 2B1PA 3HV3A 3MVHA 5EHOA 4WD5A 3NS9A 3VBXA 3M1SA 3JXWA 4DCEA 5EKOA 2VTNA 4LRJA 3TACA 4CNHA 1ST0A 3O8PA 3UIUA 5CF4A 3VRYA 2ITPA 3AC4A 3AMBA 2GHLA 3H30A 3D15A 4BDEA 4QPAA 3LOKA 4APCA 4QP8A 3CQWA 4YHJA 3AKLA 5IQGA 1M2QA 4Y5QA 4BGGA 4M97A 4NL0A 4NTSA 2X1NA 4EK3A 3DLZA 4G6NA 5H8GA 4K11A 3KFAA 4ZLYA 5J7HA 4J96A 5CXZA 4E5BA 4XYFA 5HICA 3WOWA 4DFYA 3GP0A 5IA5A 2B4SB 4EOSA 5JFVA 4O86A 5IQCA 1KE7A 4EYMA 4D1ZA 1U4DA 3COKA 4E5AX 2CKPA 5HESA 4AOIA 4IIRA 1BL6A 5ANEA 5DG5A 4F9AA 5H8EA 1M14A 3C0IA 5J79A 5JGAA 4O6EA 1K3AA 2OZAA 4IZ5A 1MUOA 1WAKA 3QF9A 3ZUUA 4C0TA 3HAVA 3CLYA 1NVSA 2FSLX 4ASZA 4YJNA 2OU7A 1RJBA 5E90A 4MXXA 2G2HA 2UZWE 5DEYA 4AE6A 4M12A 5GIOE 1U5RA 3UZTA 4NSTA 4O2PA 5JH6A 4PDOA 3FYJX 3IOKA 3KXHA 4NW6A 4JBPA 4FTCA 4MQ1A 1GZKA 2F57A 4J99A 4QYFA 1XBCA 2VTSA 1SZMA 5L4QA 4GFOA 3OEZA 3OT8A 5EHYA 4BWKA 4NJ3A 4W4XA 4A9SA 3H3CA 2ETKA 3O2MA 5DRBA 2VN9A 4GV1A 3LFFA 4L3LA 3DV3A 2I0VA 2WEIA 2YM3A 3IGOA 4O4EA 4FV3A 4ZZMA 4E6CA 4EOKA 4FODA 3VIDA 2C6DA 3ZXZA 3R63A 5CSWA 4O1OA 1BKXA 3LFNA 4BHZA 5AR3A 1J1BA 2CNUA 2XH5A 2VTIA 3SHEA 2F2CB 3OCGA 4QMTA 1IASA 3P79A 4FIFA 4ZJJA 3L9LA 4LFIA 4KBCA 1V1KA 4NJDA 3F7WA 4OBOA 5EYDA 4RQKA 4OAUC 3NW7A 4PDPA 3WIKA 4OTPA 5EOBA 3TIYA 5ITAA 5I3OA 1KE8A 2XIYA 1GIHA 3SQQA 1U46A 3NYNA 1Q41A 1AQ1A 4EOQA 1V0BA 2HZIA 4BIBA 3MA6A 4LOQA 1Q5KA 4IB1A 4BCNA 5M08A 3GCSA 4FNYA 4FIHA 4EWHA 4QQJA 3N4UA 5EQEA 4GJ3A 4E6DA 4JNWA 3KK9A 3W2CA 2XAOA 2B0QA 1QL6A 3WZKA 2BAJA 2OG8A 4NK9A 1A48A 4DINA 2QOKA 4YJTA 4PDSA 4DFUA 4C38A 2JEDA 5CT7A 3PPZA 4RLKA 4GG5A 2C0IA 4R8QA 4X3FA 5F1ZA 1SMHA 3VS0A 5IDPA 4X7QA 4RWLA 1WCCA 4E73A 4ALVA 1KSWA 4BKYA 2YJSA 4OBQA 5E8UA 3KVWA 4YJRA 3ALNA 5AP1A 5H3QA 1RQQA 2YHVA 4H3BA 5EDPA 1B38A 2CGUA 3TIZA 2Y6MA 4ANQA 3R9NA 4EKKA 4DHZA 3LJ2A 5CSXA 2R3NA 5AP6A 1IR3A 2VTMA 4MD9E 4AUAA 3FLYA 4BDAA 1Q3DA 2HY0A 3QTQA 3LCOA 1J3HA 4GK4A 4BZNA 4NKAA 4MYGA 4CKJA 4O1PA 3Q5ZA 4GCJA 4MBLA 5FWKK 5GJFA 5KBRA 3WARA 5J9YA 2XJ2A 3OEFX 1JKSA 4BRXA 4OLIA 2Z2WA 4F6WA 3HP2A 4S2ZA 5HORA 5C26A 4YZ9A 4YPSA 1O6YA 2G01A 4CV8A 4I0RA 3R9HA 4UX9A 2I6LA 3Q4TA 4IVDA 2BKZA 3DB8A 4JQ7A 4DBXA 5E7RA 2GS6A 4EUUA 3MFUA 4BGQA 5A4TA 1OUYA 3C4XA 3ZS5A 3PLAE 4WSQA 3O96A 4FR4A 3VVHA 3FSFA 4G3EA 3MVMA 5A14A 4FTAA 2WTDA 4QO9A 1JNKA 2WQNA 4ORKA 3MN3A 3FZOA 3ORTA 5EDRA 3PZHA 3A7IA 3TI1A 3TKUA 4RX5A 2PY3A 5CNNA 1PXPA 3ZLXA 1G5SA 3BLRA 4RJ7A 4BDGA 3KMUA 5AAGA 1M2RA 1RE8A 4C4JA 4C34A 4ANBA 4JOAA 3PVGA 3ZFXA 3PJ8A 2WNTA 2PVHA 1YDSE 4MF0A 5E8ZA 4ZTMA 2XNNA 5IMEA 4CTCA 5LVPA 3V8TA 4GFGA 2J50A 5JZJA 1QPEA 2XUUA 4Y5HA 4QT1A 4I22A 4M69A 4FUYA 5HO6A 3BYMA 5C9CA 4IDVA 1YXTA 3F5UA 4NM3A 4E4MA 4FX3A 5I9VA 2QOLA 5L2TA 4MHAA 4U7ZA 1PMVA 2J4ZA 3QCYA 3ZRLA 2XJ1A 3HKOA 5K4JA 4RX8A 3EMGA 4JIKA 4Z16A 1QCFA 4PPAA 5KMJA 3COIA 4M14A 3KY2A 3ZSHA 3AC5A 3DK3A 5JMSA 2AEGA 2J0LA 3F69A 5FDXA 2WD1A 4OGRA 2OJGA 2UW0A 3T8OA 4CTBA 2GSFA 4IXPA 5GJDA 3AGLA 4H39A 2JIUA 4RQVA 4QTCA 3V6RA 2XBJA 5EM5A 3QTXA 4F7LA 4BCPA 2OJIA 4IX6A 2YCRA 5D9HA 3HNGA 3QC9A 4ZIMA 4AGCA 4HVHA 3CP9A 4GH2A 1E9HA 1XBBA 4RWKA 4BDDA 5A6NA 4DF3A 2WXVA 5EM6A 3WE8A 1XH6A 3I0OA 5CI7A 3V5TA 4X2GA 3UODA 3OBJA 4AZVA 3GNIB 4LMUA 5J8IA 5AJQA 5FLFA 3ZC6A 2BALA 5AR2A 5ANIA 3H9OA 3PSDA 5CX9A 4G5PA 3POOA 3Q60A 4HCUA 3VONA 1DM2A 3BU3A 4HYHA 5DT0A 4DHFA 4EOMA 3KEXA 4IHPA 3RINA 3UMXA 2FSMX 2W4OA 3NYOA 3QTSA 4R7HA 2R3RA 4IC7A 2YDIA 4FOBA 4NEUA 3QWJA 3P08A 4ITIA 5EQPA 4ACMA 4FV6A 2W1CA 4AWIA 5LJJA 3TL8A 1ZOGA 3TNWA 4M69B 4J98A 4R78A 2GTNA 2J2IB 3GFEA 5JK3A 4FE2A 4R3CA 3OBGA 3ZSGA 4O0SA 4EOLA 2GQGA 3ZO2A 4YU2A 3HVCA 4ZEGA 2XK6A 4XLVA 4F78A 4KS8A 2QCSA 5IF1A 5FQDC 3C5UA 4V0GA 4O84A 4BWPA 3NAXA 4XMOA 3LXLA 2PVMA 3W2PA 4UWCA 3DXNA 3F7ZA 4IAYA 2WTCA 4W4VA 1W2CA 4U81A 5F94A 4DC2A 3OC1A 4PMPA 3OY1A 4RBLA 4DE4A 2IEWA 3NW5A 3D4QA 3UC4A 1J7IA 1Y6BA 2XS0A 4BYIA 4ALWA 3D5XA 4GU9A 5C1QB 4AS0A 1KE5A 5HNIX 2IZUA 2GHGA 4QEBA 3FKOA 3R8VA 1DS5A 2ZM3A 3GU4A 3C13A 1Q97A 2J6MA 3E63A 2DQ7X 3IW6A 5HLWA 2AUHA 2OGVA 4JBVA 4B6LA 4UXQA 3N4VA 2C3KA 2J51A 4FT7A 4EOOA 4RJ6A 3R02A 2F2UA 4MNEA 3P5KA 1KUTA 1G8KA 2P4IA 4U97A 4YTFA 1R78A 1SYKA 4BCOA 5KKRB 3AC2A 2C6MA 3RKBA 2ZB0A 5DT4A 5CENA 1OIYA 3DZOA 2UVZA 3IK3A 5JRSA 3RBWA 4KIOA 2X2MA 4C2WA 2XM9A 3MBLA 4S33A 4OTFA 4CFWA 4Y95A 3PWYA 4AN2A 5CSVA 5IH6A 2BZJA 5TKDA 5D10A 1X8BA 3UO4A 5AP2A 4QNYA 4QTAA 1O9UA 3CTJA 2P33A 4RVTA 4DH3A 1J1CA 1MRVA 2X8IA 4OTGA 4G31A 4XV3A 3P5JC 1ZOHA 2GS7A 3R9DA 3HMPA 3PRFA 3JY9A 5D12A 5AP0A 3FPQA 3SXFA 4C4IA 3ZM9A 3FMMA 2FB8A 5GJGA 4YLJA 1V0OA 4FTNA 4ACCA 4D4RA 2GPHA 2QOBA 4MTAA 2QO2A 4KUJA 4ZTLA 3LCTA 4UWYA 1T46A 2A1AB 5CU6A 1W98A 3EYHA 3OCTA 4ZZOA 4G5JA 3RVGA 3FBVA 5IU2A 2XK4A 3DGKA 4FV8A 3R30A 4L7FA 2Z7QA 3ANRA 4IVAA 2W1EA 4BTJA 2RIOA 3FZRA 3MTLA 2QLQA 3QRKA 4DDIA 4GYIA 3ERKA 3MH1A 4AN3A 4QMSA 4AXAA 5L2SA 3CKXA 1U5QA 3NPCA 4LG4A 4NM5A 4WBOA 4E20A 4CD0A 3OFMA 3KK8A 3CC6A 3RI1A 4Y83A 4C4GA 3KMMA 3PG1A 4G6OA 1Y57A 2X0OA 1URWA 1WVXA 2X39A 4IVCA 4FNZA 1XH5A 4XCUA 4AACA 4W9WA 3EN6A 4O7WA 2UZVA 4FKQA 2YA9A 4ZS0A 2RL5A 3LFSA 1UNHA 4IAKA 1YWVA 4NIFB 4RSSA 4UYNA 2WIPA 4U44A 4H1MA 4TYHB 3HEGA 4XUFA 5FTOA 1YHWA 2YIQA 4YC3A 2R3FA 1BLXA 3PPJA 3RZFA 3QRIA 4L67A 3B2WA 2UZLA 5M53A 4JG8A 4DH5A 2OXDA 4RX7A 4B0GA 2HWOA 2YCFA 4G16A 2ZYBA 3KULB 3Q6UA 2BAKA 2QOIA 2W1ZA 3H0ZA 4I92A 4J8NA 1SNXA 3Q3BA 1ZWSA 1OKZA 2A4LA 3LXNA 3MJ2A 2ONLC 2WELA 3CEKA 3KXZA 2XRUA 4G3FA 1CSNA 4PMMA 4IX4A 3ZO4A 4MK0A 3TXOA 5DEWA 3VO3A 3NVMB 2EUFB 1XKKA 2H8HA 5I9ZA 3NUXA 3MB7A 3R04A 3ATSA 4EK6A 4ONAA 2R64A 1STCE 1TQPA 4F08A 3CPBA 4YZMA 4F9YA 3QGYA 3PE1A 3SXSA 4FKSA 2DWBA 4ZP5A 5M4CA 4DG3E 4I6HA 4QRCA 4ZTRA 3QHRA 2QLUA 5G6VA 3GXLA 4Y8DA 1WMKA 3UDTA 4IX5A 4UMPA 1OIRA 1PMEA 1VEBA 3W10A 1UWJA 4EHZA 3W0NA 4KSQA 3NUNA 3OG7A 3PIZA 4FL1A 4W4WA 3IS5A 4I5MA 3FMNA 5ETIA 3S3IA 4FKJA 4FSMA 3UDBA 3U6IA 4AX8A 2VWIA 3LM0A 3R1YA 4GVJA 4KKHA 4PX6A 3UQGA 3THBA 1M7NA 3E92A 1XH4A 3I5NA 2BRMA 5ACBC 5IDNA 1KV2A 3NSZA 5EM8A 3NNVA 4EH9A 4P4CA 5BYYA 5JFWA 2IPXA 2BHHA 2BFXA 4WG5A 3UG2A 4DTBA 1IA9A 4YP8A 5KZIA 1NA7A 4L01A 4X2JA 5IQAA 3DZQA 5HO8A 3PTGA 2PUPA 3NUSA 2VD5A 3OWLA 2XEYA 2R3JA 4EBWA 2VX0A 5LWNA 3GT8A 3ZFMA 5KMLA 4Y72A 4YBJA 5J9LA 4L43A 4L6QA 3DK6A 2OXXA 3BZ3A 1H24A 4ZMFA 2GNIA 3LQ5A 5CU4A 1IA8A 5LARA 5JRQA 3E7VA 1Z57A 3FMEA 2XK9A 2IZRA 4PPCA 2GNJA 3FHIA 3FZSA 2RF9A 2VO0A 3Q2JA 4AXCA 2OIBA 3JS2A 3ZBFA 4B4LA 3ZMMA 4CYJA 4DH8A 4RIYB 2IVVA 2J5FA 2BAQA 2XCHA 1W2DA 4FTQA 4MWIA 3GENA 4XV2A 3UIBA 4JR3A 3BEAA 3FWQA 2WOUA 3KF4A 2QU5A 3QTRA 3R7IA 3RK7A 4APPA 2X0QA 3KL8A 4NM7A 3VF9A 3N51A 4M68A 4X2NA 4GSBA 4OTHA 4PTGA 2CDZA 3IDBA 2QG7A 3SLSA 2W05A 3K3IA 3RAKA 2UZDA 4IWQA 3R1SA 4HGTA 3KXGA 3R2BA 1FQ1B 2UVYA 3SW7A 2C3LA 3RPSA 3TWJA 2J7TA 3BX5A 1YOJA 2UW8A 2ZV9A 2EXCX 4HYUA 4EOJA 3TT0A 3HUCA 5EI8A 2JDVA 3MESA 4WBBB 3PZEA 5AM6A 5BVEA 3S4QA 3QA8A 3SG8A 1P5EA 1P14A 3SG9A 4CRLA 5CEMA 3GC8A 3BGZA 3R8LA 1LEZA 1OKWA 2BPMA 2R3GA 3HMNA 2WZJA 3O0GA 3Q6WA 2ONLA 4QMWA 1NT2A 3TMOA 4CFFA 4XH6A 3V51A 2Y4IC 1U54A 4FTTA 3IDCA 3NNXA 4XRLA 5CWZA 2PMLX 2NNWB 4WSYA 3ZOSA 5KCVA 3AXWA 3P7AA 3FY2A 2PVJA 5AX3A 2JC6A 2OK1A 3BV3A 3TNQB 1MP8A 4M13A 4YURA 4FTUA 3R7GA 4EEVA 3CPCA 5M57A 5AV0A 4QMZA 3QC4A 1PXNA 3E64A 5AP5A 2YIYA 3K3JA 2WMAA 2JLDA 2PUIA 3G9NA 2VTRA 4XG2A 3GBZA 4JT3A 1YXUA 4AT5A 1FGKA 3F3ZA 4G9CA 4JAIA 4ASDA 2ITYA 4AOJA 2CLXA 2ZDUA 3G51A 5C4KA 3O7LD 5DIAA 1Z5MA 4XHKB 5J87A 3DKGA 3EN7A 3VJOA 5L6PA 4DEHA 3PSCA 5LMKA 4GW8A 4PWNA 3F82A 2I0EA 3AKKA 4D2RA 3NCGA 2W4KA 3L8PA 2FVDA 5JEBA 4GU6A 4FKUA 3HLLA 4O0TA 1ZAOA 1F0QA 3QQJA 3AT4A 2WGJA 3G0EA 4ANMA 5EKNA 3R7EA 4FVPA 2PL0A 2UZEA 3TV6A 4IC8A 3I6UA 3VBVA 1PYXA 3PSBA 2R7BA 5DR9A 4ACGA 3GCQA 2AC5A 3RJCA 4LI5A 3D0EA 3MIAA 3MY1A 3DLSA 4J95A 2ITUA 4TYEA 3PXFA 3L8SA 4YO4A 3QL8A 3ROCA 2XIRA 3QQGA 5CANA 4HZRA 3VUGA 3R22A 4YMJA 1OPLA 2JFLA 1W7HA 3GU8A 4QYHA 5BQ0A 3ML1A 3ZZWA 5LCKA 4IWPA 2W5BA 2WMUA 3M2WA 2YAAA 2RKUA 4IZAA 4LOOA 4D2TA 2WMTA 1XH8A 3VS2A 4ITHA 2O8YA 4WUNA 5CEKA 5IISA 5IMXA 4FIIA 5HX8A 2C6OA 5JSMA 4GVAA 3UNJA 4RVLA 3BYUA 5HIEA 3VBYA 5KE0A 2YCSA 3RK5A 3ODZX 4QP1A 4YTIA 4FL2A 4L45A 4ERKA 1TQMA 4XOYA 1ZYSA 3NNUA 3HV5A 4GJ2A 3R8UA 3DCVA 2CKQA 4JDKA 2C4GA 4QMXA 4A4XA 4G17A 3UYTA 4M84A 2OI4X 3OXTA 3DBQA 4FF8A 4EQCA 3SRVA 3M11A 3HDNA 2IF8A 3F5PA 2PYWA 3LMIA 5AWMA 4EQUA 3HMOA 2XKDA 3TDVA 4L7SA 4RVMA 4EZ3A 1M17A 5B7VA 1HCKA 3GOPA 4TY1A 5LCJA 3ZDUA 3SOCA 4ASEA 2ZMDA 3DDQA 2YAKA 4EK8A 4M0YA 2V7AA 4M15A 2WMRA 2J90A 3SDJA 3FZPA 4AXDA 3DBEA 3CXWA 3G33A 4FEWA 5AP3A 2XJ0A 3R7YA 5AV4A 3FLZA 2GNHA 3I6WA 4YBKA 5ETAA 4QMYA 2QQ7A 2WO6A 2CN5A 2VGPA 4LGDA 3W2QA 4DEIA 2AYPA 3HECA 4C02A 4U42A 5A4EA 4QP6A 5M44A 3TM0A 1G8AA 1TFFA 4D1SA 3O8TA 1YOLA 1PJKA 1H1SA 1JKLA 2W1IA 3U87A 4DFBA 2R3KA 2VV9A 3A7HA 3FQEA 1WBTA 2CHLA 4CFXA 3A7GA 3SGCA 2PMNX 4G3DA 2EXEA 4ZTHA 2PZRA 2VTJA 5EYKA 2PZIA 3QALE 4OUCA 4E3CA 5CI6A 4BDKA 4HNIA 5IZFA 2PVKA 2V62A 2RG6A 4DGLC 3V8SA 3BHHA 1PKGA 3MY5A 2R3MA 3LXPA 3CGOA 3OW4A 5EYCA 2VAGA 5CVGA 2X81A 4CZTA 2G9XA 1T45A 4FZAB 4QDVA 4FZ6A 5GZ9A 1PYEA 1QPDA 2I7QA 2P55A 3ID6C 3M42A 4LYNA 2YEXA 4CFUA 3OWKA 3NYXA 4JBQA 2DS1A 2IW6A 2ZMCA 1H0VA 4X6QC 4AP7A 4BCHA 4C59A 4CQEA 3OCBA 3QZFA 4ZY6A 3HGKA 4NUSA 2YACA 3ACJA 1OZ1A 5AIKA 3WZUA 5EQYA 3GI3A 3BV2A 3HUBA 5BVKA 3U4WA 4PTCA 4RMZA 3PVWA 1JVPP 4O0YA 4DFZE 3QYWA 4A9RA 2BILB 2VTLA 2CNQA 4QMMA 3NYVA 4NKSA 4O0RA 2JBPA 3DNEA 1SNUA 1OL5A 4I0SA 3P0MA 1JWHA 3E88A 3FV8A 3U4UA 3ENHA 4F4PA 4O91A 5JZNA 3BEGA 5L8JA 3SOAA 3TUDA 3MH3A 5ICPA 4QTBA 2GMXA 1XQZA 4MBJA 3LFAA 1IAJA 4AN9A 4O83A 2PSQA 2HCKA 1YVJA 5GIPE 1JBPE 1KE6A 3FI8A 5M4IA 4YJQA 4Q5HA 3C4CA 5EOLA 4IH8A 4L44A 3CQUA 4WNKA 5K0XA 3BHTA 4NZWB 3LLAA 4GG7A 3EFWA 4YLKA 3AC8A 3V5LA 2I0YA 3VUKA 3CJGA 3S00A 2PVFA 4ZTQA 3UNKA 2BIYA 3MS9A 2PZYA 4QP3A 4F9WA 2OH0E 1Q3WA 3PJ3A 4NM0A 4XX9A 5LVMA 4QMVA 3E62A 3QUPA 4BDIA 3LFCA 2WMWA 1P4OA 3KRRA 4FK3A 4GUBA 5E91A 5AV1A 3BQRA 2J0JA 4LGHA 2F9GA 4QD6A 1ATPE 5GINE 5FXRA 4YNOA 4D55A 2OFVA 1W84A 4LQMA 3QFVA 4M67A 1SM2A 3ZO3A 4BBFA 5CU0A 3EIDA 4QP2A 5FG8A 3QX2A 3GOKA 1E1XA 3FZTA 2W0JA 1VR2A 2YN8A 3OD6X 3AC1A 3P7CA 4UYAA 2JKKA 3LLTA 4ZSGA 4TYJA 3PVUA 4TZRA 3MYGA 4S34A 4TWPA 4YJOA 3OOMA 5I9WA 2CLQA 2REIA 3EKKA 5J5SA 3PFQA 5K0KA 3DK7A 1APME 3PY3A 3VN9A 4PP7A 3Q9YA 4FSYA 5K5NA 3VQHA 3NWWA 4C35A 5CAUA 4CG8A 4WIHA 3SD0A 1S9IA 4FKRA 2FUMA 2OH4A 5HU3A 4YZNA 4BZDA 4BDHA 3DB6A 3V8WA 5KHWA 2PULA 4RFMA 4DDGA 4R1VA 4DEGA 4FMQA 1OMWA 4M7IA 3PG3A 2XAMA 4AA5A 2W9FB 4AW5A 2GQRA 4LMNA 3EL7A 2PVLA 2X8EA 3A4PA 3GB2A 4JXFA 1OM1A 2NPQA 2VU3A 4EJ7A 2BZKB 3RNYA 3OCSA 4WG4A 4MNFA 4D2SA 4M0ZA 4ZZNA 1OI9A 4O0VA 4WHZA 2ZV2A 1H8FA 2VNYA 3C50A 2VO6A 1TVOA 5C27A 3E8EA 1A9UA 3DPKA 3O17A 4OTWA 3R8MA 3EN5A 3C0GA 3FKLA 5DI1A 5IUIA 3F3VA 1YKRA 1JSTA 2B55A 3FMJA 2R4BA 3CTQA 4G3CA 4CGAA 3U55A 4ARKA 5CF8A 4AZSA 3UE4A 4RIWB 2EVAA 5L3AA 2QURA 3F3UA 2C5YA 5FDPA 2R3OA 4C4HA 4Z55A 3EJ1A 2W9ZB 3DKOA 3RWPA 3VUMA 4UMRA 3GCVA 5HD4A 3AT3A 4FGRA 4FJVA 5CXHA 4XLIA 1MQBA 1FMKA 2LAVA 5BVDA 2I40A 3EZRA 2E9PA 2B52A 3FAAA 4JDHA 2WTIA 5CZIA 4CT1A 1R1WA 4HVIA 1YQJA 3Q9ZA 2UW5A 4XNEA 3GQLA 3KXNA 4CCUA 2SRCA 3FQSA 5L2IA 1UNGA 4II5A 3QHWA 3O8UA 2PE1A 3RM6A 5TF9A 3KIOC 4WT6A 1BI7A 3RHXA 5DMZA 4FIJA 2WPAA 4O0XA 5FBNC 4FSUA 5A3XA 3SW4A 3ZLWA 3DKCA 2CCIA 2YDKA 2RFEA 4FNXA 1GIJA 4B8LA 4KIKB 3V5PA 4FSRA 2CNVA 1P4FA 4R6VA 5HNBA 4GK3A 4V01A 3VHEA 2OW3A 2R3IA 2XK8A 4FTRA 4ANOA 4BCGA 2GDOA 4TNDA 1VYWA 3VW6A 3CY2A 3A62A 3R28A 3WZDA 5CAQA 2HZ4A 4AGDA 2B54A 5AUYA 2UV2A 2ZJWA 4GS6A 3S95A 4FEUA 5IQEA 3P23A 5F4NA 4FT9A 4YJVA 3W16A 5AR8A 5HVJA 4FKOA 4EOPA 4HNFA 1YXSA 1ZMVA 2C5VA 5B2MA 3QTWA 2P2IA 5HVYA 2FGIA 3D7TA 3BLHA 3NAYA 3CGFA 4EH4A 1ZZ2A 3A61A 4IM3A 3ORZA 3PXRA 4A4OA 4QTDA 2PVRA 4XBUA 4JIAA 2GTMA 3CE3A 2JDOA 5IPJA 4X3FB 2IO6A 1QMZA 2BDFA 5CS6A 3TDWA 3QLFA 5KZ0A 4Z7HA 2HXQA 4YSMA 5CQWA 4FC0A 4QYEA 4AG8A 1UVRA 3E87A 4O2ZA 3U51A 4BJJA 4GKHA 2W17A 3QA0A 5E8WA 5L6WL 4CMOA 4FGBA 4O0WA 5M4FA 1PHKA 2UVXA 3PP0A 4CEGA 5A54A 2WTKB 4G6LA 3ZO1A 5L6OA 2VWYA 3II5A 1PKDA 3CCNA 3JPVA 4FRFA 3ZDIA 4AOTA 3ODYX 3OTUA 4B8MA 4IQ6A 5K3YA 3Q9XA 1H00A 3UC3A 4FYNA 3JYAA 4R7IA 4AT3A 5I9YA 3PDTA 4B99A 2R3HA 2WMVA 4X2KA 2BHEA 4I3ZA 3R7VA 4BCKA 2O65A 5J1VA 4Q9ZA 2BZIB 5FUTA 2QU6A 3ENMA 3I4BA 5GZAA 4UB7A 4U41A 5H8BA 4DT8A 5EYMA 3KXXA 3EZVA 3TNPC 3TZMA 3WILA 4ZJVA 4NYEA 4R5YA 5BUJA 3RMFA 3LFEA 3QCQA 4TN6A 3QQKA 4I24A 3TZ8A 4QMUA 4RFYA 2QOHA 5AIRA 3WF8A 4P5ZA 3EKNA 4IAZA 2VUWA 3QRUA 4RJ3A 4Z9LA 4CSVA 2QOQA 2CKOA 1R3CA 2ESMA 4MXOA 5ETCA 3SV0A 5HTCA 5BYLA 3FL5A 2YWPA 3FLSA 2EB2A 4FKLA 4XRJA 3BWFA 4XV9A 3FXZA 3ZLYA 4HVDA 4IM0A 1BX6A 4JL9A 5LQFA 3DS6A 3PFYA 3ZTXA 4CQGA 4H58A 3AOXA 4FL3A 3ACKA 4PL4A 1WBSA 1ZY5A 3PA3A 3PA4A 4QYGA 5AV3A 1ZZLA 5HO7A 2RGPA 3NRMA 4L68A 4XJ0A 2BRHA 5LVLA 4FV0A 4TYHA 1YWNA 4FI1A 4YTHA 4ZSLA 3FEGA 2UW9A 4NIFA 5TE0A 3VAPA 1YHSA 4FV7A 4EK5A 2XNBA 4F0IA 4PL5A 1F3MC 4YHFA 1XMLA 4G34A 1K9AA 2BTRA 4F9BA 3BYSA 2C30A 5T68A 4AQCA 2BKKA 2IN6A 4IWOA 4ZAUA 4I5PA 2R3PA 4ZSEA 3F2RA 2E9OA 4ZS4A 3Q96A 4F6UA 1H08A 5FP6A 3UQFA 2OF2A 3PIYA 3R1NA 2JDRA 5ETFA 5B2KA 3KCFA 4O7NA 4EH6A 1UU8A 2PWLA 3LQ8A 3BRBA 5DVRA 5IQHA 1KOBA 2B9HA 4TKSA 5L8KA 4QMNA 2Y4PA 4FKGA 5AEPA 4OBPA 3HMMA 2FSTX 3E8NA 5HZNA 4CVAA 1WBWA 3N9XA 2PMOX 4IX3A 1OVEA 3BU6A 4MWHA 4ENYA 5KO1A 4X2FA 3HYHA 4LOPA 4BGHA 4GK2A 2F7XE <