4EIUA

Crystal structure of a duf3823 family protein (bacuni_03093) from bacteroides uniformis atcc 8492 at 1.90 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
242
structure length
242
Chain Sequence
PSETIWGEVVDEATGKRVLTDQGSEGIRVRLTELSWGDNVQHNPDFYCMMDGTFQNTKIFKGEYNVRIDGPFIPLVRENTDGTLLHDGSVNTEISGTTKVKFEVQPFLNVEFVGNPQVSNGVIKAQVRVTRGVSDEVFREKIQPMGNWKDEYLNVTDIQFFVSYSNTVGYRARDERWSSSINYEGKSFEGLLGKEVTIQSNGNVPSGRKVFVRAAARINYDTPVGSGTRRWNYSEPMEVLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (BACUNI_03093) from Bacteroides uniformis ATCC 8492 at 1.90 A resolution
rcsb
source organism Bacteroides uniformis
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized hypothetical protein
total genus 58
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2012-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12866 DUF3823 Protein of unknown function (DUF3823) N-terminal domain
A PF18003 DUF3823_C Domain of unknown function (DUF3823_C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 4eiuA01
2.60.40.2060 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4eiuA02
1QMUA 3NJVA 3E8VA 2NSMA 3KCPA 4YOKA 3HN5A 3MN8A 1NKGA 5G5DB 4IYKA 1UWYA 5AQ0A 2XHNA 4WI0B 3G3LA 4FXTA 2B59B 5K39B 4FL4C 4U3SB 4EIUA 3NJXA 1H8LA
chains in the Genus database with same CATH superfamily
3VRJA 3US1A 2Y7QA 5IVNA 2LGNA 1AP2A 5EFIA 1E4KA 3NP4A 2GJRA 1XCTA 4FNQA 4LSVL 5E8OB 3LQAL 5JA8B 2OMUA 3F84A 4PCSA 5IJVA 2FWUA 5K9JH 3U9UA 1HK6A 2RJMA 3CD4A 3H42H 4DN4L 3GHEH 3IETB 2VXSH 2EIKB 2PCXA 2WKOF 3NJHA 1UA3A 2YBRB 4RFOH 1DE4A 1IAIM 1YMMB 2BY3A 2XI9A 3L4VA 5B3JF 3VD3A 3MRHB 2GJ6A 3WEXB 5M7QA 4KKLD 1UCBH 2DJ4A 2BVTA 1T1WB 1OCZB 3AT9A 5D7IB 1B2YA 1FA4A 3WD5H 1YQVH 1MIMH 4H20H 5I1EL 3EJYC 3IT8D 3CSTA 1QABA 3LN4B 5BRZD 1RUMH 1SJHB 1BM3H 4YNYA 4XP1H 2V2TA 4LRNH 3DGCR 4K55A 2Y72A 3T6VA 5EN2B 5DZOA 3J27A 5E4EC 1I1AC 5SX5H 5SWQB 4K8RH 3DHUA 1OHQA 1YUHB 1JNJA 4QOKE 1JPGB 1HJCA 3NIDB 3VXRA 3O6MH 2Z35A 1OTSC 4Y4FA 3GSXB 2I60H 5JA9A 1BD2A 3VFSB 2FLRT 3MLYL 3VFMB 2YAFA 5L88L 3MJ9L 3PRZA 4PY8J 4P3DB 2CK0H 1PLAA 3FRPA 3GSNH 3VXUB 5JIPA 5KSAA 4JFYB 2ZOTA 1CBVH 1BD2E 1U8HA 1TZGL 4H8PA 4LCWA 4AV5A 1HL4A 3HN8A 5FYLE 2X2JA 3QRGH 3RG1C 5EUOB 1AHWA 3LEVL 1BQLH 4P2RE 3TO4D 3A6OA 2WTOA 3ZK0A 1H8LA 1O7DE 1JTPA 2NY6B 4CRPA 3H7LA 5FYJH 3LMJL 4N0FB 5FUZH 1Y1DA 2MOVA 2YPVA 1JDDA 1G9MH 1L9TA 3QQXA 4FL4B 4MVBC 4L1TA 1BBDL 3S3BB 5KVEH 4IOFD 1JFHA 1HH6A 4CGTA 5DK3A 4L3AA 4UT6H 3S7GA 1IAOB 5DS1A 1H15A 2DQUH 4FNLL 1H19A 4JO3H 4PI0A 2BVOA 3B5GA 1IAMA 4R7NA 2RD0A 2HA1A 5C0CD 1E3ZA 5JHMA 4NENA 1N67A 3FQ1A 3WFZA 4XPHH 1NFDE 1YMHA 2J44A 5FHAH 5IK3B 2WB1A 5IESL 4LLQB 3FFCB 5KOVC 3L4CA 5EEVA 4UIKH 2WZPA 4Y7OC 3RPBA 3B1TA 4UNUA 5AYUL 2EDDA 4RRPA 4L4VE 1CD1A 1SPDA 2GUOB 3H4FA 4FNUA 1G7LB 1CBJA 3GXDA 4IU2A 4NRXA 2X2UA 4O5LL 1IEBA 2AQQA 3W0WA 5C08D 5BVJB 4RA3A 1JGDA 2HZHA 3HC2A 3L5WB 4KC3B 3K5RA 2AXJA 3UTOA 4D9RE 3WHXB 1KCVH 5MEOB 2A6KA 3EOYG 4LCWD 3HJ0A 5SWSD 3T9WA 3QFJA 3IMBA 2X1OA 4UAOC 2XTJB 2Q87A 4WSGA 4WI9A 1QVOB 3BH8B 2VXQA 3BD5A 4ZO7A 2KQNA 5K9KA 3UP6A 4DP9X 1RH8A 3OMNB 1EEZA 1OW0A 5LGJA 1D5BA 3AC0A 3QC6X 4XWOD 3ZDWA 1R9FA 4Y4FD 3UC0H 3PUCA 4RISL 2A83A 3L5HA 2ARJB 4QGYA 3E8UL 1G6RL 4IKJA 4WNQA 4E5XA 5E8EA 3BZ4B 4LKXA 5DS8B 1Y6NR 1FHGA 1EFQA 4FNRA 4MB4A 3FU6A 3EUUA 4WI0B 1IILE 4L37A 1IL1A 1S4IA 4QKTA 4PCKA 1VFOA 5M95B 2IFFH 5HHPB 1EVTC 2EDLA 5DUJA 4NPJA 2LU4A 4TNFA 2WKLA 4DZ8A 5IUSA 5AD0B 4Q9QL 3T6ZA 3LKRB 1G7JB 5GISH 1Y6KR 1TMQA 3FT1A 4JFSA 4N28A 2GSIA 5IOPA 3BVXA 2NY1D 1VACA 5LGYA 3BVNA 1EA9C 2WBJC 4QHNB 3DBXA 3DOSB 4H13C 4K3DH 4KO7A 4MNGA 1OPGH 4PD4J 1BLNB 1YA5A 4N5EC 3UAJA 3BT0A 2XQBH 3TN0D 3HI6L 2D7QA 1IQDB 1GPOL 2WQVA 2H32H 4N0YH 2CIKB 3DX4A 4JFXB 4Q56A 1R5IB 3E1ZA 5EA0L 1HWWA 3FTXA 4AKPA 3DUUB 1J5OL 3DJ9A 3QEHA 4UMGA 2HVKA 3QYNA 5BV7B 1QA9A 4OLEA 3GSUB 1L9SA 5G55A 5I0XA 3ENEA 2PXYC 4HS3A 3DIFB 4PB9L 1AHMA 1FUNA 3RFZC 1J1PL 1WC7A 1M7XA 5JO5A 2Z93B 4TNVK 4QO1B 1FBIL 1AC6A 2HLAB 2CMRH 3VFOA 4MAUL 3C8HA 3U0TB 1KV3A 1MCLA 2AXFB 3AZUA 3UIYA 5CBEB 2ICEC 2KPNA 1QRND 2AJYL 3G6JF 4MDJA 5HYFA 1NMBL 4MGXA 2P3YA 4UANA 1G4MA 3EHBD 4QR7A 4D8PB 2YO3A 4NKOA 2ZTBA 4UF7C 4WCYH 4WEBH 2ZUTA 4I3SH 5I18L 1SVBA 5IR1A 2XICA 2ATPB 3SPJA 3BUQA 1OXYA 3ESPA 2UZPA 3NCYS 3O2DL 4LLVB 4F7EB 3F83A 4TTDD 2B2XH 2I5YL 3TEUA 1SY6L 2BJMH 2TRYA 5HGHB 4S1DD 1BEYH 1I1YA 1ET8A 4XPTL 1U33A 3FRUA 3WENA 1OTUD 2ALAA 2FD6H 4FHKA 4X6FB 1RI8A 5ESAB 2ZONA 3NABH 1V5JA 2C1PA 1AANA 2WLYA 4QMEA 4P23D 2DKSA 3LQAH 2GJPA 5C86A 1NM4A 4Y9CA 4X0KB 2LAAA 2XWJB 3EDEA 5F72S 3HPLB 1K2DA 1NGXA 2W38A 1JPEA 4ZSOE 3GSWA 1IJ9A 1MRCH 3GHEL 3P2DA 3NFPA 5LBSL 5CD3A 3VFNB 1ZGLP 1PZBA 1AFVH 2BWDA 3QDHA 5GHWH 3FU7B 5A2JH 5LUMA 3TWCH 3MV9E 3NQKA 4KTGA 3I9PA 4GSDH 2G60H 2WBJD 5EEYA 2XN9D 3EH4B 4WW2B 2Q86A 5LWYH 1X5XA 2VXUL 3SE9H 5DCCA 3PQYE 3ZKND 2FO8A 1YQVL 4R97B 3NAAL 3PV6B 5E94B 3U1SL 1DQQA 3F7KA 5L9DH 5HJGA 4UUJB 4LVNB 2XBDA 4MMZA 1L9OA 1IEHA 4XP1L 2IDCA 5I1LB 2A73A 5K9OA 4NJ9L 4TL5A 4X80H 4BQCA 1YPZB 2VISA 3FO9B 3UG4A 3WAKA 5H37H 2F5AH 5JR1H 2IMMA 2Z3FA 2AK1H 2F8IA 2P26A 1IUZA 1NGPL 5EZJA 3T0EB 2Z65C 1DANT 3TT3L 5HVGB 1KYFA 4Y4KC 1OT1A 4G70B 1AKJD 4PP2A 4Q0XL 2IV8A 4XTRC 4KKAD 1QI5A 2COQA 4R26H 4ZDHA 4IRJD 3KJ6L 4XCFH 1FI8C 2CXKA 5MEPA 4NKQB 2EDOA 2WIIA 2CK0L 3GRWA 3NYKA 4ZFOL 3ZL1A 1I4FB 3CSGA 3GC3A 4XN7A 4P2QE 1ZHNA 3NQIA 3P4MA 4R7LA 3QUZD 4IOFC 3IMVA 4UOW1 3RX8A 1A1MB 1MCCA 2QVKA 4HS8L 5HDWA 1RK1A 4TUJA 4YXLL 3ULUL 4GO8A 3HB3D 4W93A 2RCSH 3LZFL 4JRYB 3W2DL 1MJJB 2HFEB 3KXFB 1JWSA 3D18B 4Z3EA 4O2FA 2YARA 3CDFA 5F7KC 2E7CA 2QQKL 5JLZB 5DLLA 4IRSD 1NFIB 4GNKB 4L48A 3B2UC 1YEIH 2QHLA 4I1PA 4GI8A 5F2FA 1KOAA 4HBCH 5AZ2L 4ADIA 3O0RL 1S7RA 4HEME 4GMTL 4C56A 2MEJB 4ONHA 4QO1A 4XHQA 3HVDA 3QZNA 1J9RA 1WCBB 2WLLB 4AQOA 3G08A 2XHNA 5JO5B 3OVUB 5AZEL 5F9JB 5E6RB 2J6EH 3DNKA 4U05A 5GZNC 4QHKI 2R56H 3RUGA 2WY3B 4FLRA 3PYCA 5T5FL 1LJMA 3MXWH 2VDRB 3ZKMC 1OP3K 1EO8H 5GRUL 3JV5A 2E6PA 3H8NA 5INDA 3VJ6B 4R9HA 5CINH 3DUUA 4PJFE 1P2CA 3AJ7A 4E9VA 5I75B 5DURB 3K0YA 5EUKA 2PPFA 3WN5C 5FM8A 4ELMA 8FABB 1AR1C 3LXAA 1ZS8A 5TK4A 4R4ND 4FLQA 4J27A 2ARWA 3AB0C 2YD1A 4JRYE 4NIKB 4NHUB 3RVXC 1ZXQA 3NDZE 3WI9A 3FPYA 4TQIA 1R46A 1WCBA 2GBVA 4Y8DC 3CPLA 1KGJA 3HHRB 3DVNA 1MWAA 2PNDA 4IRZL 1JZJA 1HHJB 5KN5B 3C6EA 5A2BA 2GEQA 2X42A 4PRPE 3LS5H 2IFGA 4LHUD 1FG2A 2GY5A 4LLUB 5HHOE 5CCKH 5AD0A 3EJZD 3C6SA 2BS9A 3WFHB 1RVFL 4JW3A 1RJYA 1LO3L 3RHWF 1T6WA 5DWUH 2VDQB 1RK1B 3GXTA 4TUJB 2X05A 1QSFA 2R2HB 1XL6A 3SCMB 2BSDA 5MENE 2PTVA 3SQBA 4PJFB 2WXPA 4C4KT 3QBTB 1NTDA 4JDZB 4S0HA 3KBHE 2VLJD 4BFIB 1IAIH 1N4XH 3VG0L 1Q9OB 5GS2D 1S9YB 3VI4B 2OCJA 1CK0L 3CLFH 1Z9MA 1WCQA 2G0KA 4FNSA 2CBMA 2CHDA 5FM5O 1U8CB 3KPMA 3K2UH 4BUHA 1TO5A 4U1JA 2V5YA 3RX5A 2W94A 3P3SA 5SWZE 2HRHA 2XDHA 1I85C 1YPZA 1M3JA 3FO9A 4HPHA 2AJXH 2AV1B 2FH6A 2WLJA 2JXMA 3K6SA 3THML 1ZRUA 4AYBA 3CN3A 5BNXD 1L7TH 3BE1H 3LNFA 3II2A 2WCGA 2X9ZA 3BAJA 5EEUA 4KROC 5CLXA 5EU6A 4W81A 4DW2L 5AW6B 4MQ7A 1TG8A 2QSTA 5EIVA 3QDJB 3FBKA 3RU8H 3E8UH 2ISDA 1WUZA 4KMQA 2VDML 1O7DC 5E2UL 5A3IC 1BOGA 4L0ZA 1F90H 1T5XA 5DQ9A 1JZ4A 4GO6B 3MYJB 4BZ1H 4Z0BH 1MAKA 4U1LB 1J1PH 2WLNA 5FUZL 3ZDYB 3ULVF 1S5HB 3V0GA 1F1GA 4J3UA 1MW0A 3F6JA 3GMOA 4OLXH 1CGWA 5KYUB 4LNRB 1L3WA 2OMTA 4FNLH 4MS6A 4Y89A 3GSRB 3ZL2A 1J8HE 3VFGH 1N8OE 3G5VA 4X2UA 1PY4A 1OT4A 3CZFB 2HKHH 3BP7A 3LSOB 3GLZA 4YVUA 5E9DD 2OMWB 4MMYA 2H3KA 1JGVL 4PRAB 4EIGB 3N55A 4AXWB 1TKWB 2JKNA 2G5UA 3UCRA 3B9VA 3PGDB 3FSVA 4LP8A 3S5YA 1E50A 4EBQH 2AK4A 4GRLC 1F58H 5FW6A 5IGXH 2KBGA 3LKOA 3SZKC 4TUKH 4HIHA 1WBYB 4HIJA 2IPKA 1QFWM 3BP7B 2VXTH 5J56B 3GRWL 2X44D 3RL1B 1MXDA 4ONFL 3VU1A 4N90E 4U3HA 3OM3B 3CMOL 3IN2A 4K0OA 2B4CL 5KVGE 3VG9C 5C9JA 1A6UH 1YY9C 3NZHH 3I6LE 1W91A 5A6LA 4OQTA 4YWGH 4EI5B 4BKLB 1X5IA 2BIMA 1A4AA 4G8GA 4U33A 1BQSA 5D7IE 5L0QB 3N04A 1VFBA 3PS6A 5FWRA 1GGUA 1AQ8A 1EZSA 4WENB 2UVFA 4LVOB 3NFNB 2NUPB 3LN4A 4HHAA 2IBGA 2CNZA 4TSAL 3CTTA 4OD1L 1XB6A 2JJVA 1KGUA 1QOKA 1HN1A 1OAJA 2XIDA 4PLOB 4KDVA 1DCEA 2YD8A 3SOBL 1OP9A 4PRHD 4QRRB 5LAPA 2K0RA 1AXTH 4HK3J 4R96A 1C8PA 1I1FB 1CGYA 1MIEL 2NR6A 3L1GA 4QRPB 3UXFA 2MNUA 4NAJA 1TPXC 4WGKA 1BWWA 3P3TA 1HXYB 4WDIA 1GS7A 1P6FA 2VDKL 5C6WH 2PXYA 3T8MA 1SY6H 2FQGA 3CFIC 3KL0A 3L1EA 5CSBA 3IFLH 3ULVC 4AVKA 4CN1A 4ZFFB 3NCWA 2EIJB 2VDQH 5D1XA 2DLFL 4NC2B 1AD0B 2EXWD 3NABL 1U3NA 5LQBL 2ZF8A 3QHFH 2O93L 1XV8A 4IJ3C 4YDJA 3MNZA 3BQVA 3OBAA 2RGSA 4MRBA 4MD5A 1E8XA 1MFDH 4KH2A 1HAWA 4NDMB 2WXGA 4QAWA 4PHXA 4A63A 1U8QA 3QZBA 4MB3A 5I8OL 2XZAL 5DVLA 3FTGB 4LRIC 2CU9A 2VLRD 3IDYC 1U8KA 4A2EA 2Q10A 3Q3GA 1NKGA 4JGMA 4LSPH 1MQKH 1KIUB 3O11B 3TGXA 2BRQA 2PMZA 3QH3B 4XNUH 2TRHA 4RMTA 2GG1A 1QPKA 3AS2A 1QFWI 1UWEL 3IEAA 5DA4A 4EOWH 3VM5A 1A8ZA 1F4YL 1A6VH 4RESB 2E9WA 4YXLH 3LKPA 4NN7B 3NUKA 1DVXA 2F08A 1Z9PA 2EO7A 2NY3B 3QDMD 4Y16B 3P73B 1KLUB 4W1TA 1WHPA 3RWCA 1ZHLA 4L8SA 3C5ZB 4WUUA 4PSPA 2G0LA 3QDAA 1A64A 3AREC 2IGFL 4L4VB 4N2BA 4F58L 1NFKA 2P8MA 5FM4A 1Z5HA 3IGUA 2R51A 2YPVL 3C5SA 1E6JH 1RJLA 4F2FA 2BNQE 1QI4A 3QCVH 1N6QL 4WTZG 1BVZA 1IC1A 2ZP0T 3WJJC 2HRGA 3FCTA 4WUUE 3HE7A 3D30A 3IDXL 4ZRGA 1QBML 4OTXH 2RQ8A 2XIBA 4PRNA 5EWIL 3VXRE 3IRCA 1MCPH 4OW6A 1JGDB 4Z7VA 2JCCA 3JSSA 4QWWC 4U7MA 5I73C 1JGLH 4RFEA 3O2DH 1XGPA 4EZKA 2YR3A 4BK4A 2H32A 1B6DA 5DDHB 3NCYP 3WY2A 4TN9A 3HZVA 4MXWH 3QZPA 4W9HC 5AFAA 1A21A 1EVUA 1WIOA 4G42A 5D1XE 3NSYA 4NUGL 1ONQB 5JLZA 3II1A 1EZVY 2WTPA 1HI6B 3TYFA 3PQYA 3D18A 2ZOWA 5BW7C 1AO7B 4GRWB 1EZVX 4LIQE 5E2TL 2OYMA 4Q9RH 2QQKH 3MBWA 4F8OA 1HH6B 1YNTB 5DD0H 5J11C 1W2KT 1UM6H 5T1KB 1D5IL 4UQCA 3Q9QA 3HCVB 4GSQA 2A99A 5GHWL 3TBTA 1EXUB 2NQDA 5MP6L 3KPNA 4N2GA 4NCC2 1UGKA 3MA9H 3ASWA 3MUGB 2WO4A 2FJSA 2HG0A 3E6FA 2CSPA 1TKWA 1VFAA 2DS4A 2BXZA 2F74A 5BOZG 4AUJA 4OCRH 2OMWA 4DKFL 1A7RH 1B0RB 4MA1B 2F53B 5FO8A 1MVUA 4IMKA 4NUJA 1LP9B 2NPLX 3M1OA 1QLEB 1BMWA 4X5XB 2DDQL 1CI5A 5K1NA 3DPDA 1JHLL 2BP5M 3EH5B 3PE9A 4Q9CA 1BJ1H 4N20A 1ZY9A 5IROD 1XF2A 4M1CC 1JPSL 4KKPA 5J7CC 3KPSB 1DYZA 1JVLA 3NSJA 4BQ8A 1T5XB 2ZWSA 1IM9D 5HHMD 2ZKHH 1YEDA 4RAHA 1KJVB 3E7JA 1K4DA 5DJ2B 1KJMA 4KHXL 3G5XA 1RULH 5A2CA 2F7QA 2YLHA 1HEZA 4LFHG 4E41D 1IGJB 1NPJA 4V1DA 4JO3L 3PAVA 4AIOA 3V4PH 4Z3IA 1GS6X 1QKZH 4KMTL 4IMLA 4UQ3B 3U1PA 4P04A 3MNZB 3LKSA 2JCCF 3LXUX 1SN5A 2ITFA 5KYXB 1HYSC 3D12B 5HD8C 4OF5A 5KANG 4NO3A 5KW9H 4IGBD 2AI0H 4AJYV 3GI9L 3ZZ1A 1YEEH 2VRKA 1H5BA 3W38A 1CF8L 1QI3A 4ELMF 2I9TB 2WCSA 5FA4B 5DQJA 1ML0A 2YPLE 1BBJB 4AMKL 4PS7A 1MLCB 4UTAA 2GUYA 5I1GH 3CH1B 5ICYB 3UBXG 1UXWA 3VFGL 3DRTB 3QAZB 4AYGA 1CK0H 3CLFL 3ZKNC 1OAUL 1EAQA 5KVDE 4APQD 2J6EL 2DJMA 3NJFA 3TJPA 4UQ3A 3TF4A 2Z8VC 5LLIC 2OS7A 4G8FA 4JZJC 4R7XA 1ZGLB 4Z7AA 2H9GB 1L6XA 2JK5A 4A1RA 3HJEA 2O5YH 4HWBA 4YHKL 3S36L 1UEMA 2QQLH 1OB1B 4EUPH 3WIIH 2X6AA 4OJFH 3RWFB 3LRSA 3UYPA 2MCPL 4M29A 1RJYB 3IXTB 2NW3A 5C71A 3AVEA 5FEBA 4KKCD 2Q76A 2VXTL 3F6LA 5EBMB 3GXMA 1I7ZB 5AVYB 4AV4A 4GUQA 5DRNB 5TF1H 4H8QA 4KJYB 5C8JB 1A3LL 3VWKA 3AADB 4PCTA 3IU3B 3WNJA 4IBQA 2YC1A 5JXED 4IRJA 1LILA 2NY3C 4APXB 3QQ3A 4GAAA 1NSNL 4MCYA 1FNFA 1D2OA 2VM9A 1CLOL 3GB7A 3V0AC 4K3JH 5FCUL 4JPVL 4P2YA 4M43H 1INQB 2EQDA 2QQNL 3T0DA 1EEUA 4YHYC 5L4IA 2Y9RT 1JZDC 5DQDL 3I85A 4IGBA 3WNLA 1AAJA 1KXVA 1ZV2A 2HKHL 3QJFA 1ZLUH 4OH2A 4Z18A 4LEXL 4GXUM 3C5JA 4K3DL 4MNHB 1IQDA 1MLBA 2VC2B 3PG2A 1B2WL 1JPFA 4FYSA 1P53A 5CJOL 2CD0A 4UT9A 2VM4A 4PWFA 1YNTA 4ZXBD 3G08B 4MNGB 1AS6A 1XAUA 5F9JA 4DT2A 4F7CA 5C0BB 3SPIA 4FTVB 3GJFH 3HLKA 5FM5M 1WD8A 2QADB 1CL7I 3U6XS 4NZDA 3E3QE 1MXGA 4NX0A 5BQDA 3AGWA 4WO4D 1AE6L 4UTAL 4X7DC 4WO4A 1S5HA 2HJFB 1DJSA 2VDKB 3Q2VA 3QYCA 4N9GA 3Q01A 1OSYA 3RJDA 2UY7B 1CR9H 3AU1B 3PXHA 4BQ6A 1GHFH 3HC0A 3QCUH 3SBPA 3KAAA 3MV8E 1DJHA 4FKKA 4Z1PA 1NDMB 1WEJL 2F9BT 1RZIA 3C60B 3FC8A 1XH0A 4ANXA 1Z0MA 3THMH 2NT0A 4KMLB 4KY2A 3UTPD 3QNZB 3BW9B 1GXEA 3ECBB 4K5LA 2IQAA 1TCMA 5I8OH 4F15B 1KY7A 3B9KA 4GYBA 2E6QA 4F37F 4AYID 2W60B 2AS5M 2DLGA 3QJSB 1OGAD 1ETZB 1UURA 3FT4B 4LLYB 3TBYA 5CBAB 1IIIA 1SHXA 2O6CA 2OMBA 5F97E 1O5DT 3QO1A 5ENWB 2JWYA 3RGBA 2IVFC 3NCJL 4N86A 1LQSR 2V37A 3L3JA 2XPGA 3RVTC 2QSCH 2HVJB 4BZ1L 3ZE0E 2EXWC 5ACLA 4OZIB 4HEMA 3BP6A 3FQRA 4XVUC 2WKGA 2LVEA 1ND0B 1P7QD 3Q8EA 1R5WB 2A73B 4MQSB 1PLGH 5KSAD 5IVXF 4DVRH 2K9UA 4AMWA 2FGZA 2H3NB 2IDUA 5FYJE 5CGYD 4HWEH 1W0VB 4H1LH 3T77A 2DBLH 2J21A 2A4EA 1RZPA 3EJTA 3O11A 2X4UB 5HY9B 2ETWA 4LIQH 1U8KB 5F7NC 5D2NB 1E5ZA 2PWDA 3EGXB 3GBMH 2EEAA 3EJYD 3OAWA 4DGIH 2BVPB 1JXKA 4H1LG 4HMEA 4AQ1B 4Y2NA 4WEEA 4N9GB 1TZIA 5KSBE 5CD3B 1B90A 3DOIA 2D9CA 1TVHB 4PTTB 2HG5B 1MWAB 2ZX7A 2BVQA 2YOCA 4MXWL 3ZTJH 4ZUSB 1FZKA 1GMIA 2CGYA 5F6HJ 2QJDA 5T1LD 2DN7A 1KLFB 2L7JA 4RAUB 5G5DB 2V7NA 1HHGA 4JM2D 2VW4A 3X3GL 2YAQA 5KVEE 4NQVB 4L4JA 3CV5A 3OTTA 5L2KA 3FUKA 5E0FA 4QI3A 2OK0H 2HCZX 4KPHL 1IVLA 1WV7T 2HSIA 3HNSL 1NINA 3VJ6A 5AAWC 1WITA 4EIUA 1MFBL 2J43A 2GC4C 1INQA 2JB5H 4DP8X 5IW3A 3KYKH 1N0XL 2B0SH 2HMID 2FLMA 1R19A 4JG5A 4OV6F 5E9DE 4GLRI 5KS9E 2VM3A 5D1ZI 4MRCA 1CDBA 1DVFD 4DZBA 1RZJC 2FQFA 4PRBB 4F57H 1E30A 1QAWA 3OB8A 1W6LA 4J3OG 1FNGB 3STZA 4IHOA 2GI0A 5F7EH 4W9LC 5CBEA 3T6XA 5KUKA 5L2JA 3FFOA 4YFDB 1DEDA 3U0TA 2H26B 1NC4D 5E7FA 3VFOB 3UIZA 3NJJA 1FYHB 5GGQL 3UYPB 1MWAH 4OCXL 3VI4E 4X42A 4XCYA 2AZUA 2J8UF 4C4KO 3MLPA 4QNPF 3S3JA 4UNTA 3SB3A 5C0GB 2ESVA 3NSDA 4O2EA 1ED3A 1GC1C 3RRQA 2F7IA 3D09A 3QJHA 4L29A 4OLUH 3ROLA 2A6IA 5GJSH 1KWKA 4LMQI 5AZ2H 5AVVB 1SEQH 3QIBB 2BO0A 4KZEL 3BQUB 2QL1A 2UZXB 3QFJD 4PV1C 1WZAA 2IAMA 4LK4A 5E8NB 3CVHH 4HUXA 1SJMA 5MP6H 1XIWB 3IGKA 4F93B 3QWOB 2FUTA 2ODIA 3MA9L 5CP3H 4YSTA 3TH2T 3GI9H 2OMTB 3GKWL 1XCWA 3BRDA 1BXVA 4Q4IA 4Y5YA 1E7VA 3EOBB 4YE4H 1ZLWK 5CINL 1CGUA 5CZVH 3MCKA 1N2RB 3I84A 1IM3D 4UM8B 2D2CC 1G7PB 1ZLEA 1AP2B 5EFIB 4NZRH 3P4NA 2V2WA 2ZPKH 1GZQB 3AACA 4Z0XA 1XAKA 4PJ7F 1NQBA 4X98B 3CXDH 2VC2L 1CDYA 2BPBA 2ZSVA 3P40A 4WW2A 1NH6A 5D2LF 5T5FA 5T33H 3R4DA 4KK9C 1NZRA 4BQ9A 4JFEA 2WSKA 3WLBB 1X5FA 4PRIE 1LD9B 3VRIB 3G6DH 1SRDA 3D25A 2ICEB 1U36A 2VKXA 4QHUB 4AX3A 1H3TA 5I76A 4KVNL 3VXSA 1T80A 4PS4H 2HAZA 2C34A 5EOCH 3V52H 1LP9F 2HRPH 2WGNB 4ONOA 4U0RB 4A6YL 3ZUCA 1NEUA 2BFGA 4WF7A 6PAZA 1G9MC 5TK2A 4A66A 4BE6A 3FQYA 5DRZA 5F9AC 4Y4KA 1CFMA 3U9PL 2UX6A 1PVHA 4HK0B 5IQLA 2IG2L 1AKJA 5FO9B 4JFED 4UOW0 4CVXB 5IUCA 1U93B 4XR8C 2P1YA 1VZIA 2UWEE 4RETB 3QJOA 2A4ZA 3UROR 3CZLA 3G04A 3M1BB 3L95A 4DAGH 2P7TB 3GUTB 1GZPB 4F9LA 1RZ7H 2HWZL 2E7LA 1ZV5A 1J0ZA 1H0DB 1N19A 2IDTA 5E08L 5EBLA 3MRRB 4HDIA 1IM3A 2JLLA 1GTNA 4MDJB 3TA3B 1J9CT 4DGYL 2O5YL 1MCWM 4RMQA 2QQLL 3PHSA 5CJ5A 2C4FT 1D5XB 4Z7WF 3FSZA 5GGVH 3EH3B 4DH2A 2IJ0C 5DK0B 2PYEB 5BOJA 1NCWH 5CEZD 3BVTA 4CDHA 4D9QE 2IAMD 1MJ7L 2V6HA 2Z8RA 3QIUB 1QD0A 3GEFA 4ELMB 8FABA 4Z78B 5HI4C 3QJFB 2MIZA 4PRHA 3T65A 4M4PA 2CGRH 4Z7UF 5I6OA 1NSNH 1CZ8H 4G83A 1MPAL 3NFSH 4BCXA 2JKSA 3UTQB 5FCUH 1WFTA 3FRPB 2YKLL 3D39D 1YPZE 3O6FB 3VXUA 2QKIC 4L8BA 1XR8A 5D5MB 2QT6A 2YAOA 4J3TA 3KD4A 3KVPA 1RUQL 1JGVH 3I50H 4L8SB 4KX8A 4WUUB 3RWCB 4XOAA 1E4KC 1MCRA 1U21A 2AEPH 1AGBA 2BP0A 2XWTB 3IU3A 3JUYA 2VN5A 3MREA 2IWFA 4NWTL 4Y16A 5L4JA 1T0NB 4PWEA 4LPTA 4YSQA 2D0FA 4LSSH 1I7ZA 3PP3K 4N87A 4Z6AT 2I27N 3IAQA 1SY6A 2Z1KA 5EN2A 4XBPB 3MV8D 3NCBB 4RDQG 1FFPB 4G2AA 3WTWA 3UP1A 4C56E 4B9GA 4URTB 4NQCD 1R3JA 1S9VA 4P5TD 3W9EA 1DDTA 4AL8L 1EEYA 2JK5B 4BWWA 3VD9A 3KLLA 1CR9L 5IKCA 1NAMB 3AWEA 3HE6C 2VYRE 2FBOJ 5DMIL 2DM4A 4TSBL 2XQBL 5I8CA 5J13C 1HS6A 4PTUB 2ED8A 3BEVA 5E9DA 1RZQA 2BFVH 4P9MH 1I8IB 4U1HB 5INCB 4DIXA 1ORSA 3MV01 1KB9K 3O8XC 4ODXA 3KH4A 3AAZA 4LPCA 3IDNA 2Q6WB 3CFCL 5KYYA 4QRPA 1NGZA 4M7KL 1I1CA 2GK0A 3RI5K 3WOVA 2AJZB 5J13B 2WWMD 2QLYA 3RLSA 1REIA 1JPTL 3JTTA 4PJEE 1YNLL 1WS8A 3TT1H 3NVQA 4Y5VB 3UAJD 1OVZA 4KDTA 4V1DB 5AVUB 2MCG1 1WFNA 1G0XA 3IMSA 3HS8A 5CCHE 4HWNA 1Z2KA 2BP8A 4R2GB 2R69L 3IFLL 4PJEA 5EU6D 3FFCA 4ZFQA 3A5VA 1X5KA 3F7YA 1FO0H 4AJWA 3FN3A 4E0RB 3CVBA 1NBCA 2ZX5A 5AL0A 3SODB 1TVBB 4TNWF 4RGMB 4TVPH 2Y3AA 5JHDE 4YXHH 4EO5A 2CNYA 2NNFA 4M93B 1B4RA 3PJSA 3TXAA 4ZUVB 3ZGIA 2I9LA 4IOIA 4K3EH 4RFOL 5ICXB 2F53A 5I0VA 2FL5B 2XZCL 2ZOUA 3DVGA 2AJVL 2XT1B 4RGND 2JH2A 4P46A 3SYOA 3ZMEA 5C0JB 4LHJB 4PV9A 4PGCA 5BZDA 5KSUB 4HWZA 2Z91B 1ZT7B 3MLXH 1ACZA 4X5WB 3FU8A 5CIPH 2BW5A 4WO4C 4NAQA 4P2QD 1ROCA 3HNVH 4Y4KD 4J6RL 4AVHA 1VRSA 1WVZA 2ZG1A 5IMMB 5GJSL 4ZUVA 2WUCH 3D3VB 3VXQA 2ARJQ 2DLHA 4J28A 1XWVA 3C12A 2XWXA 1DQDL 1MUJA 1N8ZA 3BFWA 2H6PB 5DRXA 1F2XK 1BF5A 2CKBH 3MBEA 5AVTB 4GKZB 5J57B 3FRPG 2PCFB 1EDQA 2X4TB 1T2JA 2PTTA 1QG3A 3UAEA 3LOWA 1ZT4A 1JXGA 3ILPB 5E5MB 4P06A 4J2QA 3KPPA 2WNWA 1JGLL 3U1SH 1AGDB 3W56A 4G8IA 3LEXB 2EEDA 1WC7B 5T3XL 1IB5A 4QTHA 1TCRB 1FF5A 1AH1A 3VXTB 4N2LA 3U6RB 5DJDA 3BPOB 5JXEC 2BC4B 3M45A 4IBLT 2A74A 4EEEA 1GSKA 5FECA 1CFVH 3LY6A 4AH2B 5I1IL 1XF1A 3QIUC 3VQ2C 4IK7A 3NPSC 3TEXA 1HEJC 3V0VB 3ZO0A 1RZ8B 3LRGA 4TUOA 2YXVA 3PWPB 5DMGD 3MV9D 4JFXA 3M17B 4N8UA 3EO0B 1U8CA 1W6WA 2C9PA 1PZDA 3C5SB 3A4EA 1I3RB 1PSKH 1OZTG 3FOLA 3AQDA 1LK2B 4S2SA 3IFPA 3DBXB 3DOSA 4AV0A 5I8CB 4FJ6A 4PJ5B 2PETA 4NWUL 1WAPA 1R3IL 1KY6A 3KPRE 4JHWL 3C08H 5FHAL 3TZVB 4GKSB 4L8DA 3HZKA 3S35X 1K6QH 1BYPA 3SCMA 4ZD3L 1MN4A 3KPOB 3ZIMA 4G71B 1H8NA 1KYUA 3QG6A 4O5LH 2KZ1B 2P80A 3KPTA 1TNMA 3ISRA 2GABA 4APQA 1YYCA 2F58L 3L2LA 3TX4A 1KGYE 1LYQA 1H6FA 2QHRH 2YUWA 4MCZB 2XWZA 4I48A 1U8IB 2Y6SC 4XZUA 3WKYA 1MCOH 2GPZA 3NA9H 2HTLD 3FSWA 1TQCC 3FZUC 5HJ3A 3TF7C 2BCMA 1T5WB 3OB0H 2CJUL 2ZG3A 3QQ9D 4LLDA 2OSLA 5FYKU 1KCUH 1QFHA 3QUMA 4WVRA 3US9A 1ZHBB 1A9EB 3WTSA 1XR8B 5E99H 2MCAA 4XP4L 4KRPC 1ZLSL 5T3ZH 5ABAA 1MNUL 5DJ6A 2EYTA 4RA0C 3GJFA 1UKQA 2Z7WA 1ODUA 4GW5A 4WAFA 4MXQD 5BRPA 2AVGA 4M7ZB 1YDPB 3Q8AA 5TDPA 5JPNA 2D3JA 3EJPA 4PJ8A 5CEYB 2C4FU 3SDDA 3NT0A 3FB8B 5F6IC 4HT1L 3QPXH 4N8VG 5AG8A 2YFOA 3LS5L 4JRXA 4XNAA 3UBHA 1TU2B 1ZDSA 3FUNA 4DK6A 1M7IA 4RDBA 4QCIA 4X5QA 4KDTC 1KF9B 1Y18B 3DUHA 1W72H 3OAUH 2FCBA 5IQMA 3B56A 3DV4B 1ZVYA 2XZQL 3B9DA 3G6JE 1FZMB 1COBA 5L8JB 1SUJA 1NMAL 2LTQC 5ESVB 3X11A 1KDIA 3GKWH 1SLXA 2BSTA 2X6UA 5MERA 3SKUD 4LSSL 5IMMA 4PVNA 2Q20A 3U4AA 1OD9A 2FJFB 4MJIE 3SO3C 1UOLA 3T0VA 5DEGA 1ZHNB 1NLBL 1OIOA 3BGFB 3MOBL 5FFGA 3IJYA 4F7PB 1DLFL 1P9MA 4PJ9C 1QP1A 3P0VH 4HK0A 5EV7A 1DUZB 3AS1A 1G9NH 3ZTNL 2EIMB 3DYMA 4YHYB 2VLMD 3TCTA 3JWNE 3QQDA 4K9EH 1ZLVH 3H2PA 1HU8A 3QC5X 3AQYA 2XV3A 4HKZA 3L3DB 3D85A 1JNLH 2HYMA 2P5ED 2EDXA 4XVOA 5D4QA 4AGNA 4G80B 4PWKA 5ID1A 3PAZA 5FA3B 3O0LA 3DX3A 1NBVH 3EO1A 2HLFD 3TCLB 4RSVA 5JPMB 1NMBH 5DFAA 1NCOA 2LLLA 4O2CA 3QIWC 4G7VH 2J4WL 4WCYL 4KJQD 5C0CA 4UIKL 2NDGA 3LX9A 4LXFA 4C47A 1XXFC 4XN2A 3STBA 3HUJE 1QHPA 3U7AA 5KJ7E 4HC1L 5JQIB 1NM9A 4WU5A 3V9CA 2FEJA 5BJTA 4XAKE 1XHHA 3OKMB 1HXMB 4KY1H 4A7TA 5BMFH 4IDJH 5K59F 3WS3A 4NFDA 4OCLC 5F7HA 4JRWA 5JPMA 3STLA 5E6IC 2R69H 1PGRB 3UOAB 4JRXD 5DR5L 3WEXA 2HPOA 1SMAA 3QFDA 2MPAH 1M2VB 1U95B 5EUOE 4YFEA 4DGVH 4MQTB 1IFHH 3M46A 5DYOA 3FU3A 5C0DA 1C5DB 4I89A 2K6WA 43C9A 3RX7A 1ZA6B 2B39A 5TQ0L 3NEXA 4RISH 4C4BA 3MTRA 4I0PA 4JZOB 4ZMYA 5K33A 4PJGA 2DMBA 4F7EA 3VXRD 2D9QB 1CLZH 2DH2A 5IBTH 2WQSA 5IKCB 3A4AA 2G60L 1V54B 3KYNB 3R18A 1WA2X 2IAAC 2QPEB 3KVDD 2VXUH 3VNYA 5IW1A 3OLDA 1FFPA 1KPUB 2WLHA 3W9DA 2YMXL 1U8JA 3C6SB 2OW6A 4QKXB 4HUVA 1AGEA 4ADJA 3CFEA 3GFUA 4JJHA 2FATL 3EO9L 3S34H 3GMMB 2PO6D 1ROWA 4PJHF 3JV4A 3TFKD 2VDOH 4G11A 4FI7A 4TLUA 1GOFA 5D72H 3VFTB 2P8PA 3D2UB 1J8HD 3ZTEA 5HYQB 1EERB 1UA6L 2DLIA 3SDDB 1A7OH 4RZKA 5GZOD 1NC2D 2J88H 3EIFA 1RZGB 4UV7H 1J10A 3NMEA 4RNRB 3HI6H 4FQPA 2W5PA 1DN0B 4JUSA 4OZHB 5HHVL 5FUCE 4BSVB 1OQXA 1YYMH 3EG9A 5IQ7L 3BSZH 5D1ZB 2C9VA 3R19A 1S7UA 4F80A 4PWJA 3LRMA 4U1MB 1EZUA 2DQTH 1WGOA 1F4XH 5INDB 4UCFA 1KYAA 2IGLA 5KVDL 3GS7A 4HIIA 3RVUD 2YPKA 2EADA 2DQHH 4MKMA 3UEZA 4ELDA 1YJDL 2QFPA 4ODVH 3RUGB 5I1IH 1FNLA 3X12A 1OCCB 3LKNA 4P5MA 5F7LB 4QYOB 4XPGL 2FQEA 4R3SA 1R4XA 4CSSA 3LZNA 4PJAA 1J1OL 5F93C 1FYTA 1RERA 1KB3A 2G5RA 1FGNH 3O4OC 4XCNA 4QIRA 3DK2A 5CSGA 3DUSA 4RFNB 1BVLB 1FVDA 2WWOA 1MQKL 3EADA 3CVIH 3U4EA 4AQZA 3F5WB 1YLBB 4WFGE 1RZJH 5EULV 4XCCH 1R3IH 1QW8A 2VL5A 1LE5A 2CO1A 8PAZA 1X5LA 2CKBL 5DD6B 3TYGL 3KJ4C 2XG5A 3PUUA 4OLYH 5DLML 4ODSL 4Z23A 4Z76A 3E1F1 5DC0A 4KTEL 1XCXA 3BLPX 4WKXA 4Y2OA 3S5LA 2WINB 3H3PH 3U0WL 3BAXA 3BZFA 1BGXL 1YYLL 2J8UE 4E5XB 4X4YA 3VD0A 2R1XB 4ZDHB 1IARB 2K8MA 2P49B 2EC9T 2D3LA 5F70A 3N5AA 2VR5A 3NIDF 3HRZB 4PP2B 3CLEH 5T3ZD 1AQDA 1Q8MA 4YPGA 3IDXH 5D2LE 1E4JA 4NO2A 3IAPA 5C0IB 2NNRA 1OSPL 3QI9C 1NDTA 3M17A 3NDYE 4R4BA 2OXGB 4LVNC 2QQQA 4I0CC 3LVEA 1YVLA 1HESA 4QHUA 3TBSB 4XBMA 3P11L 1FVEA 4NPYA 3MLSL 1NGQH 4UBDD 2IANB 1AFVL 4W4OA 4XO4A 3DARA 4N3UA 4XP6H 2W65B 1OB0A 3ECUA 5JIHA 4ZX6A 2EIEA 3QNZA 4O9HL 5CZRA 5EC1B 3U46B 3K71A 3BUBA 3GXIA 1GOHA 1JYNA 4KK9D 3QA3B 1MCNA 2WXIA 3C60A 4P4KD 1CYXA 1AI1L 4EDWH 3F62A 2CCVA 2R29L 4FXTA 1LEKB 4OJAA 4S1QL 1KT2B 4CL7A 3CXHJ 4LFHD 3PP4H 4P3CH 5KBMA 2NY5C 4HT1H 1SOXA 1DZBA 2VN6A 4W9CC 3DJZA 4Y4HB 1MUJB 1N8ZB 2P43B 4NN5C 1Q9WB 4OJDH 4PSRA 2PO6C 1IAOA 3NSFA 2ATKB 1MW1A 3QUML 4QT5A 2PLTA 1Z9LA 3SDCB 2P48B 4H26B 4BK5C 2P5WD 5B1BB 2NSMA 4KQ4L 1OP5K 4U3SA 1OGSA 5D5ME 5EU6E 5KSAC 1INDH 2OKMA 4JCLA 1JIBA 4LLMB 4AE0A 3OSKA 5F0MB 1MF2H 5AG9A 4XCFL 3SDXF 2XQYA 2VQ1B 4F3FA 1TLMA 1P4IH 3VH8B 1KB5B 2OSXA 3ULSB 4JQVC 2WXMA 4ZS7L 4ZPTB 2JTYA 3ULVE 2E0PA 3ZSSA 3PIQB 3P0VL 2BVEA 2C9XA 2C8NA 3TV3L 5SV4A 4XNMA 3CSYA 4EE2A 2O4EA 2WB7A 4NM8L 4IEFA 5J11B 2TSBA 5I2IB 1FAKT 4FJZA 2WBWB 3FO1A 2R4RH 3BPOC 3EFFB 4FQ1L 2BCKA 5KOMC 1OWRM 4JB9H 1MZZA 1A4CA 1XB3A 1BQUA 3IKKA 4M5ZH 3QUZC 3BYYA 2YD7A 4HUVB 3I9AA 5I2IA 1JE6A 2V2TB 4PRIA 3LNHA 5HHQB 4A7SA 3K6NA 1XMWA 2XBZA 3HFML 5GGSB 1HYRC 1QSFE 3DIFA 3PIQA 4WHTA 4XWGL 1FAIL 3F7QA 2X2IA 4HGMA 4UV4H 4GW1B 3LRLA 5KZCB 4GW5B 4M93C 2YAMA 4EBQL 1IAKA 2YGNA 4ZK8A 4OFQA 1FL6A 4PGZA 3MRCB 2PWHA 3CK0L 2YUXA 2UXVA 1NJ9B 3ZYZA 3B7RL 3JTSB 3CX2A 3D39A 5DUPL 2YBRA 5HDBB 4KX9A 1SHSA 1MCIA 1V7ML 2F7OA 4KKBC 4MNQA 2A3TA 4R8WL 5E6YA 4C56D 4CDGC 4W4OC 2O1AA 1DANU 1IE4A 2F54D 4XXDA 3WEAA 1DCLA 2E3VA 4QHNA 2YD4A 4ZAKB 2C9RA 4YLCA 4OKVB 5JHAA 4BA0A 4XB8A 3ZHLA 5C70A 2CG9X 5C09B 3HE6B 1MCFA 3T0XA 3JVGC 1NFDA 3GBNH 2FECL 4DGUA 3FOMB 1DHKA 1HINL 4GP8B 1DJWA 1FNHA 1N18A 4DOHB 2ENYA 4MHHG 1CFTB 1MRFL 1E3XA 2FBRA 5DWUL 4Z7WA 4HJSA 3ETBF 4LCVA 4MAYB 2PO6A 1IL1B 3IKCA 4A04A 3O8XB 1IC4L 1A3LH 4RRPG 3OKEB 1MJ8H 2AZAA 3JBG7 4ZTOL 1OP5H 1E0OB 32C2B 3BWAB 3GWJA 2FJGA 4OF6A 4XBEL 4DFIA 1WZMA 1KBKA 4NPYB 4LKXB 4ZW5A 5C0RH 1T0NA 4ODBD 4UU9A 2I32A 3V4UL 5F9OH 1L9PA 5DVOA 1ZK5A 3V10A 1E9PA 2BSRB 3V0EA 5I16B 2LFEA 1LK3H 2ZAIA 1N0LA 2E46A 5IHUH 2MJWA 2QGCA 3QIBC 1EEZB 4J2XA 1QPPA 3A6CH 1UHVA 1QZ1A 4XMVA 3SKMA 2YPLD 1SHMA 2NY4C 1I9JL 1ZOXA 3D3VE 4TULL 1GGIH 3MUGA 1PIGA 4K7PX 4KO5A 2J88L 2YUZA 5T1JA 2HFFA 2WBKA 4L4TB 4E5XG 1GY1A 4BFRA 2J6WA 3HCVA 2DIEA 3AQZA 3B2VL 5D1QA 1MHEB 3QORD 4PG2C 3TIEA 5KSBF 1JI2A 4G8IB 2AMUA 1L3NA 4YAQA 2QKIA 3KYOB 4WWPA 1CQYA 1SVCP 2OYPA 3FUDA 5BVPL 3OWEA 3DOHA 4P46C 1YNLH 1L0XA 4PJ9A 4TTDC 4B5ZA 5D8JL 3ARQA 4PJ7A 2VZUA 5DDHA 3D3VA 1DQJB 3VXQB 2GC7C 1JD9A 1PNCA 4F33A 4JHZA 2P47B 5CEYA 1A6PA 1MHEA 3TIEB 3RVVD 4X5LA 5EIQA 3CVCA 4OD3L 3TN0C 4FFVD 4DKEH 2R39A 1RAMA 4FG6C 3OZKA 3OXSB 1JFQH 4QRTA 4BRVA 2ILLA 4BSJA 5HYSB 4YK4B 3KPRB 3ATAA 5JHLL 4LNVA 2NY4D 3G9AB 1XGTA 1QLEL 3DVGB 2Q3AA 4XGZA 1LEGA 4ZSOA 4ZJ9A 3ASOB 4IMKC 3HI1B 4B0MB 4HGKC 4I77H 3MUHL 1RSFA 1JWUA 4NNXA 3EYUL 4APXA 3CN4A 2AJVH 3FJTA 1BQRA 1EX0A 4KOCA 3IJEA 4Y4FB 4WV1C 1KJ2H 5C8JA 1IJNA 1AQKH 3BKCL 3X2QB 3KJ4B 3W57A 4NUGH 1U2HA 3HG1B 4X7EC 1OM3H 1NCNA 5JOFB 4J1UA 2YXWA 1VFMA 2EVJA 3GBML 1ZD6A 4LOEA 1DSFL 4UQ9A 1N12A 5B21A 2VGLM 4IBUA 3UPRB 1OB1A 4D2NA 3LB6C 1T21A 3H9SE 2YIHA 4NQUA 4BM7A 4NRYA 1BDYA 4B0MM 1ZGLA 3S97C 2ITDB 4G8FB 5IREA 4MMZC 3TZVA 4JFDB 3HE6A 3I9IA 1JK9B 1T1ZA 3SKOB 5F3FA 1J1XL 4ZYKB 4ZNEE 4K3HA 1MIML 4NQEE 3MFFB 4M6NH 4QWWD 2BSSB 3IDNB 5TPWH 3BAEH 3GM0A 4LSRH 1M1XB 4UQIM 1QSEA 3QWOA 1RPQA 1ORSB 2MQ0A 1DP0A 1S9XA 4GS7B 3N0AA 1G6RB 4H0IA 1EGJL 2WN2A 3S0PA 5A2IH 1Q0XL 4Y19D 2EJ1A 2OBGA 2QPDB 3BUIA 3LQMA 5KANI 2Q1EA 3L7EB 3SKOA 4XHJC 4DGWC 1ED3B 5HPMB 3FH8A 1F6FB 1DBMH 3ERXA 6FABH 4Z7UB 3DDGA 3N42B 5IB2A 4KH9A 3EFOA 5A6MA 2ZUQC 4GG6A 1ZSHA 1R3JB 1S9VB 1XTLA 1UYWH 4XN4A 3KLHD 2XY1A 5JOPE 4BE5A 4N5UA 3MRFA 5HHQA 2W80C 4FKEA 1KB5L 1FIEA 4X7TA 3FCUB 2NXYB 3ILQD 2JFCA 3SDAD 3TJHD 3V4PL 1FORH 2I07A 2AQRA 3B4NA 3GGWA 4XNUL 3H53A 5IIEB 5HHXH 4PV8A 3QIWB 3FH5A 4KO9A 4GQRA 2RBLA 4TRPL 1F4YH 4W4NA 1S7TB 4QRRE 3IU4H 1A4BA 2DQDH 5K9QG 2ADGA 1P69B 3LNDA 3QNYA 4O02L 5ICZB 1U3HC 1NEZB 4JO1L 2LV4A 1FFOA 1OCWH 2J8HA 4FNPA 5AW0B 3WE6B 1TETH 1O75A 1U8NA 2YPVH 1QFUL 3OKNB 5CKAA 3NEOA 4OLUL 4BGDA 4X99A 5KVFL 4HIHB 3UBGA 1HC1A 1T66D 3LQAC 4MXVE 3ABGA 3E6FB 2XVLA 1PY9A 4GT7A 4TNVF 2OL3L 2Z91A 4UMSA 4PV9B 5KSUA 3IFNH 5C07B 2CIIB 4KVCH 3C6LD 4OLYL 2AXGA 4XE0A 2CJUH 2BNUB 1DDHA 1NCJA 3L08A 3V0WL 2ZD0A 5EH1A 3H3PL 1DFBH 2YA0A 1GR7A 1I75A 4RAUA 2F2HA 3GSRA 4AQEB 5T1MA 1KIQB 4KBPA 4PGDA 5D7LA 3Q5OA 2W88A 3LDBC 5DK0A 4DEPB 5IVZB 4M6MH 1TVBA 4L2LA 5TE7H 2AQTA 2FK9A 3CXDL 3IDMA 2HT3D 4Y1AE 4Y9EA 4Y5XA 5T3XE 4JFTA 4QJ3B 4LQFH 3RY5A 1A4JA 2VUYA 1XF4B 3RAJH 1VHPA 4FMKA 1MKFA 4Y0GA 1AR1B 2HPTA 2VLKA 2WXQA 4J4PD 3HS0A 2WBJB 3MLSH 4MTMA 2VDPH 4QXGL 5I1DB 1W0VA 4FQXD 2CRIA 4JNXA 4FQLL 3K72B 3L2NA 1D5MA 3OKDA 3HMXL 2YA2A 3QUYD 4NZTL 4AEIL 5DHVH 2QDVA 2EIZA 1MW2A 3QI9D 1QR1B 4LEEA 3CBJB 3OSVA 4YHIA 3PWUB 3S4SG 1Q1JH 3AAZB 4PEEA 2FX9L 3MGOA 3VFVB 1A7RL 1ZHBA 2BHYA 4GPVA 4KK8C 4PJBA 3UTPE 4NQDB 1JRHH 5FB8A 2OSLB 3WL9A 1FPTH 4FN0A 3KCWA 2O61A 4BFIA 3VXOA 4BFBD 1DLFH 3FQWB 4XN1A 3N43B 3MUJA 1F6AB 3X13A 3BUPA 4WW1A 3QT2A 4GRMB 4MSWB 4KQ4H 2HN7A 2ZUVA 4HHWA 2KZWA 3ZE2E 3BRFA 5E6IB 3IB4A 3CG8A 3ZKSD 3DMMD 3V0IA 4V2CB 3W9EB 2PW1B 3WBDA 4ZAKC 2VUOA 4HKJA 2X4OA 3KPOA 2B5IC 3B7YA 3L3HB 2JQMA 3WFHA 1EZLA 2X1PA 3MSPA 2ZSWB 3SJVD 3M07A 2V2WB 4AIZB 1AACA 3B83A 1ZK9A 4RH4A 1N2RA 1CJYA 1HHJA 1THCA 4OU3A 1AD0A 5FO7B 3RGVC 1J5HA 1S2EA 4WJ5A 5JQ6L 4X7SL 5E7BA 3RWGA 4AYSA 2VAAB 4N26A 3GTNA 3ULVD 1CS6A 4MBRA 1UATA 4OM0H 3QEGL 2FHBA 3KPQB 3FT0A 1TXKA 3ZE2F 2YJLA 1X6LA 1E2WA 4JVPA 4J8RA 3T3ME 4RMVA 1OARL 2FX7H 2UZXA 4R5XA 4XO5A 3BSZA 4TXVB 5I1GL 1AXSB 3RP1A 4PJIA 4WWKD 4DJMA 5C3TA 3U4BH 3W3BA 2OMVB 4Y5XC 4X0NA 5MEQA 1C08A 5EIIB 4ODWB 4Y1SA 3VD5A 2BNRA 3ZZQA 1B9KA 3UYOD 4JFHD 3Q6FB 3H9HB 4NT6A 4XP5H 3NESA 4PRIB 5K93A 1I8KB 1JN6B 5I1CL 4MMXB 1RIHH 3OB0K 3UL4A 4KJYA 3CBKB 4K7FB 4YDIL 3O9WA 2X28A 3MXVH 2XG4B 4HETA 3V2AR 3STZB 1KGXA 3NCCB 2HFEA 3KXFA 6PCYA 1I85A 4OF7A 1PBYA 3GDBA 4I9WD 1DLHA 5DZVA 4H8HA 3PGCA 3G04B 3O4LD 2QTEA 3EBIA 3X3GH 3DX6A 2N01B 4BJLA 1S9KC 1U3HA 4HCRL 5DZNA 5FO9A 5IROA 3WMPA 3MU3A 3I6LD 4DK5A 5I15H 1JWMB 3L5XH 1IAII 3K2IA 3I3BA 1XR9A 4NP4L 4WHYG 4LEXH 2JV6A 4F20A 1DUYA 3D6GA 3OKKA 3B9KD 4JKPL 4MMYB 4RQQA 4NKIH 1QLRA 3QXDA 3U1QA 4GAGL 4ICXA 1RKRA 3QUXC 3PJSB 4MNQE 5HHVH 4CADA 3NAAH 3V4UH 3WJJA 5L9DL 5E8PB 1N59B 2ZYHA 2SODB 3UTTD 2NR6D 3ZE0F 2BHFA 4CC4C 5I1KL 4M61A 1WD9A 3NEEA 3FMGL 4R84A 4X8JA 3REVB 3GS0A 4B7IA 5PAZA 1UQSA 4LOUD 5D2NA 1T66C 4OCXH 1RJCA 4XPGH 2ED9A 1GYUA 5GGRA 1DL7L 3ET9F 2ENSA 3K1DA 3TPKA 5EF0A 3P9LA 1Q9LB 1PJWA 4AM0A 1J1OH 4MQ7B 4DEWA 4X8JB 3REVA 1G7PA 5F7FA 3WKPA 1TTBA 3HB3C 5HDLA 2IWEA 1I8MB 1BFVL 2L04A 3RDTD 5B39G 3NOIA 3G6JB 2ZXAA 1E8YA 3BVWA 3O3BA 1M7DA 3QYMA 3D0AA 1I3GL 3FQRB 2Y07L 3NCJH 3G9VA 4LKCB 4I0KA 3QGVA 1T4KB 4HJ0D 1PKQB 1UUNA 2DMHA 5I74C 1UM5H 5E2VH 4LL9A 4TYUA 1P1ZA 2R2BB 4JO1H 1WWCA 3IFOB 3QIBA 3AQXA 4YE4L 5C0BE 2H0PA 5JQHC 1OCWL 4RZCA 4F7MA 5IY5B 2O6EA 1J48A 1YYLH 3VDCA 4CMMB 2A9NH 1RK0A 5DXWA 2AK4D 4LU5L 4D9LL 2MSPA 1KTDB 3G6AA 3D05A 2UY6A 1ZVSA 3WS6C 2F5AL 2RAMA 3VGDA 1Q9KA 5GGTA 1BVKA 4LBEB 1T7VA 2V5MA 3L1OH 1BJ1J 4FFWC 1IGTB 4YC2B 4FP8H 2K3HA 3T2NL 1VIWA 2KERA 3PXLA 2F8OA 4HEPG 1BD2D 3UO8B 1BM7A 4KGLA 2CE6A 4LLUA 4GG6E 4N85A 1HNYA 4Q2ZA 3DDFA 5E8DH 1BVLA 1FVDB 3RWIB 5IJKC 2AQ3A 1IFGA 4MS8D 3B8SA 3WIHA 4XP9H 5DJAA 2CO4A 4IOSD 4PJAB 3U82B 3VSUA 3O6KL 3Q2WA 4FE9A 5D2NE 1HHHB 3BKCH 4OCNC 5AKTA 5HGDB 5I73B 5KTEH 2FBJL 4JRFA 5TDPB 5D4HA 5HHOA 1UADC 3QNFA 4YDNA 2FR4A 1MLBB 4Q6IA 1RD6A 2WNGA 1Z3GL 4K9JA 1RPKA 2HUEA 3FTVA 1M56B 4AMXA 5DFVC 12E8L 4KK5D 1ILSA 1FE8H 4V1DE 2MTAA 5D1ZA 4OGXL 3Q43A 3W11D 4F37K 4B27A 4F9LC 3D4CA 5I1JH 4P9HL 4Q6IB 1M53A 1D7BA 3RTQC 5GXBB 1OTUC 4D7PA 2OL3H 4L4VA 5K69A 1INDL 3V9EA 2WLLA 5CJXC 2AKRB 2BOBB 1SJEA 2OMXA 5T5FH 4NB7A 2Q7YA 1CICB 3AWFA 3MRPA 3ROOA 1VPOL 3B7TA 3BN3B 4AJ0A 1RMFH 1MCJA 1MFVA 2K3TA 1NKOA 4JFZH 4R83A 5SWZB 4BH7B 4ZMXA 3MLTB 1SN2A 4K71B 2MQ3A 5AAWA 3V6ZA 1J0JA 3TA3C 1PW3A 2KPWA 3WIHH 5BRZB 3ZQ9A 4X8CA 3FULA 5TE7L 4QLWA 5DD1L 4NNYB 2XLLA 3P4MB 4G8GD 1ZVSB 5C7XH 2O72A 1B0IA 4L8SC 1G43A 2H3NA 1U91A 4FCAA 5BXFA 3L4YA 5GS3A 3V9FA 2YWYA 4P46D 5A2AA 1MPAH 5E99L 2D7NA 2VKWA 4GUPA 1ND0A 2WXJA 4LCUB 2YKLH 1CE6B 1ZLSH 1CI3M 4GRLB 1U41A 1N5YH 3C5ZD 4NKDA 1S7SB 3CVHL 3IS0X 4L4VD 3MGOB 4HQQH 2E7DA 1CDJA 2WVTA 3WS6A 1TSHA 2FLBT 4M9OA 3VGEA 3VXME 2XNAB 4XBGB 1EMTH 3OF6D 4POZC 1KN2L 4TUOB 4XNYH 3WO4C 1HOCA 4OM0L 3SPVA 1Q1JL 4K5OA 3LKSB 2B5IB 2NY6D 2RACA 3HOGA 2IBZX 4F1ZA 4OLXL 4LP4A 4PJEF 5I5JA 3UMTA 1OARH 5ACZA 2BC4A 5KVFH 1JNNH 5I1DA 1KCSH 5CZXD 3OJVC 2G4GA 2M8XA 4FZEH 3WFCH 3N41B 4HHAB 5EO0B 4XO9A 3CU7A 3FU5A 2X6VA 3D07A 1O9VA 2NY1C 3ALXA 3LHPH 3RUGF 3T1FB 3KG5A 2YKKA 4S0TD 5CM1A 1QW9A 5CZXC 1VFBB 5KAQF 1IV8A 1F42A 2ICWI 1CFSA 2G9HA 3BD4A 3TWYA 5K1VA 2GI7A 5J6SA 3LB6D 1DZ0A 4GG8B 3ZDXB 4JGNA 1MI5B 3NSXA 4YVNA 1HINH 3Q9PA 5B8CC 1G1KA 3MBXH 1RJZA 5AEAA 4NERA 2BFVL 3F8UB 4P9ML 4X6DA 4OZGA 4JZJA 3QQNA 2AV7B 1UJ3A 4M6ML 4HLZH 3S2AA 4ONFH 2YRLA 5D96B 3N06B 4HUXB 4PJ5E 4HIJB 4TF4A 3N43F 3QP3A 1JZ8A 4JPSA 4FS0A 4R5VA 2GKIA 4EZJA 2WBXA 2E27L 2CPCA 4K9EL 3UBXA 3BYTA 5J0BA 3ARGD 5D70H 3UJJL 4TQEH 5CILH 2NXZB 4LSDA 3V6BR 4OLVL 3X1BA 3MCLH 5I19L 1JNHA 3GB7B 4I9WE 4HX1B 4W9EC 4APQC 3ZQWA 1IBFA 5DEGB 1Y07A 5TGBA 3DO4A 4LSUH 4GAFB 4JKMA 3ALWA 2AV7A 2FT8A 4L1LA 3Q48A 4TSCL 4X6DB 1HOEA 1RZ7L 2HWZH 1F45A 5IROC 1SQ2N 3EHBC 4YL9A 1VF5C 3L3KB 3L9YA 1Y0LA 3KLQA 3QB7C 5JYMA 5F8QC 1RFDH 1MCHA 3OR7B 3HPJB 1ZHKA 2JB6A 4IGBC 4NAMA 4P57A 2PP8A 4BFEA 3WLWC 1ZDQA 3BDXA 5HI5D 5I1CH 2KKQA 4BA8A 4PRBA 1D6VH 3X1FA 2OV0A 3VFRA 2Z93A 5KBDA 1RZKC 3LD8C 3QK0A 2PPDA 1JAEA 2WQXA 2IIJA 4HCIA 2MRYA 3S3DB 5E4IA 2PXYD 2A6JA 5EB9A 2BNRB 2I26N 2VDQL 3ULUF 4B9CA 1OL0A 2DEXX 3NIDE 4PRPD 1IGMH 2IPTL 5AVZB 4MLSA 2GJ6B 1N3NA 2VDMB 5HDRA 2X4SB 4EJ1C 2VLJE 4UM9A 4XMXA 5LDSA 3BC9A 2Q6WA 1FNAA 4KUCF 5DGRA 4HGWB 3FSAA 4TV3A 5HVHB 4M4RB 25C8H 1F4WH 5HJ3B 1AHWC 5ID0A 1CUOA 4HLZG 2UXGA 2XWCA 3ZKXC 1T1ZB 4FGMA 1Y7VA 3PHQB 4QY8A 4K8RC 5DJ8A 4GEJA 2G9KA 2NMSA 4N1EA 1XZ0A 1X9UA 2OSWA 2NQ3A 3GZOA 2YMTA 2WYTA 1XEUA 2WQUA 1LO5A 1USQA 3LNGA 1RUML 3ZT6A 3AXLB 2JJWA 3DVFA 1KJVA 4X4ME 5KVGL 4ZFGL 4Y9FA 1IVTA 1TITA 2DWDA 4ZZKA 3V6ZB 3BO8A 1OV8A 1A3QA 4J3SA 1XZWA 5CEZH 4DQOH 4HUNB 3RDJA 5SWZA 3QHTC 4FABL 1YQ2A 3DC0A 3GSOA 5D1XB 3MJ8B 5E03A 1BAFH 4N2DA 5AENA 5KAQG 4Z3TA 1LO4L 1UWFA 3WL9B 3FQ4A 4JREC 2P5WE 2A9DA 1RU9L 1SXZA 1LP9A 2AP2A 2RB8A 3NPZB 1LDPL 3V79C 4XMKH 2H2PC 2HVJA 5HYJA 4RSYA 4H8UA 1HXYA 4OZ4A 3F05A 1URIA 2PPAA 4DPAX 1CBVL 2XWBA 2GSGB 2IADA 1RXLA 3VXNA 3UDWA 2VSDA 1IC0A 2W9EH 3OKDB 4JZNB 5J1AA 3T0EC 4B9JA 1MG2C 1IQWH 2VITA 2VDOB 2IH9A 2X38A 4PUBH 3V4LA 3DX8B 4PP1C 2APXA 4M6NL 2A6JB 5E2TH 1TQBB 2IXQB 4LSRL 3ZMNA 5ISZD 4YHOL 2UZYA 3FO2B 4YBLC 2IGFH 1DO5A 2E9BA 2B8OT 4J12A 4MCNA 5DO2C 2J8OA 5CWSA 1EHKB 5JORB 4L3EB 4PVMA 3WO4B 4NZUL 1AVAA 1Z9OA 3FT3A 3V0DA 1YHPA 1ZT4B 3MJ7B 2Y5TA 4I3GA 3WKML 2R27A 3ULUE 3GHPA 4XPHL 2QLVB 2PCFA 4P99A 5D71H 4WO4B 4Q2ZB 4FP8L 3D8MA 3SE8H 2BIPA 2ZXGA 4DKDC 1S78C 2A9MH 5TE4H 5SWSB 3BVUA 4PHZA 1TJXA 4XCEB 2OFQA 4DP6X 1I7UB 1NEPA 3S2CA 4FERA 2KZKA 3FFDB 1JK8A 4NGHL 4B53A 3C60D 4P4KA 5FW8A 4N22A 3DXAD 2D4FA 3RGVB 8CGTA 1KGWA 3BDBA 5EF3A 5BW7A 2GITB 4HLJA 4XT1C 4A68A 5AB9A 4KRPB 3F7VA 4UILL 5CJBA 2J8UA 2WJ5A 3CVDA 3ZBMA 2VDNH 3QSKB 3T0AA 5FYKE 1MDTA 5L4FA 4OV5A 4P3DA 2HJKA 3K74B 2WNKA 4JANA 4M7LH 5G4OA 4ZUTA 5JDSA 1NCUA 1CXIA 4JQIL 2JKJA 2FWLB 1ZHLB 1J5IA 2LFGA 3D9AH 3MZTA 2VH5L 4S1SL 5KVFE 4JDVB 3VXSB 2Z35B 1JPGA 4PN6A 3RFRA 3KLKA 3PNWB 4FQCH 1E4XI 3PV6A 1HWGB 1GGYA 4GAJL 1ZLUK 2Z0UA 4GQ9L 1O5PA 2NY5L 3RA7L 4N8PA 2V9RA 1FL3A 1H6TA 3KXFD 4RGMC 3HHMA 5BO0D 3FDWA 4Z0XB 4N0CD 3VWKC 1H3PL 1SBBA 3MV7E 3QJUB 3TJEL 3MCKB 2IDQA 4WUKH 4MCMA 4IKLA 3RB5A 1C12A 3QZLA 3BKJL 1KEGL 3UO1L 2LTQB 3RUGE 4XXDB 3FN0L 4PBVC 1WF5A 1FYTD 4YHKH 4P59H 1JZHA 4YHML 5B1KA 1GVIA 1S9XB 3L16A 5FK9A 3W37A 4Q97A 4GRLA 4Z7QF 5ALCH 3M1CA 2AEIT 1BYNA 1JS4A 2CDEA 1CLYL 3OG4B 5KSBA 3W81A 1E27A 5F88A 2YD0A 5I6PA 2A6IB 1JV5A 4NLHA 4PJ6A 2Y1VA 5A1AA 1CVSC 4RBPH 5FYLL 2OI9C 2QPFA 4NZTH 4AEIH 3O6KH 1S7XB 1U6AL 2IBBA 3Q06A 4IMLB 1U3HB 5FDWA 4IRSA 2E7BA 3EYOA 2PPEA 4X7FC 3V5HA 1MWOA 1YEEL 5JNYA 1E3FA 1WGVA 3ASNB 3G5XB 3ECQA 7PAZA 1FBIH 3DO7B 5E6SB 1LO2H 3QEQB 3US0A 1F86A 1G5GA 3C60C 4X9GA 4EN3C 1THAA 1J05A 1NOAA 1KC5H 1BZOA 2DTMH 3ULAB 1DJIA 4UDTB 2EYRB 1HIML 3CX5K 3HFMH 2HT4C 2DWYA 4I4WB 1JSYA 3IDJA 2EDBA 3IF1A 3LN5A 1SYSA 3MRLA 3PWJB 4MB5A 1U92A 3CDGA 4MMXA 5C0AA 3AABA 3S3CB 3HHSA 5JMRA 1ORQB 3GSVB 3H9HA 2J1ZA 1AD9B 1GYWA 1I1AB 2WXLA 2V7HA 1MVUB 4F5CE 1HSAB 1CFNA 2A0LD 3GMPB 4PG9B 3QCTH 4ZQTA 3JWOC 1XGTB 4BH8B 3H0TA 4NO5B 2WZ5A 3OAYK 2OZ4H 3CXHK 3F7LA 1KMGA 2IANE 4J23A 3CQQA 3SBWA 1V7MH 1SXSA 1GZHC 4Z78A 5F1SA 4AXWA 1NPUA 1NCIA 4X7SH 3Q7JA 4AENB 3N41F 2A2QT 5TJWK 3QIUA 3OLIA 3IJHB 1QLFA 4BSWB 2Q3XA 2A6DB 2WO3B 4HG4J 1BLNA 4UM9D 5D7IF 3SYPA 2GVYA 3KPLA 5IVOA 3IWUA 1KZQA 1QWNA 2OMNA 3ZZLA 5IVXB 1CLOH 1WLHA 5SX4H 5J3HD 2BVQB 1G7QB 3IWVA 4GG8A 1WAAA 4R90H 4LZKA 3IDYB 3E2HB 4O51A 4KK6C 1QO3A 1CFSB 5GZOC 4PS3A 3FT3B 5I1HL 5EBLB 3ZDYF 4L3EA 3SEPA 5AKVA 4GIOA 3ZDXF 5JORA 2V9TA 4YGVB 3R06B 2X4OB 4LAQH 1J0YA 4XP5L 5EC1A 3U46A 1LXMA 2M83A 5LB1A 3J2PA 4NQXA 2W65A 3RZCD 2ROXA 5E6IA 2Q8BH 5ACZB 5GS0C 4RIRB 1RIVL 3WFCL 3W5MA 4A2GA 3TP4A 1J5DA 2L3BA 1XX9C 3DSNA 5GIRA 3QR0A 1JDCA 5D1QC 2X0UA 2XWBB 1HHIB 5IHWA 1ZVNA 4HFWA 5L6YH 4MJIB 5CEZL 3GQFA 1GGIL 3WFBL 1KFAL 4PJBB 3KLAB 1KXTA 4HYTB 3ZTCC 3UPCA 1UFUA 1A14L 2Y25A 4YHIB 3S8FB 3D1MC 4AT6A 1X6NA 2VRQA 3JTBA 1UB6A 3DV6A 4XODA 1TYRA 2R1XA 4MXQC 2OTWB 4N68A 4H25A 4XPAL 4Y9BA 2A6KB 3WFDL 3NJKA 32C2A 3BWAA 1M3IA 1YAZA 2A9AA 2W9LA 4AC2A 1AY1L 1FDLH 2LU3A 2Z34A 3QEUA 5F7AA 4QJ4B 3OMAB 1V3MA 1QSFB 4TMPA 2X4RA 3ES6A 2JELH 1ZMYA 2Q86B 5BZZA 3ULUH 2VLKB 1LE5B 4KJPC 4X98A 3UCQA 4AZ8A 5KYWB 5ITBH 1BJMA 5F3HB 2APTA 1C16B 2GIYA 4Y19E 3U4EB 1EGJA 3LXCA 3R1GH 4XMWA 4OUOA 4NDMA 1IGCH 1YMHB 1HNFA 1GZHA 1W72B 2QDWA 2XWRA 3L7FB 3SDAA 3ARWA 4DVRL 2KC0A 1FZOA 4QOKD 3CGTA 3GSWB 4YN3A 1NGXB 2ZP9A 3CFDA 5DO2D 1GA2A 5AOLA 4KRMB 1OLZA 2DWEB 4WFHE 1PX3A 3BKYL 3O41B 2VSMB 2YN3A 3RTLA 3CWGA 2IAMB 1KTLA 1CTNA 5FOBB 4DP7X 5J6GA 1NJ9A 4WK2B 5GRUH 4AM0Q 1LO4H 4DN4H 2CLVA 3WGUB 2OTUA 4GLRH 2VXSL 3MRCA 4LO9A 4HCFA 4K5PA 1ULVA 2OP4H 4DOHE 2GTZB 1ZT1A 4PJXE 3VGBA 1CT8B 1MCEA 4WK0B 1DBJH 4LHUB 5MI0C 4ALAH 5HHOB 1N64L 5I74B 3APCA 2VZ1A 1SXBA 1G6VK 3MRGB 3VFTA 2YMXH 3UBXI 1M57B 3O3UN 4ZBJA 4J6IA 4JDEA 1I7TB 5I5RA 2J5LC 3B2MA 4P3CL 5I1AB 4NI6A 3AUVA 3VGAC 3O9WB 2COVD 2DRUA 2VLRB 4WJG3 4PRDB 2V3DA 2VZVA 3D51A 5F7YC 3RZWA 1QSZA 2XQYG 3D06A 3QQ4A 1FZJA 4YUEH 1SFHA 1BQHG 5KSVB 2R2CA 4E9TA 1OGTB 2AXWA 2VXQL 3EFOB 4LHUA 5I30H 1UH4A 4FC3E 1FO0A 4JJ5A 1JZGA 3IMRA 4LCWE 2XKNA 3B6SB 3MLYH 2E86A 3KNBA 3RWEB 1NBYA 2W0LA 4PJXB 3RTQA 3BJ91 4I0PB 4JZOA 2FEEL 3VI4F 1TMCB 1MFEL 1IBZA 1WAAE 2YGOA 4MZRA 3WTVA 3B2PA 1MJUL 2YN5A 4NO0A 2EH7L 4C83A 4AJVA 5BCAA 2I9TA 4U3SB 3O41A 5C08A 2WWNA 1HHKB 1QR4A 4P9HC 2VQUA 3BT2H 5EZJB 5IV2A 3JWNG 2JKLA 3INOA 4H8WH 3FB7B 5E00A 4NO3B 1TVHA 4Z95H 3EGSB 2CJSA 1RU9H 5ALBH 4PJCB 3BWZA 1YEJL 3MYJA 3BQUC 1NUNB 3K8LA 5DFTA 3LKRA 2CBTA 1HXMA 3EFDL 4HIEA 3VRJB 1TF4A 2ZSWA 4S1RL 5FX3A 4KKNA 3K6DA 4Y2DD 5DJ2A 4X9FA 4EIZC 2PP9A 1AS7A 4KQ3L 2Q8AH 4HUKB 3VVVA 3WLWD 2E7LC 5GRVK 3IU4L 3W2DH 2Z31D 5JOFA 1G94A 4KTEH 2BOLA 3CLWA 3CDCA 1SDDB 3MODL 1VGEH 5CP7A 4YL4A 5EC2A 5H35A 3X13B 5ID1B 1DTUA 1LO2L 1GIGH 1U8PA 2O61B 2N7BA 4ZUTB 3VU2A 3LIUA 5JXAL 3MJ6A 1Z5YD 4JHBA 4JFQA 4KRLB 2MWCA 4HFWB 5K9KB 2BIOA 4X83A 5TH2B 1KNOB 3A24A 2X1QA 3FRUB 2OLDA 3ARGC 4GKNB 4YC2C 5HGHA 3KGUA 3OXSA 4QRTB 3GM8A 4NZJA 1U91B 5L7XH 1T3FA 2XYCA 4XN5A 4AYFB 1MAML 4MA7H 4XXCC 2X4PA 5JIKA 3ZIYA 1BW8A 2ZCKH 5C1MB 5KBLA 3GMRA 1H5BC 1UD2A 4MWFB 1ZANH 3HW7A 3KL5A 1A3ZA 4F8LA 1NLDL 4LLWB 3A6BH 1UKSA 3UTSD 1PZSA 5K1JA 1KFGA 3LPPA 4NHCH 1ONQA 2NSXA 3BUYA 4IM8A 1WT5C 3JWNH 4FZ8L 4G42B 3IYLW 4DPRA 2K45A 1R3LA 1NL0L 4FZEL 5GISL 1KTRL 1RVFH 4R90L 3F00A 1GYAA 1OF0A 2CHZA 2UZYB 3FO2A 3L6FB 3QULB 4OKDA 4FA8A 5CUSL 5D2LB 3U2JA 2YPKB 1WT5A 4CNIA 1S3KL 2YGVA 5MEQB 3P3UA 4G6FB 5A43C 2P28B 3UGUA 3B7UX 2EYTB 1K85A 1Q72H 1R3KA 1ZE3H 2WV3A 3FCTB 1JHKH 5GGVL 1RZFH 1ZA3B 1KLGB 4KTDL 3DIVA 5GGRY 3D48R 1RIVH 1QNZL 4HAKA 3ARED 4XE5B 2FSDA 1ZTXL 3KDMA 4WUKL 5IB3B 5L8KB 5I71C 3VFSA 3VW3L 5ICZA 1KPRB 3BKJH 1KEGH 5CIPA 3IF1B 4N8VA 3LPOA 3P73A 4MJ6A 3D5OF 5IT2L 4UDTA 5DVMA 3EBHA 1T83A 3QXAA 4M6AA 3KWWA 3RY4A 1UOKA 2J57A 3NIGE 1PCSA 3G5ZB 4LDLB 3IXTA 4MMXC 2DQJL 2A5UA 3ECVA 1R5VA 1RUQH 2HB0A 4ZMAT 1PU0A 3NGBB 4YLQT 1TTCA 2AEPL 4JN1H 1G84A 1RFDL 3Q13A 2D8KA 1XGYH 4MSWA 4U2ZA 2X10A 2R9HC 4ODHH 1OPOA 4AEHL 5ECJE 5ESQA 1JV5B 2XPZA 1JGUL 2VZTA 4PM1A 3E80A 3MOAH 4NOBA 5DO8A 5D7LE 4L1HA 2ZUUA 1E6JL 1TZOA 7FABL 5D4JA 4KU1A 3QXWA 1M1XA 4RMWA 5IB5A 2FD6L 4MD0A 4YE0A 3REWA 1WIUA 2XN0A 3L8QA 5IJVB 2DWTA 3HS9A 3QFDB 4OR1A 4WWKA 5DHVA 1IGML 4JN2B 1XCTB 2AEOA 4H0HB 3STLB 1BPVA 3ZL4H 1DQLH 1HDMA 2J7LA 2E9GA 1YC7A 3SBRA 5CFAA 3GINA 4DSYA 3VFUB 3FTYA 1OP3H 3MRBA 2XC8A 1LP9E 1PJ9A 3QZWA 4IBYA 5JW3H 1JZ3A 4G6KL 4L3CA 4S11A 2UWEA 5HYJE 4B9FA 3KEHA 4Q74A 3K8MA 4ZNEA 2HFTA 5I6MA 2IGTA 2G2PA 4ORGA 1XF4A 1A1OA 1NDGB 1B4TA 1TQUA 1OE3A 1A6UL 5D1QD 4O02B 2CHWA 3HC4H 4OGQC 4PWHA 3QS3A 5CAYB 1N7ML 3N44F 3O3AA 5HI3C 4WTWA 5D7LB 1H15B 2H7WA 3ZVVA 4CU8A 3CSYB 4JY6B 3L5IA 3IPBA 2NY0B 4NUJB 1RUAL 3X17A 1D6EB 4GAYB 4BZ2H 1JXFA 3S96A 4N0FA 1LEGB 1QFWL 4FNTA 4BFGA 4G59C 1MZYA 3COOA 4XMTA 1IU1A 4I2XA 4E9SA 3KPRA 2AJUL 3OR6B 2F1EA 4OZFA 2YBGA 3VXSE 3EBGA 1KCKA 1NCDL 3ARTA 4Q0XH 3VVWA 5AL8A 3RDTA 1OGPA 2JIXA 5C09E 1GJUA 3N1QC 1MIEH 1WTGT 4P2RD 4YXHL 1L9QA 2EABA 4LCYB 1FFRA 3PWLA 2G2RA 2KH2B 1Y1UA 4GAYA 1LDPH 5IR1B 4GS7C 1MVYA 3CHOA 4K15A 4KNQA 4ZO6A 4HVBA 4XMLH 4K5NA 3G3LA 5B4MD 1AO7A 4MA8H 3NRFA 3TO2A 2DMKA 3CFKB 3IGFA 1CFVL 3TVMD 3FS9A 1K8DA 4JKNA 4JO4H 5BVPH 2G9HB 1NA8A 4FXGB 2NY2C 3CDYA 4LBAA 2DQGH 2R1WB 1UACH 2EKSB 4OGAC 1BOGB 4ABVA 4X7TB 4YEEA 5EN3A 3V55A 3EYSL 4X5RA 4KHXH 1S7WA 2APVA 4I0PC 4YMPA 1UVQB 5D7JD 5GS0L 2XN9B 4XPAH 3BDYH 4ZMWA 2X89D 1XBDA 1NBZA 3PNRB 4KUCD 2NR6C 2Y07H 1S3RA 2GBUA 4QXUH 1R47A 2GK0B 4X5PA 1MH5B 3L3GB 4QRBA 1HX0A 4XBGA 1KXVC 4MQXD 2OQJA 4U1JB 4H20L 1SMDA 4HFUH 1TENA 2MCMA 3CVHB 1D9KD 5I66B 2DYPB 5IHBA 3HRZA 3U7WH 2ZWYA 1A9VA 4N0CC 3VWKD 4HJJH 4M7ZC 3TBBA 3N9GH 5AOMA 1XBRA 2XACC 1JRHI 2OMUB 5I8EB 1SOKA 4L3FA 2VMDA 5IOPB 1JHTB 2VJ0A 2WXFA 4P4KC 2FJGB 4RGOH 1G7JA 3T2NH 3DURB 3EHBB 3CFTA 4R0LC 1I7RA 3PL6D 3OKEA 5CD5D 3VDBA 2EUXA 3K8KA 2DI7A 2CO6B 2R69A 2K1MA 4Y16C 3S8GB 2KL6A 4WTXA 5HBBA 1GKOA 3ARFC 2PW1A 3CZUB 1Q38A 1PG7X 3G5ZA 4K94H 3VXPB 3O6LH 3KWWB 4H88H 3SE6A 2OMZA 4O4YH 2R1YA 2Q7NA 4NLAA 2DKMA 5DJ0A 3HEIB 4MD5B 4FADA 5DS8A 1N64H 3S5LG 5BS0A 3NGBC 4E68A 5E8EB 3ZHFA 4XI5C 4OKVA 1UFGA 4M9PA 1DBAH 1HILA 4PB0H 2AKRA 2ITEA 2FDBP 3VFWA 4LGSB 4S2SB 2OCFD 4M4RA 3RVXD 2DJSA 4V33A 4OZGF 4PGJA 1E2VA 5D6DA 5MI0B 4NHUA 3GNML 3SKJL 1A66A 1H8SA 2X4NA 5I6KA 2WTRA 1UXMA 2GQHA 4JR9H 3EO0A 2C9AA 4PJ8D 3SDXA 3X1EA 2HT2D 5CF3A 3DSFL 1WJ3A 3PABB 1K5NA 4GBXB 4U1IB 4FTVD 4F2MA 3GTVA 4LL1A 2R83A 3T65B 3CN1A 2CRYA 4I88A 3V6OE 1H3XA 1D3CA 4IW4C 5GS2H 1E5CA 5L0QC 1P5UB 1MOEA 4HUMB 3S5ZA 2B59A 4MJHA 1SN0A 4WHTB 2NTSP 4KAQL 3LH9A 1E8WA 2FAUA 4GQPH 5GGSA 5HHNA 1Q72L 5FO2A 2YUVA 3P9MB 2EDEA 3NP3A 4M3KB 2ZCHL 3MCG1 4M5YH 1A4JB 5HDQH 2MH4A 3E3QC 1ZHKB 3E8VA 4JGUA 3GLAA 3C87A 3OKLB 4NUMA 9CGTA 1XMEB 5ABZA 2X41A 4RDQF 5AUMA 3MRRA 4HDIB 4KROD 5FF6A 2WP3O 1U8JB 4EKXA 4IEFB 1PKQE 3T0ED 4Z0BL 2YSTA 1QQDA 3D0LA 4ZPVB 2XX0A 5TGBB 4Z3JA 4FZ8H 3U9WA 4O58L 4X8XA 4IKIA 1DDHB 4FG4A 2VDRL 1ZE3C 4YO0A 3MROB 1J87A 1J0KA 1XO8A 3AM8A 1Q94B 3IDIA 4C4UA 4WY7L 2XFGB 3HN5A 4JFYA 1Z6JT 1WPCA 1P4BL 3FW6A 1AKPA 1NMCB 1EO7A 3MLUH 3S96B 5J6HB 1XH3B 1FG9C 4LKCA 4FQ2L 5FGCE 2YQBA 1TJIL 4YH6A 5C08E 3CC1A 3G6JA 5I0DA 3BESR 2X2YA 2DM3A 1GIGL 4LCIH 3ARDD 1G7MB 9PCYA 1BZ9A 4UQEA 3P4OB 4XMPL 4G9FE 1OY3B 4DVBA 4JKLA 4MA1C 2B1OA 3H2WA 1WZKA 4U1LA 1AR2A 3DTXA 1W8OA 2EVIA 2EINB 4LQFL 4L23A 3UDWC 1VFUA 2MKWA 3TASA 1XIWC 4P4RA 1ANUA 3QZOA 4M3HA 3RVTD 3CIAA 3LQZB 3QDGA 2JI1A 4LIQL 4Y2LA 1W80A 2CO3A 5FLUA 1BQHA 2H45A 4MJ5A 1F3JA 1O0VA 2CJ3A 2XETA 3NN8A 1NFDB 1I9IH 1KENL 1E6OL 1KXHA 5C09A 5EU3A 4IQHA 1TLKA 1AIFA 3X1GA 5BQ7A 3S48A 1ZANL 4G80A 4ZAKA 4NN6C 5ADOH 3NZ8A 4YDVA 3T6WA 1OWWA 4HKZB 4U6VL 1YRKA 3FTZA 3DX1A 5IP4A 5INCA 1OP4A 2OJ1A 1AQDB 3WEBA 4ZUUB 4EN3B 3HG5A 4PTUA 5E9DB 3MVSA 1CXLA 4DTGH 1XR9B 1BECA 4GUPB 4OSUH 4IDJL 3N50A 3DIDA 4KPHH 2Y7MA 1JZIA 3FAXA 4PJXA 3RTQB 4GSRA 2JB5L 3DECA 2AK4E 3SQRA 5D72L 2FWSA 3M86A 5KWYC 4Z77B 5TQ2H 3OHXC 1XF5A 1A4KA 4FQIH 5CP3A 2FIKA 2FJFA 4YSSA 4JUTA 5B39A 1S5IL 2R0LL 5AWNL 3FU0A 2Z7UA 2LE9A 3FHQA 1OQOA 2VABA 3CFMA 4GUOA 1A7NL 2Y22A 5T5NF 1CLCA 1WRFA 3IGLA 1WK0A 5JW3L 2XG4A 1QNZH 3PY9A 4CBZA 2F7RA 1CFQA 1EJOH 3ILQC 4MJ6B 1XT5A 3MRPB 4G5AA 4XPTH 1AY1H 1CLZL 1UM4H