4EIEA

Crystal structure of cytochrome c6c from synechococcus sp. pcc 7002
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
DQGAQIFEAHCAGCHLNGGNIVRRGKNLKKRAMAKNGYTSVEAIANLVTQGKGNMSAYGDKLSSEEIQAVSQYVLQQSQTDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c6
publication title Cytochrome c6 and c6C from Synechococcus sp. PCC 7002 - structure and function.
rcsb
source organism Synechococcus sp.
molecule tags Electron transport
total genus 25
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2012-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4eieA00
4FA9A 1KV9A 1NTKD 2LITA 1WEJF 2QJYB 2AIUA 2ZZS1 3L74D 1DVHA 1L0LD 2BH4X 1IRWA 1WVEC 3H1LD 1YICA 5CIEB 1GJQA 2DVHA 1HZVA 4PJ0V 1C6SA 1B7VA 1ETPA 2BH5X 4LJIA 1NTMD 4WQ9A 1QL4A 3X39A 4EIFA 1CEDA 2VHDA 1DW0A 5B5EV 1GIWA 2N3YA 1LS9A 1M70A 2ZXYA 1CSVA 1FI7A 2CE1A 2MTAC 2C1DA 1MG3D 2B10B 3A9FA 1RZ6A 1HJ5A 3SXTA 3ZBMA 2MHMA 4P4QB 1SQVD 1CHJA 1SQPD 2JTIB 2L4DA 4YE1A 2C1DB 3L70D 3CYTI 3HQ9A 3HQ8A 3WFCC 3DR0A 2N3BA 1W2LA 1AOFA 1PPJD 1RAQA 1LFMA 1I6EA 2C9XB 1HCMA 4NFGB 1N90A 3WC8A 2FYNB 1CXAA 3HQ6A 1L9JC 1VYDA 3VNWA 5DFSA 1NMLA 4AAMA 2CXBA 2YK3A 1F1CA 3VRDA 1CRGA 1AOQA 1FJ0A 4GYDA 3CXHW 3OA8A 3PH2B 3L73D 3SWSA 4Y5RA 1M6ZA 4AALA 4RSZA 1S5LV 1H9XA 1E29A 2GC4D 1YNRA 3OA8B 3C2CA 1C52A 4MU8A 4WQEA 1BE3D 1NU1D 1A56A 4H0KA 1C6RA 4V2KA 3VYMA 1C75A 1YIQA 2EXVA 1NMIA 1EZVD 4UB8V 5TISV 1I5TA 1CSXA 4AANA 3CX5W 1I54A 3SJLA 1QKSA 3NWVA 4EICA 1AKKA 2DGEA 5DJQC 4UB6V 3MK7C 2N9JA 1CIFA 5KAFV 2A06D 3NBTA 4PD4D 2I8FA 1CYJA 4FA1A 2FWLA 1CHIA 1U74B 2LIRA 1FHBA 1CSUA 1SQQD 1N50A 2QJKB 4KMGA 2GB8B 1CTZA 3JBTB 4GEDB 4O1WA 4XXLA 1CCRA 1E2RA 2IBZD 1R0QA 2ORLA 3PXWA 4WQCA 2D0SA 1YEAA 1GKSA 2YCCA 5E79V 1CHHA 5DF5A 1YEBA 1EB7A 1F1FA 5EXQA 5B6QA 155CA 1H33A 3ZIYA 2PACA 1RAPA 2FYUD 1HROA 2GIWA 2B4ZA 3TGUD 2GC7D 1N15A 1HRCA 1IO3A 1GDVA 4Q5PA 4WQBA 1H33B 3L72D 4PW9B 3RMZA 5CYTR 2C1VA 4N0KA 5DJQB 1ZRTD 1H31A 1HJ3A 1NIRA 3MK7B 2C8SA 2N9IA 5CIFB 1W5CT 2CA4B 3ZCFA 4EIEA 1CNOA 3CP5A 4XYDB 1NNOA 1H31B 1BCCD 1FI9A 1CO6A 5AURA 1CIGA 5B66V 3ORVA 1J3SA 3NBSA 1YCCA 3WUIA 3PXTA 4WQAA 3O20A 1BL9A 1M60A 2BCNB 2OZ1A 1U75B 1L0ND 3BCCD 3CXHD 4AX3A 3H1ID 2B12B 4AAOA 1QN2A 2C2CA 2FRCA 1IZL0 2B11B 1K3GA 2D0WA 5H2FV 1FCDC 1RZ5A 1CIEA 5CIDB 1CSWA 1S6VB 1MZ4A 4L1QA 3L4MA 5KLIB 3H1JD 1P84D 1KB9D 3M97X 1CC5A 1CRJA 1MG2D 1DVVA 3DP5A 1LC2A 1A2SA 2XTSB 4JCGA 3CX5D 1FI3A 1CIHA 351CA 1I8OA 2CE0A 3A0HV 4WQDA 1CYCA 2PCBB 3CU4A 3PXSA 1CRHA 2N18C 3RLMA 3L71D 4DY9A 3WU2V 4FANA 3RN1A 5KAIV 4U3FD 3O5CA 1IQCA 1LMSA 1I55A 1AYGA 2BCCD 3SLEA 1H9YA 1DT1A 2V08A 1QYZA 4O1QA 1NTZD 2C1UA 4EIDA 1LC1A 1N9CA 1JDLA 1C6OA 5GTIV 5CICB 1E8EA 1HH7A 5C9MA 5CIHB 3A0BV 1KYOW 1L9BC 1C7MA 2PCCB 1KX7A 4WQ8A 2BGVX 3WFDC 2ZONG 1CRCA 1HZUA 1H1OA 2V07A 1CXCA 4WQ7A 3L4OA 1I6DA 5GTHV 1CCHA 1OAEA 2ZBOA 1CRIA 2YQBA 2BLFB 3ZOOA 4K3IA 3OCDA 3O1YA 451CA 5CIGB 2AI5A 1KYOD 2ZOOA 1I8PA 3RN0A 1K3HA 1DW3A 1GQ1A 3OCDB 1KB0A 3CWBD 4L3GA 3O0RC 4H0JA 3L75D 2N18B 1DW1A 3WFEC 1CTYA 3KZIV 2JQRA 2AXTV 4QAOA 1YTCA 3TYIA 4FA5A 2YIUB 1SQBD 1OCDA 3H1KD 1SQXD 4PWAA 1BGYD 5IY51 1CORA 2CA3B 1KX2A 1CTJA 1HJ4A 1CYIA 1DIIC 3H1HD 5CIBB 1FOCA 1DW2A 2OZ1B 3ZOYA 5C0ZA 4FAVA 1C2NA 5KKZB 4FB1A 3ZOXA 4FA4A 1IRVA 3SVWA 2B0ZB 2BPBB 1H32A 2QJPB 1COTA 4J20A 5KLVD 1DIQC 3WFBC 1QL3A 1CRYA 1ZZHA 1A8CA 4D6TD 1H32B 1PP9D 4IL6V 1C2RA 3ZOWA 1GU2A 1KIBA 3HQ7A 2HV4A 1YFCA 4L3HA 3DMIA
chains in the Genus database with same CATH superfamily
4FA9A 1KV9A 1NTKD 2LITA 1WEJF 2QJYB 2AIUA 2ZZS1 3L74D 1DVHA 1L0LD 2BH4X 1IRWA 1WVEC 3H1LD 1YICA 5CIEB 1GJQA 2DVHA 1HZVA 4PJ0V 1C6SA 1B7VA 1ETPA 2BH5X 4LJIA 1NTMD 4WQ9A 1QL4A 3X39A 4EIFA 1CEDA 2VHDA 1DW0A 5B5EV 1GIWA 2N3YA 1LS9A 1M70A 2ZXYA 1CSVA 1FI7A 2CE1A 2MTAC 2C1DA 1MG3D 2B10B 3A9FA 1RZ6A 1HJ5A 3SXTA 3ZBMA 2MHMA 4P4QB 1SQVD 1CHJA 1SQPD 2JTIB 2L4DA 4YE1A 2C1DB 3L70D 3CYTI 3HQ9A 3HQ8A 3WFCC 3DR0A 2N3BA 1W2LA 1AOFA 1PPJD 1RAQA 1LFMA 1I6EA 2C9XB 1HCMA 4NFGB 1N90A 3WC8A 2FYNB 1CXAA 3HQ6A 1L9JC 1VYDA 3VNWA 5DFSA 1NMLA 4AAMA 2CXBA 2YK3A 1F1CA 3VRDA 1CRGA 1AOQA 1FJ0A 4GYDA 3CXHW 3OA8A 3PH2B 3L73D 3SWSA 4Y5RA 1M6ZA 4AALA 4RSZA 1S5LV 1H9XA 1E29A 2GC4D 1YNRA 3OA8B 3C2CA 1C52A 4MU8A 4WQEA 1BE3D 1NU1D 1A56A 4H0KA 1C6RA 4V2KA 3VYMA 1C75A 1YIQA 2EXVA 1NMIA 1EZVD 4UB8V 5TISV 1I5TA 1CSXA 4AANA 3CX5W 1I54A 3SJLA 1QKSA 3NWVA 4EICA 1AKKA 2DGEA 5DJQC 4UB6V 3MK7C 2N9JA 1CIFA 5KAFV 2A06D 3NBTA 4PD4D 2I8FA 1CYJA 4FA1A 2FWLA 1CHIA 1U74B 2LIRA 1FHBA 1CSUA 1SQQD 1N50A 2QJKB 4KMGA 2GB8B 1CTZA 3JBTB 4GEDB 4O1WA 4XXLA 1CCRA 1E2RA 2IBZD 1R0QA 2ORLA 3PXWA 4WQCA 2D0SA 1YEAA 1GKSA 2YCCA 5E79V 1CHHA 5DF5A 1YEBA 1EB7A 1F1FA 5EXQA 5B6QA 155CA 1H33A 3ZIYA 2PACA 1RAPA 2FYUD 1HROA 2GIWA 2B4ZA 3TGUD 2GC7D 1N15A 1HRCA 1IO3A 1GDVA 4Q5PA 4WQBA 1H33B 3L72D 4PW9B 3RMZA 5CYTR 2C1VA 4N0KA 5DJQB 1ZRTD 1H31A 1HJ3A 1NIRA 3MK7B 2C8SA 2N9IA 5CIFB 1W5CT 2CA4B 3ZCFA 4EIEA 1CNOA 3CP5A 4XYDB 1NNOA 1H31B 1BCCD 1FI9A 1CO6A 5AURA 1CIGA 5B66V 3ORVA 1J3SA 3NBSA 1YCCA 3WUIA 3PXTA 4WQAA 3O20A 1BL9A 1M60A 2BCNB 2OZ1A 1U75B 1L0ND 3BCCD 3CXHD 4AX3A 3H1ID 2B12B 4AAOA 1QN2A 2C2CA 2FRCA 1IZL0 2B11B 1K3GA 2D0WA 5H2FV 1FCDC 1RZ5A 1CIEA 5CIDB 1CSWA 1S6VB 1MZ4A 4L1QA 3L4MA 5KLIB 3H1JD 1P84D 1KB9D 3M97X 1CC5A 1CRJA 1MG2D 1DVVA 3DP5A 1LC2A 1A2SA 2XTSB 4JCGA 3CX5D 1FI3A 1CIHA 351CA 1I8OA 2CE0A 3A0HV 4WQDA 1CYCA 2PCBB 3CU4A 3PXSA 1CRHA 2N18C 3RLMA 3L71D 4DY9A 3WU2V 4FANA 3RN1A 5KAIV 4U3FD 3O5CA 1IQCA 1LMSA 1I55A 1AYGA 2BCCD 3SLEA 1H9YA 1DT1A 2V08A 1QYZA 4O1QA 1NTZD 2C1UA 4EIDA 1LC1A 1N9CA 1JDLA 1C6OA 5GTIV 5CICB 1E8EA 1HH7A 5C9MA 5CIHB 3A0BV 1KYOW 1L9BC 1C7MA 2PCCB 1KX7A 4WQ8A 2BGVX 3WFDC 2ZONG 1CRCA 1HZUA 1H1OA 2V07A 1CXCA 4WQ7A 3L4OA 1I6DA 5GTHV 1CCHA 1OAEA 2ZBOA 1CRIA 2YQBA 2BLFB 3ZOOA 4K3IA 3OCDA 3O1YA 451CA 5CIGB 2AI5A 1KYOD 2ZOOA 1I8PA 3RN0A 1K3HA 1DW3A 1GQ1A 3OCDB 1KB0A 3CWBD 4L3GA 3O0RC 4H0JA 3L75D 2N18B 1DW1A 3WFEC 1CTYA 3KZIV 2JQRA 2AXTV 4QAOA 1YTCA 3D0WA 3TYIA 2YIUB 1SQBD 4FA5A 1OCDA 3H1KD 1SQXD 4PWAA 1BGYD 5IY51 1CORA 2CA3B 1KX2A 1CTJA 1HJ4A 1CYIA 1DIIC 3H1HD 5CIBB 1FOCA 1DW2A 2OZ1B 3ZOYA 5C0ZA 4FAVA 1C2NA 5KKZB 4FB1A 3ZOXA 4FA4A 1IRVA 3SVWA 2B0ZB 2BPBB 1H32A 2QJPB 1COTA 4J20A 5KLVD 1DIQC 3WFBC 1QL3A 1CRYA 1ZZHA 1A8CA 4D6TD 1H32B 1PP9D 4IL6V 1C2RA 3ZOWA 1GU2A 1KIBA 3HQ7A 2HV4A 1YFCA 4L3HA 3DMIA
chains in the Genus database with same CATH topology
4FA9A 1KV9A 1NTKD 2LITA 1WEJF 2QJYB 2AIUA 2ZZS1 3L74D 1DVHA 1L0LD 2BH4X 1IRWA 1WVEC 3H1LD 1YICA 5CIEB 1GJQA 2DVHA 1HZVA 4PJ0V 1C6SA 1B7VA 1ETPA 2BH5X 4LJIA 1NTMD 4WQ9A 1QL4A 3X39A 4EIFA 1CEDA 2VHDA 1DW0A 5B5EV 1GIWA 2N3YA 1LS9A 1M70A 2ZXYA 1CSVA 1FI7A 2CE1A 2MTAC 2C1DA 1MG3D 2B10B 3A9FA 1RZ6A 1HJ5A 3SXTA 3ZBMA 2MHMA 4P4QB 1SQVD 1CHJA 1SQPD 2JTIB 2L4DA 4YE1A 2C1DB 3L70D 3CYTI 3HQ9A 3HQ8A 3WFCC 3DR0A 2N3BA 1W2LA 1AOFA 1PPJD 1RAQA 1LFMA 1I6EA 2C9XB 1HCMA 4NFGB 1N90A 3WC8A 2FYNB 1CXAA 3HQ6A 1L9JC 1VYDA 3VNWA 5DFSA 1NMLA 4AAMA 2CXBA 2YK3A 1F1CA 3VRDA 1CRGA 1AOQA 1FJ0A 4GYDA 3CXHW 3OA8A 3PH2B 3L73D 3SWSA 4Y5RA 1M6ZA 4AALA 4RSZA 1S5LV 1H9XA 1E29A 2GC4D 1YNRA 3OA8B 3C2CA 1C52A 4MU8A 4WQEA 1BE3D 1NU1D 1A56A 4H0KA 1C6RA 4V2KA 3VYMA 1C75A 1YIQA 2EXVA 1NMIA 1EZVD 4UB8V 5TISV 1I5TA 1CSXA 4AANA 3CX5W 1I54A 3SJLA 1QKSA 3NWVA 4EICA 1AKKA 2DGEA 5DJQC 4UB6V 3MK7C 2N9JA 1CIFA 5KAFV 2A06D 3NBTA 4PD4D 2I8FA 1CYJA 4FA1A 2FWLA 1CHIA 1U74B 2LIRA 1FHBA 1CSUA 1SQQD 1N50A 2QJKB 4KMGA 2GB8B 1CTZA 3JBTB 4GEDB 4O1WA 4XXLA 1CCRA 1E2RA 2IBZD 1R0QA 2ORLA 3PXWA 4WQCA 2D0SA 1YEAA 1GKSA 2YCCA 5E79V 1CHHA 5DF5A 1YEBA 1EB7A 1F1FA 5EXQA 5B6QA 155CA 1H33A 3ZIYA 2PACA 1RAPA 2FYUD 1HROA 2GIWA 2B4ZA 3TGUD 2GC7D 1N15A 1HRCA 1IO3A 1GDVA 4Q5PA 4WQBA 1H33B 3L72D 4PW9B 3RMZA 5CYTR 2C1VA 4N0KA 5DJQB 1ZRTD 1H31A 1HJ3A 1NIRA 3MK7B 2C8SA 2N9IA 5CIFB 1W5CT 2CA4B 3ZCFA 4EIEA 1CNOA 3CP5A 4XYDB 1NNOA 1H31B 1BCCD 1FI9A 1CO6A 5AURA 1CIGA 5B66V 3ORVA 1J3SA 3NBSA 1YCCA 3WUIA 3PXTA 4WQAA 3O20A 1BL9A 1M60A 2BCNB 2OZ1A 1U75B 1L0ND 3BCCD 3CXHD 4AX3A 3H1ID 2B12B 4AAOA 1QN2A 2C2CA 2FRCA 1IZL0 2B11B 1K3GA 2D0WA 5H2FV 1FCDC 1RZ5A 1CIEA 5CIDB 1CSWA 1S6VB 1MZ4A 4L1QA 3L4MA 5KLIB 3H1JD 1P84D 1KB9D 3M97X 1CC5A 1CRJA 1MG2D 1DVVA 3DP5A 1LC2A 1A2SA 2XTSB 4JCGA 3CX5D 1FI3A 1CIHA 351CA 1I8OA 2CE0A 3A0HV 4WQDA 1CYCA 2PCBB 3CU4A 3PXSA 1CRHA 2N18C 3RLMA 3L71D 4DY9A 3WU2V 4FANA 3RN1A 5KAIV 4U3FD 3O5CA 1IQCA 1LMSA 1I55A 1AYGA 2BCCD 3SLEA 1H9YA 1DT1A 2V08A 1QYZA 4O1QA 1NTZD 2C1UA 4EIDA 1LC1A 1N9CA 1JDLA 1C6OA 5GTIV 5CICB 1E8EA 1HH7A 5C9MA 5CIHB 3A0BV 1KYOW 1L9BC 1C7MA 2PCCB 1KX7A 4WQ8A 2BGVX 3WFDC 2ZONG 1CRCA 1HZUA 1H1OA 2V07A 1CXCA 4WQ7A 3L4OA 1I6DA 5GTHV 1CCHA 1OAEA 2ZBOA 1CRIA 2YQBA 2BLFB 3ZOOA 4K3IA 3OCDA 3O1YA 451CA 5CIGB 2AI5A 1KYOD 2ZOOA 1I8PA 3RN0A 1K3HA 1DW3A 1GQ1A 3OCDB 1KB0A 3CWBD 4L3GA 3O0RC 4H0JA 3L75D 2N18B 1DW1A 3WFEC 1CTYA 3KZIV 2JQRA 2AXTV 4QAOA 1YTCA 3TYIA 4FA5A 2YIUB 1SQBD 1OCDA 3H1KD 1SQXD 4PWAA 1BGYD 5IY51 1CORA 2CA3B 1KX2A 1CTJA 1HJ4A 1CYIA 1DIIC 3H1HD 5CIBB 1FOCA 1DW2A 2OZ1B 3ZOYA 5C0ZA 4FAVA 1C2NA 5KKZB 4FB1A 3ZOXA 4FA4A 1IRVA 3SVWA 2B0ZB 2BPBB 1H32A 2QJPB 1COTA 4J20A 5KLVD 1DIQC 3WFBC 1QL3A 1CRYA 1ZZHA 1A8CA 4D6TD 1H32B 1PP9D 4IL6V 1C2RA 3ZOWA 1GU2A 1KIBA 3HQ7A 2HV4A 1YFCA 4L3HA 3DMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA9 A;  1KV9 A;  1NTK D;  2LIT A;  1WEJ F;  2QJY B;  2AIU A;  2ZZS 1;  3L74 D;  1DVH A;  1L0L D;  2BH4 X;  1IRW A;  1WVE C;  3H1L D;  1YIC A;  5CIE B;  1GJQ A;  2DVH A;  1HZV A;  4PJ0 V;  1C6S A;  1B7V A;  1ETP A;  2BH5 X;  4LJI A;  1NTM D;  4WQ9 A;  1QL4 A;  3X39 A;  4EIF A;  1CED A;  2VHD A;  1DW0 A;  5B5E V;  1GIW A;  2N3Y A;  1LS9 A;  1M70 A;  2ZXY A;  1CSV A;  1FI7 A;  2CE1 A;  2MTA C;  2C1D A;  1MG3 D;  2B10 B;  3A9F A;  1RZ6 A;  1HJ5 A;  3SXT A;  3ZBM A;  2MHM A;  4P4Q B;  1SQV D;  1CHJ A;  1SQP D;  2JTI B;  2L4D A;  4YE1 A;  2C1D B;  3L70 D;  3CYT I;  3HQ9 A;  3HQ8 A;  3WFC C;  3DR0 A;  2N3B A;  1W2L A;  1AOF A;  1PPJ D;  1RAQ A;  1LFM A;  1I6E A;  2C9X B;  1HCM A;  4NFG B;  1N90 A;  3WC8 A;  2FYN B;  1CXA A;  3HQ6 A;  1L9J C;  1VYD A;  3VNW A;  5DFS A;  1NML A;  4AAM A;  2CXB A;  2YK3 A;  1F1C A;  3VRD A;  1CRG A;  1AOQ A;  1FJ0 A;  4GYD A;  3CXH W;  3OA8 A;  3PH2 B;  3L73 D;  3SWS A;  4Y5R A;  1M6Z A;  4AAL A;  4RSZ A;  1S5L V;  1H9X A;  1E29 A;  2GC4 D;  1YNR A;  3OA8 B;  3C2C A;  1C52 A;  4MU8 A;  4WQE A;  1BE3 D;  1NU1 D;  1A56 A;  4H0K A;  1C6R A;  4V2K A;  3VYM A;  1C75 A;  1YIQ A;  2EXV A;  1NMI A;  1EZV D;  4UB8 V;  5TIS V;  1I5T A;  1CSX A;  4AAN A;  3CX5 W;  1I54 A;  3SJL A;  1QKS A;  3NWV A;  4EIC A;  1AKK A;  2DGE A;  5DJQ C;  4UB6 V;  3MK7 C;  2N9J A;  1CIF A;  5KAF V;  2A06 D;  3NBT A;  4PD4 D;  2I8F A;  1CYJ A;  4FA1 A;  2FWL A;  1CHI A;  1U74 B;  2LIR A;  1FHB A;  1CSU A;  1SQQ D;  1N50 A;  2QJK B;  4KMG A;  2GB8 B;  1CTZ A;  3JBT B;  4GED B;  4O1W A;  4XXL A;  1CCR A;  1E2R A;  2IBZ D;  1R0Q A;  2ORL A;  3PXW A;  4WQC A;  2D0S A;  1YEA A;  1GKS A;  2YCC A;  5E79 V;  1CHH A;  5DF5 A;  1YEB A;  1EB7 A;  1F1F A;  5EXQ A;  5B6Q A;  155C A;  1H33 A;  3ZIY A;  2PAC A;  1RAP A;  2FYU D;  1HRO A;  2GIW A;  2B4Z A;  3TGU D;  2GC7 D;  1N15 A;  1HRC A;  1IO3 A;  1GDV A;  4Q5P A;  4WQB A;  1H33 B;  3L72 D;  4PW9 B;  3RMZ A;  5CYT R;  2C1V A;  4N0K A;  5DJQ B;  1ZRT D;  1H31 A;  1HJ3 A;  1NIR A;  3MK7 B;  2C8S A;  2N9I A;  5CIF B;  1W5C T;  2CA4 B;  3ZCF A;  4EIE A;  1CNO A;  3CP5 A;  4XYD B;  1NNO A;  1H31 B;  1BCC D;  1FI9 A;  1CO6 A;  5AUR A;  1CIG A;  5B66 V;  3ORV A;  1J3S A;  3NBS A;  1YCC A;  3WUI A;  3PXT A;  4WQA A;  3O20 A;  1BL9 A;  1M60 A;  2BCN B;  2OZ1 A;  1U75 B;  1L0N D;  3BCC D;  3CXH D;  4AX3 A;  3H1I D;  2B12 B;  4AAO A;  1QN2 A;  2C2C A;  2FRC A;  1IZL 0;  2B11 B;  1K3G A;  2D0W A;  5H2F V;  1FCD C;  1RZ5 A;  1CIE A;  5CID B;  1CSW A;  1S6V B;  1MZ4 A;  4L1Q A;  3L4M A;  5KLI B;  3H1J D;  1P84 D;  1KB9 D;  3M97 X;  1CC5 A;  1CRJ A;  1MG2 D;  1DVV A;  3DP5 A;  1LC2 A;  1A2S A;  2XTS B;  4JCG A;  3CX5 D;  1FI3 A;  1CIH A;  351C A;  1I8O A;  2CE0 A;  3A0H V;  4WQD A;  1CYC A;  2PCB B;  3CU4 A;  3PXS A;  1CRH A;  2N18 C;  3RLM A;  3L71 D;  4DY9 A;  3WU2 V;  4FAN A;  3RN1 A;  5KAI V;  4U3F D;  3O5C A;  1IQC A;  1LMS A;  1I55 A;  1AYG A;  2BCC D;  3SLE A;  1H9Y A;  1DT1 A;  2V08 A;  1QYZ A;  4O1Q A;  1NTZ D;  2C1U A;  4EID A;  1LC1 A;  1N9C A;  1JDL A;  1C6O A;  5GTI V;  5CIC B;  1E8E A;  1HH7 A;  5C9M A;  5CIH B;  3A0B V;  1KYO W;  1L9B C;  1C7M A;  2PCC B;  1KX7 A;  4WQ8 A;  2BGV X;  3WFD C;  2ZON G;  1CRC A;  1HZU A;  1H1O A;  2V07 A;  1CXC A;  4WQ7 A;  3L4O A;  1I6D A;  5GTH V;  1CCH A;  1OAE A;  2ZBO A;  1CRI A;  2YQB A;  2BLF B;  3ZOO A;  4K3I A;  3OCD A;  3O1Y A;  451C A;  5CIG B;  2AI5 A;  1KYO D;  2ZOO A;  1I8P A;  3RN0 A;  1K3H A;  1DW3 A;  1GQ1 A;  3OCD B;  1KB0 A;  3CWB D;  4L3G A;  3O0R C;  4H0J A;  3L75 D;  2N18 B;  1DW1 A;  3WFE C;  1CTY A;  3KZI V;  2JQR A;  2AXT V;  4QAO A;  1YTC A;  3TYI A;  4FA5 A;  2YIU B;  1SQB D;  1OCD A;  3H1K D;  1SQX D;  4PWA A;  1BGY D;  5IY5 1;  1COR A;  2CA3 B;  1KX2 A;  1CTJ A;  1HJ4 A;  1CYI A;  1DII C;  3H1H D;  5CIB B;  1FOC A;  1DW2 A;  2OZ1 B;  3ZOY A;  5C0Z A;  4FAV A;  1C2N A;  5KKZ B;  4FB1 A;  3ZOX A;  4FA4 A;  1IRV A;  3SVW A;  2B0Z B;  2BPB B;  1H32 A;  2QJP B;  1COT A;  4J20 A;  5KLV D;  1DIQ C;  3WFB C;  1QL3 A;  1CRY A;  1ZZH A;  1A8C A;  4D6T D;  1H32 B;  1PP9 D;  4IL6 V;  1C2R A;  3ZOW A;  1GU2 A;  1KIB A;  3HQ7 A;  2HV4 A;  1YFC A;  4L3H A;  3DMI A; 
#chains in the Genus database with same CATH topology
 4FA9 A;  1KV9 A;  1NTK D;  2LIT A;  1WEJ F;  2QJY B;  2AIU A;  2ZZS 1;  3L74 D;  1DVH A;  1L0L D;  2BH4 X;  1IRW A;  1WVE C;  3H1L D;  1YIC A;  5CIE B;  1GJQ A;  2DVH A;  1HZV A;  4PJ0 V;  1C6S A;  1B7V A;  1ETP A;  2BH5 X;  4LJI A;  1NTM D;  4WQ9 A;  1QL4 A;  3X39 A;  4EIF A;  1CED A;  2VHD A;  1DW0 A;  5B5E V;  1GIW A;  2N3Y A;  1LS9 A;  1M70 A;  2ZXY A;  1CSV A;  1FI7 A;  2CE1 A;  2MTA C;  2C1D A;  1MG3 D;  2B10 B;  3A9F A;  1RZ6 A;  1HJ5 A;  3SXT A;  3ZBM A;  2MHM A;  4P4Q B;  1SQV D;  1CHJ A;  1SQP D;  2JTI B;  2L4D A;  4YE1 A;  2C1D B;  3L70 D;  3CYT I;  3HQ9 A;  3HQ8 A;  3WFC C;  3DR0 A;  2N3B A;  1W2L A;  1AOF A;  1PPJ D;  1RAQ A;  1LFM A;  1I6E A;  2C9X B;  1HCM A;  4NFG B;  1N90 A;  3WC8 A;  2FYN B;  1CXA A;  3HQ6 A;  1L9J C;  1VYD A;  3VNW A;  5DFS A;  1NML A;  4AAM A;  2CXB A;  2YK3 A;  1F1C A;  3VRD A;  1CRG A;  1AOQ A;  1FJ0 A;  4GYD A;  3CXH W;  3OA8 A;  3PH2 B;  3L73 D;  3SWS A;  4Y5R A;  1M6Z A;  4AAL A;  4RSZ A;  1S5L V;  1H9X A;  1E29 A;  2GC4 D;  1YNR A;  3OA8 B;  3C2C A;  1C52 A;  4MU8 A;  4WQE A;  1BE3 D;  1NU1 D;  1A56 A;  4H0K A;  1C6R A;  4V2K A;  3VYM A;  1C75 A;  1YIQ A;  2EXV A;  1NMI A;  1EZV D;  4UB8 V;  5TIS V;  1I5T A;  1CSX A;  4AAN A;  3CX5 W;  1I54 A;  3SJL A;  1QKS A;  3NWV A;  4EIC A;  1AKK A;  2DGE A;  5DJQ C;  4UB6 V;  3MK7 C;  2N9J A;  1CIF A;  5KAF V;  2A06 D;  3NBT A;  4PD4 D;  2I8F A;  1CYJ A;  4FA1 A;  2FWL A;  1CHI A;  1U74 B;  2LIR A;  1FHB A;  1CSU A;  1SQQ D;  1N50 A;  2QJK B;  4KMG A;  2GB8 B;  1CTZ A;  3JBT B;  4GED B;  4O1W A;  4XXL A;  1CCR A;  1E2R A;  2IBZ D;  1R0Q A;  2ORL A;  3PXW A;  4WQC A;  2D0S A;  1YEA A;  1GKS A;  2YCC A;  5E79 V;  1CHH A;  5DF5 A;  1YEB A;  1EB7 A;  1F1F A;  5EXQ A;  5B6Q A;  155C A;  1H33 A;  3ZIY A;  2PAC A;  1RAP A;  2FYU D;  1HRO A;  2GIW A;  2B4Z A;  3TGU D;  2GC7 D;  1N15 A;  1HRC A;  1IO3 A;  1GDV A;  4Q5P A;  4WQB A;  1H33 B;  3L72 D;  4PW9 B;  3RMZ A;  5CYT R;  2C1V A;  4N0K A;  5DJQ B;  1ZRT D;  1H31 A;  1HJ3 A;  1NIR A;  3MK7 B;  2C8S A;  2N9I A;  5CIF B;  1W5C T;  2CA4 B;  3ZCF A;  4EIE A;  1CNO A;  3CP5 A;  4XYD B;  1NNO A;  1H31 B;  1BCC D;  1FI9 A;  1CO6 A;  5AUR A;  1CIG A;  5B66 V;  3ORV A;  1J3S A;  3NBS A;  1YCC A;  3WUI A;  3PXT A;  4WQA A;  3O20 A;  1BL9 A;  1M60 A;  2BCN B;  2OZ1 A;  1U75 B;  1L0N D;  3BCC D;  3CXH D;  4AX3 A;  3H1I D;  2B12 B;  4AAO A;  1QN2 A;  2C2C A;  2FRC A;  1IZL 0;  2B11 B;  1K3G A;  2D0W A;  5H2F V;  1FCD C;  1RZ5 A;  1CIE A;  5CID B;  1CSW A;  1S6V B;  1MZ4 A;  4L1Q A;  3L4M A;  5KLI B;  3H1J D;  1P84 D;  1KB9 D;  3M97 X;  1CC5 A;  1CRJ A;  1MG2 D;  1DVV A;  3DP5 A;  1LC2 A;  1A2S A;  2XTS B;  4JCG A;  3CX5 D;  1FI3 A;  1CIH A;  351C A;  1I8O A;  2CE0 A;  3A0H V;  4WQD A;  1CYC A;  2PCB B;  3CU4 A;  3PXS A;  1CRH A;  2N18 C;  3RLM A;  3L71 D;  4DY9 A;  3WU2 V;  4FAN A;  3RN1 A;  5KAI V;  4U3F D;  3O5C A;  1IQC A;  1LMS A;  1I55 A;  1AYG A;  2BCC D;  3SLE A;  1H9Y A;  1DT1 A;  2V08 A;  1QYZ A;  4O1Q A;  1NTZ D;  2C1U A;  4EID A;  1LC1 A;  1N9C A;  1JDL A;  1C6O A;  5GTI V;  5CIC B;  1E8E A;  1HH7 A;  5C9M A;  5CIH B;  3A0B V;  1KYO W;  1L9B C;  1C7M A;  2PCC B;  1KX7 A;  4WQ8 A;  2BGV X;  3WFD C;  2ZON G;  1CRC A;  1HZU A;  1H1O A;  2V07 A;  1CXC A;  4WQ7 A;  3L4O A;  1I6D A;  5GTH V;  1CCH A;  1OAE A;  2ZBO A;  1CRI A;  2YQB A;  2BLF B;  3ZOO A;  4K3I A;  3OCD A;  3O1Y A;  451C A;  5CIG B;  2AI5 A;  1KYO D;  2ZOO A;  1I8P A;  3RN0 A;  1K3H A;  1DW3 A;  1GQ1 A;  3OCD B;  1KB0 A;  3CWB D;  4L3G A;  3O0R C;  4H0J A;  3L75 D;  2N18 B;  1DW1 A;  3WFE C;  1CTY A;  3KZI V;  2JQR A;  2AXT V;  4QAO A;  1YTC A;  3D0W A;  3TYI A;  2YIU B;  1SQB D;  4FA5 A;  1OCD A;  3H1K D;  1SQX D;  4PWA A;  1BGY D;  5IY5 1;  1COR A;  2CA3 B;  1KX2 A;  1CTJ A;  1HJ4 A;  1CYI A;  1DII C;  3H1H D;  5CIB B;  1FOC A;  1DW2 A;  2OZ1 B;  3ZOY A;  5C0Z A;  4FAV A;  1C2N A;  5KKZ B;  4FB1 A;  3ZOX A;  4FA4 A;  1IRV A;  3SVW A;  2B0Z B;  2BPB B;  1H32 A;  2QJP B;  1COT A;  4J20 A;  5KLV D;  1DIQ C;  3WFB C;  1QL3 A;  1CRY A;  1ZZH A;  1A8C A;  4D6T D;  1H32 B;  1PP9 D;  4IL6 V;  1C2R A;  3ZOW A;  1GU2 A;  1KIB A;  3HQ7 A;  2HV4 A;  1YFC A;  4L3H A;  3DMI A; 
#chains in the Genus database with same CATH homology
 4FA9 A;  1KV9 A;  1NTK D;  2LIT A;  1WEJ F;  2QJY B;  2AIU A;  2ZZS 1;  3L74 D;  1DVH A;  1L0L D;  2BH4 X;  1IRW A;  1WVE C;  3H1L D;  1YIC A;  5CIE B;  1GJQ A;  2DVH A;  1HZV A;  4PJ0 V;  1C6S A;  1B7V A;  1ETP A;  2BH5 X;  4LJI A;  1NTM D;  4WQ9 A;  1QL4 A;  3X39 A;  4EIF A;  1CED A;  2VHD A;  1DW0 A;  5B5E V;  1GIW A;  2N3Y A;  1LS9 A;  1M70 A;  2ZXY A;  1CSV A;  1FI7 A;  2CE1 A;  2MTA C;  2C1D A;  1MG3 D;  2B10 B;  3A9F A;  1RZ6 A;  1HJ5 A;  3SXT A;  3ZBM A;  2MHM A;  4P4Q B;  1SQV D;  1CHJ A;  1SQP D;  2JTI B;  2L4D A;  4YE1 A;  2C1D B;  3L70 D;  3CYT I;  3HQ9 A;  3HQ8 A;  3WFC C;  3DR0 A;  2N3B A;  1W2L A;  1AOF A;  1PPJ D;  1RAQ A;  1LFM A;  1I6E A;  2C9X B;  1HCM A;  4NFG B;  1N90 A;  3WC8 A;  2FYN B;  1CXA A;  3HQ6 A;  1L9J C;  1VYD A;  3VNW A;  5DFS A;  1NML A;  4AAM A;  2CXB A;  2YK3 A;  1F1C A;  3VRD A;  1CRG A;  1AOQ A;  1FJ0 A;  4GYD A;  3CXH W;  3OA8 A;  3PH2 B;  3L73 D;  3SWS A;  4Y5R A;  1M6Z A;  4AAL A;  4RSZ A;  1S5L V;  1H9X A;  1E29 A;  2GC4 D;  1YNR A;  3OA8 B;  3C2C A;  1C52 A;  4MU8 A;  4WQE A;  1BE3 D;  1NU1 D;  1A56 A;  4H0K A;  1C6R A;  4V2K A;  3VYM A;  1C75 A;  1YIQ A;  2EXV A;  1NMI A;  1EZV D;  4UB8 V;  5TIS V;  1I5T A;  1CSX A;  4AAN A;  3CX5 W;  1I54 A;  3SJL A;  1QKS A;  3NWV A;  4EIC A;  1AKK A;  2DGE A;  5DJQ C;  4UB6 V;  3MK7 C;  2N9J A;  1CIF A;  5KAF V;  2A06 D;  3NBT A;  4PD4 D;  2I8F A;  1CYJ A;  4FA1 A;  2FWL A;  1CHI A;  1U74 B;  2LIR A;  1FHB A;  1CSU A;  1SQQ D;  1N50 A;  2QJK B;  4KMG A;  2GB8 B;  1CTZ A;  3JBT B;  4GED B;  4O1W A;  4XXL A;  1CCR A;  1E2R A;  2IBZ D;  1R0Q A;  2ORL A;  3PXW A;  4WQC A;  2D0S A;  1YEA A;  1GKS A;  2YCC A;  5E79 V;  1CHH A;  5DF5 A;  1YEB A;  1EB7 A;  1F1F A;  5EXQ A;  5B6Q A;  155C A;  1H33 A;  3ZIY A;  2PAC A;  1RAP A;  2FYU D;  1HRO A;  2GIW A;  2B4Z A;  3TGU D;  2GC7 D;  1N15 A;  1HRC A;  1IO3 A;  1GDV A;  4Q5P A;  4WQB A;  1H33 B;  3L72 D;  4PW9 B;  3RMZ A;  5CYT R;  2C1V A;  4N0K A;  5DJQ B;  1ZRT D;  1H31 A;  1HJ3 A;  1NIR A;  3MK7 B;  2C8S A;  2N9I A;  5CIF B;  1W5C T;  2CA4 B;  3ZCF A;  4EIE A;  1CNO A;  3CP5 A;  4XYD B;  1NNO A;  1H31 B;  1BCC D;  1FI9 A;  1CO6 A;  5AUR A;  1CIG A;  5B66 V;  3ORV A;  1J3S A;  3NBS A;  1YCC A;  3WUI A;  3PXT A;  4WQA A;  3O20 A;  1BL9 A;  1M60 A;  2BCN B;  2OZ1 A;  1U75 B;  1L0N D;  3BCC D;  3CXH D;  4AX3 A;  3H1I D;  2B12 B;  4AAO A;  1QN2 A;  2C2C A;  2FRC A;  1IZL 0;  2B11 B;  1K3G A;  2D0W A;  5H2F V;  1FCD C;  1RZ5 A;  1CIE A;  5CID B;  1CSW A;  1S6V B;  1MZ4 A;  4L1Q A;  3L4M A;  5KLI B;  3H1J D;  1P84 D;  1KB9 D;  3M97 X;  1CC5 A;  1CRJ A;  1MG2 D;  1DVV A;  3DP5 A;  1LC2 A;  1A2S A;  2XTS B;  4JCG A;  3CX5 D;  1FI3 A;  1CIH A;  351C A;  1I8O A;  2CE0 A;  3A0H V;  4WQD A;  1CYC A;  2PCB B;  3CU4 A;  3PXS A;  1CRH A;  2N18 C;  3RLM A;  3L71 D;  4DY9 A;  3WU2 V;  4FAN A;  3RN1 A;  5KAI V;  4U3F D;  3O5C A;  1IQC A;  1LMS A;  1I55 A;  1AYG A;  2BCC D;  3SLE A;  1H9Y A;  1DT1 A;  2V08 A;  1QYZ A;  4O1Q A;  1NTZ D;  2C1U A;  4EID A;  1LC1 A;  1N9C A;  1JDL A;  1C6O A;  5GTI V;  5CIC B;  1E8E A;  1HH7 A;  5C9M A;  5CIH B;  3A0B V;  1KYO W;  1L9B C;  1C7M A;  2PCC B;  1KX7 A;  4WQ8 A;  2BGV X;  3WFD C;  2ZON G;  1CRC A;  1HZU A;  1H1O A;  2V07 A;  1CXC A;  4WQ7 A;  3L4O A;  1I6D A;  5GTH V;  1CCH A;  1OAE A;  2ZBO A;  1CRI A;  2YQB A;  2BLF B;  3ZOO A;  4K3I A;  3OCD A;  3O1Y A;  451C A;  5CIG B;  2AI5 A;  1KYO D;  2ZOO A;  1I8P A;  3RN0 A;  1K3H A;  1DW3 A;  1GQ1 A;  3OCD B;  1KB0 A;  3CWB D;  4L3G A;  3O0R C;  4H0J A;  3L75 D;  2N18 B;  1DW1 A;  3WFE C;  1CTY A;  3KZI V;  2JQR A;  2AXT V;  4QAO A;  1YTC A;  3TYI A;  4FA5 A;  2YIU B;  1SQB D;  1OCD A;  3H1K D;  1SQX D;  4PWA A;  1BGY D;  5IY5 1;  1COR A;  2CA3 B;  1KX2 A;  1CTJ A;  1HJ4 A;  1CYI A;  1DII C;  3H1H D;  5CIB B;  1FOC A;  1DW2 A;  2OZ1 B;  3ZOY A;  5C0Z A;  4FAV A;  1C2N A;  5KKZ B;  4FB1 A;  3ZOX A;  4FA4 A;  1IRV A;  3SVW A;  2B0Z B;  2BPB B;  1H32 A;  2QJP B;  1COT A;  4J20 A;  5KLV D;  1DIQ C;  3WFB C;  1QL3 A;  1CRY A;  1ZZH A;  1A8C A;  4D6T D;  1H32 B;  1PP9 D;  4IL6 V;  1C2R A;  3ZOW A;  1GU2 A;  1KIB A;  3HQ7 A;  2HV4 A;  1YFC A;  4L3H A;  3DMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...