4EIBA

Crystal structure of circular permuted cbm21 (cp90) gives insight into the altered selectivity on carbohydrate binding.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
GKTYYDNNNSANYQVSTHMASIPSSASVQLDSYNYDGSTFSGKIYVKNIAYSKKVTVVYADGSDNWNNNGNIIAASFSGPISGSNYEYWTFSASVKGIKEFYIKYEVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of circular permuted RoCBM21 (CP90): dimerisation and proximity of binding sites
pubmed doi rcsb
source organism Rhizopus oryzae
molecule tags Hydrolase
molecule keywords Glucoamylase
total genus 19
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2440 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4eibA00
2M83A 2EEFA 2VQ4A 4EIBA 2V8MA 2V8LA 4BFOA 2DJMA 4BFNA
chains in the Genus database with same CATH superfamily
4DEPC 2OSWA 1N59A 3HIZA 1CT8B 3QZWG 5DEGA 1MCOL 4ELKB 4P46A 2MCPH 4YHIA 5DJ8A 5E4EC 2YPKB 2ZYSA 2I07A 1U8QA 3O9WC 1R24B 2VXVH 2XRAH 3O3EA 2EC9U 3MLWL 1WEJL 3PNWA 5BJTA 5EZOH 2HFGH 3DETD 2MCPL 1LD9A 1XT5A 3LEYL 2VN5A 2B1OA 3THML 5DEZA 3PGFL 4ACTA 1C12A 2L04A 4XB8A 1ZLVK 1H5BB 4PRNB 4QWWD 4HF5H 4D0CA 3HE6A 4NRXB 4KNTA 3OXRA 1IBBA 4OLEA 1CU4H 4PJAE 5FW8A 1NCCL 1LP9A 2X88A 4HWNA 3RWDB 3T3MB 1KBPA 3MZGB 3QUMB 4QRBA 3EYSH 3L9BA 4MCNA 3FB5A 1KIQA 5HYQB 1C12B 5L8LB 3OSKA 5FYJL 3VFMB 1BVKB 1WPCA 4XAWL 5IMOA 5CCHE 3FT3B 3VYNA 5CGYD 5F44A 3EH5B 1I4FA 1YECH 2NQCA 4JPKL 1INEH 1A47A 2ZTBA 2F1AA 4YR6A 1EO5A 2E74C 5I1HL 1JXGA 4HJIA 2YAMA 4HJ0D 2DWEB 5DDHA 1JGEB 1W6WA 1KYAA 3QUYD 4Z7OE 3GGWB 1FIEA 4URTB 1F56A 2IAAC 1E27A 5CP7B 5FAAA 5ITFB 1OSPH 4HD9A 4LIQH 5FLVA 4LVOB 2J8OA 4GG6B 5MEQA 3KBFA 4YZFF 4XCEA 1FL6A 2PWEA 4S1QH 3S88H 1U42A 1H8OA 1Z9SB 2H4EA 2DIJA 2D9CA 4MNQD 5HYEA 5ABAA 2JV6A 4FS0A 1NGYB 2ZXCA 3BW9A 3LIZL 3FUNA 3QUXD 4W9KC 5AOIA 1FGNH 2EKSB 2ZIDA 1I85C 3IFLH 4Y5VA 3DTXB 4JM2B 4TS6A 5DZNA 4RRPM 4IIQC 3QHFH 1S7XB 1OCCB 5T1LA 1H15A 4YWGL 2O61A 5I9QB 2ITDA 1MW1A 5CN2A 1IT9L 1TQBC 4ODWB 3WDIA 4CKQA 1FG2A 1ZGLA 3VQ1C 1OK8A 2GT9B 5I1AA 3VFRA 1RZJL 2OTWB 4L8SC 3MNWB 3QJHB 2ZUQC 2VXQA 5IROC 4LVEA 2Z91B 1X7SA 4W6YB 4PLOB 43CAB 5CCKH 4WO4D 1H3UA 2HRGA 2YFOA 3QULB 1WCQA 4K9EL 4WHDA 1YAZA 4JX0A 4NENB 3U25A 2DB8A 4K71C 2J5LB 1F11A 3MOAL 1JPTL 3DBSA 4L0PB 5KANG 2R0LL 4YC2C 5CZKA 2Q6WA 3R8QA 4KRPD 3H3PL 3BQUB 3MRQB 4Z7UA 3IDJB 4NUMA 5I15H 1E4JA 2G2RB 3L3JA 3WUWB 1JGDA 1J8KA 3F00A 2PW2A 2BSTA 5E6ZA 5FECB 4LSUL 2B4CH 5FCUH 2AZAA 4Z3FA 5TFSH 2BNRD 3W11C 3CE1A 2K45A 4L8SA 2YGOA 3TM6A 2EEFA 5HYJB 2XWTB 4K15A 2VLLB 1I9JH 5AALA 5C0EA 2EXYC 3RNKB 2G2RA 3S97C 3LN4A 3UXFA 4ICWA 2YA0A 5CNHA 1QBAA 4HALA 4YHML 1DJGA 4N3TA 5DUPH 1AP2B 4UT6A 4HWBH 3F5WB 4WVRA 3FQYA 1ED3A 3D52A 4M8QA 1TEFA 3DJZA 3HI1A 4FMVA 4XNUH 4XXDA 4QYOA 5D2NC 4WF7A 3VFPA 2BY3A 4QWWC 1YEWA 1ET5A 2IFFL 3CQQA 3EYQD 5FYKD 3O2VL 1QI3A 3QRBA 1J88A 3RJDA 2BO0A 4ZS7L 1SXAA 2WY3B 1IGIH 1F1DA 3O8XA 1FLRH 1MCWW 5JPMC 5F9WC 1DUZA 2EDYA 4MZ2A 5IR1A 3B2UC 1K8DA 2VISB 3IBOA 4KZ0A 4N2EA 3TURA 1UCBH 3B7YA 3GMQA 1D9KD 5GZNA 4C55A 3OLDA 3F8UB 1RIUH 5F9AC 3QUGA 1IAIM 1UVQA 2ITCA 3MYJB 4LCCB 2LTQC 4MD0B 4U7SA 3TBWA 4KNQA 4ZSOE 2Q8BH 5D1ZC 1A9EA 5DD0H 1PNCA 4HS3B 2XXGA 4HKJB 4BK4A 5H37H 3AAZA 4EIUA 4G7SB 4KZCA 4EIZC 2EVGA 1OANA 1I8LC 3WDJA 4EZJA 3NUKA 2LVEA 2VCOA 1GIGL 4XPFL 2HN7A 5GSRA 3P4MB 4LDEB 4WFEE 3LRLA 2NX5B 4H8WH 3JWNC 3OKLA 5TH2B 4X6CF 1T0NA 3QO0B 1HH6A 2ZXEB 2KZWA 3R4DA 2KZ1B 2XN1A 1NDGB 1BP3B 4DZ8B 3NCXA 4KK8D 5LGHH 3HRPA 5IW1B 1V7NL 3T0EE 4KZEH 1DDHA 4FLOA 3GMLA 3MLVH 3QEQA 1QA9A 1U92B 2Q3ZA 4AMWA 3G7TA 2B9BA 4IKIA 3RL1A 4OY9A 1KGIA 2OR8A 1MCPH 3RVXD 4LHUA 3T6XA 2Y7MA 3L48A 3LQAL 1ZHKA 4QI3A 4WKZB 3HE7D 4MB5A 5E8DH 4K3HA 4ZUWB 4AEFA 1NCAL 5JIHA 5TDNB 3E2HC 1HSAB 4U1MB 3VWKD 3JWNE 1KXHA 1UWEH 1S3KH 4YHZH 3O9WA 1VEOA 1MFDL 2APVA 3ILDA 5ISZA 5KZCB 3ARDB 3OG4B 1KXVA 4JFED 3FO0L 1FORH 2VXSL 3IJHB 3U0TB 1F90L 2AMUA 5J3HC 3EYUL 2V7NB 3GZKA 4LSTL 5C0AB 4JFPB 4L48A 1PGRB 4LGPB 4ZXBD 5IF0B 4DGWC 1UJTA 1SVCP 4QXUH 1YJDL 4DQOH 1CC3A 2DQUL 1Y07A 1X5XA 4KQ4H 3FOMA 2CLRB 4N2LA 2WYHA 1CT8A 3T0ED 5AZUA 1RLWA 3KPNA 5CBAB 1IM9A 4XCCH 3DSFL 2DI9A 3EFOB 3FH5A 6TAAA 1T5XA 2APBA 3GIZL 4DHLA 4ZTPL 5BRZD 4YE4H 4X6BB 3UTTD 5BS0B 4OGXH 3WNJA 2VXUL 5EEWA 3DVGA 2WXOA 4DSYA 4MA7H 1DBBH 5EOTB 2LU5A 4EVNB 3F7KA 4KK6D 1F4AA 4O2EB 3LKOA 2UXGA 1RVFH 4U33A 1RK0B 5KAQG 3S5LA 5I6OA 1F6LL 1OSZA 4NQXB 4R7VA 5JR1H 2WTOA 2V3FA 4I0CC 2YARA 5C9JA 4D9RE 5ABZA 2XNAB 4LBAA 4JR9H 2D2OA 5HJ3B 5T1LD 4Z7VA 4HULB 4XP4H 2PTUA 1BBJB 2Q1EA 3L5WB 4GQ9H 4JFDE 3WJJC 1KTBA 3ARFD 3HHRB 2C7UA 1A66A 1KGYE 4P3CH 3F7VA 5A6IA 2A74B 3F12A 3WHXA 3RVWC 2UZXA 4JZOA 4N9GB 1RCYA 4X5WB 4HIPA 4QYAA 3ZKNC 3D39E 4IS6B 2P7TB 1OTSC 4NEHB 1J0YA 1G7IA 2XWJA 1R3HA 4WO4A 3ULUH 2LE9A 1CCZA 2QQQA 2O5YH 1RUKH 2DIAA 3MRRB 3OC5A 4HEPA 2CHXA 4X4XA 1ZLWK 3KMDA 5L7XL 4ABQA 5HGAA 3F12B 1PZ3A 4MA1B 3AREC 3HB3C 1FF5A 2O30A 3LZRA 4I9WD 4FCHA 3NDYE 3LNGA 2P1YA 4L9DA 2GJJA 4B9ZA 5I23A 3G6JF 2J88H 4YHNA 3WEBA 2PUQT 3WE1A 4PRDB 2NXZC 1OTUD 2IDTA 3QSKB 1N4XH 3NYKA 4JFZL 7PCYA 1KMGA 3F83A 3BP7A 3CU7A 2VLME 1P4LA 3BPLB 4FHJA 4B9JA 1JBJA 3IAPA 2BVQA 4PVLA 3HKZA 4WIQA 1F45A 1KPUB 3D0LB 1SEQL 2JJTA 2E6PA 2EZ0D 5D8JH 1N8ZB 1NGQL 1ZA3B 3MLUH 4DERA 2AQPA 4A7SA 1JZFA 2XG4B 4NQTA 3X13B 1ZKAA 4BFKA 4YFEA 5LBVA 4HFWB 4M3JA 2IMMA 5KEZA 15C8L 1G5AA 5LCVH 2YKKA 4YUEL 4OZIA 4ELDA 3HE7A 4ZSOB 3EADA 4YIQB 4AG4H 1IBFA 4H25A 3E0GA 1LO3H 4P06A 2OQJB 1ID2A 4PCKA 4XMWA 1T6VN 1RULH 3A67H 4X0NA 5GRYA 5E4OA 3HS9A 1Q94B 4QTIH 4GG6E 1WWAX 3DX4A 3K0YA 4KH9A 4WKXA 5E00A 3P9LB 4N2FA 3MRCA 1CE1L 4PTTB 3J07A 2OS7A 4LE8A 3QVAA 1FZMA 2NYZA 2XY1A 1CLYH 4JFUA 2VXQH 2DMBA 1M05B 5L2KA 4ONFL 1DQDL 4YQXL 1NTDA 4IIZA 3FTGB 3FB8B 3FSWA 4HLJA 4K3EH 4WJ5B 3F3HA 2ILLA 4FEMA 3QWRA 4LSVL 4PGDA 3WFDH 3M8OH 1OIOA 1CFSB 2UWEE 1KB5L 1MDAA 3VCLB 5IJKC 3UEQA 4XWOC 3ZDWA 2DMGA 2EYRA 3UIYA 3V0VB 2V2TA 1L0XA 1JDAA 3MV8D 1MLBA 5LDUA 1T7ZA 3O8XB 3IGKA 5CIPH 1KULA 2XKNA 1EXUB 3CV5A 1F6AA 5ANME 5B39A 1L3WA 2BK8A 3BE1L 3N42B 3OF6D 4LSDA 2I60L 5EEZA 3ZDXB 3O6FA 4DP8X 1KT2B 1E50A 3JWNG 4N28A 5DMYA 3PU7A 4X5WA 3HG0A 1AO7D 4UOZA 4YSSA 1IEHA 2HCZX 2LVCA 4DP7X 3NSDA 2NOYA 1RQ5A 4RMVA 1D5BA 1PFCA 1Q72L 2X4NB 3PJLA 5DEGB 3FT9A 1JGLH 3VXRE 1R75A 2CAKA 4TVPH 5FGSA 4K8RL 3S2AA 5INDB 4K94L 1YEGH 1NMCB 2WLZA 3Q5OA 4E0RB 3FO9A 2XTJE 3EW3B 4LKCB 2LLLA 2PKDA 4NUJA 4H7VA 5KBPA 1YC7A 3V6ZA 1H0DA 3N41B 3V5KA 3RTLA 1NDTA 3DXAA 4GQRA 3CVIH 5HY9B 5SV4A 2X1XR 3N0AA 1MJJA 2WZ5A 3MRLB 3QJZA 3MLZL 3U4BL 3WOVA 1AHMA 1WDAA 5JORA 3CN0A 4PSPA 4PP1D 5I1LA 1CLYL 1RP8A 3V5HB 4RGND 1P7KB 3JT2A 2OR9H 2ENPA 4NNXB 1A6WL 4J8RA 4QTIL 1HQ4A 4WDIA 4YFLI 3CVHA 1RZGB 1WFNA 4J5VA 4H88L 2VJ0A 4KFMA 2OL3B 2Z92A 3BVXA 3I2CL 1NCBH 1A4JB 4K07A 4XX1E 3CHRA 4WI7A 5DUBB 4JDVB 3QEQE 4IJ3B 1JF5A 4NNXA 2DTMH 1L7TH 4PI2A 1S3RA 3BFQG 4F8TA 1KEGL 2BVTA 3FB6A 3P0GB 1F58L 4M7ZC 1PY9A 3LZLA 3VDAA 1PDKA 3M17B 3GMRB 5HJ3A 2HX8A 3O0LA 2L7QA 5ALCH 4JUSA 3U6RA 3TC9A 3FFCE 1J8HD 3JZYA 4UIMB 2C34A 2XOTA 4QT5B 1ZD6A 3H9SE 4JHWL 3QCVL 4IRZL 2ZG2A 2IBZY 2BS9A 2YPLA 1UWXK 5C0GB 2NY1C 1S7RB 1YYML 4Z95H 5K33A 5LBSL 4R7NA 4FXKB 3BVVA 3S34L 3S8GB 3AFLA 1Z66A 4L3FA 1PQZA 4NIKB 1HXYA 2VWEE 4HD5A 3K71A 4C4KO 2VRAA 3L1FA 3M86A 3V0IA 2R83A 4WSJA 2X10A 3TZVC 1FIGL 1QBML 1MRFH 2BP3A 3LHPL 2F74B 4JKKA 3N42F 1MRCL 3WIHL 5DQJA 3UJTL 5GRJH 4X8CA 2PR9A 3FTSA 4Y16D 1GH7A 1TCRB 4XN9A 1HWGB 1MFNA 2I9LA 1U3HC 1Q1PA 4YNYB 5GZOD 4A63A 1IC4H 1PZBA 1WD8A 3PWLB 1KACB 1A4BA 2V9RA 2DYPD 2F18A 3PQYB 5EUKA 1QRNA 3VXRB 4ZNEA 2JCCF 1CTMA 2F8XC 2VJXA 3JVGC 4Z7OF 4P2OC 1G1CA 3TEUA 1X5HA 1MJ7H 2RTTA 1TETL 5HYQA 1VKXA 2P3YA 1OSYA 4KZDH 1OALA 1QKZH 1S9YA 5FWRA 1OT1A 2X6MA 3I02A 2EZ0C 3Q3GA 3RVUD 3AABA 3DV4B 1FFRA 1U2CA 3Q8EA 4Y4HD 2NY5H 1HC1A 4QHKJ 4ZPTB 2ICEB 5IMKB 3B37A 4A2GA 2WQUA 3DIDA 3ALXA 4HIJB 4I87A 2V5SA 4PGEA 1BD2A 3RIKA 2HJLA 2WBJB 1JOIA 5DD3H 4HZLA 2ZSVA 3K3QA 1U8CB 1SEBB 3TBSB 2DF3A 2GVYA 3BDYL 4G5ZL 1T04B 3SQOH 4M4PA 4PJXE 5D7LD 1JNNL 5HGHA 3NT0A 4G3YL 3EGXB 3QEGL 1Q9LA 5CINH 3VAEA 3S4SG 2CDGB 3HPJB 4H8HA 1FVEA 4I13B 1PKQB 3IGAB 2X5PA 5BZDA 3BH8B 3E3QC 3L5HA 3WSQL 2XYCA 1MLCB 3VE0B 1KTDB 3FO0H 1KCUL 3VXMA 3O8XC 1TQUA 3MA9L 1THAA 1AGEA 1ZLWH 5IQ7L 3HG1B 4PFEA 5JXED 4D8PA 2WLMA 5L88H 2F58L 3MRPB 32C2A 3F58L 1EZLA 5HHNB 5D71H 2X6BA 3TT3L 3P69A 4TVPE 5GRWA 3VXUB 4FQJL 3GBNL 3T08A 1TO5A 1I3GL 3V6OC 4TUJB 5IHUL 5LG1A 3ULSA 2RB8A 4IYKA 1E9QB 1AXTL 4OV5B 3SKOB 2DLFH 4N2AA 1WK0A 4YHKH 3UZVB 4HOXA 1IGML 4UILH 4C47A 4W6WB 3HG3A 2UZPA 5I8KL 2P7TA 5JPNA 1JV5A 5IGXH 1J1OH 1EQWA 1Q9WA 3HI5L 3PAUA 4QLRA 2FTAA 5E0FA 1E9QA 2B5IB 8FABB 4V11A 5ID0B 4PJGE 4MHHI 4PJ5D 5F3HA 5ESVB 4LLVA 1U8IA 5DD0L 1BZEA 1VADA 2CM5A 3ZDYE 4BIKA 1JRHH 3UX9B 1KB5B 1L7IH 3P11H 3BN9C 5EO9B 3V5HA 2QADD 3S48A 4NRZB 4LCUB 3REVB 4PGZA 1KF9B 3F6IA 4F8OA 1UACL 2CUHA 3IEAA 4S1DD 2BCKB 1KCVH 2BNRB 3CFBA 4GMSL 4UOQA 3ABMB 4N4YB 3CFIC 1BDYA 3IETB 1HAUA 2QLYA 3FO9B 1T7XA 2EEDA 4M3HA 1BZDA 4LCUA 3HMXH 1MFVA 3X3FH 2IADB 5EORH 1P4BL 2H6PA 2W92A 3U1SL 4ZMOA 2YOAA 4H20L 3NEEA 4L9LC 3VFGL 4APXA 4WTXA 4KKBD 2A74C 2YXWA 1PZCA 4AE1A 4Y5VC 5HVWA 2R1XB 4IBUA 4LSQL 1V7ML 2BH0A 5IB4A 4YHMH 5BV7H 3BAEH 3P0YL 3ARTA 2DQDL 4UANA 4I5BB 3IGFA 2QSQA 4MQ7A 2JXMA 4UOW0 1TKWB 4YDIH 1M7DA 5DRNB 3CVBA 3FRPA 2KS0A 2H45A 3LXBA 3V0VA 1CDBA 1NICA 4DKEH 1B4LA 1ZV9A 2A99A 3CFJA 4LSUH 4RCAA 2X6AA 3OXRB 4K7PY 5GGTA 4LSPL 1FFPA 3GRWH 4XCNA 5CFHA 4FQCL 4JAMA 4J6IA 5FDWB 1TUPA 1T0OA 2ADJA 3X1NA 1JPST 2EKSA 2ADIB 2EEXA 3GKWH 4YK4C 4IMKA 1XGTA 3UL4A 4QHKI 2HTLD 4HOZA 4YHPA 4RAUA 3PJSB 3LCYA 5IVNA 2MQCA 5E1AB 3HHMA 5E0QA 4QAMB 3LEVL 4L8BB 1LMIA 3CC5A 2XBZA 2ZYIA 1OM3L 3NACH 1KPRA 2DW5A 3FU0A 3B5GA 4XN2A 4A37A 5DA4A 3PUCA 4FFZA 3GJFA 4N0CC 4BJLA 4L8CA 4PV1C 1E9PB 2YK1L 2Z4TA 3PWUA 4HUWA 4FTVB 4R2GB 1B4TA 2I26N 4N6QA 1U4FA 5DRZA 5I26A 1E6OL 1UT1A 2ZXDA 2EXWC 2WB1A 3DX9B 3HG5A 1JPSL 2R1WB 4HFWA 4IGBB 3ZTNH 4PVNA 4HIJA 1T0MA 2F53D 4Q2ZA 2HG5B 4HPYL 4WY7H 2CK0H 3A4FA 3HOGA 4HUCA 3DO7B 3T8VA 2HJLB 3O6LL 3ZYJA 4JANB 3RVUC 3KPQB 2HT3D 3IF1A 1IKFH 1R3LA 4WI2A 2FH6A 2HFFB 3FNKA 4F92B 4NRYA 3RU8H 2UVEA 1IBGL 1UM4H 3CDCA 3D2UD 4OIFA 2J8HA 4QHUA 4PRDA 1LEKB 3U7YH 2X3BA 2RAMA 3A6BL 5HXMA 1BQHA 4N8CL 4UTAL 2VR9A 4NKIH 1ECZA 2WINB 1YJDC 2WLLA 1OSPL 2BVPB 4JFDB 2H6OA 3WV0A 5EOCJ 4H8UA 4F7MB 4GINA 3QWOA 2QFPA 2K4WA 1GJWA 4BZ2H 5CJXC 2FE0A 3LV3A 3D0VA 4KV5E 5TF0A 4AEHH 1DE4A 1WIUA 3RU8L 1ED3B 4M8QB 2ZUVA 4FQLL 2OMBA 4UNTA 4POZD 3G04B 1EPFA 3KVDD 3OQRA 4RNRA 1QO3B 2VO8A 1M3JA 3DPBB 4G8FA 4GNKB 3L4UA 3O6LH 4YFLF 4UM9B 3VGDA 1GYAA 4NFCA 1E5UI 2YJQA 2HA1A 4GS7C 3EOYG 3TZVA 4Y1AB 3O4OB 1RK0A 3MSPA 4DPBX 5F0LB 4I48A 3EYOA 3OC8A 2OYLA 1HNGA 4BQ6A 5JIMA 4UTCA 2K3TA 3MRHA 3PHSA 5SWSB 4AKPA 2BY0A 5DT1L 2YK1H 5DVOA 1KWGA 2B39A 1Z7JA 2FH8A 4P5MA 4Q56A 5I8EB 3GPSA 4R7DA 1U9KA 1BREA 2QSTA 2Z31A 5T5FH 3LS4H 3ARBD 2CJUH 5KOVC 3NACL 1YY8B 1XF2B 3MUJA 1LEGB 1TU2B 2VITA 2BZCA 4WGWB 4BXSV 4TYUA 2MRYA 4XZUB 2MPAL 2R2BB 4P2QA 4UNUA 2G3ZA 1WEJH 2CA3A 2XWCA 4KKNA 1JZ5A 2CR3A 1KGUA 2XRAL 5C2UB 3V4PH 2XZZA 1RZKL 4D0DA 4P59L 5ENWB 2WQVA 3IDMA 2X7LA 4K7PX 2BVUA 5DJ2A 1A7NH 4ZAKA 1F6FB 1N67A 3BD5A 3BVUA 4GRWB 4KMLB 4WGVB 4RISH 1QW9A 3DIFB 3X1EA 4F3FA 3BKJL 4AIZB 1G43A 1YYLL 3KPMB 4P4KC 5I5JA 1JI2A 2EUZA 1NL0L 2F7RA 3H9SA 3LKPA 4GG8A 4MFHA 4L3EB 2DQDH 4ESKA 1SF5A 3MNZA 3II1A 3CLEH 2QBWA 4K73A 1P0SE 4XVJL 5CD3A 5LQBH 5LB1A 1MCFA 35C8L 3HB3B 4QRAA 4HFUH 3OAUH 5HI4D 1AZBA 5IHHA 1E2VA 3ILEA 4PJEA 4U1KA 2A9BA 2XVGA 3CSGA 3TWCH 2APWA 2CGRL 5ESQA 3L2NA 2HVKB 5FKAA 4E9WA 3UBXI 2Q7YA 4P4KB 4RMBA 1Z9SA 5GZNC 4NUGL 3F2LA 2A6IA 2IWFA 2FWSA 3V0HA 3C5SA 3AU1B 1A9BB 3GXUB 1AC0A 1U3HD 4WNQB 2IPUK 4K7FA 2BSRB 2CDGA 3KM2A 1GW0A 5GSRB 4WUUA 1KCVL 4GMSH 3PNRB 3D85A 2OZ4L 4MNHB 1KCRH 2NZ9C 5CKAA 1ZPUA 2OJZH 5MI0B 4YDJA 2KPNA 1PG7W 2QZ5A 3GMMB 4L23A 5HDRA 1F4XL 1NDGA 1JYVA 5B3SB 3HKFA 2XC8A 4AYDC 1FN4A 4KDTC 5GRUL 2A6IB 4WZ9A 3C5ZD 1JK9B 1KFAH 1JZEA 2XX1A 4P5TA 5MEPA 4MAUL 3L1EA 3ATBA 5FYLL 1UM6L 1JZIA 1NMAH 3TBWB 4I3RH 1NOAA 4Z5RB 4U1GC 5DUJA 4TLTA 4Y4KD 3DROA 3OKEA 5G55A 3MCLH 1EZVX 2YFNA 4KGLA 3HI5H 1A1NA 2BOCB 3FB5B 2CMRH 4N85A 1EH9A 5TGBB 2VSCA 2QQKL 3MFFA 2DQFB 2FSEB 3P2DA 1G6RB 1NQBA 5EBMA 3CFJB 4TVPD 1T66C 4NQDB 2WOBA 5HDBF 1CLOL 4M5TA 1AMXA 4DP0X 1DSYA 4LSRL 4PJ7A 5JOEA 4N5ED 4CGUB 4J27A 1GMEA 2GI7A 2NY2C 1HI6B 3HG2A 2NZ9D 1G9HA 4HK3J 1J9RA 5I66B 1J18A 4KRMB 4M00A 2NYKA 2VQUA 1J05A 1PZUB 1A5FL 5AENA 3VXPA 2GUOA 2QQLL 1NCWH 3DX8A 4N9GA 1AHWC 4E9SA 2Q86A 1QHQA 3R4RA 2VDKH 3RVXC 2J44A 3LJ3A 2L0DA 4ORGB 3ARDC 2NY4C 5TE7L 3UG5A 1KELL 1AZCA 3RPIB 5H37G 1AP2A 5JHAA 1HL8A 4IBLT 4ODSL 1MCNA 4G9DB 2RGSA 1I31A 3QRLA 3NAAL 3GZOA 3REVA 3WXVH 4ELMA 3IRPX 4WWPA 1DN2A 3FH8A 2IMNA 4IOIB 1NA8A 1JFHA 1Y18B 4ZMQA 3AS1A 4B53A 1M9SA 3EO0B 5E4IA 3DJTA 3SHSA 4MSWB 2ZSWB 3L3GA 3QAQA 5L4IA 1W91A 1EGJA 4KY1H 3SDXB 3VXRD 2BY1A 4LLYA 4TUKH 4YVUA 1JWMA 5F8RC 4GW5B 4ETQB 2F5BH 3RDTB 2PR4L 2NNRA 5LGYA 4JZJB 1IFHH 5MEOB 1AZNA 4MJID 2LFEA 2R56H 4BYHA 1XSIA 2KLRA 4JKMA 4ADGA 4AM0A 2OTPA 5T1KD 5TD4A 3IXAB 1R3IH 1CXIA 2JIXB 2GTWA 3SE8L 4LCIL 2XJLA 1A3RH 2H0JA 2KYIA 3B56A 3O6ML 3QC5X 2AITA 3RY6C 4IBYA 5IK3B 1GHFH 3CHOA 1S9VA 3TBVB 3HR5A 1Y1UA 3BP5B 3FFCB 1UT9A 1IC7L 4G71B 5MEOA 4HG4K 3IXAA 4M29A 3V6OA 1IVTA 2XQBH 2E9BA 3RRQA 4B7IA 3EOTH 3QXUA 4WCYH 5JQHC 3L2LA 5AEAA 1FH5L 5D7LB 3C87A 2Q8AH 1NEUA 2BIHA 5IW6B 5JTWA 2X1WL 4J3OC 3FSOA 2DV6A 3FZUC 2CIKB 5D5MF 3MREB 1NBQA 4RAVB 1OP5K 1CFSA 3HG1A 3NCCB 5AFAA 4MLSA 4PJFB 3B34A 5KS9F 3GI9L 3GSVB 3WN6A 2FX7L 3RIAK 3B83A 4JANA 5I0DA 2NY3B 1KYFA 3NSFA 1KXQE 4NJAL 2DLGA 1UXSA 4YDNA 4AYID 3TCLB 5EU5A 2OJEA 3BKCL 4W4NA 2CPUA 2FO1A 3JWDL 5JHDE 3SOBH 1J8HE 3KHQA 4W6XB 3S8FB 4MNGB 4FADA 2XCMC 1U3HB 1ZVSB 2O4EA 5TDOA 4H0LC 1KN4H 2JKSA 3S35H 2E8ZA 3NCMA 5BOPA 4YGAB 1ZVHA 5EU5B 3DVFA 1HX0A 5C97A 3S35L 1FNGB 3T0XA 4HUXA 4AUUA 4TOYH 1Z2KA 1KENL 4W9EC 4P46C 2VQ4A 5CJOL 3ULVD 2DQHL 3Q3GB 3SOBL 2CDFB 2A0LC 2PPDA 4OFYD 4V1DB 3US0A 3KPSA 1XXDC 2CBMA 1ZVNA 3E8UH 3QFJE 4PJBE 4XNBA 5D72L 5KVDE 1RMFH 3OR7B 3BAYA 3ET9F 2Q5BA 3EBHA 5C0RL 3BEVB 1I7TA 1MCJA 4GG8B 4TUOA 3K74B 2EDBA 1I1AB 2DQEL 5KANI 5AWNH 4JEGB 5GZND 1GSMA 4FI6A 5BZWA 3UOAB 3ECVA 1ZEAH 3KPSB 4WEMB 4GAJL 5DWUH 4MQ7B 2HTKD 3GBDA 3V55A 4AYMC 1EEYB 5FWQA 4Y2NA 4ZW7A 4Z8FH 2E8YA 2AEOA 5K39A 2JTDA 2FEDD 5MEPB 4UQ2A 4YBHA 2FX9H 1M05A 2NY7H 3D6GA 3NPSC 4IRJB 1I9EA 5L2KB 5FB8A 1EXHA 2OX5A 1RIVL 2VDOH 1K4CB 1DVSA 3A4AA 5JW4Q 1DFXA 3BUQA 1SY6A 4MD4A 5AVXB 2I25N 2AEWA 4PUBL 3ECWA 4LCIH 1RY7B 2MCAA 3SY0A 4AMXA 4BA0A 3S3BB 4FLQA 3IDNB 1TZGH 1QFHA 2AXJA 3QDMD 2D31A 3GRBA 4OQ1A 3MRBA 2C9SA 2WWOA 1HWWA 2F5BL 3WFHB 5I6MA 3VVVA 4EZLA 4PSRA 3OTTA 3MX0B 4OZIF 4H44C 4MDIB 1HFUA 1BMWA 3DHPA 4FZ8H 3FBQA 2HLEB 2XWRA 1YMHA 3ZKSD 4FXGC 3WU1A 4KMTH 4YHNB 5CCJA 3TBTB 2JK5A 3GIVB 3HNSL 4MJ4A 5ABDE 1Q9WB 3TFKD 5A2BA 2DQCH 3ARBC 3PJNA 3RB7A 3ML8A 4P8QA 5E6YA 1P84J 5CJ5A 2EECA 2P8MB 4QAWA 3W0WD 2DEWX 4N2OA 5FA4B 1U8HA 2FWLB 1KGJA 1JD9A 4XN1A 2YZ1A 1A4JA 5B1KA 4HCRH 1CIUA 3MBEA 4F7PA 1FRGL 1TR7A 3ZE0E 4FJYA 3HC4H 4LL4A 3CQFA 4G6KL 2B59B 5FKPA 1J86A 2E4TA 4K3EL 2CXKA 4YXHH 1NC2A 3U0PB 3UZQB 2WVSA 3SGDI 3BD3A 5E1QA 3ZZ1A 2JCCE 3ES6B 4IRJD 3C5ZC 5CLYA 2WM0A 1JZ2A 1Z9PA 1EVUA 3A47A 3BIBX 4WWKC 3CVHH 2X0UA 1P1ZB 4QXTB 1QSEB 4XVTL 2PYFB 2UZIH 3EBAA 4P05A 4HJSA 5IB1B 3I6GA 4JRYB 4RETB 3VI3F 4S1RL 1Q1JL 3H3BC 1XMEB 5IFAL 1MG2C 1NSNH 4JQXA 3K46A 4RGMB 3UBHA 4AXWB 4XNMB 4DN3H 1O9VA 1QYGH 5KVGH 1Z3RA 4KKCD 3TZVB 2DWYA 5I6KA 3QEQD 4JG1H 2IWKA 5KYYB 5IJKA 1I75A 1TTUA 3AGWA 4XH2A 5FLUA 5C7XH 1U8CA 2X9ZA 2VDRB 4PJXF 2QTVA 1JP5A 5HBBA 3QXWA 3N44B 5EFIB 2ARJA 4NQSB 3LKSB 5HHXL 1F4XH 2DJMA 2F54D 4YDLC 4JDEA 3BLBA 1FRGH 2NY1B 3KZ8A 4N9OB 3O6FB 4HUUA 2ZUSA 5CEZL 4GO8A 3P1VA 2E9JA 2EXWD 5CBEA 2YLHA 5IESH 4R8WL 1ERNA 4H0HB 5T1LB 2J8UE 2BXZA 1IQDA 4ZQKB 5LN4A 5KSBB 3LN9A 4W68A 1HIML 1NKOA 4RDQF 1IRAY 4JRWA 4YSOA 4LNRB 4BCXA 2A6JB 3QHTC 2VLJA 4YN3A 4JFDD 4OLWL 3UBGA 3TESA 1ND0B 2YSSA 1D9KA 2ZAIA 3UBFA 5BZXA 4W9ZA 5CBEB 3GB7A 2AQ2A 4F5CE 3DXAE 1TTFA 2VM3A 3FUFA 4PWEA 2DD8H 4CUCA 4F1SA 2CKBH 2FT7A 1ID5I 4Z1PA 2XVBA 3H2PA 2IALB 3R18A 4HUXB 4G6AD 5LQBL 4JFQB 4M9OA 4EXPX 1RHHB 3MRIA 1DBJH 5CEZD 3NGBC 3PWUB 2HUHA 3P4OA 2JJWA 4HUWB 3KYAA 5DRZB 5HYFA 4I0PD 2ZX7A 3CQPA 2X2YA 4R2GD 1QRNE 5CIPA 1WFJA 4NO5A 4A6YL 5I1EH 3DX7B 2VDQB 3DUSB 2CO4A 3CVCA 3IJEA 4WO4C 5FA3B 5C08B 2WK2A 3BWAB 4L8SB 1OP3K 4LU5H 1U58A 2VRQA 4HAFA 3BPCA 1CL7H 1T83C 1YDPA 2L7UA 4KO9A 4UDUB 3GKZA 4ABVA 4EF3A 4IIQB 3NJJA 1E5BA 2P24A 3EH2A 1CE6A 1RK1B 4ZX5A 1UA6H 1UURA 2RHEA 1TJIL 3KNBA 2NNXA 3HEIB 4MNGE 1Z0MA 3DIVA 5DZVA 4EUPB 2CNZA 2OM5A 1KIRB 2DQEH 5JYLA 1JFQL 5DJ6B 4DQOL 4QJ5B 1FA4A 2F5AL 4KOCA 3DBXA 2PTTA 3LQZA 5I2IA 2E7LC 1FHGA 4Q9QL 4KAQH 4RMRA 4J3SA 2BVEA 1F90H 5CUSL 4LLUA 5E5LA 5DHYA 1U8PB 4JREB 2CCLA 3ZBMA 3MV01 2I07B 5TQ2L 2CDEA 5D6CA 1FBIH 5I1DA 3S36X 5BJTB 2X87A 2EDDA 2XV3A 5FYKH 4GW1A 1QVOB 4KI5D 2G30A 1C5BH 3B2PA 2QHLA 3ULVL 1ZGLB 3O4LA 1RU9H 1ZANH 2XKUA 3NH7H 3OX8A 3O4LD 1DQQA 1ORSA 3WJJA 5I0XA 3L3DB 4X6DE 4PJDA 3VJ6A 1LLAA 1XIWA 2VXTL 4BH8A 4JB9L 2BNQE 2BSCA 3ESPA 5H35A 3VD7A 5IFJA 5I28A 2AEQH 2O6FA 2QELA 5I8EA 3UAJC 1N70A 1WD9A 2IANA 2FHFA 3SCMA 5CLWA 2CBQA 2YD6A 3CHQA 4WU7B 4E0RA 1FLTX 3AMKA 1SJHB 1V7NH 3OB8A 4K9JA 5FO8A 2QPFA 1LILA 3BP6A 3UC2A 3IJYA 3ARBB 3IDXL 3U7YL 4PJ6A 1KJMA 1QSVA 1BMZA 3BUYB 1KXVC 1A25A 4LAQH 1PAMA 2Y0SA 3SD2A 1DEDA 3A4DA 3BFOA 4M48L 5J0BA 5IB2B 7FABL 1LE9B 4OLXH 3U9UB 3D0AA 4LCCC 8FABA 4F91B 2HTLC 4HPYH 4KRPB 3VXMD 3BXNA 5DJ0B 4Q52A 1FO0A 1RUPL 2ZCKH 3J7HA 5FYJU 2YUWA 4BD4A 2NUPA 1KLFA 2BP8A 4OZHB 3ATDA 2YQ3A 2YD3A 2WLLB 3FUJA 1YPZB 2HG0A 2TRYA 3U4KA 1IV8A 2ED7A 3GD1C 3JV4A 1N6QH 4F7MA 1OCZB 3PWNB 1U3NA 2UYLB 3NTCH 2H0FA 3MJWA 1KSRA 4D9RD 3LEVH 2DBLH 4ZS7H 4LMQE 4BWTA 4XHQA 3OR7A 4X7FC 4AL8H 4U7MA 2RFXB 2UY7A 4MJ5A 2NXZB 1KBGH 2YAPA 1M7XA 5FC9A 1ETA1 1R3LB 3F7QA 4R4BB 5DFWH 2FL5B 4ELMB 3G6DH 2BINA 1MCWM 3MRBB 2DWTA 1XGUB 5ID1A 3VXUD 1RIHL 3CDZA 1A65A 4Q6YA 2E3VA 1LD9B 2PABA 2RR3A 4AZUA 5E7FA 3NVQA 2C3XA 2FQEA 5AW5B 4Z3HA 1ONQB 3D18A 3HG4A 1RZJC 2FHCA 4K3DH 5MEQB 3D85B 4HLZG 2D8KA 1SDDA 3HS0B 3E3QE 4YDIL 1GKEA 3RGVD 4J3UA 3GMMA 4U49A 2HRPH 2IVFC 5E1GA 2O6DA 1I1CA 4NC1E 1D5ZB 4OV6F 1UD3A 2NLJA 2IG2H 3EH1A 1MIMH 2JKXA 1ET7A 4IOSA 2C1PB 2B4CL 2K7PA 3P2BA 1QR4A 4NERA 4C58B 4POYA 4G8GA 3LRSB 1KC5L 1KT2A 5ADPH 2CG9X 4P2RB 1HEJC 4KC3B 4WHTA 3D4GA 4DKAA 2QQLH 1HE7A 1IQWL 2VW7A 3DX3A 3ISYA 4NUQA 3SKMB 3H3PH 2J43A 4PLJC 4JRYE 1O7DE 3KEDA 1KN2H 5L7XH 3ETBJ 4MMXA 4EJ1C 3STLA 3D05A 4RFOL 5B7MA 5IB3A 3ZL4L 4ZMWA 4E9RA 2QGCA 1NEZB 2JQZA 2YAFA 3B7SA 2FBRA 4LLQA 4JGJA 5BXFB 3U0PA 2H0EA 3RZCD 1TJGH 5IUCA 4GMTH 2I27N 2E6JA 2WKGA 1VADB 1QUNB 1HKFA 4X7SL 1ANUA 3HG1D 5LKNA 5LHDA 4K2UH 3U9PL 4OCWL 1M7UA 3U1QA 4P3DA 1R47A 2E5EA 4P23C 1J5HA 3ARXA 4XCYB 1G7MA 4B9KC 2CRYA 2I9LB 3HBZA 3MLSH 3HI1B 5KJRL 2XHNA 5D2NA 5FA4A 3SE3A 3OKNB 5AOJA 1FO0B 2FIKA 3VFPB 1UWXH 2VL5B 3BAIA 3WN5C 3K4AA 2NYYC 3N85L 1SBSH 4ZX4A 1CGTA 4JPQA 2D73A 4KJQD 1I8UA 1EHAA 2EADA 5ENWA 4K4KA 1C8QA 3V4VH 3N44F 4GAFB 1PX4A 5C2BH 5LAPA 1BX2B 2EO9A 4P9HH 3MBXL 1WAAA 2X4RB 5A2LH 4QXGL 5AKVA 2A0LD 3ECQA 2AAAA 2ZF8A 4F7EA 3TPUB 4ZODA 3UPRB 5C0FA 1RZIA 4Q6IA 4PB0L 2KZKA 4Q9BA 1MCHA 2PTVA 3RLSA 3MACH 1Z6JT 1E9OB 1BHGA 3KJ4C 1XAUA 3APFA 3FU3A 3UDWC 3WUWG 3GJEB 1EZUA 4N90D 1BZ7A 1FNSH 2YD7A 4QHMA 3W39B 2NXZD 5IVZA 4Q9RL 2SODB 4LCVA 4FGMA 2IH1A 3VYPA 4EVNA 5M7QA 1YEKL 4GT0A 5D5ME 4NENA 2FUQA 5FOBA 3UZEA 1A7OH 2AANA 3CXHK 2WZ6A 4O2CA 2DWXA 4G83A 3HZYA 1YECL 4JPKH 3PV6A 3V0GA 3NRFA 2WLNA 4Z7WB 5KVEL 1T3FA 3C8KB 4X4ME 3G04A 2BS71 3CUPB 1S9VB 5EOCH 2COQA 4XAWH 1KCUH 1A8ZA 4FYQA 1TSRA 2AQQA 2L3BA 3KJ4B 3RX7A 4EI5A 3IDMB 2BS8A 4TNWF 3O11B 3EFFA 3VRLE 3FMGH 4PGBA 4FRWA 3KDMB 3SO3B 1WHOA 1BEYL 3F7VB 3WEXB 4P5TD 4DUXA 2PYED 3IDGB 5C0CE 1NANH 5EZLA 5DGRA 3RDJA 5E5UB 4GQZA 4MX7B 4OAWA 5ETUA 1HHKB 3DURB 3C60B 3QFJB 4LP5A 4PJBB 3O9WB 3CBKB 1RUMH 4ODUB 4PREB 3DOIA 5ESAB 1EJ6A 2C8NA 2XZQH 4U6XB 1XGPB 4EN2A 1U4EA 2E59A 3AS3A 3QORB 4RFEB 4TTDD 4PJFE 5C86A 4AL8L 4XPAL 2IDCA 2EE6A 1RUML 1T4KB 2ENSA 1I8IA 1MCOH 3PQYA 4UM8A 3EO9H 5EIIG 2IANB 4AW7A 3N0PB 3ASWA 4JY4B 4OFDA 4TSAL 2DQIL 5D1XE 4J3OF 2FWOA 3QR1A 1OLLA 2VDLL 5JUEH 1YEFH 2AQ3A 4GRLB 3SPVB 1BEYH 3TASA 4FULA 4L29A 4FABL 3POCA 1P4UA 3VQ2C 3VSQA 4XRCB 1URLA 2A9CA 2MHAB 5K39B 1FNHA 3RJQB 2Q76B 1L5GB 4PJEE 3ROOA 1OAJA 4KHXL 1UYWL 1VZHA 5K9QG 2ZSVB 3F7PC 3UJJL 3K7UA 4KUZL 4MBOA 4U0QB 4XVSL 2VDLB 3LHPH 4TQ8A 4XNXH 5HD8D 4AEHL 4YR6B 2YAQA 2Z34A 5HHOD 4AGQA 1R5WA 2V3DA 2ZAGA 4GXFA 4F2MA 4Q9RH 3GINA 4MAYD 4JN2B 1BQSA 2W65A 3QJFA 1QHOA 4DVBB 4ZUTA 4ERSH 4JFHD 4BQ9A 3GDBA 3QUMH 3SPGA 3MRMA 2E7MA 3UC0H 1H8LA 1IGJB 2NY6D 4PRNA 1AGFB 4ZBJA 1IBGH 2XWDA 2WSPA 4WWOA 4NRXA 4JPWH 4UMSA 4CBPA 2P80A 1WIPA 2HFEB 1RU9L 1ZANL 2WO3B 3CZUB 1VGKB 3GSXB 3TYGL 4PP1C 1X5ZA 1HJBC 1ZS8B 4N0CD 1TDQA 4YSPA 3WIFB 3TN0C 3TP4A 3U30B 1UKSA 1FBIL 3S5YA 1BQ5A 4JO3L 6PAZA 1GJIA 1C9SA 1SXCA 5LN8A 3SJVA 4HEMA 1Z5LA 4AE0A 4LZKA 2NX5A 1D6EB 3S4SA 4YHIB 1RD6A 4P2QB 5E9DB 1E6OH 4U6VL 4PV8A 5I8CB 3I2CH 1BXAA 3E8VA 3U9PH 3PWVA 3U4AA 3B7RL 1CXKA 4H88H 4YBLC 4ONHB 4O5LH 2JWYA 4IK7A 2YPVL 1RUQH 4G6FB 4OBSA 1QR1B 3F7LA 3EDJA 5CLZA 1KPUA 3D0LA 4I0KA 5EZIL 4AYFB 4MMYA 1FSKB 5TF1L 5EEXA 3S5LG 1QFPA 4XMLH 4W9DC 3LX9A 4G6FD 4JO5A 2IC2A 4AQ8A 4G6ML 4FJ6A 3U0WL 2JKJA 2VQTA 1PMYA 2DYPB 5EO0A 3SSGA 1QQDA 1WG3A 2G9KA 4TRPL 3OKYA 4P4RB 1WAPA 2GUOB 3DX8B 2YC1B 3K2MC 4A2DA 4QPEA 2Y2TA 5AG8A 1IJNA 1MIML 4JZJC 3X11B 1IGCL 3L4CA 3QIUC 4ZOCA 4UIKH 3IBEA 2GJ6B 4HUNB 2BHYA 2GFBB 1R9FA 1DZ0A 1G1YA 4GP4B 3VD5A 2P43B 5JHLA 5JW4M 2CBTA 1X9LA 3AXHA 3FULA 1MY7A 4JFFA 1WCBB 4YE0A 3G08A 3WXWH 1P7QD 4QHUB 3VXTA 4AEIL 5CLXA 4O2CB 4YXKH 3MOBH 4EXKA 1IKNC 1CI3M 4KUCF 1FZOB 4Y2DC 3ARFB 4YGVA 4TV3A 1L9OA 1YAIA 2D0HA 4OD2A 1D5XB 5AW7B 4ZRGA 4DO5A 3O3BA 2IAMD 5MP6H 4EIBA 3DGGB 4XMPH 3QIBB 3V0WH 5C0FB 3IRCA 1HILA 3FO1A 4PJ7E 1U93B 4PB9L 5CLTA 2WLKA 4BXVA 4YSAA 4KK9C 1A3LH 1JWSA 5DFVC 2P5EB 3QZWA 4ANVA 5FHBL 1JK8B 4JHVA 5H35B 4UTBA 2W9DH 5IFJB 1TTAA 3VTTA 2NY5C 1MCEA 4WW2F 2QGBA 5JYMA 3P2TA 4KPHH 2HZHA 2YWZA 4Y2DB 5EN2A 5A16B 2GITA 1P53A 1X44A 4RBPH 3F65A 1N6VA 1X5FA 3D85D 2BPBA 1Q9KA 3VNZA 5B38B 4X83A 4GRWE 1F4WL 2HLFD 4IRJA 3PJSA 4I0PC 1DCLA 1U8PA 4W9IC 1OD7A 1U2YA 3GBMH 4RGOL 4WO0A 4PJ7B 2XKNB 1BPVA 1F02I 4H13C 1YEEH 4JM0A 2ITFA 4TL4A 1TPXC 2QKIB 1BD2B 4IBQA 5IGXL 4GSRA 1K2DB 3KWUA 3C9NB 5E03A 3DO4A 5C3TA 3UTTA 5HDBB 4XVTH 1JPEA 4FA7B 2I9TB 1J5IA 4GIOA 4M43L 4Y9FA 2L8AA 2XQ0A 3VX0A 4X50A 1AXTH 1YPZF 4QRPD 1E8WA 1DLHB 3BAKA 4KO5A 4DH2A 3TJEL 4DKFL 3FFDA 1T1YA 3NZ8A 3BZ5A 4N8VA 4TPRL 3RTQA 3HC4L 3UG3A 3MV8B 4QUOA 2XIIA 4FQJH 3ML9A 4HKZA 3WYRA 2VXTH 1YG9A 3UP6A 1N4XL 2D2CC 3ZKQD 1C7TA 4K3JL 1XMWA 4WKZA 3NH7L 1C5BL 3HAEH 3ULVH 3GJFH 4ZOBA 2YEQA 5FYKL 2CCVA 4K7FB 5E99L 2Y5TA 1VFBA 4QJ4B 5F7WC 2YMOA 4NHCL 3B43A 3MA9H 4JFEA 4HDIA 4K23L 5BO1H 3D7PA 1LE9A 3H9HB 3J2PA 4XNZC 3EYFA 5DZPA 4LEXH 3PUUA 2XXMB 1SEBA 2Q2LA 2H32A 2OFQA 3RUGB 4FFYH 3TBSA 3ULUL 3BZEB 3QXDA 4H8PA 1R3JA 2F5AH 2V5YA 3TA3B 4OI7A 5I1IH 4K55A 3MGOA 5CO1A 3GSNH 2KH2B 1PLAA 4QRRD 1DR9A 1O6SA 1IAMA 2E9WA 4N2BA 1H3WM 4GQ9L 5TE6H 4XCNB 3V52H 4XP4L 4JKPL 3EXJA 1YY9C 2QVIA 4GFTB 3QARA 4Y1AD 4GB9A 1BQHG 1TOXA 3BOVA 3INOA 1JNLH 1ZDQA 4LGSB 4N1HB 4ODUA 4PREA 1S8DB 2FATH 3BGMB 5PAZA 4Z7AA 2I5YL 5IB5A 4D0CB 1T5XB 1NCDL 2VMDA 4Q14A 3SCMD 4PUBH 2YA1A 1RV6X 1BD2D 3WEOA 1DBMH 1IU1A 1C08B 4GJTB 4N0FA 2ZCLH 3OAYK 4LEOB 4M5YH 4YDKL 3W11D 4ZT1A 3L3HA 4IBVA 5D4QA 5FGRA 4PGBB 2F53E 4L4VB 4X9BA 4ZTPH 2ATKA 4HCRA 3OGCA 4OKDA 3AUVA 1NFIB 1CFTB 3SKOA 2EYTA 4XP6L 5JQ6L 4OD1H 1HXMA 3E38A 4TUUA 3V5DA 3GO1L 1DN0B 3U0TA 3TEZA 2AXGB 3DK2A 2DBJA 3ME0A 1ZY9A 4GAJH 2BWIA 3HC0A 4WHYH 4CW1A 3BIKB 4FHKA 1L9RA 1OAQL 3RWCB 3W5NA 2FJUB 5J13C 5C09D 2C9XA 5I6XC 3VB8A 4OIBA 3WIHH 2AKRA 4XO9A 3MKGA 4RIRB 2RJMA 4KUCD 1ZMYA 4YBQC 5C0RH 3O3AA 2HFFA 3T4AB 3RNKA 1MNNA 2X4PB 1AGBB 1LQBC 4N24A 4YH6A 4ZNEE 2IAMB 4L4VE 1WAEA 4BH7A 5BO1L 2Y06L 2WXMA 3S34H 3VB9A 1M57B 3GMOA 5LNEA 2PYEA 1H3VA 4DUVA 1YYMH 5HHOA 1BXXA 2P8PA 5CEZH 3Q6FB 4HZAA 1KZQA 1I7ZB 3EGXA 3T0DA 5E8DL 2JCCA 1BF5A 1NJ9B 1VFBB 4A2MA 4OZGA 4YK4B 3GSQB 4KJWC 5ANMB 5FUOH 1CFQA 3LMJH 3DRTA 4X6CE 5IBTH 4TQIA 4BGDA 1ADQL 2D9QB 5D1XB 2DLEA 3K72B 4Q97A 1ZTXH 1EIBA 4F9LA 3ZO9A 5I24A 1YQVH 4HEPG 1CLCA 4I8DA 3EJTA 2VL4A 3WY4A 3K6OA 1QI4A 1ZT4B 2CLVA 3CFEB 3N40P 1UVQB 2ITCB 5FOJA 4LT7A 4ANWA 1U0QA 2HX9A 3HN3A 5KYUB 3T2NL 2BIMA 3I75A 3L9RA 3RTQD 4AEEA 4BFIA 4AVIA 3FTYA 3KL0A 3BZFB 4H2AA 4J2XA 3RWHA 3K91A 1M4KA 4OJEH 4I88A 1I7UB 3ZDXE 3DOHA 2P44B 1ASOA 3I6LD 1HKLH 3ARGB 3D2UB 3MUUA 3LXUX 4QO1B 1D5MA 2VSMB 4B9GA 3IDNA 1N0XL 1BOGA 1E4KC 3BLPX 4XXCA 2J55A 4EQ3A 4BFOA 1EDYA 2WGXA 1Q8MA 2BSED 3JTBA 1F18A 2YOCA 4F80A 2EVIA 1U8LA 2X1OA 5FHBH 1T0MB 1EGJH 1UT2A 2J1WA 5EC2B 4A7GF 1D5BB 3ZTEA 2PN5A 1L9MA 1BVNT 2W07B 3L5IA 4O02L 4D0BA 1NIBA 3WGUB 4TVPL 1CZ8L 1P5VB 3B2VL 4S1DC 4LHUG 1JWUA 1UD8A 3CDFA 3B5TA 4N86A 1JHTA 1RZ8B 1E67A 5C9KA 1G6RL 4P46D 4JY4A 4OD3L 4XNUL 4FG2A 4OZFH 4X6DF 3RTQB 2WLYA 4GKZA 2H8PA 4M7JH 5D1ZA 3EBIA 4U05A 3AS2A 3T0EA 4KJPC 3QJQB 2V33A 4PRPE 1JRHI 3G6JB 3TT1L 4KXDA 3V4PB 2IEPA 4JFHE 5AZ2L 5KZCD 1G0XA 4IKJA 1VB9A 1OY3B 3NGBB 4WUUE 4KXZH 3UABA 3VG0H 1SJEB 3ULUE 4NP4H 2Z8RA 1FZOA 3VXSD 3IPEA 3D09A 1VKXB 5JPMA 1SUJA 4I77L 3FFOA 5F3BA 2PWDA 3JV4B 4A66A 4HWBA 3H54A 2IPUG 3CH8A 1YN7A 1XCQA 2VMJA 3IDUA 5I0VA 4BRJA 4TRPH 2APXA 2J6EA 3OKKB 3CZGA 5I73B 4Z78A 2EDWA 4GG6F 5E5RB 5E8OB 4W4OC 5BV7B 1A5FH 2AJYL 2BNUB 1MPAH 1UKQA 3GSQA 1DO6A 5E70A 1GS8A 2EDMA 3DRTB 1PEWA 2VKXA 4AMKL 2H5UA 5J4MA 2EDHA 1K9TA 4AXWA 5DHVH 4Y5YB 2OK0H 1XH3A 3H0TB 5KSAC 12E8L 2XV0A 1VAHA 1A8JH 1NLDL 2MTPA 2PNDA 3BJ91 3IETA 3S8WA 4O5LL 3GDCA 1YVLA 5GS2H 4XBPB 2IADA 5IVZB 3ASOB 3SBPA 1XD0A 2H3NA 4XNYL 4HIQA 2O26U 3G6JE 3NFPB 3QIBA 3QZPA 2Y1AA 4XMUA 2YRZA 2EQDA 3KXFB 1SN0A 4PG9B 1BSIA 2PPFA 1Y1DA 5FF6B 5TPWL 4YLQT 1L9QA 4Y1AA 1DANT 5ESAA 1TT6A 3NJGA 3KLAB 4FQ1H 1H3GA 2BWDA 4MNQA 2O6PA 5CJOH 2EYTB 3B6SA 5F3HB 3UTPD 4RGNC 2K9FB 4KKPA 1PDKB 3ZYOA 2R69L 4GW4A 3BIKA 1SXZA 3H2QA 4M7KH 4ZAKD 5F0JB 3SDDB 4Q9CA 1PJWA 4LESA 2HWZL 4XO8A 5C0AE 1ORSB 4ENZA 4OLZL 1F4YH 2JELH 1HYSD 1TVHB 5EU6D 3ARED 5CEZE 2WUCH 4R96B 1TJXA 3KDPB 4UI2A 2CR0A 3AXLB 4D0DB 5D9SA 1T89C 4LEOA 1RUKL 1JPFA 2EDOA 4RGNE 4HOWA 2VDNL 3IMRA 3HC3H 5TGBA 3T1WA 4ZS6C 1V10A 4KTEH 3BH9A 2VTFA 3NA9L 4L5FH 3FRPG 3ALPA 3KLHD 5AVVB 1I85A 2YXMA 5DGQA 2NYYD 4FNQA 5AW8B 3TA3A 5LBGA 2A73A 3TONA 4QKXB 4XNQA 4DP5X 3CLEL 3DOSA 2TRHA 3H4FA 4OD1L 3N1QC 4GG6A 4DETA 2IXQA 4PCYA 3TVMC 3EF7A 3FO2A 4LLDA 3EYSL 3LY6A 3QBTB 3LEXB 3CXHJ 4PRHD 5AUMB 4EMZA 2N59A 4G72B 1QATA 2WXPA 4HSCX 4F7EB 4O51A 4XR8C 5IV2B 2K3HA 1YEFL 3SKNB 4XP9L 4NIYE 4KVPA 1WTLA 1BFVH 2WYIA 1SNRA 3VMOA 4ODVH 3W56A 4ZMVA 1G7PA 3MLXH 4HF5L 5L0QC 1N6UA 4NJ9H 5J11B 4MA7L 4CC4A 3O6MH 2V9UA 1IAIL 2JJUA 3BH8A 3LD8B 4POUB 2PCPA 1KYUA 4I1NB 3Q01A 5KG9A 4XPAH 1RZKH 4M02A 2VL5A 3NFSL 5IV2A 4HIIA 3FCUB 2FR4B 4PWGA 4KJPD 1XBRA 3T6ZA 5F21B 2WWKO 1PAZA 4RAUB 2EIEA 5EN3A 3ARSA 3QPQD 4IEFB 4LHJB 1LP9B 2F8IA 2J1YA 4G2AA 5KUMA 3RZCB 4PJ9B 4PGCB 3BRFA 1JZ3A 1NLBH 4JG5A 4I3GA 2OMZB 4X8JB 3WXVL 4B96A 1SVZA 4CU6A 1DFBL 3OPUA 2WIIA 2B1HH 3MNMA 4NAQA 4PRPD 4YHYC 2Y23A 4MASA 1LXMA 5KSVA 1QSFE 2VO5A 5DD1L 4PJ5E 3PAZA 2R1WA 1NH6A 3JUYA 2CRIA 1SJMA 3LKSA 5TE7H 4DW2H 3GMLB 3QEQB 5GQBA 2CLZB 1H5BA 1DSFH 4OH2A 3PDOB 4GIPD 2UZXB 4JZOB 2B7DT 1MI5D 4I18A 4IRSA 5CP3A 4NNPH 4A39A 1QEWB 1WA1X 3RZCC 4F9PA 1A2YB 5JW4R 2B15A 3BWUC 4XAKD 1FE8H 6PCYA 2F53A 3DV6B 4G9FB 1LEGA 1TU2A 2VITB 4TNFA 4W9JC 4HKZB 4AQAA 3ESOA 3NP3A 4BFGA 3DXAB 4W9LC 5GGTL 4KROC 5I76A 3LKNA 4M6MH 4UT9H 4FQXB 3JV6B 1BPLB 5C0IA 2PW2B 2CHZA 4U1NA 2G4EA 4U1KB 4XPFH 3CIQA 1G9MC 2IPKB 3NIFB 3MLRL 5E94B 3UTQA 1CGXA 2EINB 4CMMA 4DK3A 4RFNB 4I3RL 4OSUL 4LP4A 4L37A 2B59A 4OD2B 5FKPB 3UTTB 4ZFFA 1U8JA 5D4JA 3SYAA 1R6VA 3TJPA 3N2JA 4HX1A 3SDXE 1OCWL 4F7TB 3LNEA 4L4TE 4HUKB 4NYLA 3C6SA 4OCSL 4KPHL 4KO7A 4U4IA 5KSBF 2C1OB 4E41A 2E86A 3SBWC 5J12B 1KPVA 3G5VA 1OD9A 5JW3L 4J2QA 1NAKH 3D25B 5CU5A 4MKMA 5HVHC 1TJGL 3QXVA 1U8KB 4YEFA 1EEZB 4ALAH 4DZBB 4JZJA 4NUPA 1Z9LA 4UZSA 5CEYB 1ZLUK 4PJEF 1XCTB 2WWKT 3W38A 3S37L 3BVTA 4KRLB 1XR8B 2BJML 4NOBA 3FCSB 4R5TA 4ECNA 3D33A 1SUHA 3C60D 1T66D 2EC9T 4YXLH 2YLKA 5IHBA 4JQVA 3D08A 2JQMA 1A6TB 1JXDA 1MFEH 3WKNA 2O61B 2XNAA 1TTCA 4QNPE 3QIWA 2YD0A 2R0ZL 3BQUC 3NN8A 4AEIH 2FBOJ 4LSPH 4AOFA 1KC5H 4MXQD 2PCFA 1O7SA 1OCOB 4Y4HA 4AM0Q 1A4KA 1ITCA 1AKJD 1GOHA 5FO8B 3TS8A 3CSTA 4AC4A 4PQXA 2WJ7A 32C2B 2B2XH 4IBZA 3U2JA 4BQCA 5I75C 3KLSA 5E9DA 3SDCA 1FFQA 1UQSB 2B9AA 5JHBA 3B2DC 4JO1H 1KB5A 1SYVB 1KOAA 1EBPA 2JB5H 4QHLA 3RWCA 5BV7L 3JTTA 5SWQA 5E5MB 5HJDA 4GO9A 3VFOA 3JTSA 1D6VL 1WFIA 3HJ0A 4QY8B 1T0NB 3QO0A 2Z7YA 2DQ6A 4F9PC 4DF9A 4HEME 3VSUA 4MVBD 5GS3A 4B0MB 2P9RA 4J12A 4G5AA 4IOSD 3FDWA 5JPNB 2EDXA 3LQMA 4AKQA 4YXLL 5G5DB 5EORL 4YMPA 3FTUA 1NZRA 4FNTA 4W9CC 5F6HJ 5E8NB 3TO4A 1H9VA 1G7MB 2OI9C 2A4CA 4KK5D 3GMPA 3QS3A 1JZ6A 3ZHKA 3J27A 4DO4A 1UFGA 3DDGA 1RUQL 2K6YA 3FQUB 1RZJH 2ICEA 3HAEB 3ZOAA 1NFDE 1LEKA 1BGXH 1FYTB 1S9WA 4F2MB 2BIQA 4L0YA 1N8OE 2A9MH 4F33B 2YQ2A 2IOOA 3BVWA 2WQWA 4YSDA 3IFOB 4OCSH 1M6OA 2C9VA 2H32H 1J0KA 1L7IL 3IDIB 1CQYA 1SHSA 4XHJD 2GJZA 4PPTA 3V9FA 5C6TH 1H5BC 5DF0A 1XF5B 3VFUA 2D3JA 2KI6A 2APSA 5T5FA 1CFVH 3ARUA 3HUJE 3NCWA 3FB8A 3NSJA 1BA9A 4AVHA 1J1XL 3O3EB 2FEEI 2NR6D 5CEXB 2P5ED 1A02N 3ERXA 1ZHNB 2HX7A 3BVDB 1T2QH 3OWRA 2IAND 4YHKL 3ABLB 4WFED 5JXAH 1QWHA 2XFXB 5GGRA 4U3CA 4X98B 4Y7MA 1R5IB 2AJXL 3MCYA 5AQ0A 4QO1A 1WZ1L 4MJIA 1JYWA 5KWYC 3E6FA 4KY2A 2FL5A 5D7IA 3MQIA 4CSPA 2FIRT 3IS1X 2EH7H 4NZTL 4ZMAT 3GBNH 3NN8B 5FYKU 3KPSE 2ETWA 4JB9H 5F9JA 3QCUH 5ACLA 5D71L 3TT3H 4Y4HB 3CFTA 4XVSH 3F58H 3TA3C 2IH9A 5GXBB 4U1LA 4PY8I 5F89A 3UJJH 4GRMA 3IDJA 1RPKA 5EZLB 4S2SA 3V4VA 3OMIB 4PJ8C 2WC7A 1A14H 5FK9A 4EN3A 1HHKA 3DURA 3PL6C 2QKIA 3O2WL 5CMAA 1UG9A 1KNOB 3WL9A 5CSGA 3MGTA 4HUUB 3CVDA 3FB7B 2AV7A 2WAQA 1CYWA 1YNKL 3CZSA 3KJ6L 4WEUD 3FOMB 4XP5L 4F3FB 2YC1A 1CF8L 2VZVA 2ZG1A 5D93B 3BDXA 4TSAH 3GM0A 1HL5A 5MENB 1OPGL 3V8CA 3QUZB 4O9HL 4YC2B 3GIVA 5A16A 2NDGA 4OZGB 5M95B 3QPXL 5KTEL 4GRWF 2ADGB 2ZUUA 5EZOL 3CLWA 5HI3C 2QVMA 2XZQL 1AAJA 2NSXA 3APMA 1IVLA 3UZEC 5BVPH 1TQTA 2Z8SA 1OM9A 4OLVL 1EHNA 6FABL 4H2CA 1SQMA 2H3KA 5D1XC 1B4RA 1RK1A 5D6DA 1X5LA 5AVTB 1E9OA 3GNML 3DMMA 2MH4A 2BM3A 4FFWC 4JDTH 3VD9A 1BZ7B 3B9KA 3QDME 3QI9B 2IGLA 3BCDA 1IAOB 1TEYA 2DWSA 2XTLA 3ABGA 4WK0B 5CGYC 5EIIA 2O1AA 4GRLC 3ES6A 2VIRB 2GSIB 1R3JB 3GSOB 1NBVL 4QRTA 2YD9A 4GP5B 3ARYA 3SKUD 3KPNB 1IC4L 4ZFOB 1RFDL 5EDXA 3T4YA 4KV5F 5T3XE 8CGTA 1HINL 1QFWI 1T03H 1V7MH 2NX5E 4FI7A 5D6CB 3AB0B 1QVOA 3FRUA 1DANU 3VFVA 4Y19D 4YAQB 2R27A 1A6PA 4H20H 5TK4A 3VFGH 4AYSA 5KVEE 1IGJA 4TXVB 4W9GC 1JYNA 1S4IA 2VDNH 2QVTA 3CH1B 5HJGA 4NQEA 3QIBC 1LTXA 4UQ3A 5C08E 3W9DA 4MD5B 3WCYA 3UO1L 1CXHA 4XPHL 2IH3B 2Y1ZA 5I30H 4HIEA 1IM3A 1MIEH 1TITA 1RPQA 3O3DB 4XMVA 5DEFA 5EPMB 5KSAA 1DLFH 2A83B 1AXSB 2N56A 3T77A 2QV4A 1MELA 4K7PH 4MXWL 5BW7A 5JXEC 3JWNH 4GRMB 3HI6L 3NZHH 1SN2A 1ZHKB 3BLKA 3MV9A 1IQDB 1EFQA 1NPJA 4JBSA 1EVTC 3JV6A 4KI1A 4DOHE 3HLAA 3IFPA 3MYZA 5E6IC 5I1JL 5DS8B 2FX8L 4UQEA 3MLTA 5HYIA 1KB9K 5DYOA 4M7LT 3DJ9A 4P5TB 4LL1A 2NR6A 2DTML 5DQDH 1P6FA 2NSMA 5FO2A 1FWXA 1SRDA 4GH7B 1B90A 3CPLB 4JLRB 3A22A 4NC1C 5TPWH 4GXUN 4XXDB 1GRWA 1QRKA 1NSNL 3D39D 3QQ4B 1A6VL 3VYOA 2EXYD 5SX5H 4WV1B 4OCMC 2HUEA 1G94A 5E00B 4K2UL 2Y24A 5IEHA 4TTGA 3L4YA 1AC6A 2X2UA 4PRAA 3ZR6A 2HVKA 5FKAB 3LPWA 2JKIS 1NMBL 4UOJA 2Q7YB 3GHEL 1MOEA 1ACYH 4Y4HC 3SBQA 3MLZH 2DI7A 2V5TA 5GRXG 3RILA 1WE5A 1I3GH 3KPSD 4UM8B 5K59E 1ZS2A 3CVIL 4FQXC 3O9WD 4PRID 4KTDH 3MR9A 3QWRD 4NHUA 2Z7UA 1T1YB 3NZ8B 4N8VB 4GSXA 5E9NA 4MJ5B 5E2UH 1NPUA 2VDQL 1GPOL 5KW9L 4Y89A 2BHFA 4J39A 1T1ZA 1OHZA 2C9UA 3QG7H 3BQUD 1T7WA 1IL1B 4GXVL 4KNSA 4P5KB 3MKKA 2DL9A 3MRJA 4IKKA 1OGSA 4NI6A 4TLKA 2DQCL 3B9AA 1W0WB 4PD4J 1ZT4A 2W0KA 4M6AA 4TLSA 1HCFX 2GBUA 5MHSD 1IGTB 2OMVA 2ALAA 1H9DA 3MBWB 3C6LC 2VZ3A 4XXCC 2OYKA 2XPYA 4P2CG 3D3VD 1T80A 2LQRA 4PJCA 4GW4B 3ZZLA 3BKYL 4G3YH 4X6CA 2NLJB 4QRPB 4KHTL 1I9RL 1N18A 4HQQH 1M42A 3KD4A 4NXKA 2GAZB 2QQNL 1JPGA 1G7PB 3OGOE 4NZ8A 2AJSH 2I60H 1FP5A 3VI3A 5ICXB 2J21A 1W72L 1IFGA 3I6KB 5AAWA 5K1JA 5H37A 4HLEA 2DBLL 1FYTE 5I19H 1TMQA 1YY8A 1E5AA 2WW8A 3LKOB 4NO0A 2N7AA 2YIHA 2RMNA 4LCYB 1XF2A 3VWJC 3FUMA 5KYWB 4NQXA 3R0MA 1N6QL 3O3AB 2RQEA 1HNFA 1K3ZA 4J3BA 4WFGE 5HYJD 3SCMC 3WUWA 3ZSSA 2FQFA 3M8OL 1W9XA 2DM7A 2G5RA 2FB4L 2FX9L 2CZNA 3BUIA 3D1MC 2X0VA 4WFHD 1EV2E 3KYKH 5JA9A 2ADGA 2O5NA 4BGLA 1XIWC 2FQGA 4J3VA 2CO2A 5HI4C 3T65B 1U3JA 3E9UA 4OBRA 1JGEA 3LTVA 2CLRA 1JMXA 1J0HA 4GS7B 4RAHA 4UT6L 4ZFGH 4I0PB 1T7VA 2BVOB 5GRJL 3T2NH 1WLHA 2HRHA 3MRNA 1V3KA 4NCC2 3ZKND 5FHAL 3LNDA 3MTRA 1MF2H 5CMAB 3MLPA 2WINA 4PRPB 3MGTB 3OMNB 1MHCB 1CYXA 2J20A 4A68A 1UJ3A 2R4SL 3QHZH 1NUGA 2DEXX 1SXSA 3IJHA 4HX1B 4RVBA 4JFWA 3U83A 4UB0L 5LGJA 1QUNA 2DQHH 4JUTA 1NIDA 3BEVA 2YRPA 3H1ZA 3RX9A 4XGZB 4KJYA 1E8XA 5EWIH 1CUOA 3KPQA 1H15B 5C08D 4NFDA 3UYPA 3T4AC 2DQGH 3ETSA 5SWSE 5EWIL 1NCJA 4ONOA 3WTYA 3ZKMC 2J88L 4AJWA 5T1KA 3ULUF 4FZEL 4Y19E 1OAKL 1R19A 2GPZA 2XN9D 2BX5A 4RQQA 1HHHB 4LLWA 2XVLA 2ZWLT 1FCCA 3PYCA 1FFNA 4FAAB 4G1MA 5FYKE 3T8XA 3EYVA 1L7TL 4DEPB 4BRVA 1ODAA 3EBGA 3SZ6A 2IDQA 5KG9B 3PL6A 4XOCA 2X42A 4NJAH 1U8LB 1W16A 3RJOA 3OVUB 3QZLA 3F64A 3MRFB 3BYYA 2DQJH 3LV3B 4HKXB 1IUZA 3WFBH 3TVMA 1KLGA 1QTPA 5E9DE 4P5SA 2CPCA 1HHIB 2NZ1A 1X5KA 1OGTB 2WQRA 4R97B 4PRIA 5BZWB 2KKQA 4I4WB 5F70A 2CKBA 1MSPA 1T0PB 4HH9A 4IRZA 5E23A 2Q8AL 4JR9L 4BQBA 3PV7A 4WK2B 4UNVA 3DBXB 5GGUA 1XQ4A 2FB4H 5IVXB 4OFKA 1K2DA 3DX6A 1I8MB 3SE9H 1ZHLA 4DNLA 2JFCA 3PP4H 1INQA 3ARDD 4TULH 2CH8A 1RSFA 1NCIA 5IW6A 3RGVC 2F9BT 4XAKE 1RUAL 4MNQE 1IMHC 1AIZA 3QDJE 3HCVA 4KKQA 2J73A 4BZ1A 2F54B 3B3BA 1A3RL 3CLFL 3N41F 5A43C 3KPRD 4PRIE 4K8RH 4OZGF 1R3IL 2XWEA 4AQ1C 5AB2A 2ARWA 2ZT9C 4XXWA 4EDWH 1UH4A 2HSIA 4MYWB 1GVIA 1N0LB 5DJ0A 3DX9A 3KPLB 1OF2A 3W82A 4I0PA 5K9OB 3SODB 4FQQA 1S7QB 2G9HB 2Q3AA 2Y9RT 2ZUTA 1VJSA 3FU5A 4F2ME 1I9RH 4ZPVB 4QCIA 4NN6C 2E46A 3HPLB 3RVVD 2G60L 1T1XA 2GG1A 2N0MA 3KPRE 3S2CA 1AZZC 4HK0B 1YJDH 1ZWIB 5ERWB 1CK0L 3U30C 1GZPA 3T1FA 3P4OB 4XMXA 5DR5L 4QY8A 1GY2A 5KOMC 2OJ1A 4OLWH 1JTTA 3EJRA 4RRPA 4NZJA 3RFRA 2J4WL 3VWJA 4P2AA 1ZK5A 1H6TA 3MV7D 4R26H 3IAGC 1OTSD 2R9HC 3N55A 5E99H 1P84K 1SJXA 2J2ZB 5ITBH 3UYRL 1SDYA 4XBPA 3US9A 1S3KL 3AM8C 3K6FA 5FO7A 3FQNB 3ZHDA 3MUGA 3ZHLA 1GPOH 4BM7A 2CGZA 4K3JH 1OHQA 1NCWL 1HOEA 5EOTA 1QRND 3BJLA 2KDGA 3HB3D 4JG0L 4K5OA 3U6RB 4Q6IB 5F2FA 2IANE 3IJ8A 3MBEB 3DARA 2PP7A 3FRPB 4GLRH 4LSVH 1G9ML 4DAGH 1CF1A 3Q8AA 3IDGA 3KYMA 4JFFE 1BW8A 3Q2VA 3MLVL 3GXIA 1S78C 1O5DT 1SDAB 1EEZA 4WI0A 4Y1TA 4HOMA 1FCGA 4JK0D 3WKMH 3MV9D 4FF9A 5KVFL 3VFRB 5JDSA 3ZTJG 4O00A 1AG6A 4LLUB 2VLKE 4XOEA 3V8OA 1YMHB 2FJFA 3C5XA 3FUEA 3WLWC 3CUPA 2UZIL 1KIUB 4HMDA 2JI2A 1OTUC 3PHOB 1F6AB 1GTNA 2JK5B 3NJMA 1F4WH 2DLIA 1E42A 1I1AD 3D39A 1UM6H 1I1YA 2A9DA 3WJLC 3ULSB 1HEZB 3RKPA 5D8JL 2X9WA 1NEZA 3MRKB 4F7CB 2MKLC 1KCWA 2A77L 3EJQA 3L95B 1HEHC 3SDXF 2DN7A 2X4SB 2ZD0A 3C2AL 3QO1B 4ZO6A 2OJZL 2W9DL 2BSTB 1UA7A 4F57H 1HH9A 5G4OA 2OZ4H 4IQHA 1EAOA 4ADJA 4RMWA 2FJGB 5D5MA 2H8PB 3APNA 3EDFA 4L0ZA 4U4BA 3UTZB 3LAFA 2WQ8A 4NAJA 4TSCL 2ARJQ 4PIBA 3C6EA 4NC2B 2W1NA 1HE8A 4PJGB 2OBGA 2D7PA 4ZW6A 3QG6A 1SOKA 1S7QA 2G9HA 4MMZB 1G9NL 4E42B 1KPRB 5D1QE 1NGPH 4HG4J 5EU6E 2J6EH 4YIQA 4YXKL 2MCG1 4HZLB 5DEJA 3HUJF 1WZAA 4HIXH 2FEEL 3NIGB 3QJUB 4OUOA 1QFUH 4QNPF 1XGQA 2Q0ZX 3ESUF 2Z8WC 1RFDH 2IJ0C 3BSHA 4Z78B 5HHQA 2DJUA 2X05A 2AJUH 3L3IA 5EZJB 1FYTA 1S9WB 4OZFG 3QGVA 1YNLH 1JXKA 1M53A 2OXGB 5D2NE 1P6AB 1NINA 3GRWA 4B9CA 4D9QE 3VW3L 4WSKA 3VG9B 4ZZFA 5ACZA 3S3JA 1FO0L 3L4ZA 5T3ZL 1GGIL 5IHZA 5I15L 2J57A 3BT2H 4OZIE 1V3MA 1KY6A 3PHQA 1NGXA 4G7VH 1G7HA 3EJPA 2R0LH 3BQVA 4XCEB 2NY7L 3N91A 4G6MH 2YN5A 1HOCB 3MZTA 4FNSA 3K72A 4QOKA 2F54E 4XCCL 4D7BA 3WTWA 4NFBA 3SN6N 3X2QB 5I0ZA 4Z8FL 5DQJB 4F58H 1CVSC 4I9XA 1AHWB 3MRCB 5EG6C 3BT0A 3B2XA 4FTVD 3HPJA 5DVPA 4L8CB 5J6HA 3T4YB 2DQUH 1LP9E 3B3IA 1PLGH 3IU3B 4L3EE 4XVUC 3TPKA 2NY3D 3TCLA 2XG5B 3KHOA 3HNTH 3QZNA 5CILL 5DS8A 4YSEA 2IALA 5KVDL 5T1DL 1DDTA 1SN5A 1U91B 3NDZE 2OCCB 3ZE0F 1CD1B 2BVQB 5JA8B 2MKWA 2B08A 1KTKE 2V9QA 3QZOA 3MRKA 2MTAA 1IBZA 2GK2A 4F7CA 4XBGA 1K8IB 1YEHL 4KX8A 4RZCA 2BFGA 1CDHA 2NTFB 2W0FA 3BH4A 3L95A 4MS8D 4C83B 4K8RC 3Q6GL 4WUUD 4JY5H 5DMGC 1NCAH 4CVZA 1CFBA 2KLTA 3LSOB 4LLMA 4HCIA 2Q6WB 1VFAB 4WAFA 1BZ9A 4BZ2L 3S37X 1MCPL 2ICWB 2GUYA 2XDHA 3QH3A 1HWHB 3VI3E 4GRLD 5EDSA 3D06A 5ILTH 3HBQA 3TIDA 3EG9A 3EFDL 3MRNB 4Q0XL 1F13A 3AROA 4FYSA 1CURA 5ILTL 2J6WA 2O6CA 3CK0H 3VO0A 5D6DC 3D0VB 4URKA 3LKQA 2ZE0A 2M26A 4NM4H 4MB4A 1MFMA 1UM4L 4H8WL 2Y7QA 3LXAA 1DQML 3H7BA 4NGHL 2IH1B 1G0DA 3TIDB 4LOUD 4IBWA 1IKFL 1UYWH 3WIHA 2GQHA 3FCGA 4G82A 2FGZA 5L4MA 2ID5A 5C6TL 3IRZA 5C0ND 2VC2B 3AT8A 3EGSB 1BZOA 1Z9MA 2QGDA 3FOLA 3ZGIA 2VMFA 4AGPA 1KCSL 1RIUL 3HNTL 4NLHA 3CBRA 3TPUA 1E30A 4TQPA 1DVQA 4N68A 4B9YA 3NJXA 4F1ZA 1TPXB 2QKIC 1CFNA 2X44D 4X98A 4DIXA 5HDLA 4BUGA 4ODTH 2OMTB 3MC0A 3TOPA 3SO3C 5C0JB 3THMH 1PNDA 2AERT 2X2IA 1QTYT 2N7BA 3WBDA 4A7UA 2R56L 1PL3A 3FU7B 3K80A 3K6DA 4PJ5B 4ZOAA 5L2JB 1AHWA 5IG7A 2EICA 3WHE0 2X28A 4JDVA 1QPKA 4G7VL 4YLCA 5J6HB 1SGKA 4NQCE 4X4YA 1NFIA 1QSZA 2F1EA 5DHYB 3VGAB 2NY0B 3ZW3A 4NQDA 3T6QC 4QRFA 4NQCD 3MBWA 3M88A 1OF2B 1UEYA 5INCB 2GCYA 2SEBB 2IAMC 3RI5F 1CGVA 3K81A 4HC1A 2EVFA 1HI6A 1JF1A 3VW3H 1SYSB 1VGEL 2XETA 4PJIE 2ZP8A 2LW3A 1S8DA 3FMGL 4IU3B 3VFMA 4JO1L 1GGBL 2DWDB 4CU8A 3CSYB 3RNQB 2FEJA 2WWMD 4APQC 1P5UB 5LAXA 1S7TA 1S7UA 2BSSA 1QG3A 1TENA 3EAKA 3T09A 5BCAA 5F9JB 2D0FA 1JV2A 4GQPH 3L4VA 4PV9A 2NW3A 2J6EL 2L7EA 2WZ0A 4G8GB 3X3GL 3EUUA 2CHWA 5GS0H 2A1WL 3G6JA 4WHTB 4Z9KB 3QXDB 1HZLA 1P4BH 3TNNB 3QDJA 2OI9B 5I74B 1FNSL 5DMJB 5ITFA 2CKNA 2Z1KA 1M7IB 4WUUB 4DK6A 2IOMA 3L3KA 1EJOH 1E9PA 1LK3H 2OP4H 3SKJH 2QVFB 4NT6B 4ZXBA 1MAML 3MLYH 3RPKA 5IWLC 2HKAA 1T04A 2GSIA 4FP8L 4QXGH 2WB7A 4Z7WE 3II3A 4LPYA 4XMKL 2VMEA 4KXBA 2NPLX 4MMXC 2DQTH 3QYMA 5DS2A 2R1YA 2XICA 3BPNB 5K93A 3H6AA 2P5WB 2XKSA 2FWUA 2IBBA 3SY6A 3IDIA 4BELD 4B5ZA 1FSKC 1YZZA 4JQVC 4JAMB 2P26A 1NCTA 2XZCL 1R0AH 2KHAA 4I2XA 4M3KB 1OE2A 2FLRT 3ZR5A 1C16A 3H6JA 4WTWA 1KV7A 4OCWH 1UD4A 4MZ3A 4W9FC 1JZGA 5LNGA 3DYOA 2ERJC 5D7SH 4MD5A 3ZT6A 4DPCX 2W60A 2OP4L 1AS8A 4GMTL 4OCYH 5DD5H 2BY2A 3UFIA 2JNZA 2W91A 1R3HB 4LFHD 4WO4B 3L1OL 3SBWA 3HFFA 4RFOH 5D1QA 1S2EA 2W94A 1FL5B 3FB7A 2ZCZA 1MRDH 1YA5A 2O5ZH 3QIWC 2BSBA 2E7BA 5FM4A 3FUDA 4K71B 4GUCA 3VU1A 3UTSE 3KXFE 1DSFL 3HUJB 1SYVA 4QHLB 3PABB 1INEL 4BH7B 4IHOA 3LSOA 5SWQB 5IFHH 1EMTL 4X9GA 4DGIH 4F37K 4U1LB 5F89B 1AQDB 1MFAL 5IQ7H 2WQAA 4ETYA 1E28B 1TIUA 5DK0A 1KV3A 1R3KA 3WSQH 1FGVL 3MVSA 2CUMA 3R19A 4MYPA 5GS1C 1E6JH 3MTXA 5HPMA 3IM1A 4WW2A 1HS6A 2Z31B 5FO9A 3KPRA 1VGEH 2VE6A 1OARH 1K4DB 2J5LC 3P9WB 5EO9A 4GSQA 5F9OL 1GZHC 2OMXB 1FL6B 4OGYH 3SDYH 3TEYA 2VDMH 4YPJA 1D5IH 3MNZB 1U8OB 3LPGA 2NNAB 3CXFA 1RIHH 4IDLA 2QPDB 1FZKA 1IO4C 4KOBA 3H9ZA 3N9GH 1BVNP 3QFDB 1CTOA 3VDCA 3G08B 4OUUB 1CWVA 2ICWJ 4RDBA 4OKVB 4MQXC 2LAAA 1DE4B 1RJCA 2VXVL 3ZIYA 5JNYB 4JGNA 2QGEA 2VGLM 4OVUA 5GJTH 5IHLB 4JVPA 1AO7E 1BQUA 3JWOL 3UTOA 3D51A 2PWHA 3HAEG 3EOAB 4L2YA 1MW0A 2PWFA 1RZPA 5J1AB 2CJUL 4UQBA 4U2ZA 3RG1C 2QZQA 5JQIB 1CLVA 1T5WA 4GT7A 4BDVA 4RMQA 4KZDL 3FTVA 4PGEB 3H2WA 3PP4L 3VRIB 2FK9A 4X6EB 5ICYA 2W9EL 3BP4A 2E56A 4F37F 4N2IA 5F3BB 5FPIA 2A6KA 3N1GC 2BSEA 1MHHA 3CNKA 1AOHA 3ISWA 3UMNA 4PWJA 5SX4H 3QS2A 1NGYA 3BW9B 3ARGC 5CXPA 5GGUB 3T2PA 1ORQB 3MRGA 1DQKA 1YEJL 3DX6B 1YEDB 2GSGB 4AIOA 4JM4L 3IFNL 4XXWC 2OL3H 2DQJL 4HGWB 4HU8A 2V5RA 4C83A 2CBPA 3E6FB 4ODBD 4N5EC 3Q06A 1CICB 1MZYA 3M7OA 4XN5A 4KTEL 3QRGL 5I1CH 2YUZA 1D5ZA 4NCC1 2WIMA 3H42L 1NFAA 1QNIA 2V2XB 2QHRH 4Y8AA 2L4OA 5B7FA 1G4RA 2VN4A 3MPCA 2X4NA 1HL9A 3CIAA 3T3ME 2CE6A 2WANA 4FN0A 3B3IB 3VFOB 4B9PA 3RX8A 5DHVA 5ANHA 1VESA 2CUIA 2VDOB 1AKJA 4HS3A 2IDFA 3EZJB 4NS0A 2F08A 2CM6A 3BPNC 3MODH 1J9TA 4NWUH 5AYQA 2V2XA 5DHDA 2FJGA 2VLRD 3KWWB 2HN7B 5AL0A 2NW3B 1DBKH 1D9KB 3FT3A 1OK0A 1T83A 3ULAB 1YEHH 3VXOA 3VTMA 1LNUB 3KVPA 1FFPB 3HAEA 3ZTNL 2IO5A 4JRLA 1A1NB 2BOCA 1I7TB 2R4SH 3FHQA 3WEAA 4R90L 1GZQB 4KAQL 4IU3A 2YAHA 3QJRB 3I02B 4KKRA 1OT2A 4NKQB 5TJWK 1O75A 1CLZL 3IF1B 2J71A 1XGRB 1YO4A 4TN9A 4ATWA 4KMQA 2Z65C 4L3AA 1N64L 1TZHB 1V05A 1A6WH 4ZMYA 4G9FE 3I9IA 12E8H 2GBTA 2WNWA 5G5DA 1H3TA 3NIDB 1EX0A 2AGJH 1AI1L 5CSBA 5E8NA 1Q0YH 1RXLA 3TO4B 1WSST 4MCYB 3U9UA 5EEUA 4AMKH 4QD2E 3W0WE 3ARGD 4N1CA 4LOFA 1QSFD 3BXNB 1RL1A 4NYLB 1MPAL 3NPSB 2ZX9A 4UNIA 2GSMB 1P2CB 1B2YA 2N1TE 4E42A 1A1MB 4ZFOA 2YXFA 5I1EL 4R2GC 1W2KT 3UDWA 4NQEE 4YHOL 5F7MC 4AIEA 3B6SB 5I19L 1E40A 2DLTA 3FQNA 2Q7NA 3GMNA 4Q6IC 3M45A 1CN4A 3KAAA 2VH5H 2ADJB 1JGLL 3UJIL 5HVHB 3VG0L 3NSCA 1DEEA 2NUTA 2EUXA 4I48B 5IOKA 1DJYA 1OW0A 5JW4N 3ILQD 4UQ9A 3N6YA 4JDZB 2I7SA 4Z0XB 1A6TA 4PJFF 2BERA 2HKHL 2AXFB 2BMKB 2GC4C 3X12A 2P5EE 5F7EL 3QIWB 3RQ3A 3ZIMA 5I1KH 3HC0B 2JQAA 1OAYL