4EIBA

Crystal structure of circular permuted cbm21 (cp90) gives insight into the altered selectivity on carbohydrate binding.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
GKTYYDNNNSANYQVSTHMASIPSSASVQLDSYNYDGSTFSGKIYVKNIAYSKKVTVVYADGSDNWNNNGNIIAASFSGPISGSNYEYWTFSASVKGIKEFYIKYEVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucoamylase
publication title Crystal structure of circular permuted RoCBM21 (CP90): dimerisation and proximity of binding sites
pubmed doi rcsb
source organism Rhizopus oryzae
molecule tags Hydrolase
total genus 19
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2440 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4eibA00
2V8MA 2M83A 2EEFA 2VQ4A 4BFOA 2DJMA 4BFNA 4EIBA 2V8LA
chains in the Genus database with same CATH superfamily
3ILDA 3MYJB 1CVSC 4X6CA 2J20A 3BVNA 2BFGA 3AY4A 3OR6A 2ITEA 2NQ3A 4PJIA 3ZMRA 4FXTA 3VRIB 4TPRH 1MRCH 2B15A 4X2UA 1MLCA 2HAZA 3ARUA 3O11B 3OXSA 4TL4A 2P5EA 5T5NF 3D1MC 3LTVA 1QEWB 1XCTA 1T04A 1VA9A 2A9BA 2P52A 1KWKA 4JZJA 5I74C 3GXUB 4ABQA 5GSVA 2X40A 3WMQA 3WO3B 1WUZA 1YEKH 3QJFB 1HESA 5JIPA 4AC2A 2EDBA 4JGUA 3AWEA 4GAAA 4YDNA 2FQFA 3X11B 4GLRH 3IDYB 5GRWA 3U48A 3SDDA 3WJLA 1ZKAA 2H26A 2WXKA 3VMOA 3ATFA 2HT4C 2X4PA 4DN3L 2XXGA 1IAIH 4WY7L 3BSZL 3IPBA 4L29B 4FI8A 5F9WB 1HXYB 4MS8D 1E9QA 5DJDB 2DQDH 4ZFGH 3TV8A 3RU8L 2OJZH 1MCOL 1MFCH 1MXDA 3HC2A 1T4WA 4LCWD 3VX0A 4JKMA 4HUVA 4YHML 3L7EA 4GAYA 3LPOA 1OAJA 2ZE0A 4FZEH 2CJUL 2VC2B 3EHBB 2WXMA 1HSBA 1KCRL 5AKVA 2GCYA 1JS4A 4GAJH 1JPTH 5L8JB 4P57B 2YD2A 2NY2C 5MEQB 5FFGA 4RZCA 2UZXA 2W94A 1QSEA 2EEBA 4R4NC 5E2UH 4NN7C 4ZUSA 4HF5L 1Y1UA 2H0FA 4XC1H 5EU6B 4HK0B 1ZWIA 1HC1A 1CXFA 2HFEA 3RFZA 2VQ4A 1WC7B 3RVTC 1A65A 1OTUD 1TFPA 4GOSA 1XZ0B 4R0LC 4WKZA 1AXTL 4Y2LA 4CKQA 2A2QT 3WJJA 5A2AA 5F7KC 3NIGE 3REWA 1RMFH 4X7CC 1IGML 1TZ8A 5LHDA 5HD8D 5C07E 1B4LA 1BM7A 3VSTA 4W1TA 5SX4I 4I4WA 4XC3L 4L3FA 3QIUA 4PV8A 1AC0A 2R4SH 3V79C 1TVHA 5AD0A 5J9PB 3CFJA 3GMOA 3RBGA 3U6RB 4M6NL 4I0PD 4OFIA 2XN9A 4LCIL 4GXVL 5IQ7L 3BKMH 4FFTA 4YDIH 5AVVB 2X6BA 4ZXBD 4L9DA 5I1HL 4YL9A 1UZ8B 1C8QA 5AB0A 2WWOA 2YPKA 3IU3B 3F2LA 1A1OA 1LNUB 4I88A 5DD6B 4CRPA 1JZIA 1NBCA 1WBXB 3HNVL 1J9CT 3E7JA 2UZYB 2ED8A 1H9DA 1IEBB 3W37A 2W80C 3UGXA 3HFML 1U4FA 2RH0A 4DZBA 2X41A 1DBKL 4ZD3L 3ROOA 4Q7DA 3RZWA 4WJKB 1E0OB 3VGEA 1YEJL 4JAMA 1NTDA 3VXSB 4LQFH 5GHWL 3FAXA 1CG9B 2Y36L 3KPNA 3QH3B 4IKLA 4O02B 5ESQB 2VDOB 1ADQL 3IJ8A 3LVTA 4NO3A 3OHXC 3EJYD 1PZ2A 3T5WA 3K81A 2ZYSA 2O61A 2EDYA 2WO4A 3ROLB 2Z8VC 1FFNB 4MQ7A 4NO0D 1MHCB 4HC1A 5E6IB 3QIWC 5CF3A 3EGXA 2OW6A 3IDYC 4TVPH 1EGJL 2XZCL 2VLKA 4K23L 2MTPA 2AXFA 4B0MM 1I7RB 5CZRA 5F7WC 1DVXA 1NCDH 4OJEH 4LLWB 1MRFL 3OGOE 1OB1A 1TMCB 2BP8A 4JDEA 1HCVA 5DWUL 4MNQE 4H7VA 1N6UA 5DO8A 5F0PB 1RK0B 1M7IA 2HVJB 5F7BA 2PKDA 3DGGA 4H26A 2FCBA 3SDXF 1XHHA 1UA6H 4YQXL 4KQ4L 2PP9A 4A7GA 2A9AA 3DX9B 4Q6IC 3S3SA 1D7FA 3HN5A 3G9VA 3PHAA 2BW5A 3L2MA 1SBSL 3NCFB 4ONGL 4WW2C 2J1XA 5DJAA 3T6ZA 1RZJC 2UYLB 4OZ4B 5DUPL 4RQQB 1UFGA 1KELL 4JCMA 4CMHB 1G9ML 3RL2B 3L9RA 1N26A 4AKQA 3U6XA 4ZBJA 5JNYA 3VI3A 3MRBB 4ABWA 1RHHB 2N01B 4IBYA 4RBPH 5IIEA 4P2RD 5I15L 3FT4B 4YXLH 3GXFA 3LAFA 2KYIA 3IDIB 3GI8H 4LSVH 1S9WB 1PG7H 4U2YA 2MTAA 3ZKQD 3OKLB 1HH6A 1IM9D 2GK2A 2LLLA 1NCGA 3GS7A 1BWMA 4PRHD 4JKLA 1HWWA 4HEPA 3FT3B 3SJVA 2ARJQ 2BNQE 3BWZA 3BDXA 4LMQI 4GP8B 5IQ9B 3OGCA 1IMHC 5L8LB 5K9JH 1HZHL 4GMSL 3FZUD 4L3EA 3K8LA 3PUUA 2FTAA 4PJHE 5IJVA 1YG9A 2BIMA 5A3IC 1A4JA 1A7RL 3HC0A 4Z7QF 2XKUA 2V17L 4JFQB 2AQRA 1TJGH 2DQEL 2QDVA 2CSPA 4P59L 4AM0A 5JW3L 3QFJA 1JPGA 1EDHA 4MMXA 2WY3B 1A3LL 2R9HC 4MAUH 3O9WD 1T89C 1YEDB 3OF6D 1WF5A 2ZIDA 4YDKH 1E4JA 3MNVA 3R1GL 4EKJA 4ZFFA 5JORA 1U8HA 3LEXB 3HG2A 2VXVL 3OKMB 5E9NA 4UTCA 4PJFB 2W59A 1U95A 5IGXH 1AIZA 5B8CB 3HE6D 1N70A 2DQUH 2K3TA 3KLHC 3VGHA 2DM2A 5E6IC 2BHZA 1U3YA 2VT0A 2HT3C 3K5RA 4XPBH 1S5IH 4KKLD 4GG6E 4XCCL 5F7AA 1WVZA 3IGLA 5F3HB 5F70A 4KH9A 5CCJA 4E68A 3MRHA 1KIPB 3DPDA 4PUBH 2CPCA 4F3FB 2E8YA 4XPAL 5JO5A 3BZEA 2BVTA 2H41A 1BOGA 4EZMA 1NFDB 2AI0H 1MW1A 3QWRA 2MQGA 1GMIA 5ERWA 2DV6A 3TVMC 4G6KL 2WQ8A 3AS2A 3P11L 4Z3HA 1OGAB 4ZZKA 3NSYA 3AVEA 4N2HA 4ZXBB 2EKSB 2FIKB 1CXIA 3TNMB 2CRYA 2R0LL 1NCUA 3RI5K 1GW0A 2R29H 1OSPH 2XUWA 4M4RA 4PFEA 4D0CB 3T3MF 1AGBB 2SEBB 1I3GH 4MTMA 2EIZB 2Q7YA 4KAQH 3AQXA 1IBDA 2VAAB 2CA4A 3BIKB 4KPHH 1REIA 4K7FB 2WQRA 3RNQB 5DYFA 2NXYD 2ZTBA 3VB8A 1SFHA 3WD5H 2A73A 3LIZH 4UBDD 5B1KA 5HBBA 4DP7X 4PG9A 4Z9KB 1IC0A 3ZHFA 2QTVA 1GOGA 1NUDA 1M53A 3ISWA 3SBRA 3ULVF 2E56A 2XWJB 3HC4H 4WSKA 3QDGD 4NO0B 3SKUD 2HFGL 2ORBH 5DHYB 1K8DB 1G1KA 2DBLL 3KXFB 4C83A 3RNKB 5D93C 1SEBA 1XTLA 4LPCA 4OAWB 4PJEB 1A3RL 4Z7OF 2X9ZA 4EUPG 4PSPA 2WSPA 2VZTA 3PXLA 1XV8A 4MS8C 2A83B 5EF1A 2DJ4A 2UVEA 4HJGB 4G42B 4I85A 1MCNA 4NQVB 3V4VL 3ZZQA 3MUGB 2NNRA 3FSAA 2DS4A 3WTSA 4E9LA 3VI4B 1THCA 2AS5M 3TIDB 4ICWA 1UT1A 2NY6D 1BD2D 5FPIA 4BFBD 3FQWB 2DQTL 5E8OA 3AROA 4ONFL 1DEEB 3MCLL 4RA3A 1TZGL 3CVHA 2IPKA 4J4PA 4O51A 4P5MB 3ML9A 1E30A 3L48A 2WINA 4YUEH 3TCLA 3CLFH 3FSVA 4NNXA 2YWYA 1KN4L 4B5ZA 3WNNA 1A7QH 5GGVL 4XMTA 1EJOH 2OL3L 1NAKH 2BRRL 2EIEA 3Q9QA 4TUOA 4AOFA 1C12A 4PWJA 3IXAB 3OLDA 2K1MA 4QR7A 3VCLA 4MZ2A 1J88A 5AAWA 1CVRA 5MERB 2VC2H 2N7BA 2UZIL 4RAUA 2GAZB 1EJ6A 4NN6B 5CU9A 3WCYA 2ZT9C 4HT1L 1EBAA 4A7UA 1E4HA 4XBPB 3CSTA 4OIBA 5T3ZL 1IM9B 2CLZB 4X6CF 1CFSA 1RZJH 1H5BB 4C47A 4QO1B 4PRHB 3L4XA 5GRJL 5K39A 5E5RB 4OLVH 4PJIF 5F21B 1KJ2B 5SWQA 3OKKB 2NY4D 4K5LA 5C7XH 1AQMA 2PUQT 4W9KC 1ED3A 4QTHA 1Q9KA 4EAEA 3O6MH 1C5CH 1CGSH 3C8KB 2Y9RT 1NLBH 4MYWB 1R17A 2DI8A 2EDHA 2Z64C 4IRSA 4QT5B 4UV7L 4YVUA 4EO5A 4NQEE 5FYKH 2HFTA 2VDQB 3CX5K 5E24E 4QHUB 3AM8A 4HKXA 2GUOB 3U1SH 3BUDA 4MA7H 3H42H 5E2VL 2VKXA 3LQAC 3HI1B 3LV3B 2LE9A 1JTTA 3O9WB 1DQDH 2OLDA 3SZKC 1EANA 2AV1B 2FHBA 3FQTA 2ADYA 5LG6A 2QPDB 3EO0A 2ATPA 2OJ1A 3JZYA 3OKEB 1GGCL 3ARDD 3VWJA 2WXLA 3BAEH 1BF5A 2YUZA 2BJMH 5FM5O 3T0WA 5T5FL 3CSYA 5ICXA 4U33A 4XNZB 3HE6B 1IKFL 4PV1C 5FECB 1P7KA 1QMUA 1VFAB 3EFDH 1IARB 3C5SB 2ICEC 3FCTA 3G08A 5CBEB 5A7BA 5EZLA 4DFHA 5AW4B 1AR2A 1KFGA 3HAEA 3PF2A 3O6FA 1HHKA 3QQ3B 1AP2B 4GKOA 4U3SA 3O4LE 3HVNA 3S35X 1DQLH 3FO9B 4O02H 2VDOH 3EGSB 1XBDA 3SOBH 4MAZA 2IBBA 3HI6L 2YBRB 1QSFE 5D1ZD 4UZGA 1BYNA 3GWJA 3U1QA 1JFHA 3S8FB 4PGZA 2WNWA 4BZ2H 3BW9B 3GRWH 3NIFB 1S7VA 3VXMB 4XAKD 4PJXE 1KB5L 1BIIB 3H9HB 1UZGA 1EVTC 4W6XB 1KEGH 4LDCA 3D4YA 2HH0H 2AJSL 2YAHA 3PDOA 1BW8A 2Y1VA 1I1AC 4AIZA 2L7UA 1JRHL 1RJZB 4RGNB 2OTUA 1X44A 1K6QH 2VWEE 1HT6A 3DIFB 4ZTPL 3T0EE 4D3CL 1TJIL 3I3EA 1NGYA 5JR1L 1KN2H 2NXYB 2QQQA 2PO6D 2QSTA 4XBGA 4HH9A 1N0LB 4UU9B 3FQXB 4RGMB 1LO2H 4DPAX 1FL6A 1JUFA 4QIRA 3O2DL 3KHOA 3ZDYE 1I7TB 3P4NB 4XCYB 2G5UA 3ZE1F 4TULH 3X1NA 1HHIA 2K6ZA 4Y1AE 5IKCA 4FNQA 1B4JL 3QDGB 4F2MA 1LO4L 1PDKA 4KOBA 4R7DB 3EYUL 4WUKH 3MNZA 1QUNB 2WOYA 3ABKB 3M8OH 1X5ZA 1OKEA 5EU5B 2V8MA 3MUUA 4TVPE 1TDQA 3TTSA 2YXFA 2QDWA 4FG6C 1NKRA 3CXDL 1SY6H 4PWFA 2J6EA 3V4UH 1QR4A 4QRUA 4HULB 4WFFE 1FL3B 2HPOA 5ID0B 5IHHA 4FEMA 1IKOP 4OIIL 3NTCL 1J8HE 5DDHA 3LH2H 5D6DA 1WD8A 4ZMYA 2H8PA 4PH8A 3OQ3B 1S7TA 4ENEC 2ENYA 2NY6B 1BD2B 3DETD 3MBWB 4J3TA 1CXLA 1LEIA 4F2EA 3ATBA 3RWDB 1RULL 1CLZL 3TA4D 4JPWL 4DW2L 3DX4A 2A4CA 2R0KL 2BSBA 4MHHG 4QD2E 3UACA 2C7FA 5JUEL 2AEIT 4JPVL 4QHMB 1JNHA 4NIYE 3VE0B 3JV6A 1U92B 5I6LA 3PNRB 1QFWL 4OJDH 3VD3A 1DBBH 1U8OA 1L6ZA 3TASA 3NPZB 5ANMB 2EH8H 2RD0A 1IAKA 2DIJA 1ZLWK 3AW5A 4AVIA 2XN0A 1BJ1J 3QUZC 5AAMA 4A7GF 5BXFB 2OMZB 5I66A 3SD2A 4JY4A 4R26L 5KVEL 4KKNA 2AJUL 2PCPA 1JXFA 2DWEA 3AUWB 5ALCH 4AQEB 1ZANL 1ZLEA 1KJMA 1L9OA 3MO1A 4OZFB 3RGVC 4NM8L 5F0MB 4Z0XA 4GSUA 2B14A 2BMKB 4LPTA 1A6ZB 1DANU 1RZQA 1SXBA 4LSRL 1RP8A 2NY4B 3FTGB 5GS2D 5JDSB 5E2TL 1Z9LA 1F1AA 3ZO9A 3QWNA 1T0OA 3QCUH 1NEPA 1J1XL 3QE5A 4PJDE 1JMZA 1M42A 3LSOB 2P7TB 4CNIA 5CJQH 3L4UA 5LKNA 4PGBA 3NJGA 1T5WB 4OLWH 1YYMH 2Y6SD 4JJ5A 4RGNC 4F9PC 1AG6A 2APWA 5BO1L 1B0WA 4MJIE 2F54E 5EIIB 1TTGA 2EDDA 2NXYC 3VRJB 4LIQL 1LMIA 4Y19A 3BVWA 4RGMC 2IADB 2I25N 4UZSA 3MODL 4K8RL 4NOBA 2MOGA 1SUHA 3MQIA 1MY7A 2OSWA 1E90A 2DJUA 1COBA 2PXYB 2CDFA 3DVGA 4IMKA 4BFIB 2V2XB 1M3IA 3H2QA 2OMYB 4G6MH 4I7ZC 2EE9A 2YN5A 3K4ZA 3P2DA 5CWSA 4AEEA 4CSZA 5EUKB 3SDCD 1A4BA 2FBJH 2YUVA 1SM3L 4OCWL 1WSST 4I48A 2VYRE 3FB8A 1N6QH 3EH1A 4PJAE 4NZTH 4CMMB 1G6RH 3KVQA 4FXGB 3LQAH 4MNHA 4TVUA 4XXWA 5FDWA 4CU6A 3CUPB 4J6IA 4QHPA 3ZMEA 1FG2B 1WICA 2YSTA 1JPFB 1VGEL 3HNSL 3WSQH 4KZDH 1AGEA 1PU0A 2ENJA 3H2PA 1XEDA 4GBXD 4NRXA 5B1JA 5DJ6B 5FUCE 3UCQA 3V7AE 5JW4N 2GBUA 2F5BH 4OR1A 3MNWB 4KNSA 1MXGA 4WI8A 1EFXD 5D1ZB 4HUWB 4KK6C 2QQNL 4JFPB 2WKOF 2A6KB 2VN3A 3SDYH 2AGJH 3G6AB 2H2SC 4W70A 3HRZA 3CN3A 2BVUA 5GGTH 5HYJD 1MCWM 3K6SB 5IVNA 3CLEH 3GS0A 2FR4A 3GD1C 3AG3B 4OW6A 3SGEH 4FKEA 1E27B 3HPLB 4L4VD 1G9MC 3QQ4B 2O5YL 1R5IB 2A4EA 1BQHA 1YEEH 2CNYA 2ENPA 4ZPVB 5KTEL 3MROB 2R2HB 2PO6B 3GUFA 4I3SH 3WNIA 1KTLB 2I26N 1T0MB 4HV8A 4F92B 4Y5XB 1AZRA 1IGTB 2K3HA 2R27A 1RIVH 1F3JA 4I1NB 4WW2A 4GQ9L 2W0FA 1A1MB 1BFSA 2WCGA 2NXZC 3FTSA 4UOW0 2XWEA 4B7LA 3WXWH 3D9AL 3UCRA 5AOLA 4WHYH 4LARH 5C0BD 3VG9B 1XVSA 5ITBL 1BDYA 2XQYK 4D8OA 2JJTA 4E9WA 2VRQA 4HISA 4WENB 2NY4C 1O7DE 3MRIB 1MCRA 4M7LT 2V9RA 2V7NA 3MLUL 5E0FA 4JN2B 4K4KA 3CFBA 5MP6L 2JKXA 2ZWKA 3SCMD 1IVTA 4NBYB 4UV4L 5BO0D 5I0VA 3GTTA 3FS9A 3CX2A 5C0FA 1T0NA 1QWNA 1JPSL 1P4BL 3PGFL 5DVMA 4J2QA 1IUZA 5HGHB 2A74C 4JY6A 3B2DC 1UA3A 2ZG3A 4M56A 1GZQA 3WDIA 2ZUYA 3OM3B 4JJOA 1QI3A 3DKHA 1L4IA 5FF6A 3FB7B 5JOFB 4BFRA 3RJQB 3IETA 3BKJL 1A6AA 1YC7A 3LHPL 4EIUA 1KJ2H 2N7AA 2W65A 2DJMA 4JHBA 2YWZA 4HHWA 5H2BA 2QMKA 2HSIA 4B9KC 1A9EA 3KPTA 1D5XA 2PXYC 3NT0A 1JERA 5DJYA 1GS7A 4WY7H 3BSZH 1B0RB 3BISA 3VXTB 5BJTA 4P5KA 2OL3B 3IK2A 4MXVE 2ZWZA 1Q38A 3GMRA 4PRPA 1LEGA 4GW5A 1MCOH 5FB8A 1CT8A 2V2TA 1OAYH 4JE0A 1GGIH 4LHQB 4YHMH 1KYOJ 3BGAA 4MBOA 3STZB 1FFOA 1T03L 1GGUA 1NCIA 1NGWB 1T89A 2IIJA 2CJUH 3OLIA 4FXGC 5DCCA 3S5LA 4FC3E 4XOCA 1KCRH 1CXEA 4YHOL 5G4NA 1SEQL 1DLFL 3B9AA 1BVNT 2J72A 1LWHA 1RJLA 5AZUA 3H3KA 3WEMA 1H15A 3HHMA 3MNMA 4OGYL 4KKZA 4JVUA 3BPNB 3ZYIA 4HF5H 4LFHD 3GF8A 2CIKA 8FABB 3BN3B 3QK0A 3AREA 5EU6E 4I8DA 2A3TA 3V5DB 4ZX6A 5CEZL 4PU2A 5H4YA 2FJHB 3GRWA 3QDHA 4ZUVB 3UTPE 1A1NB 5IOPA 1USZA 2MNJB 4UQ2A 4M5ZH 4YDLB 1G0YR 4LPYA 5DTFA 4JW3A 2GITB 3L17A 1ZA6B 4JJHA 4XC3H 3VNZA 5FYKE 1VEOA 5CBAA 3TVMA 2XFXA 4ZMXA 1YMHB 2PO6C 4LCYA 1NCCL 5DC0A 5KOMC 4ES9A 2JFCA 3P4MA 1N10A 1QRKA 3NJXA 1FJ1B 4M6NH 3S37L 4CILA 1MKFA 1ZA3A 5IHZB 2X3BA 4LCIH 5GJSL 4GXVH 5I1EL 5EEUA 5IQ7H 1PYWA 4Y5XC 4XX1G 4BK8A 3G9AB 4CVWA 1P7QD 3ZE2B 4DKAA 2VUOA 5I1HH 4WZ9A 2FE0A 4AV4A 3IDJA 1R3IL 3ARPA 3SDCB 4HP5A 2Y7QB 3B9KA 4FFYL 1YEGH 3I75A 1QR1A 3HNVH 3RPBA 2FEEI 2EVHA 4UM9A 4XOEA 3QZMA 5DO2C 3PWLA 1P5VA 1S7QA 4FLRA 1IIIA 2A77H 1WGOA 3HFMH 4NLHA 3MA7B 2AJYL 1DBKH 2VABA 3DTUB 4F8LA 1AANA 1HN1A 1ND0B 4QRAA 3OKDA 1YEJH 4OM1H 4GBXB 1AQKH 5FAAA 3FPXA 3VXSE 4NP4L 3OX8A 3WYRA 3ZU8A 2Y36H 3QUYA 1ADQH 1FZKA 2WN3A 3Q8CA 1EFXB 4KMLB 4HIPA 3LKSA 2AK4A 1JFQL 3JZ7A 3HAEG 1HXMB 1O0VA 2ZAHA 4KJPC 3PWNA 5T1MB 1YNTF 2DLFL 2OXGB 2VE6A 2XZCH 4K23H 4HK3N 2OQJA 4KRMB 4LAQH 2BSRA 2ZCHL 1IAII 5J1SC 1A64A 1PX3A 4A55A 5CCKL 1XMWA 4L4VB 5DWUH 2P8LA 5IQMA 2J6WA 3N91A 4Y4FC 2G3MA 5B1CA 3FB6A 3FRPG 4GI9A 4AUYA 5FKPA 2VO8A 1P6WA 3TBYA 4YQXH 4KQ4H 1THAA 4MBRA 3WDJA 1OP4A 1QHQA 2BP0A 3LRSB 4HEMA 5I6OA 5EOTB 4AYFA 5F3FA 4XMUA 1SBSH 4L37B 4ONGH 2HX7A 1BXAA 3QNXA 3QUXA 5EMYA 2ZD0A 1UD4A 3BPNC 3E80A 5C0BB 2EC8A 2MH4A 4WUUA 2H1XA 5DUPH 4M61A 1KELH 2P5PA 1IGFH 1I31A 3WGUB 4A7QA 1JZ7A 3HLAA 1G9MH 3SKOB 4AZ8B 5KVGE 3BWUC 4M7LH 4E36A 3R19A 3IN0A 1IAOB 4M1DL 4OV5B 3LD8C 3SCMB 2F7OA 4LCUA 5I15H 2G3ZA 2X9WA 3NH7L 3HCVA 4XVTL 3MJWA 3NCBB 1MCWW 1GKOA 2L0DA 3CFDB 3VFNA 3FT9A 1XGZA 4OZFH 1BVKA 3G6DL 3PPEA 3MRNB 3CZSA 1JI2A 3QNZB 4X5RA 3FRUB 4H2AA 1JNNL 3SDAA 2XDHA 3DVIA 4BH7A 1I3RB 4QCIA 1LGVA 3HZYA 2VR3A 3Q6GL 4PVNA 2XZQL 1QFUL 1HZHH 1TTCA 2BOCB 4GMSH 4GS7B 4UQ3A 1CQKA 2GK0B 3BP5A 4F8TA 1L0QA 3IDNA 1UENA 2LV4A 4FFZL 4R4FL 4G7YL 2BLFA 4KDTC 4NQCA 1G6RA 2ZUQB 5DJ2B 1E8YA 1CXHA 1JK8A 5D4HA 2DQEH 2BWQA 2VMCA 3NUKA 5LN4A 4P59H 3F58L 5JW3H 4WHTA 4M62L 4B9YA 3CPLA 4E42A 1DBJL 4WK2B 3SKJL 4NZRL 2VLLA 3R1GH 1VKXB 3V0AC 4NHUA 3BLKA 2VXVH 3Q44A 2NT1A 4PJFE 1EPFA 1XEUA 1TETH 5FCSH 2ICEA 3P73B 3L3DB 2LABA 4J3SA 2R69A 2R2BB 5GZOD 5EBWB 4FE9A 5GZNC 3EFFA 4NPYB 2EYSA 4XCCH 2LAAA 1C16B 2C9AA 3VFUB 3H7LA 4RAHA 4Q9QH 3G5YB 5AOZA 1XD0A 4AYEC 5K1VA 4NSKA 3FXIC 2HKHL 4HMEA 2P47B 2CGZA 1RUAL 3A3YB 3Q8FA 4PTUB 1MLBB 4G8FB 5CSBA 4AH2B 1NFDE 4Z5RB 4W6WB 4YHPB 1ORQB 1JP5A 3CFEA 4H5SB 5F1IB 2KHAA 3TYGL 4I0KA 1T3FA 4Z3EA 5IFHH 4MVBD 4G6KH 3T2NL 4DP1X 1FZJB 2QL1A 1Z9SA 5FW8A 4JM0A 2CO7A 1OGAE 3B7UX 3UJTL 1P7QB 4HK3J 5IR1B 4X4XB 4JFUA 4MAYA 3O2VL 1I1AA 4PGEB 2EZ0D 5C0GB 2W88A 2VW6A 3CAFA 4XN7A 3UG3A 4HAGA 2KH2B 4HKJB 3RILA 4JHAL 3WIFA 1AD0A 2F0CA 2MOVA 5KVDL 1OOAA 1YEFH 1XH1A 1AZCA 2JELL 4K3EL 3SCMC 2LR4A 2PR9A 4IS6B 4YNYA 1SBBA 1EZVX 1YEWA 1HIML 3EBIA 4YBLB 4LSTH 4N2OA 1AXSA 1ONQA 1G7QA 2DEXX 3V5HB 1YN6A 5IB3B 3C8HA 1FVDA 5IHLB 1ZLDA 2BIPA 4X9GA 4XNYL 1KXHA 3IJSA 3CZFB 3RA7L 4EDXA 1WBYB 2HFGH 1W8NA 3AU1A 1L6PA 3HG1D 2OS7A 1ZGLM 2OCFD 1ASQA 2DBLH 2EDOA 4D7PA 4G80B 4Y16D 1UQSA 3KXFE 2WN2A 3PAZA 4JKPH 4XPGH 3BC9A 5J3HD 4GS7C 1NFIA 3FQ1A 7FABL 1A3RH 2QVMA 3P2BA 4PJEE 1ZXQA 4G43B 2FZ3B 3T1FA 4JGNA 3PHOA 1YN7A 1NINA 4G59C 1MHEA 1MZZA 3ABMB 4Y4HD 3D18A 5KYUB 4GIOA 1PJ9A 3VI4E 4N0RA 4OF0A 3V6BR 4OLUL 4F7CB 3L3IB 1ZHBA 3IWVA 5E1IA 1TJHL 2DQTH 3MVSA 1GY2A 2FD6L 4ONFH 3MCLH 2VISA 3DYMA 1F11A 4IBWA 3K2UH 3I74A 3T6QC 5GGVH 4P4KA 2OL3H 5LO7A 4X4ME 4D9RD 4PRAB 3DV6A 5HDWA 3QJOA 1ITCA 2NX5D 3QUZA 4PRDB 4N26A 4J5VA 3MLZL 4QY8B 1SHMA 2IXQA 4B50A 3PWJA 4NYLA 4HIJB 4Y88A 3SPJA 2UZIH 5IB2A 1KLGA 4XH2B 4WW2F 4ZX5A 1NDMB 1YAZA 2ADJB 2EDMA 3DSNA 2V2WB 3RWEB 1ET5A 5T3ZH 2XZAL 3NMEA 2DLGA 3E1F1 2COVD 5EUOB 5C0AA 1IEHA 4CADB 3A21A 4E9VA 4FA7B 1G9HA 2BIQA 4PI2A 2YMTA 4PRHE 5GRJH 3KGUA 3GGWB 3GJFA 4LVOC 3BP4A 3E3QC 3ZT6A 4EVNA 1ROCA 4HHAB 1CDCA 2I07B 4U05A 2LOEA 3FUHA 1EVUA 1JD9A 4K8RC 1AO7A 2XIDA 3HNTL 1YCSA 2NNAB 4FF9A 5ICZB 4LHJB 4WU7A 3OTTA 1FWXA 3VXOB 1E4KA 4UT6A 1G1OA 2APXA 4M9OA 1E5YA 4UV7H 5GPRA 4F9PA 5D7IA 3CDYA 3NK4A 2SODB 4R2GC 2AAAA 4IBLT 1J05A 4IU3B 4N8CL 1TQCB 5I9QC 1FLRL 5FCUL 1K5NA 3UMTA 5E5MB 3B34A 2HLEB 5E2VH 5C0JA 2E7HA 4JDVB 2UY7B 2GFBA 2YSSA 1KBWA 1U58B 5F8QC 4G9DB 4LDEB 4OZGB 4UT9L 3WE6B 4AEIL 4U1MB 4ZO8A 1Q0YL 1S7UA 3FO1B 4BELD 1GGCH 1ET7A 2ZOUA 2ZOWA 3N1QC 4IJ3B 5DA4A 3G6JA 5T5FH 5BV7L 5KSBA 3S5LG 1XGUB 5DU7A 1EGJA 2WWMD 3LZOA 3ENEA 4N85A 4N9GB 3V6OC 5CKAA 4DKFL 3VD0A 3MBEC 3S3DB 5E6YA 5JHDA 1G7JB 1MFVA 3QZWA 5ECGA 3GM0A 3VD2A 4JHZA 5DMKA 2OKMA 4PJ6A 4GT0A 3I3BA 4AEHL 3N44F 4DPCX 2WXHA 4DP4X 1VCAA 4JN1L 5KEZA 2WZ5A 4YLQT 3BPCA 1H6EA 2HRHA 2QKSA 5DURB 2J2ZB 3PIQB 1WIPA 3VFWB 2D4FA 3REVA 2ICWJ 5D72L 4IOIB 3NIFE 3QULA 3VXME 1KB5H 1OZTG 3NG5A 1S5HB 1INQB 4DVBA 1ZT7B 1KCLA 4AI7A 2AJSH 1SOXA 4IW4C 5CKGA 3V6FB 1JRHH 4LEXL 1B0GA 3I6LD 4K3GA 1HHJB 4PJ8D 1JD7A 4RGNE 1NMBH 3SPHA 4QXWA 4D3CH 5IB5A 1MI5A 1PD6A 1N5AA 1TJIH 5JR1H 1HEZB 3LN5B 3RY5A 1QZNA 1R75A 5DC2A 2WMPB 5DUBB 5MENE 2VUKA 2H5UA 3K2MC 3UO8B 5DMGD 3O8XC 3MCKA 2QSQA 3AB0B 4R5XA 3QJHB 5DJ0B 3VGDA 2X0UA 3ZYOA 2CLVB 1M2OA 5IB1B 4RRPA 4EPSA 1AGCA 2FJFB 1UVQA 4XMKL 1B4JH 2QV4A 2HTKC 3ZRSA 5B39A 5I1JL 1LO4H 3QDGE 1JCKA 2UWEB 3EYUH 2E6JA 1RSFA 3HG1B 4A63A 4XBEL 3WUWG 1LHZA 5TH2A 1J1PL 2JB6B 2RHEA 4Y16B 3D0VA 1FE8L 2B4CL 1DVFD 4AQAB 4BFFA 1Q9OB 3QZPA 4ETQB 3QA3A 2I7SA 1E40A 1MUJB 1QBAA 1DJSA 3CXDH 3DOSB 3F62A 3SZ6A 1VENA 1FHNA 5J6GB 5JIMA 2AERT 4HKZB 1JV2B 2BVOB 4U3HA 5I8EB 2Q6WB 1ZTXH 3HKFA 2X0WA 4HIEA 1W0VB 5JW5B 2I5YH 2WIIA 3N43F 4JFZH 5CR1A 3U1PA 4UQAA 4OIIH 3NTCH 3QJXA 5D9SA 4Y4HB 5G4OA 2J56A 3B2PA 5I6MA 5L4FA 1DLHB 4L3CB 1NC2A 4IDLA 1PY9A 3U30B 2X4NB 3MGOB 4V1DA 1BD2E 5JIDA 1JV5B 3V9EA 4U1LB 1CLZH 1NPJA 4JPWH 1OO2A 2GY5A 3Q8AA 3FYIB 3MRCB 1ASPA 3IN2A 4RWYL 3ZT7A 4X80L 4PD4K 4JPVH 4PWIA 3LPGA 3K6FA 2D3JA 1AHKA 4PIBA 3V0EA 4HIQA 2IQAB 3BAJA 1GR7A 3R18A 4QXTA 4ZUWB 1QFWH 1B6DA 1G9EA 2W07B 2NX5B 4JZOA 3D25B 1P6AB 1C1EL 3KPSA 3A6OA 5C0NC 2VLRA 5ANME 3D3VA 5B38A 3IDGA 4NWUL 1QTPA 4IEFB 4P5TD 2QBWA 5FO2A 3B7SA 4KFZC 3GM8A 4R26H 2VDNB 5KVEH 2XKNA 2AJUH 3L5WA 5E4EC 3TNNA 1Z9OA 1ZANH 4D0BB 1KXQA 3CMGA 4ZUUB 5C92A 2C4FU 3ZQ9A 1GYVA 4NM8H 5EB9A 5HJ3A 1N64L 5IF0A 1N4XL 1XIWA 1N8ZB 2W9LA 2QEJA 1BAGA 3EDKA 1UD8A 4DP6X 4HOWA 4LSRH 4MVBC 3SGKA 3EJZD 5F3BA 5IHBA 4LDOB 4PGDB 3FOLB 5BZWA 4BKSC 1J1XH 3FSWA 5MEOB 5F7LB 4R7NA 2WZPD 5FYLD 2XT1B 1G94A 3RY6C 5HDBB 1Z0NA 1UACH 3L4CA 1WIUA 5HYSG 5BO1H 1VZGA 2PPEA 4WNQB 4GXFA 4ANUA 2HG5B 5D1QA 5HP5A 4DSYA 2OSXA 3N1PC 3MODH 5BVPH 3D0LB 4K8RH 1U8LA 3D85A 3AB0C 4MJ5A 3H3PL 1OP3K 1KG0B 5ITFB 5A16B 1Y1DA 1T1ZB 3NACH 1OCOB 3DRTA 1T7ZA 3WELA 1VEMA 5DZ9A 5GS0L 5F1OB 5JIKA 3T8MA 4Y2DD 1MSPA 4RSVA 5B4MD 1SM3H 4OCWH 3DROB 2BWDA 4PP1D 1MH5A 1HCFX 4QHKI 4LRNL 5HHNA 1EO8L 4LLDB 4RFNC 4P46D 3RX8A 3CH1A 1GRWA 2WTRA 3UAJC 1CDJA 5IHWA 1MWOA 5EFIA 3HNSH 4JQXC 5TQ2L 1JN6B 5J5EA 3HUJB 3ATAA 3V4VA 4F80A 1OCWL 4JFFA 4KQ3H 3ZZLA 2WLMA 1JGDB 3B56A 4G1EA 4P3DB 2QLYA 3CHPA 4EXPX 3RVXD 1MCFA 3ARZA 3P1VA 3VFGL 1JWMA 2NTFA 1I8KA 5EEXA 1LO0L 2IDUA 2IOMA 5IJDC 3O41B 4PJHA 3WAJA 3DBSA 4BSWB 4X5QA 1FZMA 1P84K 1GYUA 1UEYA 5MHSD 2AF2A 3PWVA 4UANA 5CLYA 4NPKA 4XAKE 4YZWA 2RALA 5BZDA 5EO0B 2BY1A 1GHFL 3PL6D 4WO4C 3N42B 2WUBL 5F44A 5F7EH 3OG6B 4N0UB 4Y4FA 1PJWA 3NSJA 1OQXA 4PJ8B 3T4YB 5IBUB 2O5YH 1BJ8A 1H8LA 3KW8A 5CJBA 4U6VL 3TX4A 4KQ0A 4KUCD 1HX0A 3IFLL 3IMBA 3IKCB 5EC2B 4YIQB 3OLEA 2IDQA 2Y2WA 4OKVA 1KYUA 2CE6A 1ZS8B 4E0RB 3K1DA 4W9JC 3SY0B 1R4XA 1QSVA 1SYSA 1U8NB 3LXCA 4AGPA 3Q7JA 3D9AH 3I02A 2DIEA 1IM3A 1N9PA 2O6DA 4PRBB 2VLJD 2K9FB 5ITBH 4RIRB 3BHBB 3UIZA 4IGBC 5CO1A 4YHYC 3DECA 4OJFL 1NCAL 4ZFZB 4Q58C 2CO4A 3MLUH 4NC1C 4S1SL 3ZL4L 1HSAB 2EO9A 1DVFB 4H25A 3RWHA 3GSRB 5HHPB 1X5IA 5MP6H 1G5GA 1J0IA 1OT4A 1MCQA 4NX0A 4URTB 2MCG1 3OMIB 1TXKA 1IEAB 1P4BH 3E6FB 1GMEA 3PGFH 1RZGA 4IOFC 4OJYA 4XN4A 4BH8A 4JUTA 4F7MB 2OMVA 3DC0A 3OBAA 4NRYB 4U1SB 4R7XA 4YXHH 4QTIL 2JB5L 2G60L 4D0DB 3LHPH 3W0WD 5CGTA 3EUUA 4H0HB 5K33A 1FNLA 2H6PA 1AKJA 3EG9A 2CH8A 5T5FA 4KDTA 3VU2A 2WQXA 1KWGA 5C6PB 1VGKA 3MJ7A 5JOPE 1UWYA 4UCFA 1BZ7A 4NZJA 3LVEA 1RJYB 4F8QA 1EEZB 4OBRA 2HN7B 4HXAL 4DP5X 3IGKA 4MDJA 1FYTD 4NI6A 1L9TA 1T03H 4QYAA 1OY3B 1QYGH 5FDYA 5C2UB 1GVIA 4L8DA 4ESKA 4YHOH 2D7TL 3FTXA 1SEQH 1DLFH 2XWDA 3BVVA 3FUJA 4UIMB 5AWNL 4FNUA 4KI5C 4CU8A 4L1LA 1X5XA 5CZXD 3BH8B 3S6CA 4U0RC 5CLXA 5J56B 3CDCA 4PJBB 2GUYA 5HHXL 5FO9B 3RE0A 4XWGH 1R47A 3PGDB 2YD6A 2IGFH 5E6SB 1KCBA 1TZHA 4N24A 4WW1B 2PYFB 1A4AA 1MWAB 4FJYA 2OJEA 5L6YH 5C0CB 3U9UB 4ZOBA 1OB0A 3ECBA 5ENWA 2WYIA 4BSJA 1BX2B 4DO5A 1M05B 5FFLA 3SGEI 1IFHL 3HC3L 3MOQA 3P9LB 4I3RL 4PJ8C 12E8H 3NPSC 4MDRA 5EZPA 2ZOKA 1NCHA 1T7XA 1XTMA 3PWPD 4OIAA 1F6FB 3O2DA 1LXMA 6PAZA 1I53A 5F88B 5I1EH 1Z32X 4DKDC 2CJTA 2GBAA 3QR0A 3V10A 1U8KB 3I6KA 4BM7A 3ZE2E 4HU2A 4KY1L 2J7LA 3G7TA 4LVHB 2WP3T 5D7IF 3FQ2A 1R3IH 4PGJA 3GIZL 4FFYH 1V3LA 4Z7UB 2C9QA 4WEBL 2CKBB 2BW4A 2CWRA 3LKQB 4P46B 3EOBA 1UZ6E 3QSKB 5DRWA 2ZOOA 3UROR 1DVFC 2V3FA 3S98A 2IWEA 1LO3L 5F0JB 5T1KD 1FV1A 1FFQA 1F4AA 5DQJA 5FV2A 1MCBA 4MMYB 5F96L 4LRIC 4WAFA 2VR6A 3FU3A 2YXMA 4NP4H 5JXEC 1YY8A 1KXVA 3G6JF 1CFNB 5KSBF 3CSFA 3T65A 2Z4QB 4YHNA 1WWCA 4RX4A 5TQ0H 2OMXB 3QZWG 1KNOB 1MG2C 2O5XL 1F3DH 2BS8A 3ZDWA 1A5FL 3Q01A 1MFUA 3S97C 3QJVB 4OT1L 3ETBJ 3MRKA 3PL6B 4LSQL 1WFOA 5B7MA 2ICES 2ZCHH 4X6DA 2Q8AL 5E9DA 4ZYKA 3VD9A 2HJFA 5CCKH 3IVKB 2WO2B 5DJCB 4RFEA 5EBLA 4L4VE 4UIKL 5E8NB 4MCYA 1PG7X 5SWZD 3WFHB 3AWGA 2DJSA 4IBZA 4IBUA 4PYHA 2HRGA 2Y25A 4N0YH 1RZ7L 4PGCA 3D09A 4F7TB 4RESB 4WCYL 2ZX9A 2O5ZH 4Y4KD 2CBQA 5CIPH 4BKLB 4MXQC 3IJHB 1P6FA 2NTSP 3C5ZA 1D6EB 3NFNB 1QQDB 4PY8I 3UZQA 1IC1A 2LW3A 2ZKXA 4ZW5A 2VLJB 5C0BE 2ZKHH 2ARJA 4N87A 3FO2B 5IB4B 1MVUB 2X05A 2Q86A 1EIBA 1I8IA 4LB8A 4M1DH 3O4LA 3K80A 3NH7H 2X38A 2VDNH 2CMRL 4KK9D 2P44B 4YSOA 1AHWB 1Q9LB 4XVTH 4Z7WB 1WA2X 4KV5F 1ZTXE 5KUMA 3NIGF 5JPNB 5CHNB 2A9CA 3IKKA 4KXCA 3G6DH 5GGUA 3MGAA 4GMTL 4BDVB 1CURA 1FNGB 2AXHA 1XR8B 25C8H 2B77A 1W72A 1D2OA 2ITCB 4LLQB 1FBIL 1JNNH 3W0WB 1IGIL 1NIDA 2W60B 4G8GB 3L5XL 1KYAA 2D73A 3MJ6A 4R4BB 1FN4B 1RZFH 2XZQH 1QFUH 3NDYE 3HHRB 4RMQA 1CC3A 3BUPA 1E4WL 3RJDA 1K4DB 1AYOA 4E5XB 4LL1A 4TLSA 3ZOAA 3IXTA 3V6ZB 4G1MA 3VFRA 4FFZH 4C55A 4R4FH 5BV7C 2VXQA 1EK3A 4G7YH 4J8QA 1KBKA 2YD9A 3RIKA 4FD0A 2VN7A 2JI3A 5IM7B 1FYTB 3WS3A 3F58H 2BP5M 4DK3A 2HJKB 3R0MA 1VADA 4JFEB 4MWFA 4M62H 4E9QA 3CSBA 2VUYA 1NDGA 2K8QA 3B83A 5EG6C 5KVEE 1DBJH 2EADA 3SKJH 1A8ZA 4NZRH 3ZKMD 2FATL 2G9HB 3TBSB 2XV6B 3WEXB 3BZFB 1WT5C 1XDTT 3PWUA 3RVXC 1LE5A 1Z5YD 2YPLA 4GINA 2F68X 5DJZA 4JX0A 1PNDA 1YECL 1B2WL 2WCPA 1QLFA 4RMUA 3TA3D 4YDJA 1JF1B 1LLAA 5TDNB 5L7XH 3BXNB 3QO0B 3PL6C 3PQYA 2DQIH 1KUMA 4FTDA 3WTWA 3MREA 3W5MA 5J11C 2DRUA 2HKHH 3HJEA 5J13B 1F8TL 4HU8A 2ZXWB 3NDZE 4L48A 4IHOA 3KLAB 5T1JA 3ZYJA 3I9AA 5KJ7E 1JZ8A 3HZ3A 3PWPB 3TYGH 3VFVA 4OQ1A 3ZRFC 3T2NH 1EQWA 4YMPA 2DEWX 5C0DB 4JFXB 4B95C 1E8XA 3D52A 3VRLE 3GTNA 3UJTH 4DH2A 4Q56A 5BZXA 1VLXA 3QXAB 3S4SB 1NC4A 4PJGA 2ESVA 2APVA 3GS4A 4C8XA 3MBXH 4Y9EA 1NFKA 1NKOA 5AB2A 4G6FD 1SN5A 3ARQA 3QUGA 3VGAB 4H8WL 4DT2A 3HR5B 3WAKA 1ETZA 5KVDH 2AQTA 1I3UA 1T0PB 3ZY7A 2XKSA 1QVOA 2B4CC 3O8XA 2G3NA 4JO1L 3GSQA 3RJOA 4JM4L 2IH1B 4C56A 3QUML 3EOAB 1HIMH 2RB8A 5EIQA 1AHWC 1HTYA 3HEIB 2EUWA 5HI5D 4LHUG 1UXSA 4ZOEA 3KM2A 3DV4A 3QAZB 1USQA 3QIBA 4IBSA 5B1AB 4UQEA 3KVPA 3SQBB 1P69B 3U0TA 2NZIA 2EXTA 4XNYH 1GGYA 4PJCB 3RA7H 1FORL 2Q87A 1ZHNB 3MUHL 4RMVA 1Q90A 2X1QA 5I16B 2H2PD 4ZMZA 3V6OE 3FTWA 4CC1A 4NZUH 2EYRB 3NCCB 3UEQA 3H9SD 3HZMA 2YAFA 4JO2H 3K91A 3U4EA 1FAKT 1OE3A 2JV6A 4PV9A 7FABH 5E8PB 1IQDB 2K4WA 3PFQA 1I8UA 3HJ0A 1FC1A 1NCOA 3HPJB 2VB5A 4ELMB 3IB4A 4XWOC 5SWZB 2FH8A 4G7QB 3E2HB 4XP4L 3QG7L 1X5MA 2A6DA 3ZDZF 3OSVA 4KO6A 1GH7A 4PJHF 4U1NB 2DQJL 1BVZA 5JQ6H 4OLUH 3X1FA 3E6HB 5DZVA 2IJ0C 3EUDA 4Y4KB 4MA8L 3BIAX 2FD6H 1BQSA 1V3JA 2VRAA 4R3SB 3LKNB 4A6YL 2AMGA 4HXBL 1U8MA 3VD5A 1I7ZA 1E3XA 1M7DB 2R59A 3BUYA 5KS9B 1QBML 4XP5L 1QOKA 1IGYA 1HYRC 4I2XB 5IESL 3QI9A 4MSWB 1WCBA 3DMMD 3TBTB 2OMTA 5I1IL 3ASOB 2CPUA 2JCCB 1AQDA 4FJ6A 4PTTA 2CGRH 3US9A 4BHUA 2IWGA 3UABA 4WSJA 2V7HA 2IDFA 3IAQA 5B7EA 4DP9X 5JMRA 5EH1A 1BJMA 4WI4A 4JG0L 3II2A 5G5DB 4CW1B 4F7EA 3HS8A 4A39A 1EO5A 3FU6A 2ZONA 1YEIL 5E8DL 2XZAH 5J13C 1IE4A 5EUOE 4J39A 4XCNB 4KXZH 3BEWA 5ID1B 2FX9H 4GW1A 2Y5QA 4OCXL 4YFLF 2ADFH 5I5MA 3AXIA 2NY3C 2R0WH 2CK0L 4YS4A 1OTSD 1OP5H 3OZ9L 3VWKD 3HNTH 1T4KA 4FCHA 1MWAH 3RY6A 1SZNA 3JV4B 3S3PA 4FFYA 2NRDA 3ZYZA 2E9WA 5GS0C 4KXBA 1A4CA 2IAMC 5F93C 2WTPA 4LNRA 3PCYA 4N8CH 3MKGA 3SYPA 1FLRH 3BJ91 4ODXB 5FCUH 4JM2C 5K9OB 3SEPA 4NKOB 4ZTOH 1RXLA 1P2CA 1S9XA 4H1LG 1HJBC 1OM9A 2KLRA 1SRDA 3X13B 1CQYA 1UYWL 2OPCA 4N0FB 4UT9H 5D7KD 4OZGE 1KTRL 4DPBX 1X5KA 4IMLB 1OAKL 1TPXB 2VDPB 3S3BB 4FQQB 4J3VA 3QAZC 3CCHA 1B9KA 2K9UA 4NHCL 4XP9L 3CDZB 2P24B 5BV7H 5CD3A 4FTVA 2J1WA 3TA3B 3UAJA 2CKBH 4DKFH 3BAIA 4LSPL 5C0IA 5IEKB 3PG2A 5LGHL 3LN9A 2CRZA 1K5WA 4FQ2L 4NO5A 4AEHH 5DXWA 3SPVB 1DSWA 1FFPB 4WU5B 3X11A 1DO6A 3F7RA 2GC7C 2H3XC 3B9DA 4JN1H 4XNMB 2F7PA 3TO2B 4AXWA 1SMOA 4BCYA 5KG9B 3D39A 3AQZA 2NQDA 1T80A 5IMLA 2A9MH 5CIPA 1DANT 5AFAA 1UADC 5ADOH 1LD9B 2HKAA 1BGXL 3KPRD 4L29A 4X5LA 1HXYA 4YK4C 5LBGA 4WO4A 4Y4KC 5D72H 5AVQB 1P84J 5LQBL 4IKIA 5D4JA 2FGZA 2NNXA 5E95B 1YO4A 3QJQB 1QLEB 4F37F 1I8MB 4G6FB 4BA0A 2Q8BL 2V5SA 4GSRA 4JRYD 4PY7B 1QW9A 2YRPA 1DZBA 2PPDA 3GXMA 4MA1B 1C08A 3IU4L 5DT1L 2I9LA 1OF0A 3QORA 3F85A 3QFDB 3FUEA 3FCSA 4OLEA 3QDME 4KK9C 3L8QA 1E6JL 4NDMA 5F1NB 1TZIA 1CL7H 3N41F 2VDML 1KLUB 4MCZA 1KT2A 2P80D 4IGBA 4GP5B 4X0NA 4XMKH 1ZT1B 5I1JH 3UTTD 4G6JL 2R51A 2UWEE 3AY2A 3N9GH 3L4VA 3HG1E 3TL5A 4XBEH 1U3HA 3UYRL 3X3FL 3MLTB 1J1PH 3CXFA 3QPKA 2B4CH 3ILQD 5TGBB 3DO7B 2FQDA 1AD9B 4A38A 3UTSD 3U6RA 4MD4A 5C3LD 1OSEA 5IROD 1X7QB 2A0LD 2ZG2A 4ODWA 5FYJD 5T3XL 1FL5A 2F08A 3HB3C 1M71B 2FHFA 4TLKA 1CIUA 2Q5BA 5EWIH 4S0SD 4LCVA 5DFAA 2EVGA 1UD6A 3IU3A 4BQ6A 3PJSA 3D05A 1FVCA 4RWYH 2MCMA 4X6DF 1TFHA 3LIUA 2VL5B 2CO6B 1CD0A 4G72B 3OQRA 4OFYD 1JYNA 4D9RE 3P9MB 1A6TB 3NGBC 3DMMB 4M8UA 1C1EH 2NX5E 1OW0A 3VYOA 1XSIA 4CVXA 4WI7A 5E4AA 2PW2A 3NFSL 3N50A 1CG9A 4QHNB 4B9ZA 3FU7B 3DXAB 1Q1PA 3T6WA 1U8PA 4NFDA 1MFBL 2XWTA 2YC1A 2HUEA 4FMKA 4PB9L 4ISVA 5EN2B 2QVTA 3ZR5A 4D2NA 1KGUA 1MHCA 3UTZB 1HDMB 1N64H 1N4XH 4MD0A 1SHWA 1BFTA 3U7WL 1EWHA 1SHXA 1I7RA 4NJ9L 3BVXA 1DN0B 1BAFL 1Z5LA 2XTLA 1CU4L 4LLWA 4N3TA 3HG4A 4NQDD 2OP4L 3MUY1 5FW7A 1N5YL 4GY4A 4OB5L 3AC0A 1PF3A 3VWKB 2X9XA 3CH8A 2EE0A 3V0VA 1EUTA 3ZJAA 4DUVA 2IGLA 1E43A 2Q10A 5IMOB 2HVJA 1U9KA 3NJHA 5ISZD 3FQUB 4G6AC 3EYSL 2BY0A 4QYOB 5HDBE 4L9LB 3L3KA 1JRHI 2JXMA 1LK3L 1GXEA 4ZMVA 3O3UN 3SE8L 4LAJH 1BEXA 1D5BA 4MA1C 3ARFA 3M1BA 1NMAL 1T22A 3P4OB 4QRRD 4F5CE 1Q9WB 1WFIA 2EXWD 3CSPA 2QADD 2I60L 3OSKA 1KIRB 1BEYH 2KLTA 4JCLA 4UUJB 4X5XA 4ZW6A 4RQQA 1R3KB 3FN9A 3SO3C 1MVFA 1KENL 3MGTA 1B4TA 3W81A 1FDLL 1SJHB 3H3PH 3RL2A 2ENQA 4HCIA 3P3UA 3TS8A 3DLQR 5DS8B 2EABA 4RDQF 3BN9D 1CE1H 5GS0H 4WJ5A 1UCTA 3K6OA 4HW6A 1ILUA 4XN9A 5ACLA 4ZW3A 1SDAB 5HGAB 4LRNH 2H2PC 1UKTA 5EIVA 1F4YL 1XF5B 1OD9A 2XV0A 2BO0A 2YFNA 1QUPA 1CDUA 2PABA 5IWLC 3DI2B 4XNUL 3VFSB 4TNVK 3X12B 5JXEA 3C8DA 4P07A 3HUJE 3MAWA 4JO3L 1OCWH 1OCRB 2GJZB 4ES8A 4YGVA 3ZTEA 4Q6KA 4WI5A 5T33L 3Q2WA 2BDNL 1OP3H 4MD5A 2LVEA 1A9BA 1CICA 5DGQA 3VFGH 4L8SB 1E9PA 5D6CB 3GMQA 2IALA 4GW4A 1LO0H 1UH2A 1WDAA 5CLZA 2PTTA 4GKZA 2Y3AA 4BUHA 3MV01 5FR3A 3EYQC 4Q8BA 4AV0A 4LCWA 1GHFH 2I27N 1OPGH 4JFQA 4W9FC 4HX1A 2WUBH 1KCVL 4TUJA 5KYYA 4M93C 2IOOA 5I0DA 4MJJA 3MRQB 4XNQB 5AB1A 5BZZA 1SNRA 1QFWI 4JRYB 3I6LE 3Q6FB 4X98B 5JIHA 5K5YA 2ED7A 2X89A 1EHAA 4F24A 1LP9B 4IIQC 5B7FA 1NZRA 3DX7A 4O9HL 3H9ZA 3LEXA 5JPMA 2JTYA 1F02I 4FQXA 3OKMA 4MZIA 3VFOB 5DLLA 3F04A 4JDZB 1IAMA 4YGAB 3J8F7 1UKQA 4FL4B 4PW9A 4I89A 2C1PA 2MOQA 4PJGF 1R0AH 2F53D 4ZMQA 4P2YA 5D2NC 4XCEB 4EEEA 3VA2C 3MV11 3UTTB 1HFUA 2EC9U 5CSZB 4W9DC 3B5TA 3TH3T 3MLVL 4OJFH 1NCAH 4KK8C 4S1SH 3ZL4H 1E42A 1IGJA 4JKNA 3IAGC 4PRNB 1OTTD 1NFDA 5LDUA 1M1XB 2VQ1A 4DF9A 1DYZA 2E59A 1UJTA 3UTSB 3ILEA 1FRGL 4I0PA 5I23A 5I1GH 4JGJA 2OI9B 5TD4A 2OYKA 2IPUG 5IJKA 4N8VB 5MEPA 4PJDF 5IW1A 3QG6B 4ZXBA 1HHHA 3C5XA 2FIKA 2G60H 4QTIH 4YE0A 1A4KB 5GRZA 4JCWA 1TU2B 1OE2A 3K2IA 3H6AA 3M88A 3ULUL 3V4PL 1KPUA 4A6YB 1BOYA 3MYZA 3IWUA 2EIZA 3GXDA 2VH5L 4G8AC 1I75A 1WS7A 2FSEB 1CO1A 2VAAA 4AQOA 1QRNE 4K7FA 2ERJB 3BAXA 4YBQD 3NCYP 3WKNA 1SJEB 3GMLA 1NEUA 2UXTA 1KV3A 4UDUA 1MF2H 5KN5B 1UURA 2DL2A 2DM4A 4AUUA 2V6HA 1BYOA 4L05A 1OT2A 2DQGL 2A6IB 1CFQA 4JFYA 4PLKD 1UXLA 5IMKB 1HI6A 3MV8E 2YA1A 2Z7YA 3LMJL 1QABA 1O9ZA 2D7TH 5HHOD 4QOKD 1BWWA 1ZAGA 5AWNH 1WT5A 2XLLA 1JTPA 4LEOB 4PJAF 3VXRD 4FLHA 5KW9L 1K8DA 3C60D 5FUOL 3V4LA 4OGXL 3CFNA 3GSOB 4LEEA 4PJBE 3V7AG 1G7PB 1L9RA 3GXNA 1CF8H 4XRCB 3CFCL 4Y0GA 4M5TA 3FFCA 4G42A 1NCTA 4P2QD 3WDHA 1I1RA 4JFOA 4UT7H 5E94A 3MRLB 4Z77B 2X4UA 4KJQD 4ZW8A 3ULVD 5C0CE 1JWSA 4JRWA 5E51A 4PJ5A 4KXDA 5ISZB 3KYNA 5IV2A 3WNMA 3HC3H 3UXFA 3BJLA 4M3JA 4NAMA 4G9FB 1TCRB 1NBQA 1UUSA 1G7MB 3MRFB 4P49A 4UI2A 3MRGB 5LDSA 1II4E 2CLRA 4KKRA 4WLCA 2QADB 2WLIA 3MSPA 5EC1B 43C9A 1X7TA 2DYPD 5HYQB 4UTBL 1I4FA 4FL4C 1RI8A 3UIYA 2ZWYA 2B7DT 4KY1H 1AAJA 4UMGA 4ZDHA 4ZT1A 3PHQA 1QLEH 1EO7A 1MEXH 3RUGB 3SDXB 3GIZH 4P2RA 2RTTA 4B41A 5DZNA 4Z7UE 5KYNA 3DPBA 1OAZH 5C3IA 1XGYL 2RACA 3HE7A 5FO7A 5E08L 2AXGA 1AS6A 1T1WA 4Y5YA 2NW2B 4FA6A 2VDRL 3NN8A 1CBJA 1LO3H 1TCMA 4CN6A 2H3NB 2BC4B 2RFXA 3GB7A 3VAEA 4AY0A 5F96H 5LXGL 2GT9B 2LTQB 3AACA 4I77H 1HWGB 1YQ2A 3AS0A 4NCC1 4UQIM 3Q3GA 4GAFB 3WN5B 5IW6A 4AYDC 3JXAA 2CHXA 3AT9A 2ENSA 1D7DA 4A04A 3MV7A 2ZSWB 2O5XH 4UB0L 5F7NC 1NM4A 5MHSE 2YAQA 4ETYA 1UB6B 5E56A 4B9FA 4I0CC 1HOCB 3TJEL 3RZCA 4QHUA 4LSQH 4WI0A 3IJ9A 3AQYA 5DMJB 5EPMA 5I73B 2ERJC 3QHTC 2WANA 1BZ9A 5J1TC 2KZWA 3QPQD 5TDOB 1WGVA 4FG0A 4UIKH 4FI7A 2AC0A 3GSUA 3WU1A 1IZJA 3KWVA 1KGJA 3KBPA 3RWJB 1D5ZA 1XGPB 2AABH 3OKEA 1MG3C 4WCYH 4KO9A 3F7QA 4HGWA 4J3OD 4CA4A 1SDDA 4Z7QB 3ZGHA 1A7OL 3ISYA 1VFAA 2VDMB 1ZD6A 3QWOB 2F53B 4LZKA 4ODUB 2V5MA 3UPRB 2MPAL 5SX5K 3U4BL 1KZYA 4M1GL 2VLJE 2XNAA 3V5KA 1J0KA 3L4TA 4LPWA 3B37A 5FKAA 3FCGA 4JRLA 3SDDD 4KROD 1IKNC 3F84A 4KTYA 3EJRA 1WTLA 2QVFB 1NCWL 4KKBD 4BHUI 2H6UA 2YEVB 5SWSB 3JTTB 5H94A 4X0KA 3LNEA 5INCA 2Z8WC 4Z7WE 3CFIC 4ELDA 1UGKA 2K6WA 4J2XA 1E5AA 3H56A 3WMSA 2Z91A 1Z0MA 2Z35A 4GMTH 4X7SH 4MA3A 1FBIH 1IGIH 2D31A 2CA3A 4X8JB 3W0WE 4DETA 5IEHA 4G8GE 1VEPA 2ZSVB 5FYLL 5ETUB 1QSED 5CN1A 4N5UA 5FS5A 4K2UL 1E4WH 3O0RL 2HLFC 2IAMA 5A6IA 4YLCA 3DTXB 4X4ZA 3BQUC 3TT1H 1M2VB 4UQ9A 1ACYH 2W92A 3GZOA 4JM2A 2GJPA 1TQSA 3GYRA 1P4IH 2FWOB 2XN1A 2Z9TA 1UTDA 3B2XA 5FK9B 3U82B 4L8CB 3O45B 5I6XC 1FYTE 5ELIA 5GIRB 1LK2B 1GZPB 4F33B 5H35A 2XVKA 4FULA 1KB3A 4JFEE 5FM5M 4TOYH 5ICYB 1NBYA 2V5TA 4QOKB 3FTUA 3VXRB 1SJXA 2FATH 4U49A 1PNCA 4U4IA 2LTQC 3WNJA 3WJMA 3UBHA 1NGPL 1NCJA 3CFUA 3C60B 5HI3C 3SPGA 5HJBA 5A6LA 1XR9B 4QRSA 3GMPA 3O3AA 2Q76A 1S9VA 2XN9D 3W5NA 3DIVA 2ZOTA 43CAA 4Q9RL 1B2WH 3OAYK 2NZ1A 1E5UI 2P26A 5DEGB 2G75B 5DK0B 3HN8A 4P2QB 5ID0A 2GC4C 1A3ZA 2H4EA 2VSCA 4N2BA 2BVPA 2WNKA 4AT6B 4FFVC 2J5LC 4EN3A 2JKJA 1Y0LB 1A7NH 5A2FA 1V55B 1WV7T 3L3OC 4EKXA 1BFVH 1M6OB 5GISL 1F8TH 1BFOB 2WGNB 3I9PA 3LKOB 3WV0A 3N3EA 4JKWA 2WP3O 4MNGB 2PLTA 4L4TA 1OGPA 4LF3A 4WEMB 1A14L 1A2YA 1TQBB 5EA0L 1AXIB 5DHVB 4QHMA 5JHAA 2KUTA 1DO5A 4J23A 3KGSA 4OVVA 4W6YB 1DDHB 4ZX3A 2DYPB 3K72B 4O2CB 2DD8L 3WXVL 4D9LL 2DLTA 3TLRA 1IIKA 2YAMA 5AW3B 5KSAC 3WFDL 3TO4D 4NQXB 4JL1A 1JNLL 1XQ4A 4FQIH 2MFNA 2O72A 2WVVB 5KBPA 4PREB 3DJ9A 4Y2OA 2IG2H 1G4RA 2B9AA 5JXAL 1L9QA 3S2AA 3RL1B 4ANXA 2R1YB 2NY0D 4KVNH 4CVUA 4G5ZL 3QR2A 4U3CA 3O3DB 5IG7B 4AQEA 1QO3B 3Q43A 1T7VA 3AQDA 4JO1H 3WL9A 4KJWD 3QUMH 4X6BA 5FX3A 4PJ7B 2LAGB 3ME0B 3MRJB 5AVZB 3FTGA 5LXVA 2P45B 3UJIL 2P8PB 5DFVD 1FNHA 3IBEA 5CU5A 4EDWL 1A25A 3K4DA 3RVUD 2ZX8A 1R3LB 3K0YA 3KDMA 1NGQL 1JZJA 3CVHL 3ZTDC 1KIUB 1ITBB 3L7FA 4FYTA 2CCLA 4YVNA 3EOYG 3ML8A 3T2QA 3UYPB 4X6CB 1TOXA 3BVNB 3G5XA 5DC9B 1KBGL 2GEEA 3OR6B 2B1OA 2ADIB 2EXYD 4PJIB 1CDBA 4ELME 1IFRA 4EI6B 3PXJA 1EA9C 3KCPA 3FQ4A 4XP4H 3QG7H 5SWZE 3HI5H 3OXSB 2P5EB 5DR5H 4DHLA 3LDBB 2ZUXA 4KVCH 1Q1JL 3L6FA 1F6AA 4PLKC 4BFIA 5ADPL 3ARDA 1XCTB 1W8OA 1WISA 5E6ZA 1T04B 1JZFA 4JZJB 4MA8H 4RMWA 4X9IA 1OP9A 4OCSL 5E4OA 1AIFB 4MCNA 3RDTA 4A6YH 4EOWL 1P7BA 4HXBH 5GSVB 3NYKA 3UFIA 1TSHA 1QBMH 5DQDL 5KS9E 3C60C 4K9EL 5IESH 3SJVD 4I2XE 4PVMA 1FZOA 4G3YH 4X9HA 2X70A 4DGWC 1QBLH 3NEOA 3SDDB 4KROB 2JCCE 1KCUL 2TSBA 2X4PB 4HSQA 5IFAH 1LL1A 3KLLA 3P0YL 1E9QB 2B08A 4KJQC 3MLYL 4JG0H 3PAVA 1RZKC 5DVKA 3RVVD 4KGJA 4RGOL 3DVNB 5D1ZA 5E8DH 1YEIH 1BXXA 5ESAA 1EHKB 4HUVB 2YS4A 2R1XA 4LK4A 3L7EB 4GAYB 3ARBA 2H1PL 1HHGA 1T7WA 3LB6D 3NZ8A 1HSBB 1TQBC 1ESOA 3I85A 2X2IA 4GUQA 1E8ZA 4UILL 3LJ3A 4HUNB 3C2SA 2WVUA 4RZCB 4UOQA 5F2FA 2UZXB 3DURA 1NFDF 1QSEB 1F56A 3OZ9H 4K71B 4ZUSB 2C9RA 3UERA 4U4BA 5CILL 2ZXCA 4KJYA 4ZPVA 2HFEB 3RFZB 2ZXGA 2R2HA 3MROA 2P42B 1LDPL 3T71A 1R3HB 4U31A 3L4WA 3L1OH 4WKZB 3ZXAC 3ALWA 1IGTA 1CFVH 3T8XA 3REWB 4ALAL 5CINL 2BCKA 4ODHL 1PAMA 1EDQA 4I4WB 1UYWH 2HB0A 1JHTA 3QIUB 4YOKA 5C09D 4PV8B 3QPXH 2APTA 1OAKH 1TVHB 4P3CL 2ATKA 3CFJB 3EKCA 3GMOB 5CUSL 3QWRD 3JVFC 4HWBL 3MLXL 4JN2A 4UM8A 3T4AC 3P30L 4XP9H 4NHCH 2C5DC 2XN9B 2XX1A 1ID5I 4AIEA 3JT0A 3QC5X 2M8XA 1KBVA 1G7LA 2YPKB 3KYKL 1MIEL 3GT6A 3DJSA 2DKMA 4FQ2H 5JOFA 3AY4C 2G5BA 2A4ZA 3QPQC 2C4FT 4OGQC 3DX8B 2NPLX 2BH0A 1M56B 3F6IA 3EJPA 4PJEF 3ROOB 4BZ1L 3H1ZA 1BGXH 1XWVA 5D4QA 1TZOA 4JZJC 2FUTA 4KRNA 3KPNB 5K1JA 4TSBL 3VFPA 3TO4B 5FEBA 5LQBH 1PLGH 3B3IB 4NO3B 1OPOA 3R4DA 2ZCKL 3STZA 4MDIB 2O61B 2FO4A 1EERB 5I5RA 2E5EA 4OCRH 4E41A 4MQ7B 5F7HA 5IVOA 2J12B 2NY0B 3EGXB 5CNHA 5K9QI 2QPEB 4OZIA 2X4TB 3WJLC 1X9LA 2VLKB 2AXFB 4U1KB 3RPIA 3PAYA 2J6EL 2Y7OA 4KKBC 2APBA 1OB1B 1OHZA 2VJ0A 3E38A 3NCYS 5TE4L 4APQC 2BP8B 4QEGA 4JDEB 1SOSA 4TQPA 5AG9A 1OIOA 1INDL 2CHDA 2N0MA 4YPJA 2DAVA 5D2NA 2VDMH 1M7IB 4ZUVA 1D6VH 3N40P 1A1NA 3DGGB 3N0PB 4H26B 4KXZI 1MJ8L 3MLSL 3RG1C 1E7UA 4WWKA 4G6JH 2COQA 2FNBA 3QYCA 4J4PD 3UYRH 3WE1A 2DM7A 5EEYA 1ZA6A 4YDZA 5DJAB 4BFJA 1IAIM 3H3BC 4K71C 3SE9L 5LBSL 2QQLL 3UZEC 3N6YA 1QD0A 4YHLL 5M95B 1UM4H 3ZRCC 1D7BA 3EH5B 3L9RB 1ANUA 3PV6A 2J71A 5IHZA 1FJ1A 2CRIA 5A2KH 3RKDD 3FTYA 4OD2A 1V54B 2NY7L 5JNYB 2OYLA 3WJJC 1BMWA 3VI3B 1ML0A 2MSPA 1ZVHA 2H0JA 5IIEB 1F2XK 4OD1L 5IVXA 3O2WH 2BHFA 1NEZA 3QIUC 1HH6B 1I85A 4HIHA 3WOVA 4B9GA 4PVBA 3F83A 1QSFD 1TIUA 4N9OB 5LB1A 2X4OA 3F3HA 1F42A 5LJYH 3KW7A 3SJVB 3NFPA 1F90L 3CWGA 4FXKA 3T1WA 3WFBH 1EAJA 3S36X 3OGCB 1EZUA 3A5VA 4GBXA 4L3EB 5AUMA 3NFSH 3A4DA 3BVDB 5CN3A 2PWFA 1B4RA 1RLWA 3DXAE 3T0ED 1PQZA 3HC0B 3OWEA 4ZO7A 4NGHH 5EU7C 3FJTA 3FCUB 1GGTA 4PB9H 3X17A 3S35L 4AM0B 3W38A 5E1QA 3QFJB 1JPGB 4CGTA 3ZKND 5F6HJ 2HUHA 3U7WH 5HYJA 4MMXB 2DZEA 1EFQA 1X6NA 1BAFH 1FSKC 4LSUL 1CU4H 4XN5A 3AT8A 5JLZA 4AZUA 1OAXL 2OSYA 3MNVB 1N5YH 2OP4H 3KS0J 1U8HB 5JORB 4PB0H 1KSRA 3DARA 4J7RA 3KJ6H 4OB5H 4L4VA 5AL0A 2DI9A 1Y18B 4DK6A 1KGCD 1F86A 3VWJD 1BF2A 1U95B 1RZKH 3P0VL 4KMQA 2YD1A 4TVPD 5GGSA 3TN0C 2AV7A 3STLA 3EYSH 2Y72A 4XAWL 3NIFF 1LK3H 1HILA 1Q94A 1O6SA 2EAEA 3SE8H 4N3UA 3GLEA 4ODVH 3QUMA 1NMAH 3MRHB 4FNLL 1EHLL 4JFSA 5DHVH 2I60H 3A24A 5JO5B 3BZEB 2X2JA 3MN8A 1LJMA 5C09B 5D7KE 5AW2B 2VR4A 1KENH 1BOGB 1MCKA 1FDLH 1WAAE 1U8IA 3V0WH 3NEXA 3T6XA 2QKIC 3UBGA 1YC8A 1N67A 1O7VA 3WLWD 2Q3ZA 2XVLA 4JM2F 4QRPA 3RVUC 4URKA 4B97A 1NOLA 3A6BL 3S5ZA 1SJMA 3F7YA 4M7KH 2JH2A 4GSDL 3WY4A 2DWDA 3CFDA 1NSNH 3P2TA 3OAUL 4AG4L 5HDQL 5LCVL 4BFEA 2ZKMX 4XNUH 2J8HA 3W57A 3FRUA 4PP2A 3TFKC 2MQ3A 9CGTA 2P5WA 3BOVA 2EXYC 4JO3H 2Q7YB 1BF8A 4IYKA 5T33H 1C5BL 1G6VK 4MKTA 3OJDA 4U6TA 1IGCL 2BOCA 3ECQA 3NJVA 3GI9L 1A0QL 1UD3A 3CZUB 1BVLA 3BPLB 1R34A 1DUYB 1XAUA 2JTDA 4APXB 1MN4A 1AGFB 3DYOA 3QYMA 2R56H 2MWCA 1GIGL 4IBTA 1KCVH 1JYWA 4OLZH 3WFEL 4N90D 4F7PA 4ZS6C 4JRYE 2V8LA 4C83B 3FULA 1MREL 5GS1C 1SEBB 1LP9E 1WFJA 3N2JA 2HA1A 1P1ZA 3D06A 4UAHA 5IUSA 2CBPA 3RVVC 1ZLSL 3VQMA 3NZUA 2F54D 4MJID 4O2EB 2OK0L 2F74A 1ERNA 1PLAA 2PW1A 2HJLB 1O9VA 2YGPA 4I3GA 1AI1L 4PCYA 5AOIA 1EXUA 2YD4A 4N22A 5C6TL 1C16A 4MMXC 3UTTE 4OZFG 2HT4D 4JRXA 3MLVH 4O51B 2IPKB 1CGUA 2WINB 1CXKA 3TCLB 4UINL 3VD7A 4R5TA 4NNXB 1YMMD 3BYYA 5CZKA 2PF6A 4AH2A 2MPVA 1W2KT 2D3LA 2VTFA 4EQ3A 3QUKB 4TUOB 1C12B 3UTSE 1FZJA 3VCLB 2CD0A 2R4RH 3JWNE 3QS2A 2E9IA 1P7QA 1QKZH 4X4XA 4RAUB 4XB3A 4XXDA 3FMGL 2NY2D 4PGEA 5FHBL 4R4ND 3VB9A 5EIIG 2WW8A 4M7ZB 4HCRL 2C7UA 3DX6A 4OFQA 2B9BA 3BQUA 1CFSB 4F15C 3A67L 4JPQA 4DUXA 5K39B 3WKPA 4Z0BL 1HH9A 2VAJA 4O2FB 1PLCA 2WTOA 3VM5A 4BK4A 5I1KL 3DYPA 3WO4C 5SWQB 2YUXA 5JTWA 1OAQL 2E9JA 2EIMB 1CS6A 4FG2A 1Q9KB 4QTHB 1KB9K 3PHSA 3QBTB 4Z3FA 2R2CA 2DQGH 4N2GA 3CLWA 3SY6A 3GIVA 4IRSB 1MCPL 1PZSA 3T0EB 2X28A 3B4NA 3LMJH 2WKLA 3VTAA 1CLVA 4V11A 4ZFOB 3BO8A 1VCBC 4V2BA 4YE4H 1TNMA 4FLQA 1NCBL 5KW9H 1HL9A 1RIHH 3CC5A 3RRQA 2NSXA 4HSCX 4OFPA 3RIFF 5FUOH 4Q4EA 4OGXH 4Y19D 4M5YH 5I82A 4RNRA 5D7JA 1Q4NX 2ZXQA 4XE5B 4FQ1L 3FQTB 3BPLC 4KTGA 3CFCH 2F6AA 3EO0B 2ATPB 5FWRA 2F19L 3VWJB 4ODTH 3L3OA 4L5FL 3CSYB 4A67A 3M17A 1PKQA 1P7KB 1T20A 3OVUB 4M3HA 3EGDA 3L3IA 4M6OL 1D5IL 3SYAA 3FCTB 3M86A 2ICWA 3G08B 4G9FE 1MJJB 4M43L 3NQKA 4NQSA 4PHZA 2PWGA 4AV5A 3O6FB 6PCYA 3CGTA 1HHKB 2RQEA 1MRDH 4QXVA 5J7CC 1XB3A 4M3KB 4U3SB 2Y07L 5F9OL 4C4KT 5DD5L 1R24A 4OI7A 2X4SA 3OJMB 4PRDA 1ADWA 1HKLL 1MCHA 3WN6A 3QIWD 3WKYA 4BQ8A 3S0PA 2WWKT 4HC1H 2W0KA 4JR9L 3RUGE 3SDXE 4GKNA 1P4UA 2GW5A 5GS3A 1S7VB 1NDMA 2XPGA 4RFOL 2Q7AA 4J4PC 4U7KA 4CSTA 1DFXA 1XGYH 2V2WA 1R5WA 2FSDA 4WEUD 1ZHKA 5E08H 3QS3A 2OMUA 2WM0A 1NDTA 4ZRGA 4CADA 3PDOB 3GBNH 4AIZB 2D3VA 4KDVA 2YEQA 1T1XA 1RUPH 3UAAA 3IRPX 2MIZA 5LXGH 3ISRA 3QCVL 1MW3A 2DMGA 4HHAA 3D50A 5CR8A 1NGYB 1OGTA 3DX2A 3FO0H 4XBGB 5AAWC 5L9DL 4N2MA 1OSZA 3E8UL 1U33A 2NNAA 3A4FA 4FHKA 1FL6B 1JUFB 2LVCA 2LU3A 4AKOA 1DJIA 4LLMA 4PLOB 5TK4A 4Z95L 1HHIB 4KKQA 5EU6D 3VD4A 3TJEH 5IKCB 4IU3A 1R5VA 1QP1A 1DDTA 3TC9A 3KGRA 3HZVA 4F2MB 1PDKB 5GRUL 1S3KL 2EINB 3EJUA 4V2CB 3CFMA 1UXWB 3MNZB 3G5ZA 4NO2A 1F4WL 1PIGA 3HS0A 4EBQL 4JDVA 1XF3A 1CZ8L 5BRZA 2W1NA 1UOVA 4G82A 5ESVA 1X5GA 4OZGA 3BESR 1SLUA 3WE6A 2VDKL 3TZVC 3DK0A 3O6KL 3I9GL 3L95A 5BUAA 4IRSC 3EYFA 5IQOA 1TQUA 4XR8C 1G7HA 4K5OA 4MJIB 2XWRA 1XGUA 1HQ4A 4QGYA 4G8EA 3IFOA 3AADB 3AM8C 4Z7QE 5DDHB 5JHBA 1WZAA 4OF7A 2EUZA 2H8PB 2F53E 3UC0L 3QP3A 5GZOA 1S7TB 2MPAH 2XETA 3U4BH 4HBQA 1LEIB 5DS2A 4M1GH 4JHWL 4NLAA 3DGDA 4OZIF 2CQVA 4OF5A 3RTQC 3ZL2A 4S0HA 3IMVA 1DUZA 3PLYA 1YMMB 2O1AA 5A3ID 5EZOL 4NIKB 1NCWH 2X6UA 3EDFA 2GSMB 3JV6B 1AQ8A 4Y1SA 5L8KB 3BSHA 2NYZA 5SWSE 4PRPD 2J2ZA 1U8OB 3PIQA 5J6HA 4EI0A 2CR3A 1RZ8A 2CU9A 5FC9A 1IAKB 3KDPB 2Z1PA 4CBPA 2R9HD 4CC4A 5GRVK 4ALAC 4BA8A 4OF3A 5I66B 5SX5H 2NY2B 4A7TA 2EQDA 2AQSA 4JY4B 1QZ1A 2PCPB 2V0AA 3MRPA 2DWEB 2JKRM 3O6FC 4X99A 1E4XL 4MFHA 3ZDXB 4EUPA 1ZGLA 4NUPA 1KJMB 3MO1B 1QPXA 3KLHD 1FPTL 1BBDL 3O0RH 4Z0XB 1PG7W 1I9RL 1HEZA 4W93A 2JKTM 2HT3D 3QQDA 2R69L 2WMPA 5CJOL 4WJG3 2H0EA 3AG1B 5TDPA 1YEHH 5JW4R 5HDLA 5LGKA 1NL0L 3T2PA 3OMAB 4BSVA 4FQCL 2CDGA 4KHTL 4CNIB 3EJJX 3KPMB 1Z3RA 4HKBA 4IOSD 3FSOA 4BKTC 1TTRA 2XV3A 4JFDA 4QOKE 1A6VL 3TP4A 1A6PA 3VXRE 3TVMD 1UZ6F 3HG1A 2BSEA 1NGPH 3NSDA 1CD1A 1JE6A 1OGSA 2UY6A 3CHXA 4RMSA 4ZMNA 3HS9A 3CHRA 4Y19B 5A6MA 4P2OC 4N4YB 1HJCA 2YPVL 1QASA 5CJ8A 5JHLL 4TQEL 4AQZA 4HUMB 5J6GA 1E7VA 3IM1A 3E9UA 3B9EA 4OQTL 3VMNA 1PLBA 3FFOA 4P2QE 3VA6A 2C9SA 3H4HA 3WMPA 1XFPA 4P48A 4ZO9A 1B0IA 5E6RB 3ULVE 1DLHA 3B9KD 4I48B 5FFOA 4QTFA 3VVWA 5GISH 4XMPL 4UM9D 2ZCLL 5C9JA 1KGYE 4HH8A 4F8NA 5EOCL 4MNHB 2XXCB 2ZAGA 4MNGE 3R0NA 4MYPA 5FDWB 1A14H 4XP6L 5BVJB 2BNRA 4WKXA 2C3HA 1AGEB 4MASA 1AJ7L 3LRKA 3LS5L 4Q52A 4YJZL 2DQCL 2EP6A 3OHXB 4NRXB 3OAYH 1Z6JT 2WLLA 2H32H 4QKXB 3WXVH 4D9LH 1MPAL 3MXWH 2WLNA 4XP1L 5D6DC 3R8QA 1O5PA 3QIWB 1VHPA 5AVSB 4OLYL 3T0VA 1RZIA 3NQIA 5JXAH 2RA1A 4XHJC 3CFKA 2EIDA 5IREA 2IANA 1ORSA 2J73A 5I6NA 4APQA 5I17B 3CTTA 2X4RA 3B1UA 1KACB 4WRLA 3GSNL 5IFJA 1K9TA 2X1WL 4DEUA 3DJRA 2FR4B 3EJQA 5A7EA 4PJ7E 3JYCA 5JQIB 2MCPL 2ALWA 3FHQA 1VFBB 4I9WD 4XNAA 1BQHB 4CC0A 3US0A 4U6HB 3UJIH 3ZPDA 4GAGL 2YGVA 4G71B 1VF5C 4PGDA 1GSKA 4Q6IB 4EDWH 4YHZL 3HTLX 3H7BA 5AAMC 3MX0A 2YGNA 1OANA 4HV8B 2I9TA 1ETB1 2E3VA 4WWPA 3QWQB 4LOUC 1NGQH 4WW2B 1F3JB 3V4PA 4RISL 3CVHH 5I1LA 2W0FB 1YRKA 3BVTA 4JLRA 2B59A 3GXTA 4JO4H 3QUXD 3UZEA 3S88L 3GJFK 3EIFA 4NUJA 4WUUD 2DQ6A 2X09A 4X6CE 4YZFF 5EOQL 1KBGH 1C9SA 4J3WA 2DTML 2HG5A 4POYA 2HWZH 3U0WL 1XXFC 2V7NB 5C7ZA 4PJIE 5J1AB 4PHXA 2E6QA 3ZBMA 4ODBD 2P5EE 1X9QA 4MRCA 4W9GC 3WEBA 3BQVA 5L88L 1CD9B 1ZGLP 1GJUA 1T1ZA 1T0NB 3BLBA 4DGIL 5ADPH 4N1HB 3RIAF 3KWWA 1YDPA 4JY6B 4EXKA 2D7QA 2CBTA 3PNWA 1GZQB 1MQKL 4OCSH 4YHKL 1TO4A 4EOWH 2GJ6A 5EU3A 2XG4A 4GRLC 3DROA 4Z7VA 2WB7A 3RGBA 1B9ZA 1W6WA 4ZMLA 3IETB 1YVLA 5DQDH 5HVGB 3NBNA 1E50A 2Y5TA 3ZX1A 3BPOC 4LLYB 3V2AR 1OGAD 4LDLB 3BMVA 2W65B 4PVLA 5H2BB 4AIXA 4LFHG 3L16A 3EFOA 5KZCB 1A9EB 3PP3H 2QJDA 5HXMA 1HCZA 4PRID 5DJYB 4IMKC 1JGDA 4UT6L 5KVMC 3P0YH 5BJTB 1FNEA 4P5KB 1H3VA 3MLYH 3EBAA 3GMRB 3QAQA 3ARGA 4PCTA 3JWOL 1LEGB 4PRPB 5BS0A 4GW5B 4NQCD 3NJJA 5FB8B 1VAHA 5J8OA 1FFOB 1FQ9C 3QHZH 4XXWC 4B7IA 5FXCH 5M94B 1BHGA 4ICXA 1RJLB 5B3NA 4UTBA 1H15B 4N0UA 2HMIC 2DIBA 1XB8A 5B1JC 2LU5A 1QSEE 3T4YA 3AAZA 3W9DA 5CILH 2CIKB 3TN0A 5D96C 4JY5H 1WWBX 4A2HA 2XPZA 1W0WB 2D7MA 3K1KC 2ZUUA 3KXFD 5IOPB 2GPZA 3CHSA 5HY9A 5DC4B 1HU8A 2R7EB 3HRZC 4ALAH 5DTFB 5I2IA 4F57H 2BNUA 5CINH 5DD1L 4ODHH 1V7NH 3HAEH 3ZHNA 2VW7A 4B6ZA 1Z66A 4WGWB 4POUB 2QKIA 1ID2A 2X7LA 4Y2NA 3Q2CA 5CBAB 1IQWL 1UXMA 3CBRA 3AU0A 3TVMB 1DEDA 4P3CH 3HMWL 4KNUA 4NT6A 5CUSH 3ESNA 2ITDA 5MI0B 4ZQTA 4LCYB 3LNIA 3MLXH 1ZY9A 1VFUA 3P4MB 3P30H 4DN4L 3GSRA 1MCSA 4BCZA 2XN9E 4N2NA 3T08A 1PYWB 3FONB 5EF3A 3E6FA 1IEAA 4KK5C 4G7RB 3JTSA 1I1AD 2B1AL 4LU5L 1KXTA 1NUGA 3IDJB 3KYKH 2PTVA 1YNLL 4WK0B 3B9KB 4P9MH 3D30A 5EU7E 1BQKA 1QBBA 2MQCA 3I75B 1QR1B 5AKRA 2JJTC 1JGVL 4UM9B 2EH7L 2D0FA 1P5VB 1S7QB 3PWLB 5C0RL 4C4BA 2VABB 1R19A 4BZ1H 4Q2ZA 3X2QB 2WZ6A 5C71A 1SXNA 3OKDB 4PS3A 5F1SA 3LN4A 3W3BA 2GI7A 2DQMA 2AITA 3OX8B 2YQ2A 4TSBH 3Q5TA 3QUYB 1FZKB 1TVBB 2TAAA 3RLSA 4NWTL 2ZCKH 3LKSB 5TF0A 2WVSA 2R39A 1YUHB 3APFA 4HIXL 4P5TA 1A47A 3LXBA 4WI2A 4Z78A 1FCCA 5DRNA 5D93B 5GS1A 3KPLB 2EACA 1JHLL 1CI3M 4FG6D 3VXUA 2VE6B 4IK7A 4UIMA 2GTWA 2VLKE 5I28A 4HUKB 4XPFL 2C26A 2BSRB 4DZ8A 3BUTA 5L4IA 3BH8A 1QAWA 2J6EH 1RFDL 5TE4H 2CUAA 2XI9A 3D8MA 4FNPA 1BQLL 1INDH 2P8LB 4ZPTA 1MELA 2CHZA 1FGNH 4ENED 3SYQA 2YRBA 3FB6B 2AZAA 3PGDA 1MJUL 4TUKL 5FKPB 3TBYB 2ILLA 3T0DA 2FNWA 3NCJL 2EO1A 2BP0B 4M29A 4KGLA 5E2WH 3LPFA 1BX2A 5EV7A 5D7SL 1H6TA 3QNXB 3QUXB 3RX7A 2XQYG 4DWHA 3QW9A 5FV1L 4WUUB 1XCXA 4M61B 3SE9H 5LBSH 2FEJA 2IWKA 2QQLH 4P0DA 3AREC 2Z92A 2WKOA 3HLAB 4YHLH 4ZUTB 3ZT5A 2FJGA 3D6GA 4GG8A 2JSFA 4KOCA 1LQSR 3QUZD 3M07A 15C8L 5F88A 4F7KA 2Q3AA 3VI3E 4LCUB 4YO0A 4JGMA 1SYVA 3K6NA 3HCVB 3HKZA 3L3HA 1X4YA 3DJZA 3F7PC 3RGVD 4G70B 5EZIL 4Y2DA 3KPPA <