4EIUA

Crystal structure of a duf3823 family protein (bacuni_03093) from bacteroides uniformis atcc 8492 at 1.90 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
242
structure length
242
Chain Sequence
PSETIWGEVVDEATGKRVLTDQGSEGIRVRLTELSWGDNVQHNPDFYCMMDGTFQNTKIFKGEYNVRIDGPFIPLVRENTDGTLLHDGSVNTEISGTTKVKFEVQPFLNVEFVGNPQVSNGVIKAQVRVTRGVSDEVFREKIQPMGNWKDEYLNVTDIQFFVSYSNTVGYRARDERWSSSINYEGKSFEGLLGKEVTIQSNGNVPSGRKVFVRAAARINYDTPVGSGTRRWNYSEPMEVLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized hypothetical protein
publication title Crystal structure of a hypothetical protein (BACUNI_03093) from Bacteroides uniformis ATCC 8492 at 1.90 A resolution
rcsb
source organism Bacteroides uniformis
molecule tags Structural genomics, unknown function
total genus 58
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2012-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12866 DUF3823 Protein of unknown function (DUF3823) N-terminal domain
A PF18003 DUF3823_C Domain of unknown function (DUF3823_C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 4eiuA01
2.60.40.2060 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4eiuA02
2B59B 3NJVA 1UWYA 1NKGA 4FXTA 4FL4C 5AQ0A 4EIUA 4IYKA 4WI0B 3NJXA 5K39B 3KCPA 3HN5A 1QMUA 2NSMA 4YOKA 4U3SB 3MN8A 3E8VA 2XHNA 5G5DB 3G3LA 1H8LA
chains in the Genus database with same CATH superfamily
5D7LE 2XPGB 3H42H 1QYGH 5GGVH 4JW3A 2PO6D 2J88L 3H9ZA 1R0AL 5C0JA 3VGEA 3MV8D 4HOWA 4HXBL 4LVNB 4KK9C 5A40E 5I0YA 1FL3B 1RP9A 3O4LE 4HSQA 4ODXB 1INEL 3U2JA 5JHDB 1E3FA 4OZIE 4XBMA 4XOCA 4QRRA 2CLRB 4DUXA 2ZSWA 4Z77B 2SEBB 3A4FA 2PABA 1RJCA 2E74C 3FQWA 1OTTC 1RJLA 4OFYA 1DJXA 2OX5A 3QEQE 4NFBA 3WFZA 4WNSA 4Q89A 4ODUA 1RUQL 5CD5D 1NCHA 1NPJA 3FO9A 4F2MB 2OYMA 3ARZA 4G5ZL 2C9SA 5IMMB 1KCUH 2JSFA 5MI0B 4DVRH 1EPFA 1G6RA 1UJ3B 3AXLB 4FHJA 4P4KA 1B3JA 4ICXA 3HZYB 3CLFL 3D4GA 1RUMH 2DDQL 3NDYE 4NXKA 3LRHA 3DVFA 2Z0BA 1FE8H 1GA2A 2A4CA 3R0NA 1DVUA 4ZUVA 3CBKB 4AQZA 2DD8L 5I8CA 3V5DA 1RIUL 3JUYA 3MBWA 1JZ4A 3A4DA 1YEGH 3PS6A 1A22B 1HZLA 2IAMD 4YH6A 1BX2A 1YEJH 1ORQB 3B43A 3EBIA 1WFNA 4EKXA 3TO4D 1MELA 5LAXA 4N22A 1QSFD 3MRHB 4PJAA 3D8MA 3I75B 3FCUB 1UXLA 3O2WL 3SKUD 1KTDA 2D03H 3F7RA 4U1HA 1KIQB 4X0KA 5ACZA 4NKDB 3V5KA 1TF4A 4F58L 2A6JB 2OSYA 2R39A 2AJSH 4U31A 4ZW8A 1E9QB 3WJJC 5KVEL 1A6WH 3CH8A 1N9PA 4BSJA 1IC1A 4OU3A 3M07A 3T77A 2W95A 2V9UA 1YEKL 3FS9A 2UZIL 5D4IA 4AH2A 3RPIB 1OGSA 4WI9A 2AJUL 4Q9RH 1T5WB 2FSDA 2HRPL 3Q13A 5I6LA 1BPLB 1HI6B 2IADA 2RTTA 4M7JL 4ONHA 2VZ3A 3O0RH 1PEWA 5DRNB 3CN2A 4X5WB 4WFHD 3WFEL 4MQXC 1KELL 3D30A 1T21A 1UKQA 2RALA 4NC1C 5C86A 3DGCR 2D9CA 2JJTC 5AWNL 5CJXA 4UQCA 4ABUA 2X2YA 5DJ2A 2WXNA 4CSSA 3PP4H 1OAKL 2BINA 1QBML 2PP7A 3D0VA 1NUDA 2YPLB 2YC1A 1KWGA 4PUBH 3VTAA 2F7RA 2EICA 3C5SA 1SEQL 4GAGL 4JPQA 4PAZA 5J1AB 1PBYA 2DQ6A 5HD8D 4GS7C 3OZ9H 4FABL 2UY6B 1X5AA 2VR7A 4OT1L 5G4NA 4MASA 5G5DA 1OL0A 3STBA 3VFMA 2BSCA 4XP6L 1NGPL 1U21A 4W4NA 1IGCL 5DC9B 3FONA 3S5LB 4F57H 1CLOH 1QBBA 2BVOA 4O5LL 1ZLSH 1PX4A 3KGSA 1BQ5A 4UMGA 5SX4H 4F37F 2WNGA 3RFZA 3DMMC 3RTQD 4DOHB 5CZVL 3RZCD 2QSTA 4N0UA 2HG5A 3KWVA 1ADQH 3N91A 4OD3H 4X8GA 4B9CA 4PRDA 5T1KB 2VC2L 2KBGA 1JJUA 3C5ZC 4IJ3C 1CGTA 5EEXA 3VFTA 3OPZH 4JFDE 5BVJB 2BSSA 3KWWA 2UUDH 4U7MA 2GSGB 2RA1A 1Y6KR 3FSWA 3LQZA 4NKMA 4R5TA 2DPKA 4NO0A 3TBTA 1KXVA 1U8LA 3RDTD 2Z92A 1FNLA 2MH4A 5FECA 5DC0A 3LKPA 4FQLH 4Q0XL 4KRPD 3CVCA 5MHSD 1TQWA 3RFRA 3QPXH 3UAEA 1A6VL 5DD6A 2ITDB 4KDVA 4P5TD 3MREA 1S3KL 4PSRA 3QISA 5C0EA 2VABA 3S4SG 4IHOB 2W59A 4AM0B 1A7NL 4P3DA 4BFRA 4UTAL 1TZHA 2XN9E 4N1CA 2HX7A 4JO2L 1HOEA 3GRBA 4RWYH 3QJHB 3PWJA 1LP9B 3EGSA 3F58L 4X7SL 5E08L 1I8AA 1FYTD 5B22A 4WSJA 5EEWA 3LNDA 5DDHA 2L04A 4OBSA 1U93B 2IMMA 3AW5A 3U4KA 3WTWA 1DQVA 3IU3A 3POCA 2ZKHH 4X6CE 1AS8A 4LCCA 1PF3A 4QXTA 1NANI 3SKNA 3G5VA 4AYDC 3GSUA 1VFBA 2JJUA 4YBHA 3DC0A 1V7MH 4NN6C 1WH0A 2HN7A 3CNKA 4P5MA 4JFYB 5MENB 3RZWA 1BAWA 4J3OD 1TYEB 3GI9H 1SF5A 1JPTH 2P5EA 2VNCA 3QIBD 3MRIA 2QADD 3NIFB 3JVGC 3TV3L 1WWBX 3QUYC 5L6YL 1OY3B 3TBVB 2NLJB 2DQDL 2OR9L 4H44C 1PFCA 2CR0A 3P0YL 1AHWA 1QTPA 2G0KA 4PVNA 4GSQA 1DP0A 4KVNH 1QFOA 1ZAGA 3BX7C 1XIWA 3VH8B 4XNXH 3S3BB 1MW2A 4JANA 5HJBA 1A4AA 3UIYA 2MEJB 3U7YH 3QQ9D 1G7PA 2EJ1A 4FL4C 4KXDA 3DUHA 4ODWB 4XRCA 4EIUA 3LEYL 3WL9B 2HVKA 3C8KB 4D7BA 4I9WE 4M3HA 1JF1B 4KZCA 1TVHA 3KD4A 2CKBA 5F7BA 1WBZA 3O6ML 4V1DE 1ZTXE 4L9LA 2ODIA 1GGBH 3AXHA 2YD4A 4LPUA 3ZKMD 2W80C 4E5XA 4KOCA 4HKJA 5EZPA 3KNBA 2J8UF 1ODAA 5H94A 4IJ3B 1EO5A 1UT2A 5GZNC 4D9LL 1E28B 2OL3H 3G3LA 5DMIL 5K9KA 1QBLL 3ASNB 4QT5B 1XH2A 3TU6A 4YE4L 5AAMA 4URKA 4PI2A 4HWZA 4PRPD 2N0KA 5AVRB 1LMKA 2FO4A 2E7LA 4GSRA 2DWDA 2OXGB 1S2EA 2VLKA 1J7VR 1TEFA 5CSZA 5D72L 3GTVA 3K2MC 2X88A 4ETQA 2R23A 5TDOA 3OSVA 4JFSA 2NX5A 5C0FB 2X1XR 3KPMB 5FM5M 5E4AA 2XG5B 4Q9BA 5CN2A 3J8F7 4E9XA 4F7PB 1NCBH 5E99L 2CAKA 3UC0L 4PVBA 2GFBB 5C08B 4JHAL 3PABB 2MFNA 3UBXA 3WEOA 1XWVA 2XPZA 4K8RC 4B97A 4Z6AT 2Z93B 3VD7A 8CGTA 5ETUA 5DUMH 2IGFL 4Z9KB 9CGTA 4K7PL 4KK9D 2NZ9C 1A7QH 2AP2A 3NCFB 3QUHA 4L4TB 4G7VL 2FX8L 4PJ5A 4E42A 3TTYA 1BM3L 1U91B 4RBPK 5D5ME 4NO5A 4PY7A 5IM7A 4NN6B 5AYUL 4RZCB 2XA3A 4H8VA 4P3WA 1XGTA 3QEGH 1LEIB 3IDYC 3NABL 1B4RA 1D6VL 5I0ZA 4GW5B 1IRAY 1T7ZA 1F58H 3SE3C 1NC4D 3QUYB 1HHIB 2Q2EB 2OQJB 1NFKA 3AGVA 4ZOCA 2WQXA 4MX7A 4BK5A 5F9JB 1Y18A 5KN5B 1MCWW 3PXLA 3BKJH 3WBDA 3RIFF 3ECUA 1NMBL 1MI5E 1J1XH 1JMZA 1F13A 4OCXH 2O5ZL 2PW2B 3GJFK 2VRAA 5DJ6B 5ID0A 1GS6X 1XGYH 4FL4B 4MAYA 4TMPA 2LHAA 1HXMA 4PGCA 5F7EL 1LE9A 5JA9A 5CEZD 4K73A 4LRIC 1E5UI 5T1MB 4CUCA 1SOQA 2K4WA 2A73A 1CFSB 2B9BA 2JE8A 2FEDC 2NY1C 3BT2H 5E2UL 2OSWA 3GFUA 1HH9B 4X4ZA 4AEFA 3B37A 3I6SA 1RUPH 4GP5B 3SBWC 2GYSA 5AD0B 2OXHB 3GHBL 4XN5A 3A6BH 4P46A 1FQ9C 3ARDC 2R29A 3O45A 2A0LD 4KJQD 4OGXL 5DHEA 2FNWA 43C9A 2WVVA 4LHUA 1BQUA 3CFBA 4N90E 4H20L 3WSQH 5IGXL 3UYPB 1P2CB 4MBRA 3O3AA 1JPSL 4KJYA 5ENWB 3RJOA 2ZKXA 3VI4A 3K5RA 4YSEA 4X5XA 1BQHG 1IJ9A 1LO2L 3DK0A 4OVUA 2WVTA 4HWBL 4HFWA 3WEXA 3ARBB 1SN0A 4DK6A 1TUPA 4UQ3B 5TE4L 3TT1H 3GUTA 5FDYA 4L5FH 5I0VA 4RESB 3OHXA 1EMTL 3KPOA 1A9BA 5IHUL 2LTQC 1TETH 4JN1L 4P9ML 5DF0A 5IVXB 4AGQA 3QYCA 3RWJA 4FNRA 3G04A 1ZTMA 3D1MC 2CWRA 4W6XB 3FZUD 1XL6A 2KLSA 3ABGA 4X6FB 3QHTC 5GGTL 3VJ6A 3TCTA 2BY1A 1KXHA 1OCWH 5EA0L 4GW4A 2H8PB 3MTRA 3SOBH 5A2KH 4GXUN 5FDWA 1A64A 1EXGA 1G1CA 2HJFA 2FWSA 2W07B 2X10A 4CNIB 4JAMB 4CVWA 5JYMA 4M6NH 4F8NA 4OTXH 1R5VA 4XH2A 3JV6A 3DLQR 5CGYD 5JIHA 1FV1B 1YEHH 4YAQB 1FLTX 1CBJA 1RK1A 3IDYB 2FUQA 3W5NA 4LQ1A 2KYIA 3Q7JA 4PJDE 4A55A 3MUY1 3VFUA 1R19A 2O6PA 5EFIB 3IM1A 3BUPA 2WNKA 4XPHL 2O6CA 2NZIA 2NY6C 4XO5A 1KLUA 4LNRB 4AITA 1KGWA 4L3EE 4Z7VE 2FGWH 4AKPA 4BHUI 4GMSL 1AGBA 1BPVA 2OL3B 4BDVB 4HIJA 4MNHB 3W11D 1JWMA 4IHBA 4KX7A 3WY1A 2X7LB 3SDDA 3WNLA 3L3JA 1PG7L 2XICA 1KACB 4OD1L 1QOKA 3QORD 2XQ0A 3ML8A 3H85A 4NQDD 3O2DL 2C3XA 3NG5A 2Y7SA 4JDVB 2GVYA 4LEXL 5T5FL 2EVHA 1U8QA 4G8EB 2UZXB 2D0FA 4JZJA 4KK6C 2DKSA 4DCQB 2F53D 4CVZB 2NY4D 1D6EA 4R6UA 4YDZA 2NY1B 5I76A 5I0WA 1XF2A 5I1LA 4N3UA 3U0PA 4BFFA 5DQ9A 5IEHA 3HLAA 3DUUB 3PLYA 2QPFA 3LQMA 3P2DA 1ZANH 4FTDA 3ZE2F 2P24A 4LCIH 4YSRA 3ARDB 2E9JA 3EO1B 2B1HL 1DLFL 2WINA 2ZXGA 2WOYA 1M05B 5HY9B 2LVEA 5F1NA 4APQD 4HWEH 3ZTNH 1OPGL 2X70A 3RGHA 5IBUG 4N2HA 2QSVA 3BLPX 1KGIA 2FIRT 1FBIL 1I1FA 4ZAKC 4NKIL 3KYKH 3U25A 1WE5A 1TZIA 4P4RB 4TL4A 5I26A 4B7LA 1WHOA 3BSGA 4E41A 3WJMA 2LTQB 2VMJA 1S9WB 3L5HA 5AW9B 4HHWA 4OJEH 3BFWA 3L3IB 3MCYA 1EGJH 3MI6A 4XC3L 2VJXA 1U8MA 4C4KT 1J5IA 4R3SA 2VW4A 4L48A 5KBDA 3QO1B 1M4KA 1SJMA 1JVOA 3OKEB 1M1XB 2ETWA 4GXFA 1IILE 4K2UL 3OC5A 3T0BA 3NA4A 3QZBA 4HUNB 1OHZA 1SLUA 4KTEL 1GGYA 4TUKL 1P4BH 1OB1B 5F7KC 1C12B 3A5VA 2XFGB 3IJ9A 4JL2A 5KSAC 1JWUB 2CIKA 1G7JB 1UWEL 5T33L 3G08A 1NOFA 4H88H 2BVQB 3D4CA 3N2JA 4A37A 2NY6B 3D06A 4IMLA 2CHXA 5CSGA 5C07E 4GQ9L 3TT3H 3TONA 1WD9A 4WUKL 5F21B 3FUKA 4NT6B 1ZA3B 1ZT1A 1I7TA 1IGJA 4JPKH 2CPUA 1FSKC 5DYFA 3SKJL 1GH7A 1OANA 1E4HA 2YRBA 5C09B 4QPEA 1I8LC 3V5HB 3X12A 2UZYA 2QLYA 1WAAE 1ETJA 3S36L 5DJXA 1OP4A 1IAMA 3B2VL 1YMHB 4U6TA 1W6WA 5KOVC 3BPOC 4C83B 2DMGA 1B2WL 4WUUA 1ZPUA 5EO1A 3MQIA 1DVFC 4NYLA 2ITCB 5E8NB 1E8YA 2WZPD 4IBLT 4H25A 1EO8L 1N64H 3JV5A 1XT5A 4HIIB 3BVWA 3NIGE 4H7VA 43CAA 4XP1L 3M88A 2BDNH 5JDSA 4NGHH 4LSVL 1BQKA 1AR2A 3D34A 4A7VA 1G0DA 5C0AA 4NQSA 3B9KA 2JKRM 1E4WH 1KYFA 2B9AA 4B7IA 1L9QA 4OQTH 1BZEA 2WBWB 4E9RA 3BHBB 4YSQA 4U1MA 4JG0L 4GKNA 1IKFL 1XD1A 2HA1A 1XF5B 4MJIA 1GZPB 3APNA 3UMNA 4ELKA 4B9FA 4IGBA 4ZAKB 4A2MA 3LD8C 1X5JA 3WEAA 1MRFL 3MJWA 5GGRA 1FP5A 2CO6A 3ISRA 5ERWB 1JXJA 3OXRA 4FD0A 5C0RL 1AR1D 5HDQH 3FRPG 2V17H 1R34A 4XHJD 1HFUA 3ZVVA 4RRPG 4MMXA 2OLDA 1AD9B 1UUSA 1QWUA 3PQYA 4CVUA 2WYTA 5C9JB 4R7DA 1GGCL 1PL3A 1QZNA 3DROB 1NCUA 4TKWA 5ILTL 3SPIA 5D2LB 5DUJA 1NEZG 4WJ5A 3U2IA 3JTBA 5F7FA 2XZQH 4QHKJ 4XWGH 4HH9A 1OT4A 2A99A 4LSRH 5AENA 3QYNA 1ZHNA 5HYIA 3MCLH 4S2SA 4LAJH 3WAKA 2OI9B 5CJBA 2OR8A 3B34A 1EA9C 1WIPA 1GGIL 1MWAA 4H40A 3FU9A 1H8LA 4QAMB 3NJKA 5HI3C 1FSKB 4DAGH 3UTOA 2Y4SA 2K4AA 2VR9A 3D18A 3JTTB 1JGDB 2GTQA 3SDAC 3VFNA 4ALAL 4G43A 1F4YL 2WBXA 3KLDA 4QOKE 3UAJD 2UWEF 3HN5A 1BQSA 3SOTA 2DKUA 3BPOB 3OMZA 4ONOA 1DVFB 1VZHA 1IC0A 1DUYB 3ARPA 1KPUA 3I2CL 4QI3A 4QF1A 5B39A 4NQEA 2QMJA 2XUWA 4LE8A 4Z7NF 1MCEA 2ENQA 3TIEB 1EEYA 3ZDYB 3I9GL 3TH3T 1QFWI 4YDLC 7FABL 5LXGH 1ASQA 3HZMB 3BAJA 4P2QE 1L5GB 1UZ8B 3B3IB 4N87A 1UXWA 4M93C 2BP5M 5ABAA 1CE1H 2VRKA 3WKYA 1LO3H 2DICA 1FNGA 2G9HB 4ACTA 2HFTA 1YJDC 4XCEA 2IWEA 4NRXA 4M03A 2DQEL 5DT1L 1BCIA 2NSQA 5F7AA 5C0GB 4TVPL 3LS5H 2IG2L 3LD8B 5L8KB 3RI5F 5ISZE 2GHZA 1ZV9A 3ESOA 3IFPA 1DQLH 2LE9A 4H2CA 1YYML 5DHMC 1ZMYA 5TQ2L 1BWMA 2ED8A 2CJTA 1N59B 1SDDB 4NWTH 5ELIA 3TN0A 1I1AB 5E1AA 4F8LA 4GUPB 3IAGC 1IMHC 2EDBA 2B7DT 3FO2A 4OIIH 2VLJE 4WW2A 3LNGA 4HS6A 4U6HA 2NYYC 3VXSD 4I18C 1PLBA 1MHPL 3GSNA 1A4KA 2FQGA 3CHOA 1SDYA 2CO2A 5KYXB 3QZOA 4JVWA 4Z7IA 2HT2D 4E9LA 4GO8A 3WTVA 4WI3A 3TNNA 4XXWC 4MCZB 4PBXA 1CBVL 1KB5A 2E47A 4G80A 4PLNC 1P7BA 5H8DA 3TO4A 1X5YA 1I9IH 4PJ7E 5A16B 4AUUA 2B77A 5D7LA 3EJPA 1QSFA 1TJHH 5E8EA 3U9UB 4XZUB 2GY7B 3MRQA 2A6KA 3BC9A 1YPZF 2V2TA 1EO7A 3CHQA 1TJIH 2D31A 4G1MA 3T4AA 1U8NB 3A0OA 1X44A 4X9BA 3T1WA 1FL5A 2YRZA 4OZIA 4RGNB 3OKKA 3PL6C 4G9FB 1Z5LB 4JZNA 4TOYH 5IJDC 1RK0A 1SOKA 2ADIB 2XWCA 4C59B 1TFPA 4MB4A 2HKFL 2OP4H 4ZMQA 2E9BA 1U8PA 1JERA 2Z35B 2AERT 3MLSH 4HC1H 5D1XD 4BZ2L 1H8NA 1CL7L 1KCLA 3D07A 4MJ4A 4ODVH 1HIML 2MWCA 5I17B 5EF2A 3QPKA 3KYOB 4LKXA 1B2YA 4OZHF 1HJCA 1VDGA 4I0PD 2KH2B 3EYQD 5L2JB 1CFBA 2VM3A 4UU9A 5I8KH 4MB3A 3VXOB 5DK3A 1PIGA 1EEZB 1X9RA 4YDLB 4PJBF 1DBJH 2CHZA 1UWXH 1XVSA 4ISVA 3LHAA 4KDTC 3NN8B 5DUBB 5EIQA 1MFUA 3X11A 1YY9D 3C60D 4U1NB 5C0IA 3G6JE 5CN1A 4M93B 4O02L 3PCYA 3LHPL 4IRZA 3MAWA 4GEIA 1DBAH 2K9UA 4UT9A 4HJTA 4FLHA 4YDJA 4KROC 4YPGA 4Z7OF 3D2UB 2V7NB 2X2JA 1VZGA 2AEQH 3BKML 4L3CB 4ZO6A 2Y7MA 3ROOB 1OP5H 5SWZB 4MDRA 4MZRA 3ZQ9A 1TKWB 4PJFF 4XO3A 4OFPA 3UTTE 1FJ1A 1IZKA 1M2OA 2QKIC 4XCFH 3FOMA 3R4RA 3LTVA 2VDNH 1INEH 5DA4A 1SYSB 1T1ZB 3CLWA 4J8RA 3D85B 1E3XA 4JVPA 2WVUA 4U6VH 1URZA 2VXSL 4HJGB 3UG4A 2H0PA 3NCWA 5IHWA 4ADJA 5JMOC 2UXVA 4QRUB 3CFJB 3NZ8B 3VXMD 5I6PA 4HULB 3S3DB 1RUQH 4I18B 4Y4KC 5AZUA 5BUGA 1KPVA 1NLDH 1N0LA 2QGBA 3FUDA 1ZRUA 2WWKO 4UZUA 4AQ8C 1CICD 4M8QB 5AOMA 1T4WA 3TCLA 1R9FA 3ZL2A 3OJDA 1I1RA 1KFAL 4JFOA 2UYLA 1G7HB 1LEKB 3CLFH 4H1LH 2CALA 4MXVF 1A47A 1X9LA 2DDQH 4IU3B 1G4MA 3OMNB 2DMBA 2BIIA 1UYWL 5EZOL 4X6EB 2NNFA 4P5TA 3MCKB 2VAJA 5E5MB 2DD8H 3AQDA 1XF3A 1DCEA 3PL6B 2A9CA 3CK0L 3IFOB 4MNQD 3SN6N 4LSSL 3VG0L 4DP2X 4GRLA 4QJ4B 2HUHA 3L3KB 1IL1B 2CDGA 3EJRA 3KJ6H 2WLMA 4R97C 5I5RA 1NUGA 4CW1B 3PHOB 5DO2C 1L0XA 2ZYSA 1G9NL 1ZHKA 4KH9A 1F41A 4S0SD 5DRWA 2PWFA 5I73C 5GGUA 1ZGLA 5EU7E 4DKAA 5D9SA 1CDBA 5E7FA 2VLRB 2GJ6D 4F58H 2WLLA 3DUSA 4ACPA 3CSYB 3SKOA 2B15A 5KVEH 1N6QL 4BKLA 3LKOA 4HK0B 4HUWA 4WRLA 1ESOA 5CD3A 3ZT7A 5BPPA 3KLKA 4M43H 3VGAC 3ZKNC 1GPOH 1PTZA 1UATA 2MPVA 1OLZA 4WI2A 4LLMA 5DJYB 1E6OH 3I50L 5J6HA 2N7AA 4JFDA 1DVSA 1G6RH 4JM2D 1Y6NR 4WNQB 5EBWA 2AJUH 2E56A 1E65A 4P2YA 1DJGA 2HRPH 1HESA 4KROB 4X4YB 4D94A 4CGUB 3VFOB 1ZPLA 1JHKL 2EEAA 1ACCA 2HT3C 3DX6A 4H8WH 1K4DA 3UP6A 2WK2A 4HOZA 2HFFB 3L48A 5F6IC 3O8XD 5AWNH 3P0GB 3T0AA 3QCTH 3VU2A 4QO1A 4YHZL 4U6YA 4HKXA 1PGRB 4HHAA 5FFOA 1KBVA 3C6SA 4LCWE 3MRMA 3VXRE 3FQXB 1SEQH 1JNHA 3D09A 3DHMA 3PWUA 5IB3A 2X4RA 4FKHA 3AMLA 2XN9A 4B9GA 4Y4KB 1MIMH 4LARL 4BUHA 4FABH 4OT1H 2Q6WB 1ZA6A 5C6WH 5JMRA 4XP6H 5AOJA 1K3IA 1NGPH 3P1VA 5CUSL 3UH8A 2CPCA 4X6CA 2QHLA 1M7IA 1RI8A 5E9DB 4L1BA 4BSWA 4O5LH 4HCRL 2TRYA 2MMXA 3OB0K 4J6RL 4GQZA 4X6DF 3LZOA 4LSPH 4XBEH 5KG9B 2IO5A 3CFIC 1LE5B 1BFVH 3D87B 4BBWA 1PLAA 1JFHA 4WI8A 2ENYA 2JQMA 4QXUL 1VLXA 4IU2B 3P4LA 1UM4L 1GHFH 2WO4A 3QPQC 4NM4H 2VC2H 3KLAA 5J89A 2NNAA 3WEMA 5C3LD 3EBAA 4DKFH 4TQPA 2BP8B 3K2UL 2NUPA 1EH9A 2JLPA 3BIBX 3COOA 3VVWA 4DPAX 2AHIA 3JWDH 1VJSA 1LK3L 1FNFA 4KUZL 4M6AA 4OFVA 3ZO0A 4GSDL 3T3ME 2NXYC 1C16B 2X1OA 2QVFB 2AV7B 3HHSA 4Q0XH 3X3GL 4WW2F 3BGAA 1SEBB 4UV7L 4JQIA 5BS0D 2VW6A 5I73B 2H2PC 4KPHH 1KIPA 4OLZH 1QACA 2PTUA 3BWUF 4TNEA 3FQYA 4PRHD 2P5PA 4BYHA 3CUPB 3TH4T 2CU9A 4V1DA 4YNYA 3L45A 1A7NH 1T20A 1YQ2A 3ZMNA 3N0AA 3VGAB 4NCC1 1S7SA 3KHOA 1TO5A 2B14A 5JW5B 1ULVA 5ADPL 3AACA 3OX8B 1SMDA 5AAWC 4HG4J 5LNEA 5HGAA 5TJWK 2OMUA 3P9MB 4XMKL 4L1DA 4XNBA 2I5YL 3HS0A 2EDMA 3VXUE 5BZZA 1INQA 1KJ2L 1NDGA 1YN7A 2DM2A 4R5VA 4X98B 1FN4A 2FQEA 3UCRA 2HWZL 3SCMD 1S5HA 4TLSA 4WWKB 4XXDA 1OF2B 4KHTL 4ZMTA 2RAMA 1ZDQA 2P28B 4WU5B 3IMSA 5F6IB 3UAAA 4H1LB 5KAQF 2CBOA 3WXVL 4YDIH 3GB7B 3FF8A 1FG2A 3NSFA 4BCXA 1FORH 1AQMA 2X3CA 4BJLA 2DQDH 2C3HA 2ZUWA 1T7YA 5DK2A 5F7DB 2R1WA 4ELMB 1KBPA 2YKLL 4FMFA 5T3ZL 3K46A 3L2LA 2H2SC 2DIBA 1M9SA 3BCFA 1EVTC 3SPHA 1IEHA 1VF5C 2E9WA 4HFUH 2J8UB 4GAFB 1QHQA 4PJ9D 4X9IA 3Q8BA 5GZOD 1HWWA 1U6AL 4XC1H 1NCGA 1WIOA 4F7MA 1SVBA 3ALXA 1DJHA 2KHAA 4KKQA 2G5UA 1TDQA 3W38A 3VFSA 2XCMC 5FYJE 2V5YA 5HHQA 4FQXD 5JHLL 3LPPA 5D5MA 5EUKA 4WV1C 4CU6A 3VXNB 1RZ7L 4YHPA 4D7PA 3EYUH 1E9OB 5I6MA 3V8CA 2WO2B 2QL1A 5JHMA 3P2BA 5EIVA 4TSAL 3U4BL 4PQXA 4NZRL 5E5LA 3CFQA 1QBLH 4PRBB 5EBMB 3CFKB 5LHDA 1G6RB 1S8DA 2A9DA 4KZEH 2VISA 4YWGL 3N06B 5FUOL 4I3RL 3U7WH 4AYMC 2WQ8A 5TDPA 3VI3E 5EEUA 4N8VB 1MI5A 4QCIB 2YUXA 3Q2LA 4LLUA 3GIZH 4HJJH 1W6LA 1FCGA 4F9LA 2FH6A 2BS8A 3BUQA 1OD7A 2KMWA 1WS7A 1MVUB 2EC9T 3O3DB 4OGYL 1OGAB 3ULUL 2CE6A 3HE6A 5I8EB 1QA9B 2OKMA 4PJ8C 3B1TA 3QXAB 4PIBA 1P7QD 3DBXB 4ZDHB 4K7PH 4BZ1H 2WGXA 4JPVL 1CQKA 4G7VH 1NEUA 1GGTA 1IV8A 3RWEA 4HLEA 4KMTL 3SD5A 1FZKA 2G4GA 4IRSC 4GKOA 3B2UD 2K45A 5AYUH 1E7VA 3MA9H 1ZHBB 5DMGD 2YQGA 3SB3A 1JRHH 2WJ5A 5I2IA 3NABH 3VWJA 3QB7C 3U1PA 1D6VH 3B2PA 3AQZA 4HBQA 5B38B 2WWNA 3VRLE 5H35A 3HPJA 1JK8B 3HNVL 5IV2A 3VWKA 1AP2A 3D39B 5D1ZD 5D4HA 4EI5C 2VC2B 2X9WA 1TYRA 4W9LC 3MKKA 4ZTPH 3LXUX 3MSPA 3CBJB 4M29A 1YEIH 2APWA 2Y07L 4PGDA 3EYVB 1I8UA 2COQA 3V6ZA 5C6TL 1JS4A 1XL4A 1GZQB 1N0XL 1G7LB 1KGCE 5B3JE 2QFPA 1BXXA 4Q7DA 4R7LA 2FCBA 2O5ZH 3K4DA 2EIMB 1T5XB 2VXVL 3SPVA 2P44B 4R26H 2CUMA 2JXMB 4Y16C 2AXFB 4BCZA 1Y0LB 4YHOL 2IH1A 4V2CB 2E4TA 4G42B 5BUPA 2CCVA 1RIVL 1LDPL 4WV1B 1F6AB 3OKOA 3QSKB 2F74B 2D3LA 2YO3A 4Q14A 4RDQF 3CIAA 5IJKC 4PJDA 3S5LG 4LFHG 3ATDA 1CE6B 3R06A 5CILH 3BO8A 4ADGA 5E6IC 1AS7A 4OGAD 3CU1A 4MVBD 4EAEA 2OJ1A 2FIKA 1NCWL 1FFNB 3PGDA 4WCYL 2EIZB 4M7KL 5CP3A 4I9XA 4Z7VA 4OGXH 3HRZA 4L8DA 4HUXB 1R3JA 3FB5A 4XP4L 3SDXE 3W81A 1S7TA 4A66A 3VQ1C 2XBZA 1JZEA 1RU9H 2QPEB 2RMNA 5FB8B 3ARGA 3P02A 5F1KC 4X99B 4QLWA 1I7RB 3HCVA 1TZAA 3F64A 4QRPB 4J27A 4NQCD 5EUOE 4JO3H 5CINL 2KERA 2IQAA 5HHOD 3F12A 2CUHA 3BZFB 5IG7A 1JCKA 2XZCL 5T1DL 1ACYH 3DO7A 1L3WA 3J27A 1WFOA 2CCWA 4TUOA 1MJJB 4QYAA 2WB1A 3JZ7A 3WFDL 3BVNB 1F4WL 4X6CF 3GMMB 4AVKA 4J3UA 5F96L 2CCLA 1S3RA 2AEWA 1G7IA 1ZLDA 1MUJB 5GRVK 1O9VA 3U2SB 1OB0A 1NGXA 4PCTA 2XNAB 1W0WA 5EA0H 4DZBA 8FABA 4Y8AA 1HSAB 2PPEA 2WBJC 3APCA 3EYFB 3MGOA 4YDVB 3BEWB 5IQLA 4ZX4A 1DDHA 1KV3A 3M17B 4IRSB 4YVUA 5I1DA 1T03L 3UJJL 3FU7A 5DD6B 5C2BH 3GPSA 2WTRB 3N1GC 3CZKA 1UXSB 1SHXA 5GRJL 3GSRA 1RHHA 2EZ0C 4Y1AD 2OW6A 4F33A 1U8HB 2H9GA 3E80A 1E8WA 3Q1SL 4XPHH 2Y2TA 3UPAA 4NN7B 4R8WL 4EI5B 2MNUA 2R29H 5BOJA 2OTWA 4HPHA 4XODA 2WZPA 1FRGL 1AQKL 2GHWB 2P49B 1XGPB 4TM9A 5DEFA 5IREA 2QZ5A 1M7DA 3GSUB 3OC8A 4N25A 4PJCE 3ULVE 1HCYA 3NA9L 3QQDA 3P4MA 4K71C 4OD1H 1VB9A 2P5WD 2XN1A 3E7JA 3ZE2B 3CGTA 3WS3B 2WXGA 3DI2B 1TVBA 4YGAB 1X5IA 3O2DH 1NCAH 5CLYA 4LEXH 3VW3H 5T5FH 5CZXD 4MQ7A 1A3LL 5IB5A 2AJXH 3VH8G 3S4SA 4BK8A 3JTSB 4Z0BL 5J4MA 2IPKA 1YCSA 4G1EB 4PREA 3TFKD 4DN3H 4C8XA 4NCC2 1U3HC 2RACA 1UURA 1CTOA 1LD9A 3QDMB 5E6IB 5IF0B 4LBEA 5IMOB 1NJ9A 1A1NA 4G8GB 2VWEC 1TYJA 2FBJH 1ZLVH 1J0KA 5C07A 3RY6A 5TTRA 4H0GA 3KBPA 4NIKB 3SQBB 1DLFH 3WKNA 2ZX7A 3QA3B 1DO6A 1RZ8A 1SOXA 3VCLB 3FTGA 3MBEC 3RL1A 1UVQB 4DTGL 2EYTA 2XXCB 1OPGH 4YFDB 3TNMB 2ESVD 2YD1A 5DHYB 4HU2A 4YHIA 4LEOA 3FT4A 2WNWA 1WAAA 4RNRB 3BW9B 1FZMB 2DKMA 4OLWH 4R2GC 4UI2A 2PYEA 3L7EB 5CIPA 4NKIH 3TC9A 3TA3C 3T8XA 5C0CD 3ZBMA 4JKNA 3GSVA 1N8ZB 3NJGA 2UUDK 5B1JC 4FKKA 1JHTB 2IANE 2NTSP 5JPNA 3F6IA 2AQRA 2C4FT 1JPGB 3QCVL 4XC3H 4AT6A 5D5MF 4EO5A 3IDJA 5AW8B 5SX5H 2OR7A 5SWSD 4H0LC 4L8BB 1TZ8A 2NX5B 1M9WA 4KJPC 4KMQA 5C0BE 1RJZA 4QRTB 4Y2NA 3WIHL 4XNUL 1D5BB 1AHKA 3D69A 5SV4A 1UADC 4KTEH 2KUTA 4TSBH 3UG3A 3K6FA 7PCYA 3O3EB 4GT7A 1CXHA 2V33A 4QHNA 1WG3A 3CH1A 2VN6A 5IOPA 5B21A 1XD0A 3OV6A 2M2DA 3QWRA 1KC5L 1NAKL 4XBPB 4YLBA 2AMUA 4M9PA 3QR2A 1LNUA 1JZDC 5LCVL 1A8JH 2D4FA 1AXTL 1GYUA 1P5UA 4WUKH 5LGJA 1EAQA 3ENEA 1Q38A 1XQ4A 2G2RB 3Q2CA 1NCJA 1V8HA 1OT2A 3EOAA 4K71B 4QAWA 4XN9A 2X4OB 4L4VB 2DW5A 1DDTA 1V5JA 3FOLB 1EJOL 1PCSA 2WXLA 4NRYA 1EHNA 2MKLC 4QY8B 4XTRC 1B2WH 1NAML 2YA0A 2BC4B 4FFWD 3IJYA 3PY9A 5JHDE 3RWCA 3QIWD 3MUZ1 3BYYA 1EO8H 4JRXD 1JZ6A 2VIRB 3U48A 4GAAA 5DU7A 1U3HB 3GNML 4XP1H 4MCNA 2G4EA 4YSCA 3O11A 1AXSA 1BVOA 3ULSA 1HHGB 3MUUA 4UTBA 2IDFA 4ODTL 4PWGA 1ZVSB 4TSCL 3WJLC 3L17A 3QUKB 1XR9A 3VSQA 4F2ME 5L4JA 1N2RA 4UQBA 4W9IC 1CF8L 5LUMA 5JPMC 4LBAA 5D70L 2YLKA 5JOPE 3LXCA 3MBEB 5FCUH 3QQ4B 3QUZC 4M56A 3LXBA 1WA1X 3STZB 5IQ9A 5C8JA 3QJZA 2QQQA 2PXYC 4LB8A 4ZUUA 4WFFE 1TJGL 1LWHA 2PYFB 1KLGA 1E8ZA 4QOKA 4PP1C 4R2GB 2PWHA 3ARFC 4NUMA 4HKZA 3TOPA 3NK3A 4PS4L 3TA3B 5C0RH 2X4NA 3DRTA 4RFOH 4LPVA 3WNPA 2NR6A 1MCDA 1KJMB 3QFJD 3W0WD 2WTOA 3IJEA 1FAIL 1O6SA 4YBQC 3Q8EA 3P9LB 4S1SL 3NSJA 4PJDF 1KNOA 1R75A 3DIVA 4P2QA 5FYKE 3NGBB 2WXJA 1O5PA 1Y1UA 1KOAA 2XN0A 4HIPA 2WUCH 4HG4K 3QIUD 4KDWA 1A0QL 4E9SA 4XMPH 3B56A 4CU7A 3IXTA 3EF4A 3QUXA 3GLAA 1MF2L 1F3JB 4HIEB 4ANUA 3VD9A 3EGDB 4GBXA 1UD2A 1A4JA 2EABA 2UWEB 3MRPB 3OKYA 4FYSA 4PYGA 5FXCH 1FI8C 3TF7C 1JN6B 4UQDA 1Z9MA 4I0PA 5DJCA 1OSPL 4Y4HD 2DH2A 3O81A 4G70B 5ISZA 1GGIH 4HH8A 1AGFA 3VXTB 5A3ID 1G7QA 4WU7A 3UZVA 1BQHA 3RNKB 3U30C 4OY9A 4ZFZA 1SXZA 2K7QA 3HW7A 4YOKA 5FYLH 1XB6A 1XSOA 5D6DC 4YFLF 2EP6A 3E8UL 4WFEE 4MCMA 3GJFA 4PB9L 4RAUA 2ADFL 1XZWA 1SXAA 4K9EH 1U9KA 3F6JA 3I2CH 4BH8B 4FXGC 1U8KA 3I9IA 4YZFE 2HJKA 2QJDA 2VQ1B 3C09C 2UZPA 3V4LA 5KYUB 5CFHA 1I8KA 1ND0B 2NY0D 3Q06A 2CNZA 3I9GH 1JIBA 4FQ2L 4YR6A 2P1YA 2FHCA 2NTFB 4U33A 2O26U 2FYYB 2AQ3A 2FNBA 1A7OL 3L4VA 5HI5C 2ENSA 2VL5A 4F3FA 3QUZB 3GSOA 4G8IB 4X83A 5LGHL 3CXHJ 3LN9A 4C4BA 1MDAA 3GUFA 1NGWA 1S7UB 4WEEA 4OM1H 2DQEH 1MW3A 4DOHE 4A04A 2X4SB 3ARFB 4XCCL 5F1IA 5JLZA 3ZO9A 4QHMB 5I1EL 1A25A 1MWAH 1MAJA 1YYMH 5TQ2H 1UFGA 1EZSA 3M1CA 4MQSB 1OSEA 1XEDA 5EZIL 1WWAX 3UTZA 1K8IA 3EDJA 3FHEA 3NCBB 4PRAA 1TQBC 5DK0B 1I7UA 3V6OC 5DMYA 4HUUA 2IXQB 1H9VA 1R47A 4F8PA 4BH7A 3QFGA 5ESQB 5E24E 4BSVB 1YPZB 3BIAX 1U8CB 3BN9C 4NNYA 4ALAC 3KDPB 2WMPA 1IGML 4W68A 4U4IA 2RR3A 4G9DA 4LHQB 5MEQA 1WHPA 4HIXH 1MFAL 2J43A 4YO0B 1EHXA 3MDJA 1NCCL 1RZGB 1SJHB 3CCHA 1CBVH 3I6GA 4YPJA 4UM8B 5FOJA 1IEBB 1Q9KA 3AGWA 4X5PA 2YPLD 5FV2A 3PDGA 4I48A 4ZODA 2CKBL 5BQ7B 4OKVB 2IBGA 3LSOB 1U3ZA 3WS6A 4OZHB 5TF1H 3WHXA 2JELL 3UTTA 2J21A 3ES6B 3P3TA 1LP9E 1WAAF 4L0YA 2COVD 1AKJA 3MRLB 4J1UB 1DQDH 2W0LA 3C87A 4DSYA 1KTCA 2BRQA 4TV3A 5E6YA 3B5GA 5BMFL 3FC8A 3ML9A 5IIEB 1OQOA 2ZXCA 3BYTA 2I9TB 3LKQA 4FHKA 1ZE3H 4PJBB 3GBNL 5E4OA 3U30B 4AZ8A 3UL4A 2HKFH 4L8SC 3LB6C 5T3XL 1FIEA 3NIGF 4TUJB 2XKNA 4NC1E 1LM8V 2BMKB 1J0YA 3JXAA 1X3DA 3SQOL 1A2YA 1S9VA 4HISA 4XCYA 3UC2A 2HCZX 1G1YA 4FXGB 4RFNC 5T1KD 3HR6A 5A7EA 5L4IA 4PVMA 1KXTB 3C09B 4UMSA 4YLQT 1IAKB 2PCXA 5KOMC 4XX5A 4PJFB 3O8XA 4EN3A 1E5BA 2IH3B 5JDJA 1LTXA 1D9KD 3F6LA 5JOFA 2AKRB 4Y9CA 1AH1A 3LHPH 4K23H 2GCYB 3S8GB 1HYSC 3K8LA 3ROLB 4LASL 4G8FB 3EGXA 1QZ1A 4DFHA 1JUFA 4DZ8A 3PP3H 1HH6B 4FE9A 1H15A 5K39A 3ATEA 2R2BB 5FO9A 1WEJL 1M2VA 5EPMA 1RVFL 4JREB 1DEEA 4JY4B 1YYLL 1G7MB 2BZ7A 5DD3L 1TQBB 4PJHE 1ZVNA 2B39A 2VUYA 3V0VA 2EC8A 5BO0D 5IQ7H 1QFWL 4Z0XA 4AENA 1ZE3C 3RLSA 3BP6A 2HTKC 2IBZX 5JIMA 2DQJL 5MEND 1XGQB 4GLRH 1FL6B 2F2HA 5LGYA 4Y5XB 1UZGA 3PPSA 5I18H 1AZRA 4NUQA 4R96A 2ROXA 3KPRB 5TK4A 4DKEL 2JLLA 3DWTA 5J1SC 3UX9B 3A6CL 1KY7A 1H3XA 2XRAL 5TDNA 1PFOA 3C6LC 2OJZL 5C08E 4LLYB 4BXVA 1JCVA 1FDLL 4DETA 5BS0A 3IXAB 2CDEA 3HB3C 1JD7A 5EZOH 3OTTA 3HG1D 4L4TE 1QD0A 4W1TA 3CK0H 3W37A 2WQAA 1B3IA 2E9GA 4LCWA 3VXRA 3QEHA 3EHBD 2HVJA 4KO5A 1T2QL 3LZRA 1BM7A 1NMCC 1KJVB 4L8SB 3GS7A 3IDNA 3CBRA 3F7YA 5AUMA 5INCA 3WE1A 3AMKA 1ITCA 3HNTH 2FTAA 3FCBA 4KK8C 4PTTA 3B6SB 4MYPA 3IF1A 1JYVA 5GJSL 3FRPA 4E68A 5KZCB 3WO4C 4RRPA 2ZOWA 2RGSA 2BVYA 2ZD0A 2D0HA 3PFUA 5B7FA 3B8SA 4Y19B 2QPDB 2YMXL 4OCWL 1XF4A 2P8PA 3V6FB 4DGYL 1N6QH 4URTB 2C1PB 3GSWA 1MFEL 4K3GA 9PCYA 3SO5A 2Q86B 4RMWA 4WTQA 5IK3B 4CDHA 2J1ZA 3VFRA 4B5ZA 3B5TA 1NEZA 4W4OC 4OAWB 2X87A 4FXKC 3JBG7 1SLXA 2LLLA 2XETA 4PP2B 3UXFA 3FB7A 1O5DT 5J9PB 5IROA 4ZFQA 4OM0L 1NIFA 2F0CA 3H55A 1UA6H 3IU4L 4KMLB 4A7QA 1U8IB 1K2DB 1FO0A 5ANHA 3EADA 1ET7A 4XO8A 4ZTOH 4X6DB 2VB5A 1WYJA 5GS0L 1JGLH 1RZPA 2WKOA 1C08A 2NQDA 3JWOH 1G0YR 3NCMA 5CMAB 2BFVL 3FJTA 3CFEB 1N5AB 4PJ7F 5EIIB 4KITB 3LYRA 3TS8A 2R0WL 4W9EC 4XPGL 3ARRA 1DLHA 1PLGL 1EXHA 1NFIA 2Q9OA 4R0LC 1QNZL 4KVCL 1G9NC 1CXFA 3Q48A 5DS8B 5FLUA 3VXUA 2BX5A 4HZLA 5IW6B 2ICCA 3ZSTA 2Y22A 1MH5B 1T7WA 3IJSB 3TVMC 3UO8B 2J3SA 5ESAA 2VQUA 1L7IL 3C6LB 1NDMB 1OK0A 1QHOA 3QZLA 5IVXE 3HBQA 4QXUH 1QLRA 5LAPA 3SKMA 3KE0A 3CSTA 3HB3B 4UDUB 1I9JH 3LV3B 4XO4A 2ZWNA 3V52H 5EEZA 2EDNA 4YL4A 1SBBA 1W91A 4EXKA 1GOHA 4ZQKA 1BGXH 3CC5B 3K2UH 3FRUA 5LB1A 2HT4D 1KBKA 3DSFL 5F89B 3RBGA 1NMCB 2C3GA 3MR9A 4KUZH 5AYQA 1ONQB 4JPWL 1YN6B 2R0LL 4Y4FD 2APXA 3KPNA 1K85A 3E0GA 1A14H 4FXLA 1MNUL 5DQDL 3ZPDA 4YDKH 3WO4B 4TNFA 5DI8A 2WWMD 4QD2E 3O4LB 1W72L 5ESVB 4AV4A 4N2EA 3G6JF 1S7RA 3NEOA 5CO1A 1KCSL 5CCKL 3KPLA 4YHKL 4C55A 1EXUA 3BH9A 4Q9CA 5E00B 2ATAA 1G9ML 2C3VB 3TX4A 2AW2A 1CPUA 3QEQB 4RH4A 1A9VA 1IC5L 3GGWB 2YN5A 2Y24A 1NCNA 4OBRA 2XWRA 3D2TA 3OKDB 4K0OA 4MA1B 4FXKB 5FA3B 5DXWA 2NSMA 4IOSA 5JO5B 2YIHA 4XMKH 2I5YH 1KCRH 1E40A 4CMMA 3QNXB 5BJTB 1KJ2H 1OM9A 2WKGA 3ORJA 2X4TA 4XNYL 3ARBD 2QLVB 2EE3A 3KS0H 2FVNA 1RFDL 3VI3A 2KT6A 3VSUA 2J5LC 2PP9A 4KHTH 4P99A 1K8DB 1SMOA 1TPXC 3T4YB 2FE0A 1FNEA 5E56A 4B0MM 1UCBL 1XMEB 2MRYA 2QBWA 3LIUA 4GQQA 4NHCL 5JORA 4G72B 5FKAA 4NNXA 2CO7A 1Y6MR 1NWOA 1JGVH 2ICWI 3FQNB 3HJEA 4Y2DA 1YMMB 3F7KA 4XXCC 2B3RA 4G6AD 3C08L 3FTVA 3MJ8A 2J2ZA 1T7VA 2GT9A 4JRYA 4U3SB 4ZUTB 3NZUA 5IB2B 3DPBB 4TNWF 3FTYA 3PREA 3WIIL 5JW3H 1TTRA 3LKSA 4P59L 4NZUL 4R0LB 5I1AB 4MKTA 1D7BA 5L2KE 3F2LA 4GP4B 3MFFA 3LS4L 3TVMB 4KQ4H 4ADIA 5CZRA 3QI9D 5JHLH 5KSUA 4PLJC 3TBYA 1HCZA 1RZ7H 4JFPA 5CJOL 4IOFD 4TQHA 3CFCL 3QNZB 1R17A 5T1LA 1L3NA 3NRFA 5KVDE 4TSAH 2ATPB 2Z31C 3WTUA 3TL5A 4TVPD 2P4AB 4NZRH 3NEEA 1JF6A 3N50A 4JKKA 4P23C 1ILUA 4OKDA 3T8MA 3WHE0 5HYQB 4J4PD 4ZXBC 2UX6A 3REVB 5B8CA 3X13B 5FUOH 2BZCA 4I3RH 2VITB 2RCSH 3U1QA 2BVUA 1JDDA 4LIQE 2FJSA 1A6ZB 4QRQB 3DX8B 5AKSA 2DL2A 3NJFA 2Q76A 2GEQA 2ZOLB 1AO7B 2WQUA 3R19A 1KCVL 2E75C 2YD2A 1YEWA 4RMVA 2WLIB 3ARSA 3QDGB 4HSCX 4ZW3A 4MDJA 3SIKA 1T3FB 2V4LA 1AGCA 2DQIL 3QXUA 1PVHA 3QULB 3LRSB 4JJ5B 4F37K 4OCNC 4OGYH 1XZ0B 3ULUH 5AW6B 5A3IC 3K6SA 4JK0D 1WBXB 2FSEA 1XTLA 5DJAA 4GQPH 3A4EA 1JTOA 2V2XB 5DTFB 3IMBA 4DUWA 3OF6D 3BGFC 3CG8A 3I74A 4PJIE 5DMKB 3ZDXB 2OTUA 2CXGA 4A6YL 4JPVH 4ZI8A 5ICZB 2BVTA 3DTDA 4KMTH 3TYFA 5MEOA 3WN5C 1MRCH 4KKBD 3V10A 1KTLA 4GG8A 2A9MH 3BVVA 4OCLC 2WVSA 3F8UB 3MMEB 3WGUB 3L5IA 2J5LB 3F62A 1TJXA 3BRDA 1TPXB 4PV8B 1U58A 3S37X 1E9PA 3CXHK 5EUOA 4NQVA 1UH3A 1E27B 3S0PA 3TIDB 2CIIB 2HJLA 3OG4B 3CC1A 1UWXK 3HNVH 2Y25A 1PZBA 4AE1A 1D2PA 3ISYA 1BVNT 3OQ3B 2WZ0A 5EO0B 4ZMZA 1MIEL 1TQCB 5IW1B 2OCFD 3EZJB 2VZSA 3T6QC 1R5IA 1WQVT 3L3HB 1XX9C 3OGOE 2UY7B 4JO8A 3KL5A 2BOBA 3LN5B 4HT1L 5BO1L 2YAFA 5C6TH 1N0XH 2NY7L 1SN2A 4P57A 1UB5A 2X0UA 3HG2A 1G5AA 1KPRA 3PNWB 4K5OA 1OP5K 1YUHA 1LK2B 4QHUA 3RGVD 4UM9B 2VXVH 5FW8A 3ZYIA 2H1PH 2IDCA 4HPOH 2PLTA 3SGKA 2O4EA 1NANH 3X14B 4DP5X 3GXMA 4IIQC 5ALBH 5LNDA 1RIVH 5E6UB 2P8MB 3FBQA 4U1KB 4JR9L 1LQSR 1OK8A 1V27A 1IBYA 3J2PA 3QE5A 1FFOB 2KZKA 3ULUC 4P5SA 2YAMA 5C09D 2Z31B 3CVDA 2ICES 2XWJA 4UBDC 3T3MF 1JZ3A 4GUQA 5IB4A 1NCWH 3FCSA 2P8LB 4W93A 4M7KH 4ZXBB 1PDKB 2YLHA 2JKJA 3PYCA 1F5WA 3FL7A 4LP4A 1DN0B 3MUGA 3QJTB 1S7WA 5D2LE 3UJTL 4UDTA 3K8KA 1ZK5A 1KJ2B 1I3VA 2AEPH 1BOYA 3ARVA 5TH2B 4AI7A 1IT9H 4N26A 2FWOB 1AGDB 4FTVD 3V9FA 2XVBA 3VDAA 4U6XA 5CINH 5DVKA 3IJ7A 4NQTA 2EKSA 3WXWH 1IFHH 1IC4L 3QHFL 4HMCA 2XZCH 1IFRA 4H0IA 4EZKA 1YDPA 3DRQB 1QFUH 3WI9A 1TJMA 1NGQL 1IGFL 3K81A 2OMYB 4LSTL 3IMUA 2VR3A 2D2CC 5A43C 5JIDA 3BGFB 5J3HD 5JQIB 1L0PA 4S11A 3SY0B 2EUXA 2J8HA 2VZ1A 3CXDL 3IYLW 4GW1B 5F9DC 1HZHL 3C2AH 1T03H 3GSNL 3WN5B 4AIXA 4LXFA 3U0WH 1OOWA 1PX3A 5E8DL 1QVOA 1NIEA 2J1KA 2YKKA 1P4IL 3GLDA 4HP5A 5GRJH 5LWYH 3L7FA 5F9OL 3D9AL 3V4PA 3MCG1 3ZDYE 1BJ1H 2HLAB 1KN2L 3Q1SH 4R8WH 2ZCHL 3UBHA 1JBJA 2L0DA 5K9QG 3QDJD 1TT6A 1FRGH 2OMUB 3EO0B 3QIWA 1U8JB 3QQNA 3Q44A 5BXFB 1Z3GH 4H1LG 4UOW1 3E1ZA 3NA9H 5CEXA 1FH5L 4JFXA 1GCFA 4CJ0A 3UTPD 3AY4C 4ZS6D 4OI8A 2X6UA 3I02A 4W9ZA 1YRKA 4P2OC 1OEZW 3OKNB 4L37B 4CU8A 4MWFB 3MUJA 1G1OA 5F7UA 3F85A 5C0BA 1OHQA 3N1PC 1DL7L 3AWGA 4IIQB 1HINL 1PQZB 1X7TA 3K1DA 3NACL 4NUGL 1Z5HA 3MNWA 1EJFA 4B60A 4YGVA 5BRZD 1CYXA 4FFYA 5DURB 3GMNB 5DEGB 3VI3F 4B0MB 3NJHA 3NK4A 1C5BH 5MERB 5I66A 2ZX8A 5JIQA 2B5IB 1IM3A 3W0WA 3U9PH 3CZGA 5ITFB 3ARYA 3RIFK 4PWJA 4IRZL 4DTGH 5D7JD 4QTIL 1B4JL 4UCFA 2XYBA 2TSBA 4UT9L 3ZR6A 2YA1A 3O3BB 3EH1A 2XPGA 4ZMNA 3B9EA 1J12A 5IT2L 3NCXA 1FNHA 3WNJA 4N8VG 1HYRC 4N2OA 3O6FC 3VQ2C 2JI2A 1SPDA 1FL3A 3DYOA 5INDB 4ODXA 3ZE1E 5JHDA 1IAII 1S8DB 2FGZA 4ONGL 4G9FE 4LPWA 2OM5A 2CLRA 2MCPH 2DS4A 2X6CA 3IMTA 3QCVH 3HMXA 2SEBA 3VACA 2DIAA 4Z77A 2FQFA 4QEGA 3TEUA 4ZW5A 2ZXEB 1BQLH 4IJTA 2WPGA 2BIPA 3MU3A 4F2MA 1N7ML 3WIHH 3TJEH 3P4OB 5F7YC 5IMMA 1WP6A 5EG6C 3A4AA 4PTUB 3FU3A 3OMIB 4CA4A 1BECA 1UJ3A 3AXLA 4QYOB 5EOCL 5GRWA 1URIA 5CEYB 3HZYA 2Y6TE 3KXFD 3L13A 5C71A 1J8HB 1I1AD 1JP5A 2VXUL 5B3JF 1RLBA 5EN2B 5LCVH 2GIYA 3SDCD 3UBGA 1IFGA 3L4ZA 4XNDA 2JJVA 3A24A 4U4BA 3AG3B 4QTHB 5B38G 5D1ZI 1I8MB 4D0DB 3BQUD 4KH2A 2WCPA 5KTEL 2VJ0A 1BZ8A 4JFHE 1A7RL 2QTVA 3AC0A 1NTDA 1GMIA 4PRIB 5AYTA 2X3BA 1ORQA 5HVGB 3DDFA 3LDBC 4HIQA 5SWZE 5I6KA 5GJTL 5D7SL 1UT9A 1CLVA 2K70A 3MRHA 4U2ZA 4JB9L 3I75A 4G11A 1NAMH 3I6KB 5IVOA 3WKML 2CHDA 3GSQB 1KIQA 1HDMB 2BNRE 1LO5B 4NKDA 3BGMB 3SDXF 2A6JA 4RGND 3Q0HA 4YEEA 2L8AA 1E9QA 1YO4A 1B0GB 1HVXA 4G6KH 3UROR 3T0VA 2VERA 2N1KA 3KGRA 3D3VD 1P7KB 3ZQXA 4DO4A 4GAYB 3HE7B 4ODTH 1T89A 4M3KB 2IV9A 4RAHA 3KM1A 4IDLA 4JG5A 3UPRB 4FEMA 5FLVA 1CF8H 5CLTA 3QG6B 1F86A 2GPZA 4P2AA 4QIRA 3PWPB 3RPIA 1T5WA 3K6NA 5DS1A 4LO9A 1MLBB 3IDIB 2A83B 1HI6A 5F97E 2H26B 4DEWA 2XWDA 1W8NA 5T3ZD 5DRNA 5FHBL 4X5WA 2JKNA 3ESNA 2CHNA 2FH8A 1CFTB 4AW7A 1PW3A 4AJWA 2R9HD 2NY2C 4IS6B 5IBTL 2ZJSL 3O6FB 4PS4H 5K9OB 4JFFD 4L3EB 4TQ8A 2OMNA 1S7TB 1TMQA 2YPLA 3FUIA 1EEQA 1BMGA 1ZY9A 3BZ5A 1BFOB 5DS2A 3X2QB 3MXVH 3EJQA 3QRFM 1PJWA 2ICEC 5J1AA 4ZG1A 4YHML 3NAAL 1OTUD 1E2ZA 1R1CA 1NQBA 4S1SH 2UY6A 2PR4L 4HJIA 2J1XA 2ILLA 1N12A 4FC3E 1XBDA 3TYGL 1T1WB 3PWVB 3DTXB 2LR4A 4QXGH 5I74C 1CD0A 1PKOA 3S5LA 2NOYA 1F3DJ 1Z3RA 2OMBA 5EORL 2VLRE 4M1CD 1MF2H 4OGZA 1H19A 3ULVF 4PJCF 1QSED 2A6DB 4TXVB 1AC0A 3AVEA 3G5XB 1OSPH 2BNQE 2CO3A 2RFXB 3ZTDC 1I7ZB 4WO4D 4L2YA 5FR3A 4Y0GA 4JO5A 5BVJA 4I1RA 1RIHL 3AABA 2AQ2A 2GSGA 2RIKA 3T6WA 1A7PL 4F7CB 3CZFB 2N1TE 3T2NH 4AV5A 5E8OB 2XKUA 4UBDD 1QX1A 1PCXA 3E8UH 3LPGA 2LAAA 4HZAA 1XF1A 3IAQA 3N42F 1X5LA 3MNZB 4XMXA 1OOAA 1LO4L 2EINB 4JQIL 3PXJA 1B0WA 4J23A 3KLSA 1K3ZA 2ITDA 1RZKL 3BT0A 5KEZA 2BCKB 2AJYL 3HI5L 1E5ZA 3RX7A 3WJJA 2YGOA 4IHOA 4AM0A 4Z5RB 4FQ2H 4IBVA 4FG6C 1VAHA 2QELA 3QJHA 4JL1A 5E70A 1LP9A 1HQRB 3NH7L 2FECI 1U93A 3IDMB 4M5ZL 5SWQB 4MS8D 5CHNB 5LGHH 5KBKA 2YWYA 1ORSB 2X2HA 5E9DE 1VZIA 3T0ED 4JFYA 2OMTB 4KNUA 1PY0A 4FRWA 5MENA 3BUIA 5CP7B 4A2DA 3FO0L 4BELD 5DO8A 5I1JL 5I1EH 2NY2B 1X5ZA 1KEGH 2DV6A 5ABDE 1ZLUH 1DHKA 4AIEA 4OIFA 1QUPA 3TBVA 2NLJA 1A4CA 3DSNB 3FMGL 3VX0A 4DQOL 5EZIH 4YHYC 5CEZL 2ZWSA 1W0YT 4PRNB 2X6BA 4AJ0A 2KS0A 3P73B 3K72B 4GI9A 2ICEB 4N3TA 3MRRB 2J6EA 5EF3A 2G2PA 2ZP8A 1BVKB 1CFNB 4GQRA 4XPBL 3VH8A 2P48B 1BZDA 3D4YA 1AC6A 1EAOA 3OHMB 4F80A 3ZZQA 1F1AA 1MFAH 3BMWA 5I74B 3H7BB 3MZGB 4ODWA 4CN6A 1NAMB 3H2QA 3JUZA 3UEZA 3WL9A 1S7XB 3C8KA 4A38A 1G6VK 1JF1A 1OV8A 4OCRL 3NIGB 3FFCB 4GRWH 3P3YA 5I0XA 2BJML 5DD5L 4RX4D 2JELH 4FP8H 3OJMB 4NBZB 2FX9L 3EG9B 4OF5A 4A7UA 3UDWA 1RZQA 5BMFH 2MHAB 1E28A 4NLAA 2F5AL 3FFOA 4FG0A 1UT1A 4QT5A 3CJJA 5I5JA 2EH8H 4NOBA 1CLZH 2F19L 2JK5B 3V9CA 5IEKB 3HZKB 3P2TA 2OXGA 2QHRL 4G8AC 5KBPA 5D7HA 2K9FB 3NZSA 4N0YL 2ZP9A 2WSPA 4OF6A 3SQOH 1MFBH 1NSNH 5C0FA 1MFDL 3EDEA 3KPMA 1MCIA 3GMQB 3NSYA 4YDMA 4AXWB 1P5UB 2XG5A 1LWJA 1MKFA 3MRCB 5F0PB 1AG6A 1OP3H 1SRDA 2V5TA 3SJVB 4F7PA 3M1BB 1DBKH 1PSKL 4UUJB 5GGRY 2AI0L 4NUPA 2GFBA 4POZD 1ZXKA 4ELME 5C08A 4N0CD 3PABA 4IRJB 4OCSL 3DK2A 1IM9B 5GRUH 2J8UE 4DP1X 4I89A 3STLB 2Z93A 3VYOA 5CM1A 1TNMA 25C8H 2HKAA 1BV8A 2C1OB 3BE1L 2FLMA 3QYMA 4L4TA 4JUTA 1AD0B 2QVMA 2OSLB 2AXGB 4ONFL 4YHLL 2GI0A 5D96C 5HGBB 2LLGA 3X1BA 1U91A 5D1QC 5EWIL 5JOEA 4RZCA 4LCUB 2H0FA 5CJQL 3RWFB 2H7WA 1LEIA 1JZJA 5FK9B 4D9QD 1WJ3A 5D6CB 2E76C 2W65B 2XLLA 5KVEE 3JV4B 4GW5A 1XCXA 1SY6H 2EDEA 2W1NA 3JVGA 3FSZA 4NPKA 3QUYA 3GHPA 3IBEA 2DLIA 1ZLVK 3SDYH 1ADQA 1HHIA 1RVFH 2AQSA 3QT2A 4Z7WE 4YHYB 2OQJA 5DD3H 1AYRA 1ZWIB 3JV0A 1H3WM 3KPSD 4LPTA 2AABH 1I85C 5F9JA 5IMLB 1QFWH 1FF5A 5B3NA 5KN5A 4TRPL 4ERSH 4LSUL 1A65A 3MV9D 5F0LB 2EXWC 1YSOA 5HYJD 2Z8RA 4QOKB 3FQ4A 3I6LD 2CJUH 4WWKD 2DQJH 3RNQB 3S37L 2A77L 5EO9B 4EDXB 3CV5A 2PW2A 3NEXA 5DJ6A 2ZT9C 1YEDB 4XP5H 1I1CA 2MSPA 2ORBL 2V6HA 3WCYA 3ZLQC 1AYOA 1HL8A 4DKEH 2FEJA 4U1SB 3G5ZB 3OAZH 3A6CH 2DTML 4XOAA 2WY3B 1OGAE 5T1MA 4FI6A 4BINA 2EO1A 2F6AA 2OJZH 2VR8A 1CFSA 1FDLH 2ODHA 4N5EC 2NNRA 3AS2A 1HH9A 2B2XH 4JFED 3RI5K 1IO4C 4EUPH 5SX5K 2XVGA 1XMWA 5AD0A 4C58B 3ZL1A 2OXHA 3KG5A 1TQSA 4AGLA 1QR1B 4G7SB 4RRPM 4PJXB 4HEPG 5GZNA 3HUJE 4GNKB 4D3CL 1T6BX 5TQ0H 1KUMA 3HR5B 4YZFF 1BVZA 1J5DA 1FFQA 4KOBA 3RX5A 2ZICA 4WKZB 5E6RB 2OMVB 4QRRD 3UYPA 1P2CA 2A74C 5F3FA 5ENWA 5HYSB 5AB2A 2Z65C 2JB5H 5IKCB 4OFYD 2VXQL 3GRGA 2DI8A 4LGPB 4AG4H 3D39E 2Y6SC 3ARBA 5DVMA 3NZHH 4Z95L 4UQ3A 4FULA 1XV8A 4DGYH 2NT1A 3L1EA 3G6AB 5IVXA 4GJTB 4YDNA 4OCYL 2NSXA 5BVPL 5AB0A 2VLJB 3QZNA 4P4KD 2JKIS 4QNPF 2VN3A 1RZIB 4X6FA 4IYKA 1MSPA 3B1UA 3NT0A 2WN2A 2H8PA 2HRGA 1MEXL 1H0DB 4IDJL 4JE0A 5DC4B 4Z18A 4CNIA 2W07A 5D96B 4JAMA 4J3TA 5D1QB 3K4ZA 3MRGB 5ICUA 4LDLB 4H26B 4F7EB 4MAYC 1FV1A 4MJJA 5DFVC 4PJ7B 4YAQA 5GXBB 2ZKMX 2HTLC 4NUJB 4XMVA 4OM0H 5FUZH 1UUNA 2WQRA 3VRJB 4GRWB 2VM9A 3IU4H 5EFIA 3SE3A 3QQXA 4OV6F 2R4RL 2W81C 5MP6H 1E3ZA 2FHBA 1UACL 2WD0A 1D5ZB 3AREC 4LNRA 3RKDD 4J12A 4HU8A 2VSKB 4OZGF 4N28A 4IW4C 3RVUC 5GS0H 5DVPA 2OL3A 4BDVA 3CN3A 4MNHA 3GIVB 2X7LA 4LSDA 4AQAB 1YG9A 2H1XA 3CZNA 1L9NA 1IC7L 2F54B 4CADB 1PLGH 2IEPA 2X9YA 3N1MC 4JDVA 1R24B 2DLTA 3LKNB 2UZXA 4G8EA 1AFVH 4ENEC 4XE0A 1LP9F 1GIGL 3H1ZA 1MFNA 1SGKA 4DCQA 1XCQB 4CVZA 2BHYA 3MNVB 1OKEA 4RCAA 2VDKL 4WI6A 2XV0A 2V9QA 1USZA 5KJ7E 5FWQA 3OHXC 3SBWA 3LNEA 2HMID 1F2QA 1SBSL 3DUUA 3LEVL 3G6JB 5F93C 1CGUA 5HHMB 4HUMB 5F2FA 5DD1H 3ARDA 3VFGL 5CR1A 3EO1A 3S5ZA 4OJFL 3DSFH 2G9KA 5FM8A 4XVSH 1M05A 5HY9A 3WIAA 3MLZL 2A74B 3VSVA 2ZNWA 2EH7H 4PMFA 5DQDH 4RGMC 2ZAGA 3D08A 1W8OA 3U6RB 2DQFB 2L7QA 1AZBA 1W72H 2CKNA 3VD1A 3WNMA 1RCYA 5CBAB 4B9IA 2PP8A 4A68A 5CCKH 4YHKH 4P4RA 1MCBA 4WWID 1G9MH 1I4FB 4WIQA 3MJ7B 1S9WA 3NCCB 5T8IA 5GS0C 3R4DA 5C97A 3L3IA 2ZCLL 4HAKA 1UOVA 1IC5H 4CKQA 2ZUYA 5EU6B 5E9AA 3ZE2E 3S9DB 3QO1A 2ATKB 2GTZB 3OKEA 4QRPD 1M1XA 1QI5A 4M1DL 2UX7A 2XTJC 4OLUL 3NCYP 3S6CA 3HC3L 2IQ9H 3NJMA 4ORZC 1OB1A 5MEPB 3MHZA 1DZBA 5TD4A 1C12A 4PJHF 5KJ4A 1JWUA 1UCBH 3B9AA 1G7JA 2BLFA 4EBQL 3MACL 2HRLA 2DLFL 3QDME 5BZDB 2BVQA 4NO0D 3PRZA 2E6PA 3CSBA 2GB2A 2LU5A 4YZWA 3S3SA 2AQNA 4EUPB 2AVGA 3AREB 2BH0A 4LVHB 2EACA 3QZPA 4NT6A 1ZA3A 1WCQA 4U05A 3GSXB 1ZK9A 3CPLB 5FCSH 5DFTA 4DHLA 1JZFA 5C09A 1O6VA 4KKCC 3ECBB 3V5HA 4U1JB 3MLRL 1DBBL 3DXAB 5E2TL 4LNVA 3WIIH 4NHUB 2VLMD 2XOTA 2CNYA 3EJZC 2CK0L 4NZUH 3D05A 1YMHA 4C83A 5I0DA 2XTSA 5CSBA 3THML 2ITCA 5E8NA 1PZDA 1BBDH 2AANA 4HIIA 3DVGB 4XVUD 2R0KL 1G9MC 1MCHA 3L5WB 4WEUD 3I9PA 2ITFA 4M7LT 2P5ED 4UIMB 4IBZA 4XPFH 4QJ3B 4JLRB 3DJ9A 3H9SB 4JDTH 4AMKL 1O0VA 2MOGA 1EBAA 3INUL 3HKZA 1MJ7L 3BHBA 3ISWA 5IQNA 3BPNC 3FFDB 4RGMB 1XF5A 1GZPA 1IE4A 1R3IL 1NIBA 1XIWD 2WLJA 3AZUA 3O9WC 4V33A 1NICA 4Y89A 4ZAKA 3KWUA 2JTDA 5DC2A 3LRGA 5ERWA 1QW9A 2ZOTA 4J3SA 3AADB 1T0NB 3HOGA 1XB8A 4NFCA 1Z1WA 3HG3A 5DRZB 4EI0A 1X5FA 2PF6A 3MRDB 1QKZL 1NEPA 1PJ9A 1MCFA 2PTTB 5C9JA 2WXKA 3FRPB 4A6YH 4HLJA 2XTJB 2CO4A 3DROA 1SUHA 1W15A 4NQXB 5D2LA 3EJCA 3E1F1 3DX4A 1T6VN 1OAZH 3UERA 3BD4A 1FCCA 3RHWF 1IQWL 2YUWA 1DQQB 5KSAA 5DD0L 3KCWA 2IPTL 4U1GC 5BOPA 4DO6A 5HVHC 3T6ZA 3ARUA 1JOIA 1UQSA 3CE1A 3NPZB 2VWEE 3K8MA 4JFZH 2VLKD 2XZAL 1MCLA 1NFDB 2DWEB 5AB9A 5J1TC 3OWEA 2IGTA 2NX5D 5IMKB 1O9ZA 5BO1H 4HT1H 5EU5B 2ZWKA 3PWLB 3FU6A 4UB0L 3WDJA 3B9KC 3JTTA 1BP3B 1JGDA 4AY0A 1I8LA 1BJ1J 4EOWL 2VDMH 3T3MB 5FFLA 4M62H 5IVXF 2IMNA 3PP3K 3SHSA 4DP0X 2EO7A 2FLBT 2D7PA 3ZTCC 1AACA 1RKRA 5DQJB 4Y8DC 2MKWA 5SX4I 2C34A 2IDUA 1DVFA 1XO8A 3E6FB 5EIIG 1DUYA 1S7QB 1W72B 4KXBA 3TZVC 2RD0A 4AL8L 4PJ5D 1UJTA 2X12A 3TIEA 3RAJH 4X4KA 2VN5A 1W2KT 4N2CA 3Q8FA 1F4XL 4MMXC 1EGJA 1S78C 5JA8B 4G5AA 4L4VD 4UINH 3HZMA 5E03A 1B9KA 2Y1AA 5IWLC 3O6LH 2C9RA 4YBLC 1L5GA 5E1QA 3ZL4L 2GBAA 1UZ8A 4PG9B 3B3IA 1WUNT 4ODHH 4X7DC 1WBYB 2R1XB 3UJTH 3FKUS 4YSDA 2QGDA 1CU4L 4G3YL 2G9HA 4YXLH 4D8PB 3BPNB 4PGZA 3CQFA 3AROA 2JV6A 4UAHA 5C0GA 3O9WB 1RLWA 2ZCZA 4MA3B 3I3BA 4N2IA 4KXAA 3RBSA 3G9AB 1UG9A 4PJ6A 1ED3B 4I2XE 4Y5YC 5I16B 3D25B 3K6IA 5DUPH 1JG9A 1SVCP 2AGJL 5HGHA 1N59A 1SDDA 4PGEB 1IGFH 1RMFL 2HKHL 4KKPA 1I1AA 1TTGA 4LSTH 4GUPA 4L18A 2D3VA 3CFDB 3FB8B 4XB3A 2DYPB 1J88A 1RULL 2WLZA 3OAWA 3BN3B 1JSYA 5KAQG 1LJMA 3QG7L 4EQ3A 5KYXA 3MODH 1OAXL 5E8DH 4FKEA 3NFNB 1P4IH 5DR5L 2CGYA 12E8L 3DYPA 4P46D 3Q3GB 4MCZA 5AW2B 3FYIB 3LQAH 1NIAA 5F9OH 4HBCH 4U1GB 5HVHB 4Q9QH 3IDGB 4KTDL 5A16A 1W8EA 3TJHD 5EU4B 3WNOA 2Z4QB 3U9UA 1S7VB 4XZUA 1TMCB 3L3DB 4AVJA 4XO9A 1S5IL 3BAEH 3O0LA 3ULVH 3MLXL 1U8NA 3HHMA 4D2NA 4OF3A 3IFNL 3S5YA 3L54A 4XB8A 3SO3B 4G9FA 1Z5LA 2KDGA 3ARQA 4MRCA 2UVFA 2ADIA 1IAOB 3GMRB 4DIXA 1H6UA 2BVPB 2Z35A 2IWGA 3BESR 4OQTA 4KTGA 5LBSL 4Q97A 4LQFH 3BLBA 4WHYH 5I17A 1P0SE 4DESA 3KYOA 5CD5C 4HF5L 1HINH 3ZSSA 5L2JA 3IDUA 1FFPB 2LT9A 4NUGH 3NACH 3TZVB 1EHKB 2JMRA 2B59B 1V3MA 3VXOA 5FGSA 1EEZA 4PW9A 4F20A 2JIXB 3L6FB 5H37G 3GRWL 3MLPA 1YPZE 1F8TH 1O6TA 2D3JA 5KVGL 5HHNB 5DUBA 2WLNA 3NN8A 2LU3A 1UFUA 4ZMLA 3T1FB 4YBLB 4U1NA 2EEBA 4A6YB 1H9DA 4J2XA 4M00A 3BAXA 1GC1H 2VLLB 1NGZB 1OGTB 1XXDC 4L3AA 4AQ1C 4MA7L 1QO3B 4W9CC 3IEAA 5IJBC 3D2UA 4OLVL 2V7NA 4L3CA 1VGEL 2IAMC 4PCYA 4PV1C 2KDYA 3ROOA 5E6SB 2M26A 5SWZA 3SDDD 3KYNB 4KGJA 4OZHE 1TKWA 3TO4C 4MCYB 4PJIF 1QLFB 1BD2B 3N6YA 4HWNA 4LSQH 4Y5YB 4C4KO 3M46A 1SYSA 1T1ZA 4TLUA 1XCWA 4ONGH 1CGYA 3D85A 3ESUF 4WHTB 1Y1DA 3IRZA 1HC1A 5ITBL 4HJGA 4PJBE 3EOTH 4X6BB 3MV7B 3AU0A 4V2BA 3TCXA 4QRUA 4BQCA 3CFJA 3NZ8A 4OJDH 3N04A 2G5BB 1E30A 4I18A 1D2OA 5DEJA 1N7MH 3MBXL 4YSOA 1ODUA 4F91B 2YPKB 3P30L 2CGRL 2AQ1A 4MKMA 4NWUH 4FNLL 4M8QA 4NZ8A 3RJDA 3OB0H 3IWUA 4UYPA 5I15L 5J7CC 4XXWA 3RIAF 4FFYH 4NM8L 5FGCB 1N5YL 1G7HA 1LEKA 4Z7QB 2VXUH 4IU3A 3UTQB 1S46A 4KZ0A 2F7PA 3PGFL 5JUEH 2PO6B 4X6EA 3MCKA 3MV8B 2Z1KA 4RISH 5E5MA 3SDXB 3PL6A 2R51A 1A7RH 4OCMC 3VX1A 3OLDA 3EIFA 3IFOA 1OCCB 5LN8A 4PLKD 3SE4C 3ZTEA 4E41D 3L3KA 1IL1A 3X1GA 4AV0A 4CW1A 1VCAA 1TU2B 5GJTH 5D7SH 4ZYKB 3PHOA 5HD8C 1RD6A 4XAWL 4HJ1A 3T8VA 4JB9H 1Z9SB 2B16A 4AGNA 3NSXA 3WKMH 4KNTA 1IQDB 4P0DA 1I3GL 1PPIA 2VW7A 2GI7A 3HN3A 3V6OE 2VLRA 3HKFA 2YAOA 1QATA 4LESA 5D2LF 3CSYA 3R1GL 4DJMA 4J3OH 4HK0A 5FV1L 1CIUA 2L4OA 1QRNE 1WUZA 3OKMA 4KDTA 4PI0A 3RTQC 3V0EA 3RZCC 2NY5L 2NY3D 3KPQB 5DJYA 3S3PA 1A5FL 4RGOL 2FWLB 3MFGB 3CN4A 3UP1A 3BUYB 4WNQA 1CDIA 1C7TA 1UOKA 4OW6A 4AQ1B 3M7FB 3IE9A 2XTLA 3KPRE 1YC7A 4PB0H 1RZJL 4X4YA 5ACMA 1ZGLP 2IAMB 2LFGA 5E2WL 3VFOA 4ZMVA 1YNLL 2QQLL 2X44D 4UT7L 5LXVA 4JS7A 3RDTC 3CHSA 3BZEB 2HFFA 1CDUA 5IBTH 1NBZB 3F7VB 1HEHC 2YOCA 1MCPL 4KRPC 4UV4L 4UILL 1QAWA 1WTLA 2E3VA 2WP3O 1ZS8B 4FQCL 4FQHB 2DYRB 4PJCB 4GB9A 4WUUD 2YBRB 3FQXA 4P5TC 4YHMH 3NAAH 4QRSB 5J8OA 2F68X 1TCRB 2DQUL 1D7FA 3VGGA 4BGDA 4NSKB 4Y4KA 4CBZA 4RSVA 3ZMRA 5DVNA 3ZDYF 4HC1A 2GEEA 2Q6WA 3WY2A 3TYGH 3IBOA 1VPOL 3KPPB 3KWTA 2W91A 1WICA 3WOVA 4W70A 3DIFB 3MO1B 4Y19E 3OD3A 2Y5TB 4S1RH 5E9DA 3UTSE 1GGUA 5C0AD 2ZOKB 2AXWA 1R3LB 4X9YA 5KG9A 1LE5A 1G4RA 1ZHLB 3CU7A 4U3HA 3ZZLA 2Z4TA 2JJWA 3MJ9H 4J3OC 4IU2A 3FT9A 3QRBA 5DZVA 1WT5A 4HHGA 3QIBC 2WLYA 2C7UB 4AM0Q 1IAIL 2QADC 3CZUB 4MLIA 5FYLD 5IHZB 3IGFA 4IGBD 5E7BA 1DJIA 3AWFA 3FT1A 5EDXA 2OAAA 1KULA 2BP8A 2IOIA 1B0RB 4P05A 4XOBA 1A7PH 1PG7X 2J8OA 4JM2F 3T2OA 1O7DC 2XG4B 1PZ5B 2ZXWB 3KEHA 4G82A 2ZCKL 2R69H 4LLDB 5GRYA 1C16A 3WGVB 3PQYD 5E2VL 2AV7A 1AI1H 1GKEA 1SEBA 3N43F 1LO4H 1KFGA 2B4CL 3IMWA 1PD0A 4WFGE 3HS9A 3II1A 1JV2B 2IFFL 1Q1JH 3QQ9C 4X6DE 2IANB 2AJYH 2X89A 4M02A 4IKJA 3CUPA 3HI5H 4NQQA 4TTDD 1NMAL 1KG0B 3FN9A 4B9ZA 3RTQB 5A2FA 4NEHB 3RZCB 4JEGB 2GJZB 3L95B 3BVXA 5JW5A 3ZKMC 4X4ME 4WGVB 4C56E 5CN3A 4CVXB 1UEMA 2BOCB 3OX8A 1WO2A 4XMUA 4M5ZH 3ZYOA 3ZR5A 3GI8H 3P9MA 2N4IA 4X98A 2ITEA 3GPEA 1LL1A 3ZE1F 1MN4A 3WLBB 4MHHI 4WWKA 1OF2A 4FFZL 3MNDA 3Q6FB 3FO0H 3RDTB 3EYSL 2BSEA 5I1JH 4WU5A 1D7CA 1EV2E 3I85A 2NPLX 4H1LA 4PBVC 5JXAL 3N9GH 1MHHB 2XT1B 4LOEA 3GB7A 1CGXA 4KRPB 4J6IA 5HHXH 3V4UL 4DQOH 2A1WL 3N85L 5CEZH 5IQOA 4ABQA 3N41B 2LABA 3MOAH 4N0FB 3V9EA 4ELMA 4ZX6A 5I19L 1Q9WB 2V9RA 1F4AA 3FPYA 4NQED 4DN4H 3NPSC 2J8UA 4U3CA 2AK4E 1GJIA 4DGVL 1NCTA 1TZGL 2Y3NA 4OUOA 3WV0A 1AG0A 1FYTB 2CQVA 5F72S 1TEYA 2AZUA 4FZ8L 1C8QA 1O7SA 1H3VA 5DWUH 1N10A 1J48A 4EI6B 4R4FL 1KSRA 2ZIDA 2YBGA 1A1MB 4PFEA 1MG3C 1DZ0A 4OCRH 1HE8A 1ZVYA 3VXNA 1RZKC 1E9OA 3FH8A 2YHGA 4XVJL 1MCKA 3HG5A 2Y9RT 2OK0L 1Q94B 3KJ4C 3QIBB 2QADB 4BQ6A 4BFBD 4I5BB 1N4XL 4BA0A 4FOMA 4PRBA 5EBMA 1DO5A 3CFKA 4X5RA 5I1GL 4W9HC 1QTYT 3FB6B 1L4IA 2EDHA 3A67L 1C5DB 1DFBL 2YXMA 4N8VA 4N2GA 3S36X 4QCIA 3TN0D 4OH2A 2QGEA 2DQCH 3OBAA 4N0YH 4AX3A 2E7MA 4GO9A 1MFDH 3GMLB 1UKSA 1YVLA 3APMA 4EZJA 4OLXL 4QTFA 3B9VA 4Y7MA 1AIZA 1YEEH 3VGFA 3R7QA 1MVUA 4AMXA 6TAAA 3O3DA 3SGEH 1YMME 4PHXA 1OGAA 2J6EH 4JHWH 5I8EA 2D7TL 4OCSH 1QA9A 3HMWL 2PW1B 4QKTA 3QXAA 3ZN6A 3DBXA 4ZDHA 5D7LD 3BE1H 5FW6A 5AAWA 3HVDA 3LY6A 4YHNB 1GAFL 4F9PC 4XN8A 3TESA 3CVIH 3LH2H 1OM3L 3MLTB 4KJQC 5BRQA 2A0LC 3HC4H 4DP6X 5EWIH 1D5IL 3VD2A 2UXTA 4PPTA 1JXGA 1UM6L 4PRPB 1CDJA 1ZHBA 5AVVB 2EAEA 1JAEA 5A2AA 4LLWB 2VDQL 2QVKA 5B38A 3BP7B 4DK5A 1J8RA 1IKNC 3QEQD 1JK8A 5E94B 5J6SA 5DSCB 3HBPA 3KLHD 3D39A 4OFIA 5HDBE 5I23A 5D71L 2DMHA 1BZ7B 1S4IA 2UXFA 3EYVA 3QC6X 3H3PL 2B3IA 4TRPH 2GTWB 3NPSB 4AW4A 1GZQA 4N4YB 1G7LA 2E46A 2HLFD 2BIOA 3S37H 5KYYB 3FZUC 2FECL 1AO7E 2ZUXA 3FUMA 4L29B 2ORBH 1T5XA 2BM3A 3QDGE 2P42B 2JXMA 4JM4L 4N8PA 2AXFA 4MMZC 1Y0LA 3BSZH 4UNVA 1E2VA 2AJVL 5J0BA 4G42A 1F00I 4F9LC 4WV1A 2DTMH 1F6AA 4P2RE 2XWXA 1S9XB 2F74A 4FG2A 5CGYC 2YQBA 5AKVA 1AAJA 2I9LB 3KL3A 1SM3H 1CE6A 2HPOA 4KC3B 4ZFFB 4UTAA 3HE6C 3GDCA 1KGYE 2ZXAA 3ZDXE 1NC4B 2Z0UA 1FFNA 2EIZA 2HSIA 5KS9F 1W80A 4HUXA 1GYVA 2I7OA 5JR1L 1GMEA 2HP4A 1OW0C 4A7SA 2W9EH 3W11C 5FB8A 3RQ3A 1U92B 4X99A 1BA9A 1I7RA 4PVLA 4QRPA 1XAKA 3GBDA 2K0RA 3ZHDA 1HN1A 2QMKA 3CMGA 1TIUA 3BKYH 3QORC 3N5AA 4RVBA 4XPAL 5IP4A 3BZFA 5HGDB 2V37A 1GOGA 2F1EA 1PZ2A 4X7FC 1MJJA 3UG5A 2YD7A 4O9HH 3BVNA 1WISA 2PPFA 3GMMA 4FA6A 5FPIA 2NY4C 2NXZD 3BOVA 4KUCD 5BVPH 2FUTA 4PBWD 4EIGB 3HFMH 1MUJA 3U2SA 1INDH 1RPQA 4X4XB 3WENA 1CC3A 2XNAA 1U3JA 1NH6A 4K5PA 4OZGB 1HSAA 4YIQB 1MEXH 3EYFA 4YDVA 4ZFOL 4NZJA 5JZ7D 3BEWA 3M17A 4IRSA 4K3DL 2NW2B 35C8L 1UH2A 4P5KB 4ZPTB 2WTRA 4R7XA 1S9KC 1UXSA 1X9QA 4R84A 2YA2A 4APQC 2YSTA 4GRLD 3EH5B 1HZKA 3F84A 2VT0A 3IN2A 3RVWD 3UJIL 1U8HA 4WWNA 3V4PL 4W9KC 2R4RH 3FTZA 3NYKA 5IB1B 15C8L 2GIMA 4EI5A 2J55A 4JPSA 4JUSA 1UB6B 5HPOA 3P3UA 3MV01 1XGPA 2IDTA 3CMOL 5F1SA 4Z8FL 3T65B 2K8MA 2I32A 3FTUA 4GG6E 1IC7H 3WS3A 3Q05A 2OA9A 4L0PB 4M1GH 4MMZB 1IEAA 2YUZA 1FNSL 3JTSA 2UXGA 3WTYA 4JFDD 4G1EA 2VDKH 3BZDA 1A3RL 4K8RH 5CCGE 5IJKA 3L9RB 4GS7B 2Y06L 4G71B 4RZKA 2NT0A 3QDMA 4MZ2A 5E6IA 5IF0A 3AUWB 5IMOA 4G8GA 2CGZA 4AQEB 4MS6A 2ZPKL 3LMJL 1BXAA 4X8CA 3V0WL 4NCDA 4BZ1A 1J0JA 3QUMH 1A6UL 2G60L 3SGJA 1V54B 3SQBA 3KW8A 5EBGA 1AQDB 1ETZA 3QA3A 4HAFA 3VCLA 2DY2A 1UVQA 5IOKA 1KGJA 1RZFL 3TNMA 2VH5L 1COBA 2CLVB 3DMMB 4FFTA 4LHJB 5DHYA 3S2AA 3SYAA 1CD1B 4ELMF 3KZ8A 1WZ1L 3EZ8A 4RNRA