4EIUA

Crystal structure of a duf3823 family protein (bacuni_03093) from bacteroides uniformis atcc 8492 at 1.90 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
242
structure length
242
Chain Sequence
PSETIWGEVVDEATGKRVLTDQGSEGIRVRLTELSWGDNVQHNPDFYCMMDGTFQNTKIFKGEYNVRIDGPFIPLVRENTDGTLLHDGSVNTEISGTTKVKFEVQPFLNVEFVGNPQVSNGVIKAQVRVTRGVSDEVFREKIQPMGNWKDEYLNVTDIQFFVSYSNTVGYRARDERWSSSINYEGKSFEGLLGKEVTIQSNGNVPSGRKVFVRAAARINYDTPVGSGTRRWNYSEPMEVLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (BACUNI_03093) from Bacteroides uniformis ATCC 8492 at 1.90 A resolution
rcsb
source organism Bacteroides uniformis
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized hypothetical protein
total genus 58
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2012-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12866 DUF3823 Protein of unknown function (DUF3823) N-terminal domain
A PF18003 DUF3823_C Domain of unknown function (DUF3823_C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 4eiuA01
2.60.40.2060 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4eiuA02
2B59B 1UWYA 4YOKA 3MN8A 3HN5A 5K39B 1H8LA 3G3LA 4EIUA 4WI0B 5G5DB 3E8VA 4FXTA 1NKGA 3NJXA 4IYKA 3NJVA 4FL4C 2XHNA 4U3SB 2NSMA 3KCPA 5AQ0A 1QMUA
chains in the Genus database with same CATH superfamily
4AQEB 4MAYC 4FFTA 4M7JH 2BX5A 5DJXB 3VRIB 1EJ6A 4L0YA 3MXWL 3JUZA 4U6HB 3M1BA 3MR9B 2WQUA 2IDCA 3JTSB 4MQ7B 3LJ3A 3FS9A 5D7IB 2IH9A 4YLCA 1XX9C 5D7SL 5ITFA 1Q1PA 4J1UA 2Y69B 3Q6GL 4EI6B 3P9LA 1IFRA 4ZFOL 5KS9B 1AKPA 4XXWC 3LXUX 4PJFB 3IDJA 1PPIA 3WTVA 1N8OE 2FWUA 3WFDH 5AZUA 4UILL 5GS0L 4U0RC 4U1GC 1B0RA 4JG0L 4P46D 3G5ZA 4YUEH 5EZIH 5DGQA 3T1FA 4FP8H 2D03L 2QADB 2ZSVA 1ADWA 7FABH 4IU2B 5BRZA 1J7VR 4U1JB 3C5SB 3ISWA 1HHJB 2YLKA 5MI0C 4GUCA 4PRPD 2Z65C 2ARJA 3FO0H 4XP4L 4L9LA 4TTGA 3A24A 1TQUA 3HMXH 3UJJL 3FQUB 2V7NB 4KTEL 4XPFL 1S9WA 2E4FA 5E94B 4OFPA 3KD4A 2AAVA 1E8ZA 4S1DD 2P42B 2OSWA 4M3HA 1S9YA 1E3ZA 4N85A 2NY5C 4K3DL 3VRJA 2QMJA 3ZPDA 2QZQA 1JTPA 5KBMA 1MUJB 2ITDA 1MCOL 3OMAB 2ITCA 3AGVA 2OMTB 4WHTB 3SDCA 2I9TA 1GZQB 3GSNL 5DJ2B 3QA3B 4GMTL 3GPEA 4ISVB 4TS6A 2J20A 3KS0H 4CC4C 4U33A 4QXTA 1ACZA 3Q2LA 3DDGA 3TYFA 1VIWA 5I75B 5FO8B 1JV2A 4GBXD 1WFTA 2EH7L 2XWTA 3L2MA 3MUGA 5EZLA 4C8XA 1RJYA 2IG2H 4AX3A 5I1KH 2YSTA 1R3LA 3Q1SL 3BZDA 1WBZB 1QLFA 1O6SB 4RIRA 1XEDA 1I7UB 4DEPB 12E8L 4Q56A 1GH7A 4JFZL 3WO4B 1I7ZA 3O3DB 3HKFA 4NBZB 4GKSB 3AREC 1MHEB 3NJJA 2KLTA 2BSTB 5DZLA 5AW8B 2B16A 5T1MA 1VF5C 1MJUH 3N41F 2XRAH 4K4KA 5CIPB 4U49A 4RSVA 3DDFA 3DBSA 1W8NA 1NFIA 4M29A 5FDWA 2NZIA 1UG9A 2PPFA 3X1GA 5C7XL 4G6AC 4KKLD 2V2WA 5I19H 3BCDA 3RFZB 2WCGA 3GZQA 1XCWA 4FG2A 4WW2B 4X8GA 4Y89A 1HQ4B 2JNZA 2E5EA 4G1EB 3VU2A 4BH7B 3ILEA 2EIZA 3KCWA 3C6SB 4WWKB 5JPNB 5ICXA 3SBPA 2M26A 5HYIA 5SWSD 3NOIA 2WTPA 3VI3B 4LIQL 1RZKH 3MRRA 4GEIA 3KXFD 4K3GA 4LPXA 5SX5K 1MI5A 4P9HH 2XWEA 2GAZA 4G59C 4JM2B 2K3HA 2XX1A 2X89A 5T5FL 3VI4E 5IFHH 2YGNA 4XPTL 1JUFA 1RZFH 2ARWA 4FQCL 2J72A 4U7SA 3DRQB 4L29B 4I2XB 3R19A 3ARQA 2F2HA 3VGGA 3QHZL 3V4UL 2CIIA 3ZKNC 5L8LB 1NM9A 1BMWA 2VR3A 3NJXA 1J18A 1A7PH 5TJWK 5MHSD 2VM9A 3WEBA 1T0OA 1CQYA 4KXZH 4DUWA 1IVTA 1UACL 1M7IB 3OJVC 5GGSY 5CJ5A 4DTGH 3MCLH 4HPOH 3ZDWA 2X9XA 5J89A 3B8YA 3TT3L 2EXTA 2WQXA 4JRXB 4PB0L 3NJNA 1FN4B 3TO4A 3TWYA 3QEGH 4EZJA 4PI0A 3IRPX 1EAPB 5JPNC 4MA1C 3UDWA 5C6TL 2EADA 2BP5M 4ZFFB 3HC2A 4AJWA 3QG7L 1Z6JT 2H2SD 5I73B 4I87A 2IALB 1XSJA 2WP3T 4A6YA 3O8XB 1URZA 1RLWA 3AITA 1H8NA 3WL9A 3H54A 3BUYB 2HFTA 2OBGA 4FNLH 4L18A 3TURA 3GSUA 5DD3H 2DICA 4D0BA 4PS4L 3BIBX 4NJAL 5EBWA 3NG5A 2BY2A 5E51A 5T5FA 4PRPE 4OM0L 3UBXA 3KBHE 2VLKB 3PWNA 2D7PA 1XSIA 3BFOA 4BRVA 5FLVA 3Q0HA 2BP8A 4HISA 2O5XH 4XP4H 3I6LD 2VDQB 8FABB 1J1XL 1O9VA 5J9PA 3A6OA 3FAXA 2AQ2A 3IM1A 1GZPA 2AJ3B 4K94L 4NGHH 3WFEH 1J10A 2APSA 5FX3A 2A83B 1JPFA 4DESA 2DQJH 2Y6SD 1KJMB 3ESOA 3BKML 2DDQH 4OB5L 2EE0A 1BWMA 1Q0YH 1F4YH 2KKQA 4HBCH 4LCCC 5E8PB 5HGBA 1QR1A 2PTTA 1DFXA 4XGZB 5T1LB 4X4ME 2Y7LA 4OI7A 4WU7A 4DEWA 4PJ7B 5F93C 2QPFA 4DHLA 1XEUA 2MOGA 4Z0BL 3SQBA 4WI7A 4YHOL 2YEZB 1JI1A 4X99B 1D2OA 3VJ6A 5CGBA 2H6OA 3DKHA 4JFOA 5E2UH 2K9UA 2CZNA 1NWPA 4JFFB 4CAGA 1A22B 1ET7A 1R3IL 1HH6A 4DOHB 4GINA 4W9FC 4WO4C 2LAGB 5EOQH 5C09A 5IY5B 2W92A 3VXME 5JPMB 3V0VB 2XWJA 3D18B 3EYQC 1E3FA 2WXIA 5B38B 5CCJA 1DUZA 2F7PA 2FYVA 2IBZX 1MEXH 2VISA 3EYFB 1MNNA 3NCFB 3NIGB 4UTAA 5GIRA 1BAWA 4UIMA 3H3BC 3NH7L 5JYMA 4NC1C 4XBGA 1H3TA 4YSQA 1RUAL 4OAWB 3OR6B 2J6EH 2XKNA 4HG4J 2H0JA 2Q76A 1NAML 2WM0A 3ORJA 3HMXL 5JQ6L 1TTAA 3JWDC 3AQZA 3D25B 2V17L 1NUGA 3V0EA 1MFBL 4IHOB 4QGTA 1KEGH 2MH4A 3QIBD 3S2CA 1TTFA 4PJFF 1MDTA 1ZA6A 2EDKA 3DRTA 4EZKA 3F5WB 4WFHD 4E9SA 3GMOA 3J2PA 3LOWA 4ZMZA 1KGUA 4TNWK 2P48B 2IADB 2OL3H 4EAEA 3ME0B 3L3GA 5F1OB 2RD0A 1KYFA 2EDBA 3FQWA 3VXRD 3CZGA 1KCSL 3OKDB 2FJFA 2O6FA 4HF5L 2Y1AA 4MJ5B 4P2RA 4Q2ZB 3OKEA 3BDXA 5DS8A 5LXGL 2OX5B 5I71B 2VJXA 4M7KH 4AQAB 4XN4A 4XOCA 2R1XB 2ESVA 3IMWA 3N40F 3RUGB 3EF4A 4PRHB 4PSPA 5HDBF 1EXGA 2VC2L 3O6FD 4L2YA 4U7KA 4M61A 5DHXB 3QUYB 4DO6A 3Q06A 5D1XB 5L2KA 1IL1B 4I85A 3GBNH 1QYGH 2AQ3A 4FN0A 5EU6E 2Z92B 3QFJE 1KT2B 2K7PA 3HAEA 3RWJB 4Z7AA 3WS6A 1NPNA 4C83A 2G75B 4EN3A 4XCYA 3QQ3B 1UD2A 4FC3E 1VGKB 4ACPA 3O9WC 2X1OA 2YPLA 5A16B 3IFNL 3NGBB 1TNMA 1A02N 3CK0H 4XNUL 1AI1H 1YUHA 3IPBA 1SHXA 3BWZA 3TT3H 2YRLA 5HDBE 3RL2B 3WIIL 5GZNA 2NY2B 5HBBA 3W9DA 5TDOA 3QH3B 4J3OF 4HGKC 2ZX9A 5HHNA 2AKRA 1OAJA 3US9A 5J6HB 3G04A 5LAPA 1DUYB 1ETA1 3F01A 2W65B 5DJ0B 3MPCA 1HQRA 3NIDB 4I48B 4LDEB 4A2GA 4XVJH 3T0BA 1CPUA 3KYNB 3HG0A 2P28B 4LVOB 3UABA 4JY4A 1L9PA 1OP9A 3GKZA 3ULSB 2CAKA 2HFGL 5T5FH 5IFHL 3IXTB 4PV8A 4F9PA 2PPCA 1L9NA 4X5PA 1T6BX 2AQPA 4OD1L 4P3WA 1ZV2A 3GJEA 4FI6A 3AT9A 1FUNA 4MCZA 5BO1L 5I17B 2G3NA 3SDAC 3BUPA 3VXUD 3N91A 1MCLA 2K6ZA 4KPHL 5FUCE 1CDBA 1QMUA 2QQQA 3MREB 1UZ6F 1YNLH 2X87A 3HC3L 3NEEA 3Q3GB 4PGDB 3ZKXB 4I18A 4FD0A 2X0WA 5AENA 4H25A 4FTVD 4YBLC 1WGOA 5C1MB 4A2FA 5I6KA 5JLZB 1Z9NA 4PW3A 5J4MA 4AGPA 4FEMA 2C3XA 2D3NA 5EU3A 5JYLA 3D2UA 4TOYL 3P69A 3L4XA 2ICWJ 2HB0A 4KKBD 4L05A 1JGVH 5I19L 3RX8A 3PWJA 2HTLC 3KWWB 5E03A 4HKXB 3Q05A 3Q5TA 3MA7B 5B1KA 2PYEB 4A67A 3C2AL 4KROC 2B59B 3BZFB 1TYRA 4BCZA 2VQ1B 3AS3A 4NSKA 3D50A 1JI2A 2X40A 4F8LA 5A2JH 3EUUA 1GPOL 4HPYH 1T1XB 2P45B 4NQEE 5EC2B 2AKRB 2AXGA 5IR1B 1GYVA 1YN6A 3W9DB 1P1ZA 4BDVB 2VC2B 4OUUA 3FCGA 4LCYB 2DLFH 5DJ8A 1JPST 3IPEA 2N56A 3WNOA 3QZWA 1QSZA 3PXLA 5T3XE 1AO7E 1N4XL 1NCHA 4ANUA 5AZEL 8CGTA 2G0LA 1MREH 2BSEA 3QQ3A 5A3ID 2ZWLT 2DKUA 3UTSB 4E68A 3MLTB 2B5IB 3LPPA 1DQTA 1MH5B 5E2TL 2ZXQA 1H3PL 3C5ZA 3HAEB 4HUUB 3EO0A 1RP9A 4X6CB 3JQOB 3S48A 5I8CA 4OZHB 1OAXL 5D1XA 2XQYK 1J8HE 1RIVL 3QUYA 4JFQB 1AGBB 3SE6A 2R8SH 1HDMB 3NFPB 1RK0A 4NZTL 2JK5B 3HNTH 3NIFE 3QP3A 4M8QB 5F7MC 5T1JA 3BUBA 3LHPH 3WXWH 5JOPD 4LU5H 5DA4A 1N8ZA 3HKZA 5JQIB 2XFXA 3QCVL 4MJ5A 4Q2ZA 4UOW0 3KLAB 4JNXA 1Z5LB 2YK1H 5TE4H 4OZIE 2E27L 1ZVSA 2CO2A 5D4QA 4KO6A 5BW7C 4B9FA 1M4KA 2VTFA 4ETYA 3X2QB 3QYNA 4R5VA 2DI9A 3VD3A 3VXOB 1J05B 2BSSA 2MQ0A 4G43A 1IC7L 3NAAH 1MIML 2IADA 4XPBL 2JI3A 3BT2H 5C0EB 5DD6A 4WK4B 1S78D 3HEIB 5TE7H 4OZ4A 1DVZA 1VCBC 2BP3A 4NAMA 2FYYA 2FEEL 4NDMB 2NSXA 4O02B 1KGCD 4GAJL 2ZUUA 3DYOA 1Q9KA 2R69A 5IUSA 1G4RA 2WWKO 1OOWA 3D25A 3TNNA 1FLTX 3HRZC 4JUSA 3R8BB 2Y22A 3TOPA 3VFTA 4DNLA 4QRPE 3IK2A 1XH0A 4IBWA 1JWUA 5CN2A 1YMMB 3QQDB 3ZDYF 4UMGA 4TV3A 2VDNB 4YHMH 4IBYA 3QNXB 5MERB 3QISA 1U3ZA 1XGYH 4LMQE 2HKHL 4FCAA 5H2BA 2BMKA 5LGKA 4PSRA 5CEYA 1KN2L 5AW0B 2FHBA 4KNSA 3QJZA 1E4KA 1CLZH 3TGXA 1XT5A 4LQ1A 4RNRB 3U2SA 1A3RH 3UG5A 1N6QH 1J1OH 3F00A 4HLZH 3C9NA 5C09B 3BUTA 1IQDA 2EP6A 1JGUL 3WEAA 2IIJA 4H13C 4JFOB 1ESOA 1I1FB 3RRQA 4UT9A 4PRIE 1BF2A 3SQBB 4FQXA 1GS7A 1MFAH 1C5DB 3GBNL 2HJFB 1J9RA 3RQ3A 3TTYA 3X12B 1ZT4B 3EKCA 2WLKA 3WEOA 4GP4B 4P3DA 3X3GH 5HI3D 4Y19B 3MBEA 3O6FB 3PFQA 3V6ZA 3LKRA 1KCWA 3TU6A 3F05A 3GM8A 2MQCA 2FK9A 5EO0B 3VFRA 4ATTA 3O2WL 4OW6A 4FLOA 2JXMB 2VXUH 3VXQA 3JSSA 1L0XA 4F37K 3DMMC 3B43A 2ZCKH 2OYLA 3A0OA 2CO3A 1SY6A 2FJGB 2BP8B 1GRWA 2CBTA 4LCWB 4UM9D 4LVHC 3FHEA 4Z23A 1LE5B 1LO5B 5HDBB 1NIEA 2DQDL 2MCPH 2GCYB 5KTEL 2BVQA 5GRWA 5E4EB 3F7LA 3LTVA 4PJ8A 4XI5D 3W37A 4BZ1L 3O81A 4WTZG 1K8DA 3M8OH 5F7EL 1SDYA 3MGTB 4TF4A 4YHML 1N9PA 3L4ZA 4Q6YA 2V2TA 1ZHKA 2R29H 3AG1B 3CAFA 4HIHB 1UYWL 3HTLX 3QFJB 1IKFL 2MMXA 2CCLA 4IKLA 1NGWB 1ONQB 3DV4A 3RGHA 3T4YA 5L7XL 5INDA 1NFKA 2GY7B 5JW3L 3FH5A 2V6HA 2VAJA 2C3VA 2XJKA 2D7TH 2PR9A 3IJEA 1KN4H 3O6MH 4AL8L 3ZHLA 1KIQA 4ORZC 2O30A 1L9SA 2VZTA 2NY3D 5FYJD 3UPRB 3RURA 2P8PB 2BY1A 4YDMA 2P9RA 4PG2C 2EXWC 2XG4B 3BMVA 2Q10A 1H3PH 1E5CA 3X1NA 4BBWA 5CEZH 7PCYA 4R97C 5E7FA 2C9UA 2Y3NA 3BVVA 5F9AC 4L29A 4ZMWA 3VG0H 2KMWA 4ICXA 1VESA 4JVPA 3EH5B 4MRBA 1AIZA 1GOHA 1DZBA 1MW0A 2EIEA 3LKSA 3OLIA 2Q6WB 1KFAH 9CGTA 3D8MA 1KB5L 5IJCC 1HHGB 3GSNA 4FFYH 3WUWG 4L4VB 4WQOA 2GB2A 1Y07A 4WI0B 5E5MB 5ICXB 5IHZA 2WV3A 2GK0B 3C6SA 1K8IB 2WXGA 4L1DA 3M45A 1CFVH 1NWOA 3F7QA 4JDZB 4X4YB 1GPOH 1T0MA 4HPYL 2NR6A 1IGJA 4M62L 1I1RA 5BS0D 4QI3A 1DFBL 1NCIA 1W8OA 3CD4A 3D69B 2ZUVA 5GGQH 3AQXA 2Q86B 1U95B 3UBXI 1BIIA 5IEKB 2V2WB 1N67A 3R4RA 3ET9F 1NDMA 5L4IA 4AC4A 1OM3H 1Z9MA 4Z7IA 4UU9A 1K5WA 1EUUA 4XCCH 2VXQH 2RACA 3KPPA 4PJHF 3VH8A 3OMZA 1AQMA 4TUOB 4S1DC 1KYDA 1QWNA 3ASOB 3CHPA 5I6LA 1ZK5A 2DIBA 5C0AE 4YDKL 4PJXF 1R3HA 5AYUL 5BRZD 5C08A 3UGEA 1SUHA 4IOIB 1I7UA 2JFCA 1KJVB 1F2XK 4GH7B 4JZOB 4GW4B 1UWXH 1KXTA 4OJFH 3EBIA 1JD9A 3NJFA 2CDFB 2QSCH 1DP0A 4OQTL 1JVKA 1EZVX 2EYSA 5K9QI 4OJYA 3MUGB 3OKMA 1N0LB 5D7KE 1CFNB 1LK2A 1HAWA 2VQTA 1E42A 4KY1H 3RL1B 3LB6D 4NM4L 4UAHA 3OZ9H 1FGVL 3CLEL 5FHBH 1JCVA 1UJ3C 4LCIH 3MYJB 4DF9A 2VXTL 5D96C 4L8CA 3U83A 1GZQA 3QIWD 5DJ2A 3WTXA 1XCQA 2D73A 4D0DA 2KERA 4XWOD 4MS6A 1KV7A 2N01B 2BVEA 5F6HI 1KLGB 3WSQL 3HG1A 1D6VH 1QBBA 3QUZD 1K5NB 1A1MA 3OKNB 5EBMB 1HNFA 5TPWL 3IN2A 1UM5L 4LSVL 3UP1A 4CC4A 1AQKL 1WWBX 2ZOLA 1UCTA 3LEVL 1BBDL 2BDNH 4EMZA 2YD1A 2B9BA 2V7NA 1QEWB 4PBWD 3LVEA 5GHWL 1HILA 1W0VA 4NRXA 5GGUB 5LDUA 2BC4A 1LEKA 1HZKA 4JHAL 2VN7A 2Y7MA 4UT7L 2ZD0A 1FIGL 3C60C 3DSFH 1HSBA 4FNRA 1D9KB 3MRFA 3KWUA 4IDJH 4JPVH 5EEUA 4U1JA 1QRKA 4FGMA 4OI8A 2R1YB 3P4NB 4IGBC 1A1OA 3S5LA 3MRBA 3G5ZB 1X9RA 4R3SB 1B0RB 1MCOH 5E1AA 3I50L 1KENL 2JLLA 1U8JA 4HEME 3G6JB 1C8QA 4B6ZA 5K39B 2WNXA 2Q1EA 2AVGA 5C0AD 3EOTH 1G9NH 3PFUA 1TETH 3FTVA 4GBXC 4Z7VE 5E00B 3S96B 2FUTA 4AVJA 4IRJD 1H3XA 4PJIB 1WO2A 4IIZA 2C1OB 2XZAL 5T3ZD 5D7IA 5I2IA 3FT4B 1GZHC 3UTTE 4XC3L 1VJSA 4YSCA 5JPMC 2IPTH 2VL5B 1HHHB 4RCAA 2KLRA 2ETWA 2MNUA 3L3JA 3WHXB 2YD3A 2EXSA 1JK9B 4AQEA 3P3RA 2E74C 5DD5L 1F4XH 2NXYC 3DX6B 3I74A 4UOJA 4Z7VF 3SKMB 3EJQA 4IJ3B 1RZGB 1VADA 3MRGB 4NT6A 1TKWA 5D2LE 5EIVA 2OXHB 2VLRD 5EU5B 5B1CA 3C12A 2QKIB 4PG2A 2Q8BL 2H3NB 5K9OB 4U1KA 3IDUA 1UATA 3KVDD 4WWKC 5K69A 3E6FA 1UC6A 1AH1A 1KCUL 1NAMA 1GYUA 2Z9TA 3MRHB 3VYNA 3WKYA 3BPOB 4J3TA 2ZYIA 4V11A 3SGJC 1E5UI 4YHNA 2AGJL 1IIKA 2B0SH 4LSUH 4HBQA 3KHQA 5FYKL 4P23B 4ZPVA 4KUZL 3U0TA 3WNPA 2QTVA 3OHMB 3WGUB 1T1ZA 3AACA 2CUIA 1W80A 4CSTA 1EHNA 4TNVK 2D9CA 4GUOA 4QHLB 3EFFB 1H5BC 1GJIA 4NENB 1OF2B 3FQRA 5L8KB 3BZEA 1XB8A 4WTXA 1DVSA 2DYPA 5D5MB 3MRIA 2HTKD 2NW2B 1U8QA 4Z3EA 2XC8A 3EBAA 2ISDA 1OVZA 1X5XA 5T3ZL 4DPAX 2PPDA 4DQOH 3AS1A 3RHWF 3UO8B 1QPXA 1R5VB 1XTLA 4PW4A 5T3XH 2EYRB 4BQ9A 4BUQA 2DQEH 2E9WA 5C08E 3RGVA 3FBQA 3VFUA 3K6DA 4OLYH 2R0LH 3BH8A 2DQIL 4EKXA 4WKXA 3SYCA 1WBXA 3EYOA 3FF7A 1X5GA 3UMTA 1LO2L 1WFUA 3CFJA 4AUUA 2HT2D 4HZ1A 4XNXH 3KPSE 3FHAA 2CKBB 4P5TA 4JFHD 3GHBL 1MLBA 1T2QH 3HE7B 1KC5L 5KW9L 1JPGB 1GKEA 1I8AA 2H6PB 1K3ZA 2NQCA 1AS8A 2ZUQC 4JKLA 4LLVB 4O51B 1H8LA 3L4VA 4QYOB 3PHOA 5GJSH 2ADFH 4XN1A 4ZSOA 2JTDA 2VKWA 2K4WA 3GBEA 3N0AA 5EBLB 1CD0A 4Z7WB 4CKQA 1M6OB 1G9NC 1DJSA 3STLB 4K55A 5EEWA 5FWQA 3TZVC 3VWJC 3DV6A 3OLEA 2PF6A 4O00A 5HHQB 1Z9LA 1PG7X 4HHGA 2WWOA 2DLEA 2VDMH 4NNPL 5E9DA 3QC5X 2COQA 2CHZA 1WD8A 1BEYH 4EI5A 4F24A 1DSFH 4BFNA 2IBBA 2WYZA 3EOTL 5IOKA 1DQDH 3LEYL 2GEQA 1EO5A 4NZTH 2AXJA 3WELA 4U0RB 1J1OL 1JZJA 2ENYA 5EOTB 3U4EA 3DURB 1U8MB 3FB7B 3A5VA 1TZHB 2X09A 3S88H 1SY6L 2PW1B 3EJSA 3KPOA 1FYHB 3QWNA 4HU2A 3S5ZA 4JFSA 4AZ8B 3QCUH 5AVZB 4UTBA 3GTNA 1FG9C 3OAZH 4PB0H 2Z91B 1PLGH 3KYAA 4H26A 3UYPA 2WGXA 1FVEB 2Y7OA 3BT2L 4QRPA 1D5BB 1QI4A 1CFSB 1W6WA 2ALAA 2X2YA 4O2FA 3VB9A 5JORB 4LOUC 2XVKA 4PUBH 1URLA 4FTVB 5I1GH 4XC3H 2EAEA 2WAHA 1BBJB 2YK1L 2PYEE 3FSWA 4P05A 1RJZA 2GC7C 4KWUA 1WZ1L 1NGPH 2YS4A 4JMNA 1C1EL 3OAWA 1W16A 1A4CA 1U36A 3UAFA 4Z8FH 3F85A 3D0LA 5CZVL 3HG4A 3WJMA 2JH2A 4FXKB 4XPTH 4IBUA 4ERSH 4JFFE 3BKCH 1GGBL 3LQZB 4Y2LA 1ERNA 4JPWH 3MLWL 4O02H 4NQDD 3S4SB 3TBTB 3MV7B 1OPGH 1EFXD 1RJLA 1W72A 2EDOA 5C0AB 4D94A 3OF6A 4JM2F 1JERA 3PGFH 4GQQA 4UBDC 4PP2B 3M7OA 4N2KA 3NCJL 2VZUA 5JOFB 4OZGA 5LG6A 4W4OA 1KENH 5DFAA 5TTRA 2P5WD 2VDNH 2YMXL 3OR7A 5JOFA 3CDGB 1OCCB 3DX1A 4B97A 4WJ5B 4IK6A 2OMWB 4JFYB 2X4NB 4NHUA 3F65A 4WU5A 3F6IA 3NK4A 5AVTB 2ZP9A 3KLSA 1Z9PA 2BY0A 2IOOA 2XN2A 2QMKA 2OA9A 5T3XD 5FO7A 5LGJB 1AY1L 2N4IA 3LN9A 4XVUC 3RA7L 4JQXC 2HFFA 1H0DB 3KYKL 3HR6A 3TA3C 3RU8L 4JO8A 2EE2A 4ZMPA 3IMVA 3Q44A 3D9AH 3APDA 4N0FA 2X2JA 4JGMA 2F8VA 2JKJA 3RBSA 1QABA 3KPMA 5KYWA 1G6VK 3HLKA 5EO9A 3TPUA 3L4WA 5E8NA 2WWMC 2YAOA 1P7QD 2PO6D 5I16A 3U6RB 1R5IB 3RX7A 4XVSH 2F8IA 5I1HL 1BZEA 5I1EH 2XN9D 1FF5A 3N04A 3CK0L 4XNUH 2Z7ZA 3PGCB 4HJIA 2WYTA 5I8KL 3I9GL 3GMRB 4JFDB 5KVDH 2HJKB 5FYKU 3VQ2C 3CFBB 1A25A 2R0KH 3FQXB 5JIDA 3CZFA 2GI7A 3MV11 4K0OA 4Q6KA 3UJIL 1YQ2A 2XTJE 1RUQH 3TIEB 3CHXA 2G3MA 4K3JH 3MLWH 1INDH 3HJ0A 3VWKD 1BMZA 2ZIDA 3R1GH 4QAWA 4AMKL 3PP4H 2YRPA 4YXLH 5E1IA 1CE1H 1MVUA 2XKUA 4ZS6D 3LHAA 2BNUB 3H9HB 2XQYA 4RX4A 2ZICA 3FO1A 2QDVA 4NQVA 4X42A 4A2LA 1HI6B 3GMLB 3U4EB 1NCBH 3GHPA 4PJ7F 4ILDA 3P3TA 2FJUB 5IFAH 2Z31D 2VWEE 4JJOA 2J8UA 1FRGL 3V79C 3HC4H 4HXBH 1LQSR 2F7RA 2B2XH 3LKQB 1V05A 3R0MA 3IGKA 5E9DB 1AZRA 1VZGA 3M88A 5D6CA 3ATFA 4JG0H 5J11B 5HHQA 4LMQI 1X7QA 4RMRA 3H6AA 3STLA 1PZ2A 4HUKB 4QNPF 2IH1A 3S88L 3QJSB 4FERA 4FNSA 1IQWL 1AG0A 2V37A 3NJKA 3IJYA 4M5TA 4KFMA 1A21A 3TBCA 3UADA 2CLRA 1QVOA 1RUAH 2AV1B 2COVD 3CX5K 4PRBB 5LBVA 3MUJA 4PJDA 4AYGA 4IS6A 4H2AA 4NO3B 2VE6A 1S7RA 3MLXL 4C57C 3IT8D 4JZNB 1G6RL 4M03A 3IXAA 5I6PA 3JXAA 3PPEA 3MBWB 1OSEA 2Y24A 3EYOB 1CFTA 3DUSB 3ABLB 3UTZB 7PAZA 4ODHH 5I71C 1SJEA 1PIGA 3NBNA 1IGTA 1ZY9A 3V6OA 3QWQB 3QAZB 2Y25A 4KY2A 3SDDB 4JGUA 2ED9A 4A7SA 3TBYA 5TDPB 5J57B 5CBAA 4I0PA 2HAZA 4Y2DC 4YGVA 4FYTA 1BVNT 3NT0A 2YRBA 1YLBB 2H8PA 1M05B 1PZ3A 3CN2A 4OCSL 1D5ZA 2TAAA 4XB8A 4JHWL 1TSHA 3U2JA 2CXKA 2WN2A 1F6LL 2WBJD 2DQIH 5GGSA 1PSKH 3GSXA 4JFEA 4OCYL 2WLIB 4P9HC 4UAOC 4ZPTA 2MTAA 4I3GA 1A0QH 2WY3B 1S6NA 3G5YA 2DIJA 4N3UA 4WGVB 3RNQB 1YYCA 1JZGA 2XWXA 5LJYH 3ARRA 5ESVB 4BFIA 4JE0A 1NAMB 3EOAA 4LEXH 3ZE2B 2V17H 3ILPB 4TQEH 3Q7JA 1AGCB 1OAKH 4WW2F 1OSZA 3RJOA 4XO5A 4Z7NE 3U30B 4XNDA 1XDTT 2X4QB 1CU4L 3QUML 5JA9A 4TQIA 5DJAA 4W9GC 1GGCL 2ZAHA 3FN0L 5FA3B 3SKJH 1FVDA 2XBDA 2HRGA 5DFVC 3NIDF 3SDCD 3SO3B 1PKQA 1P5VA 2GHZA 1VFUA 1YECH 3FO1B 3OZKA 4Y1AD 2XWCA 3CX2A 3BIKA 4JRXE 4Y4KA 5DQ9A 5CLWA 1NC4D 4APQB 1PG7H 1JHTA 1CN4A 3AU1B 1EDQA 2VN5A 4LARH 5T1LD 3UC0L 2VL5A 4GIOA 4EUPA 1SMOA 3ESMA 5I1AA 1KIUA 3ZTNH 5AW2B 4ALAL 3MGOB 2WLNA 5D7IF 3FU5A 3EHBB 3QHZH 3V4UH 3DMMA 3CSGA 3P4OA 4AXWB 4EKJA 3S96A 2A73A 3D39A 3L7EA 1H15A 4JFDE 4XPGH 3VI4B 3EFDH 1BV8A 2FVNA 3H2PA 5GS1B 2WZ6A 2WUCL 5F44A 3ZT5A 4IBLT 3G6JA 2F53A 2VITA 4NZ8A 1TTCA 3BKYH 1JNHB 3MV01 3S35H 2WZAA 4DAGH 3D48R 3K6OA 2DQFA 5C9JA 1CLVA 3WTWA 1A6AA 1CYXA 5KYWB 1UZGA 4XNZC 3MOAH 2H9GA 3QJHA 4LEBA 5EPMB 1MKFA 1NANH 3H55A 4AOFA 4QTHB 2A9DA 2JKWA 3G6DH 4PMEA 4GQ9L 3QG7H 3RVUC 4LKXB 2H6UA 5SX5H 2VDRB 2YGQA 1G9HA 1ASOA 2VZ1A 3Q2WA 3SPVA 5LGJA 4I88A 2WZ0A 3ABGA 5DD3L 3FQ1A 3IS1X 5FFLA 1YPZE 4HWBA 4YBHA 3US1A 4LPVA 1L5GA 5AB1A 4JFYA 4QRQA 1H9DA 4YWGH 2X4OA 3DTUB 4ELME 4JJ5A 1NUNB 4ELMA 2F1EA 1J5OL 3LEXB 1MOEA 4ZW8A 1JZ4A 4R7VA 3GXNA 1A9BB 5BJTB 2M83A 5H37G 5KVMC 1FIGH 3O3UN 3DSFL 1KBBA 3Q2VA 4M4RB 4PP2A 1P84K 3D09A 3OWRA 3R18A 4FQIH 2BNRA 2H32B 4RGOH 5AZEH 2YGVA 4HJ1A 4PCKA 3S4SA 1EGJL 3OB0K 2GTWA 4IRZH 4XODA 5F7BA 5LG1A 5CP7A 3T3MB 4BZ2L 1FG2B 4Y5YB 4MD5A 3HE7C 1NCBL 4XRCA 4F8QA 3IDIB 1P2CB 3INUL 1SDDB 2E7BA 2PW2A 1A7BA 3II3A 5GGVH 1WG3A 1P53A 2QELA 3DETC 3EFOB 3X17A 2Q20A 3QEQE 4OZFG 1MJ8H 5CHNB 2DBLL 1PZUB 1RJZB 2Y7SA 1I9JH 4UUJB 3UC2A 2Y9RT 3DIVA 4NKDB 2EJ1A 4QRFA 4X0KB 4I9WD 5GSRB 3UO1L 3RYMA 5E8EA 2IDTA 4N1EA 2B9AA 4G9FD 1CFSA 3QDGD 2FECL 1YEKL 5A43C 4HU8A 5KSUA 3HBQA 1VPOL 4HGWA 5I9QC 3V52H 25C8H 1HXMB 2DM2A 4OFYA 3T0WA 3UAEA 4AZ8A 5I8KH 2VM3A 4A7UA 4AMWA 1AOHA 2I60L 1NDGA 2R2HA 5T1DH 2CXGA 3QIUA 5FW7A 2J21A 3QUZA 1E8WA 4QXGL 3FB7A 1WC7A 4W81A 5F7LB 3PHAA 5ILTL 1S9KC 5J1AA 3IDYC 3KS0J 5F72S 4ZUUA 1SXSA 4IDJL 4JPVL 4X4YA 5AG9A 1PX4A 2DL9A 1BHGA 4R83A 5DHEA 5F9DC 1V8HA 4KBPA 1ZLSH 3HN5A 3OAYH 3MV9A 4GP5B 3E9UA 3ULVE 4GRLA 4LGRB 4Z0XA 3QZNA 1X3DA 1V7NH 4GUQA 1PDKB 1S3KH 3GJFH 1CGTA 5BZWA 4KROB 3WDIA 3FU6A 3JTTB 2ORBH 4OGYH 4HVBA 1INEL 1B0WA 1PAZA 5I1KL 3VXSB 1P4BH 3I2CH 4LXFA 1IJ9A 1WIUA 3HOGA 3UPRA 1ZANL 2G2NA 4ZSOB 3DUHA 4XN7A 1QRND 3IFPB 3KWVA 5LHDA 4M7ZC 1LEGB 3E3QE 4I4WB 4LFHD 4CNIA 4KH9A 5BZDA 2QGCA 4GKLA 1MLBB 2C3VB 2ZYHA 4K9EC 1JGLH 1S7TA 3D4ZA 4B7IA 2DS4A 4XZUA 4WI2A 3RJQB 2YAQA 1XMEB 4PJEE 2PMZA 2Q2LA 4WK2B 4NCC1 1RK7A 3HFMH 5EF2A 1WTGT 2AABL 1NAKL 1Y6NR 1YEKH 3KDMA 3V5KB 1VFMA 3WTYA 4P2QA 5F1IA 1OHZA 3LQMA 3OZ9L 4Z3HA 4GJTB 2WGNB 1U92A 1H3VA 3J07A 1F2QA 1R17A 3O2DH 4A2DA 1AI1L 2UUDK 4CN1A 3TLRA 5IK3A 1LDSA 2WJ5A 3BDYH 1G0YR 3BVNB 3DX4A 4PTTA 3VX0A 5FK9B 4YHPB 1U3HD 3FSAA 4P57B 4XB3A 2YA2A 5E6IB 4X4XA 3C6LA 1LE9A 5BV7H 3AFLA 4UQEA 4PUBL 1SNRA 3EF7A 5F71A 2NW2A 3RWEB 4FA6A 5JXAH 2BK8A 4X8JA 2DQDH 1ED3A 3ISRA 5CJXC 4HOWA 4CMMB 4JFPB 1OF2A 4YDVA 4NENA 4YFLF 1TCMA 1M56B 4HETA 4RFOH 3VG9B 4MWFB 5EO0A 3VFRB 4AW7A 4J12A 3WKQA 7CGTA 2CJSA 1FAIH 3E6HA 2ZSWA 3MAWA 4LEEA 4QJ5B 3O6FA 2JF1A 4RMBA 2JKSA 4PJBE 3BSZA 4C47A 5DEFB 2Z31B 1C7SA 2VLJB 3GEWB 3CHSA 1ZT4A 3Q6GH 2CPCA 3ZE2F 5EIIG 4P2RD 1C5DA 4LDCA 4XMTA 1ACYH 1E7UA 3E6FB 3BMWA 4AEFA 1RQ5A 2MSPA 1GC1L 4Q97A 3FT0A 2ZX8A 3FO9B 3V9FA 2QL1A 1TKWB 2ITEA 3MGAA 2GFBB 4WUUD 4GB9A 5ICUA 5CGTA 3HE6B 3MA9H 1VFBB 1UOVA 5KYNA 3IFNH 5CEYB 4IRJA 2IH3B 5MERA 2VIRB 1AD9A 4TQEL 3WHXA 1AOZA 1BFVH 1RFDL 2YKLL 3M17A 4P48A 4P3CL 4J39A 1YMMA 2PR4L 5F3BB 3FT4A 5D1ZD 2J1ZA 5E9DD 4BEIA 5I2IB 4G83A 4PRNA 4WIQA 5SV4A 5CJOH 3CFEB 3ZYZA 4PJIA 3R06A 5C0CB 3EYUH 4RMSA 5CLXA 3VNZA 2FYYB 3VI4F 2R56H 2XY2A 3FB6B 1J5IA 4DUXA 1F1DA 2BOCA 5H4ZA 5CWSA 4GS7C 4BIKA 3PJSB 3NCWA 4UDUB 2HVBA 2NY6C 2MNWA 2ADIB 2CM6A 2BSSB 5DK2B 4M7LT 3GMMA 2X9ZA 1X5KA 3BE1H 4LP4A 3HG3A 4HZAA 1YEEL 4AITA 1CD9B 1ZVSB 5L9DH 1F0LA 5HGDB 4A37A 1ZLDA 5LVEA 5F7NC 3OC5A 1MN4A 3QIUC 1QNIA 3VGEA 2QQKL 5C3TA 4BSWA 2KT6A 3LZOA 3BWSA 3F84A 2AJVL 2XA8L 1A6WH 5SWZA 1HDMA 1DQLH 3D08A 1UXWB 4JFQA 5AZ2L 3RUGF 4ZUWA 1QEWA 1WWCA 3LS4L 1HVXA 4OZHA 4MJ6A 1KB9J 4PVLA 3SKUD 4ZAKB 5EBMA 1KJ3L 5EDXA 4F2MB 4O58H 1L3WA 3D52A 3SGKA 4R7DB 5TFSL 4AE0A 4IDLA 5HGDA 3NSDA 4ANKA 1Q38A 4RQQA 2UX6A 3EG9A 4L8CB 4PJCB 4QHKI 4X7DC 4Q9BA 3RZCA 3C5ZD 4ZO6A 3GMMB 2EDXA 5DK2A 2EIMB 3GI9L 4PV9B 1RJCA 2FDBP 4AH2B 2GUOB 2E9IA 2YPLD 1D9KD 5E9NA 3TFBA 3QUXB 1J8HD 2EYSB 3FB6A 1YO4A 2AXWA 5GS0D 3PYCA 2Q8BH 3R06B 3SJVE 4WF7A 1WFIA 1BBDH 3U0PB 4Y0GA 3DLQR 4IOIA 1EEUA 4HT1H 4ZMVA 5DJ6B 1F11B 4KRPB 4UQCA 5CZXD 1GS8A 1IBGL 2A74A 1AD9B 3GK8L 4IRJB 3T6VA 1BF8A 4OBSA 3HW7A 3WYRA 5KYYB 1CTMA 3K1DA 2FQDA 4TPRL 4NQQA 2A5UA 3CV5A 3MMEB 4J3BA 4OFIA 2F54D 2A7BA 3VQMA 2XZAH 5IEKA 3CFNA 1U95A 3RY6C 2DRUA 5IB2A 4M48H 4I18B 2ED7A 1OSPL 2HTLD 4X9HA 3ZTJG 1S5IL 1E4XH 3O4LD 3T77A 3L8QA 3BSHA 5GPRA 4FE9A 4JY5H 3RPIA 2DQTL 3HI5L 4UTAL 2IFFL 2AK4D 3A23A 5JDSA 3OJDB 4F7PB 1XV8A 2WZPA 4W9KC 4U1SB 2K6YA 1S7UB 1Z7JA 4OH2A 1ZLVH 5LLIC 1SEBA 3HZYB 2YD7A 1FIEA 3CFUA 4XXCA 1M9SA 5I1HH 4MWFA 1JNNH 5DC0A 3IKKA 2WOYA 1MJUL 1P6FA 1JTOA 4LEOB 1KTDB 5F1NA 4CMMA 4S11A 4U4BA 4CILA 3P0YH 2VLLA 1FFNB 3STZB 2XG4A 1YYML 2BW5A 4OUOA 2CBMA 3O6KH 1BVNP 4I3SH 4IBZA 5GXBB 5J6HA 5CUSL 4G9DB 2NTSP 1HOEA 2WMPB 4L8SC 5GS1C 5GS3A 3TJPA 3IMRA 4AE1A 3BRGC 4P59L 5FK9A 3RL2A 1JD7A 2FT7A 3BVNA 4F9LC 1RSYA 2QADC 5F7DB 1ASQA 2NMSA 4FLQA 1U92B 4YSEA 5L2KE 4TLUA 2MKWA 3RFZC 1QZ1A 3OQ3B 3WIHH 4OIIH 2DMHA 2RCSH 4HIHA 4LSTL 1QFWM 1BAFL 1U21A 1UQSA 3GLZA 2Z92A 4RA0C 4PWHA 2IWKA 2X0UA 3FULA 1IAIL 2IOIA 4XHQA 3BJLA 5FUZL 4XBEL 3FQTA 3ARDC 4GI9A 3MJ9H 4D2NA 3LEYH 5I5IA 4H5SB 3W9EA 4PRHA 5BZDB 3QORA 1IT9H 4MMYA 3RUGA 4CNIB 2AK4E 2D3JA 2N3JA 2OLDA 4DEPC 3LH2H 3UEZA 1QZNA 3IGLA 3LZFH 3Q6FA 2WXJA 5AVSB 4F9PC 5IM7B 4OJCA 2VW6A 3HE7D 3EHBC 3BPOC 2F54E 2XQBH 1AGEA 1QYGL 1YY8B 4QNPE 2VDRL 4CU7A 2PO6C 4OSUL 1WAPA 1MFCH 1R46A 1ZA6B 3DRTB 3ETBJ 4P3DB 3QFDA 3WO3B 5CJ8A 4FFWD 5AAPA 4Y19E 4HH8A 43CAA 1BQUA 3JV0A 5B3NA 2NYKA 1OSYA 1TQTA 2OI9C 3IRZA 5B39G 4C4KT 5HYJA 3ILQD 3WENA 5T5NF 3MRCA 5J1AB 1GSMA 1S7XA 1I1FA 1NH6A 4XXDA 4MAUH 2Q76B 3SJVD 4OZIF 2CK0H 4HCFA 1I1AB 1WIOA 1ZVHA 2R2HB 3C9NB 4ANVA 4HJ0D 3IFLH 4Q4EA 3CZEA 5C09E 1SJVA 4R0LB 4QHNB 1ET8A 3MRLB 4DH2A 2YEVB 3N41B 5BUGA 1SFHA 4URKA 2BIQA 1HZLA 1SOQA 2XWJB 5B38A 5GS2H 1CLOH 4MAZA 3QNXA 4PR5B 1SY6H 1I1AA 3DK0A 4JFFA 1MCFA 5AKRA 4Y16C 1BZ7A 5GSVB 1P4LA 2UY7B 3EFOA 3GT6A 1L7IH 1HL5A 5C2BL 5IJDC 4W9EC 1UM6L 5L7XH 4RWYL 1ZGLM 3F6LA 2YQBA 3IDIA 1E5ZA 5E8PA 3EH4B 4MD5B 1E4JA 1KN4L 2DPKA 3BDBA 2YKLH 1BFVL 1RFDH 4O2CB 4M48L 3GEFA 4BSJA 1YY8A 2XWRA 5TQ0L 3QHTC 4PWJA 2Y0SA 4FNQA 1TMQA 1QTPA 4WUUE 3NN8A 3JWOC 1A9BA 5BJTA 4IRSB 1PLGL 3N42F 1NCOA 4QRTA 3H4FA 3MOAL 2XFXB 1SOKA 4BKLA 3T1WA 1B2WH 5AW3B 3SGEH 2JK5A 1TFHA 1ND0A 1ZT7A 1M7XA 1U4EA 2XBTA 3NFPA 3QORB 4MMYB 3W9EB 3DX3A 4H5SA 1L5GB 2HCZX 2X1QA 4GFTB 3TVMD 2GK2A 2ZONA 2DQJL 4A6YB 4HF5H 4ZG1A 1G7JB 3ECWA 3HZVB 1PCSA 4TUJA 2UWEE 3DVNA 1MH5A 3ZRCC 1NC2D 1UKTA 2F7QA 3U36B 4NRZA 4F7KA 4ZFFA 3KGRA 4FQXD 5E9DE 1HIMH 4MSWA 5DJZA 1FNSL 4FG6C 2VDML 4I13B 4QOKD 2IDSA 1XH2A 3K2UL 1VERA 4N0UB 5BQ7A 1Y6MR 3QZWB 1BMGA 5F7DA 5F6HJ 5D70H 1PW3A 3A6BL 2UV3A 1D7FA 3SPGA 1IT9L 1G4MA 1YEJH 1YN6B 2J7LA 4UTBH 2HH0L 1KJ3H 1QATA 2VXSH 2YPVA 1L9QA 3VI4A 3VVWA 3D39B 4PJAB 1IGYA 3AADB 1KTLB 5HJ3B 4FFVD 1T7ZA 4OCXH 4X4KA 5C0RL 4PJ5A 1KTDA 1OAXH 4S1QH 4LEOA 3X11B 3DRQA 5CINL 4HCIA 4TLSA 3SD5A 5LGYA 4P2RE 1NAKH 1O6VA 1CCZA 3ULVL 4KKPA 2ZKMX 1DVFC 1GYCA 3SGEI 4PIBA 1EUTA 5I1AB 1TEYA 2GAZB 4EUPB 4EDWL 4GSQA 4ODVL 3ARBD 4J6RL 2P1YA 3VNYA 5B8CC 4LLDB 3AU1A 1GIGL 2UZPA 4U1SA 4AGNA 4Z7QB 2GTQA 1EXHA 2J25A 3HI6H 5EU3B 2XIDA 4ANWA 1GCYA 5HDQH 1FO0A 3MC0A 4XP6L 1EO7A 5HVHB 1PKQB 5JLZA 3AQYA 3NJIA 3VWKB 1YPZF 1KBKA 3N1GC 5AOIA 1GY1A 1V7NL 3GLDA 3GXMA 1SHMA 3TO4C 2X4QA 3ROOB 3DYMA 1AJ7H 4IKKA 4PS3A 4NQXB 5DZAA 4POZC 1T04A 3EOAB 3AGWA 3BJ91 3CMOH 2X10A 5HI5D 5ESVA 4CBZA 4PJ5D 4J3OG 2YMTA 3SEPA 2CO7B 4WO0A 1RZKL 1XF5B 4R97B 4MBRA 3RNQA 2A74B 2Q2EB 5BV7L 1EV2E 1OB0A 3RPBA 3C5JA 3IXTA 1M71A 1TJIL 1OARH 2VERN 2CALA 5TE6H 2WLIA 1EEYB 5JIKA 3BVUA 4PJXB 4ODSL 4QRBA 1TPXC 2VLJE 5IVZA 1WBZA 1MRDH 2NX5D 2QVFB 2Q7AA 4Y16B 4NNXA 1A6TA 5JIQA 4DT2A 5EZLB 4WSKA 1OL0A 1IX2A 3HUJB 3TT1H 3QI9D 2XWTB 3VI3F 5KVGL 1GJUA 2WC7A 3HC3H 1DDHA 3I50H 1I7TA 3QUZC 4PV9A 4NN7B 4DTGL 2D2OA 4FI7A 3QQNA 3RZCB 4QRUB 5E2WH 3S36H 2D0FA 3VXPA 3D9AL 1OEZW 1IGIL 2ZCLH 5DQJA 3EYSL 4YL4A 1IGTB 2ITCB 1VGKA 3ZY7A 1BQLL 2AEPH 2FGZA 2HFEB 4V2BA 2FGWH 3UTZA 1T83A 4LK4A 3ML8A 3VRJB 2PLTA 4F2MA 1IGFH 1CFTB 4NERA 3S3JA 3GHEL 1PEZA 1WZMA 4N2NA 2BFGA 3PDOA 1ECYA 3IXAB 2XV3A 1FLRH 3CJJA 1IL1A 1S9WB 2BDNL 4WAFA 4JO2L 1IM3B 4PREB 4M61B 4LSRH 3JV5A 3GI9H 5EWIH 2AVFA 4L9LB 2E7LC 1X5JA 4P4KD 1UA3A 1BFTA 3GKWH 4NQSA 3ENEA 2XXGA 4DP7X 2R1XA 4BSWB 1X6NA 1HHJA 2XPZA 4OTXL 1D2PA 2WWNA 4F37F 4AL8C 2FJFB 5DS8B 5EOCH 3HIZA 2C7UB 4PJHA 4WI8A 3PG2A 2PCYA 3PV6A 2GITA 1YNTF 1GY2A 2A1WL 5AVWB 3ZMEA 1LO3H 3I3BA 2ADIA 3BAEL 4H0GA 5E7BA 1SJHB 1DQQA 1N64L 3A4EA 3NABH 1XGPA 1GTFA 1GMEA 1IFHL 5AB2A 1XQ4A 1HIML 4PTUA 2J8UB 2OZ4A 4GQPH 3GLAA 1DBML 3H7BB 5DZNA 4EN2A 1VGEH 1E2VA 5FEBA 4NWTH 4P2OD 2QQKH 4L3AA 1IAOB 5E2JA 1UT2A 3SKOB 5FCUL 1NIAA 12E8H 4PYGA 2O93L 2AMGA 3JTSA 4MQ7A 4JRFA 2A99A 4DGYL 1HJBC 2BNUA 5B1JC 4YX2H 5KBPA 5DWUH 2AK1H 3DI2B 1YEIL 2XRAL 2XACC 1IVLA 1GIGH 4KZCA 4YDIH 4DPCX 2VISB 3MRJA 1G0XA 1QUNA 1DUZB 3EYFA 2OMYA 1WS7A 4L2LA 4G8FA 4F91B 1S7QB 4JFDD 5E5RB 4JL2A 4TKWA 5GRZA 4JFDA 1SBBA 3V9CA 5FKAA 2W0PA 2GJJA 2O6DA 2YEZA 5DUBA 3HHMA 4H44C 5IROD 4EF3A 1G6RB 5L0QB 3V6OE 2JELL 4I0PC 3P77B 4Y2DA 4QHPA 2EVFA 2OJ1A 1D6EA 2FD6H 3U6RA 4Y7MA 3WIAA 2PNDA 1KJMA 4UV7L 3VMPA 1UD6A 4LO9A 5FYLH 2PCXA 4A04A 1NEZB 2BINA 4Y1AE 4F8TA 4S10A 2OTPA 4G72B 1E7VA 4U1NA 2HT3D 4X7EC 2ADFL 1XZWA 4IBTA 4JFPA 2FO8A 3A4FA 1ED3B 4JQVA 5HYJE 1QSFD 4NJ9H 2JKLA 3DROB 2GT9B 1JF6A 1DVYA 4ZS7L 2E4TA 2MPAH 1PNCA 1PMYA 5EC1A 2VLKA 4WU5B 1DLHA 2LU3A 4L8BA 3OPUA 2DTMH 5D2NC 4PTTB 2X38A 2OCCB 1JK8B 3BUYA 1ZLEA 2SEBA 3PWPE 4MAYD 5F9WB 4A1RA 2NZ9C 2NTFA 2IALA 5KJRH 1FC1A 3ML9A 3H42H 2R59A 1T6WA 2XBZA 4Y8AA 1SRDA 1TQBC 2HX8A 2VDOL 1HE7A 5C0AA 3MO1A 4K7PY 3RVTC 1N18A 2QQNH 4G82A 1S7TB 2WXKA 5HHOB 4XT1C 3CSBA 4JRXA 1D5IL 2B4CL 1F1AA 3W1ZA 3TZVD 3VWJD 4AGMA 3BP7B 4KHXL 3J8F7 4JQIL 1MF2L 4PJ9C 3DOHA 3GS4A 2Y06H 4XE5B 1J5OH 1NFDB 3MBXL 4FKHA 4I4WA 3BHBB 4P99A 3U1QA 4JFWA 3NA9L 5HP5A 3V0DA 1KTCA 1RVFL 3DHPA 5IHUL 1BVLB 4AV4A 4U05A 3OZLA 3OBAA 3SSGA 4XMUA 4FTVA 4NN6B 1ULVA 1JZ6A 3KPLA 4L1HA 3EJUA 3JTTA 5JORA 4O2FB 2WBJC 2OR8A 2ZCHL 3N1QC 2W38A 2P24A 4Y2DD 2NY6B 3UTTB 3QWOA 2HG5B 1PDKA 2P43B 4LESA 3DXAD 4HFWA 4RMVA 2WO2B 3LIZL 3MLYH 4J4PA 1HWHB 2FJSA 3ARYA 1MI5B 2R29L 3B1TA 1QW9A 4R7NA 1SLVA 3RWDA 4TSCL 3UG3A 2IH8A 1H6FA 1ZDSA 2CHXA 2DKSA 4UQ2A 1TT6A 3B2UC 3RZCD 2ZUTA 4WWKA 4ZQTA 1J9TA 3N9GH 1LEIB 4WFEE 2GJ6B 5KSAC 4ZUUB 5FGBC 2K78A 4DKEL 4PHZA 1MIEL 2GBAA 4YHOH 3G6JE 4F92B 4G1EA 3M6DA 1S46A 1ZD6A 3QIUB 4GLRH 2BCKB 5BXFB 1JBJA 4XP1H 1IAIH 3H85A 2MKLC 1TJGL 3K46A 4PCTA 4ZYKB 3LZNA 3HC4L 2ZTBA 1ACYL 3RFZA 2AQSA 4UINH 5AWNH 3RWDB 3UYRL 3ZYOA 5KSUB 2E86A 2IQAB 4Z7UE 4KX7A 2HG5A 1JXJA 5FDWB 1NFIB 2CBPA 3TC9A 1ZA3B 5ID0A 1U3YA 3TJEL 2NYZA 3HC0B 4D9QD 1DBBH 1NLBL 1OCZB 1OAYH 1OIOA 3UPCA 2ADYA 1U6AH 1MHEA 3QORD 3FTYA 2H3XC 1J8HA 1IEAB 4I0KA 4JO4L 5EBLA 5TQ0H 5LGHL 3VACA 1K4DA 2R29A 3GGWB 1Z32X 1T1YB 2UY6A 4AEIH 4YZFF 4ZMAT 3MLVL 3BUDA 1R3LB 4FA7B 2VSMB 4M6ML 2W95A 3FU0A 3KE0A 3C5ZC 3BP7A 1RJYB 1KPVB 5TE7L 3F7PC 4Z7OF 4PBXA 4Y5YA 4KHTL 3VXNA 4P5TB 43C9A 2LTQC 5FO8A 2NY4C 3EBGA 5A1AA 4OLZH 3MXVL 4W9DC 4KVPA 1QWHA 5AYUH 3BZ4B 1WD9A 4WFGD 4L3FA 1IGMH 3KGSA 2WYHA 1AHMA 3SDCB 2I9TB 3LXCA 1KACB 5ES4B 1AHKA 1CYWA 1GVIA 1MJ7L 3OLDA 2W9EH 4Y1AB 3RGVB 3PL6D 2ITDB 3QWRD 5JW4N 3Q13A 2P3YA 1A4JA 4OLVL 2VDOB 2WTRA 1R5VA 3PJLA 3UZEA 4L8BB 3FH7A 4JFEE 1R3JA 2X9WA 5I8EA 2HUEA 3FQUA 1PQZB 3KJ6H 4ODUA 4GY4A 1AY1H 4I8DA 1OGTB 3VXRB 3O3AB 4JVUA 2YUVA 4L1TA 2BS8A 4Z7OE 1HINL 2FGWL 1E6OL 1U30A 2V2XB 4OLUL 5J3HD 1KB3A 3X13B 2XJLA 4RGNC 4QTHA 2WZPD 3VG9C 5DEJA 1XGQB 4N6RA 5EPMA 3SCMC 4R5XA 4DK6A 4QWWC 3VU1A 1I3VA 5IFAL 1PF3A 3GSVB 5C9JB 1QD0A 2XPGB 3T1FB 4AGLA 1QUPA 1D6EB 1HCFX 4HJGB 1S8DB 3QRFM 2F53B 2BSED 3P40A 1LM8V 5DZPA 4G80A 5I0ZA 3WS3A 1MAKA 1ZT1B 2HWZL 3RB5A 5K9OA 3FRPG 1FDLH 2CRMA 1B4JL 1T7XA 4J1UB 3EAKA 4ZTPL 2Z7WA 2AJUH 3ARGB 2J8UE 2W1NA 1RZGA 1OLZA 4FYQA 5IWLA 3FB8A 1JXKA 1P5UB 4B9YA 3G6AA 2EDTA 3DPDA 2XSKA 4W93A 4QKXB 2J1YA 4WUKL 4YK4C 1HHHA 3UXFA 3G6AB 1N4XH 3L5HA 2EC9U 3CVHB 2OMZA 5E1QA 2YUZA 4MX7A 4AMXA 2C1OA 4DETA 3NJHA 1O75A 3SDXF 3AXIA 3H7BA 3B5HA 2QEJA 3GQFA 3Q1SH 2J1WA 3V0WL 1OSZB 3WFBL 4YHZH 5IQ7H 4E42B 4QRRA 5I9QB 3RX5A 5D7JA 1ROWA 4YNYA 2ZE0A 3SD2A 4G6KH 4BFIB 5K39A 1YNKH 4JO1H 3BH9A 4MA8L 1FSKC 2PWDA 4ZFOB 4NWUH 3RVWD 5IB1B 2X70B 4J6RH 2GITB 3JVGA 3HVNA 1F00I 2BNQE 4XMWA 3EJTA 4KXCA 3HI6L 5D72L 3U7YH 1CBJA 5L6YH 2FHFA 3SHSA 3ARZA 4WFFD 3DK2A 4FMFA 5C0GB 1XGQA 2CMRL 4N6RB 4Z76A 1ITCA 4WFGE 3X13A 1LL1A 3GSRA 3O3AA 3KPRE 1RZ7H 1LEKB 2BC4B 2PTUA 5FFGA 3L9RB 1RUQL 1NIDA 2YO3A 3LXAA 5I8EB 4KHTH 3SDXE 1R3JB 4I0PB 1O6TA 3C60D 3OLGA 4P46A 4BFFA 1H19A 5K9KA 3TONA 1IGML 5EEVA 1TSRA 2OSLA 4KNUA 4Y1AA 3V4PL 1SJEB 1RERA 5CGMA 4JB9H 1XCQB 4JN1H 3NSJA 3IBOA 5D5ME 3VXPB 3TBVB 1A3LL 3T2NH 1L0PA 4LSDA 2C9XA 3MYJA 2UVFA 3BAYA 3BZ4A 3FU8A 1MCJA 3IJ8A 1FNSH 3MKGA 4K8RL 4UBDD 1DDHB 4CDHA 4PRIB 4GKZA 4JZNA 5EZOL 1MWAH 3HUJE 3L54A 4KXZI 3RL1A 4KJYA 3VXNB 3ZGHA 2O6EA 1CFNA 1LK2B 3EFDL 43C9B 2OMXB 1A6TB 4X9YA 3ZKSD 4PJDB 4WDIB 4PVBA 5BRPA 3UPAA 2MOQA 3EOYG 3KPSD 1DLFH 2NXZD 1QVOB 2AV1A 4XP1L 3QZLA 5IVZB 5DUPL 1CT8A 1LJMA 3QNZB 1HH9B 4X9GA 3LY6A 2WYIA 4WFED 2OYPA 1DQDL 1IEAA 3I84A 1JFHA 2ICEA 1I8KB 4ETQA 3S0PA 4U31A 4UB0L 3GRWA 1MVFA 3FRUB 1QLEL 1X7QB 2WW8A 5LBGA 3HC0A 1ACCA 3KPPB 2CO7A 2DQEL 3VD4A 1V55B 4UU9B 2J6EL 3ZUNC 3Q43A 3QC6X 1T04B 3WV0A 4H0HB 4NQXA 3EBHA 1FORL 2FATH 4KX9A 5KVFH 4XO9A 1WTLA 4ZYKA 1NMCC 1MEXL 4EDXA 1T0NA 4KJPC 4OF0A 2DJ4A 5MENE 3THML 3WY3A 1Z9OA 2KL6A 3WIHA 4JDZA 1J9SA 1TTGA 1WICA 1KC5H 5KW9H 5F8RC 2Y36H 4N2BA 1L4IA 5E5MA 1HCYA 1KXVC 4MBOA 4WI0A 2NY1C 1PG7W 4JFHE 3H0TA 1LD9B 2KI6A 3LKSB 2Y5QA 1PBYA 4UQ9A 4YXHH 4A6YL 2C9QA 3SO3C 2P26A 3BQUA 4IRJC 4WCYH 5J12B 3N40P 4MFHA 3ARBC 1INQB 1RUML 2DM4A 5HJ3A 3ZDXB 4RZKA 4JHWH 1OGAA 3KL0A 4X5QA 2PP9A 3GMRA 1BVLA 2FL5A 4XBMA 4YHZL 5IQ7L 3ZHNA 4OKVB 2QPSA 5K93A 4JW3A 1BJ1H 3SQRA 4LRNH 1NFDA 1U9KA 2R0LL 4HCRA 3ZTCC 5B1AB 4K71C 4F27A 2BIIA 3NABL 1FYTE 1PD1A 5E8NB 1TO5A 5K9JL 5L8JB 2X6CA 5HYSB 4PJHE 1H8OA 5JW4Q 1FGVH 4RWYH 4AEHH 4YHKH 1YJDL 2EXYC 2ZF8A 2OTUA 4NRZB 1NPUA 1U8HB 3D0VB 4Z95L 3DVNB 5IOPA 3HZVA 1S7SB 1G1CA 2NTFB 3MGTA 3ESUF 3B7SA 3UBFA 1X9QA 3SKJL 3C09C 3CFDB 4N8VA 3B7RL 1JK8A 3T0EE 2HWZH 1U8OB 3F7VA 2GCYA 1YDPA 5ECGA 1ZT7B 5L6YL 1LO5A 4ZTPH 1NTDA 2WXPA 4GQRA 1MVYA 5EC1B 5EV7A 4CGTA 1OM9A 3CDGA 4ZNEA 1LK3L 4NO5B 1ZAGA 4CW1B 2VZSA 2F0CA 4LZKA 5ADPH 4HUVA 1OF0A 1PD6A 3FB5A 3B9DA 3NN8B 5E5LA 3K8LA 1SF5A 4D3CL 4J3OH 3B9KD 3MV7A 4K8RH 2MCG1 3NZSA 3MNWA 3W2DL 5E08H 1MRCL 2BVUA 3N44B 3MCKB 4PBVC 1S2EA 4K5NA 2PCFB 2WQWA 3V6ZB 3GI8H 1C16B 4AIEA 3KXFB 4X0NA 2XV2A 3SE9H 1J0YA 4Y2DB 3UTTD 3D0LB 3MLZH 3X12A 4ZFZB 3B2DC 3ZOAA 1U8NA 2VXTH 3FH8A 4J8RB 3TN0B 4CVZA 5HI3C 4HIIA 4MDIA 3GXDA 4QJ3B 1FFQA 4OSUH 4PR5A 2WUBL 4N3TA 4CVUA 4G8FB 5IW3A 5I5JA 2VDLB 1JDDA 2GPZA 2JJSA 2P44B 5JOEA 4AYEC 1TG8A 3ALWA 1MXGA 4OV6F 3K2IA 3O2DL 2OJEA 4QHNA 4DW2H 1IARB 4FS0A 5D7KD 3UTPD 1UFUA 1TCRA 3NJMA 4ONHA 1OWRM 3KPOB 4Q6IA 1BF5A 2BIMA 3UX9B 3QQDA 1VEMA 4MXVE 1XAUA 2P8MB 3QUGA 1NMAH 2XV0A 2PCPA 4K7PH 3WLWC 3K6IA 3V10A 4JEGB 1A9VA 3IDXL 2EVIA 2QLVB 4HYTB 3SKNA 1NC2A 4HEPG 1LNUA 2QGEA 2OP4H 4J3XA 4KXBA 1RL1A 5CKGA 4HLZG 3VX1A 4PTUB 4XMLH 4W9IC 3I75A 2XA3A 3D85A 1UM4L 1SJHA 2QVMA 2AS5M 5IIEB 4UT7H 1EGJH 4IRZL 1Q72L 2CO4A 1F56A 2NY4B 4G6JH 4MJJA 4PLJC 1NCGA 3R8QA 3PV6B 3MUUA 1ZPLA 3E38A 3LRSB 4Z7VB 5CLZA 5E1HB 1E50A 2C7UA 3FMGH 4PLJD 1A8JH 5HJDA 3DARA 5GRJH 4YOKA 4LIQH 3RVVC 4QTIH 5DR5H 3ZVVA 4GMTH 5TK4A 4O51A 2VL4A 4NQSB 2H6PA 1MJ7H 1IKNA 1QWUA 5G5DB 5MEPB 2IDUA 4OCRL 2DN7A 2TSBA 4KX8A 2P80D 4OLVH 4FG6D 4GI6A 2FB4H 5C6WH 4BUHA 3BWUC 5IQ9B 5E6YA 2R4RL 1GJWA 3H3KA 2FWLB 5JQHC 1NBYB 1QI5A 3O6LH 4RRPG 5C7XH 4NUGL 3LSOA 3P3YA 1CF1A 1Z9SA 3FCSB 4NYLA 3TASA 2JJUA 4LPWA 1E8YA 3VD9A 5I0DA 3P11L 1CXLA 5DQJB 2ZX5A 3HHSA 3TV3H 5D7EA 3QPXL 5DJ8B 4NC2B 4QRUA 2NY7L 3RKDC 3LNHA 1WFJA 4QMEA 2ZPKH 1TFPA 5BNXD 2AI0L 1QR4A 1DVXA 1TJHH 2WMPA 3FN0H 1HU8A 1K4CA 5GZOA 2G5UA 4G9DA 1NBZA 2YAFA 3K72A 4B41A 4BRJA 5EF0A 4RISH 4BFBD 1T1XA 3HUJA 4LNVA 1PIFA 2KDYA 1NGZB 2PABA 3KJ4B 4JQIH 4KGJA 5E0FA 2HG0A 3BZEB 4LLYB 3BZFA 3BO8B 1WZ1H 3L1OL 1ITBB 4PGJA 1EEYA 2AMUA 1UCBL 4G11A 1ZEAL 1R47A 3SOBL 1AMXA 1M71B 3W82A 4DGIH 4NN5C 3ZJAA 2V5YA 4UQ3B 2NCMA 1QASA 1RH8A 4G8IB 3WKNA 3MJ6A 1XF5A 3HHRB 3GI8L 4LCUA 4DOHE 3L3IB 3LPGA 4LPYA 3LXBA 4XO3A 3MRHA 3MV7E 1ZS8B 4Y5XA 5E2VH 5T1KA 4U1KB 3PQYE 2H3NA 4JCWA 1MFMA 4HW6A 3ROOA 3MLSL 5LO7A 1YA5A 5EOCJ 5CGYD 3BESR 3VFGL 1FAKT 3VWKA 4KUCD 5B4MD 4AGOA 1UH2A 2M8XA 3IDYB 5FYJE 1HYSC 3MMEA 4MA7H 2JE8A 2VNCA 1F3JA 4E5XG 1JK9A 4AEHL 1M53A 3GJEB 5IBUB 2NY1B 5L4FA 4GSDH 4J2QA 4S0SD 3RVWC 1G9ML 4P3CH 1CU4H 2ERJC 3K4DA 1R3IH 5F7YC 5AALA 3MBXH 3TZVA 3VWJA 3ULSA 3NQKA 3X3GL 5DK0A 4YUEL 3MJGX 3TJEH 3ZX1A 2OJZL 4PJ5B 3VW3L 4N5ED 4TLTA 4YDZA 4AG4L 1GHFL 2DYRB 1FL5B 3EO1B 3S34L 5D1QC 3C8HA 1AGDB 4J3UA 4PVNA 4X6FB 2GIXA 3CQPA 2EXWD 4JKMA 1RAMA 5A2CA 1UOKA 3K2KA 3UDWC 3TS8A 3L1OH 1Q0YL 4IJTA 1A1OB 2BLFA 4Y16D 4N0UA 3GZKA 5BQ7B 1V5JA 1N5YL 5FS5A 5JUEL 4MSWB 1GSKA 1NIBA 2VZVA 3KBEA 1A7QL 1D9KA 3O4LA 2D4DA 3BX7C 1DCLA 1UD8A 3EDDA 4FKEA 1F4HA 4ZAKA 1KG0B 3REWB 5I66B 4MJ6B 2VDPH 3ZMRA 2Q3ZA 1FHGA 2GIMA 2VH5H 1JRHI 3UTOA 3SE3A 1CXKA 1U2YA 1XIWC 1QFUL 4ABQA 4KMTL 1YEDA 3QCVH 4DQOL 1T4KA 5SWZB 3ZLQC 5CU9A 4P5KA 3QIWC 4NWTL 3VFGH 1K5NA 2ESVB 4GMSL 1KXHA 4K7FB 3BXNA 3VXUB 4IRSD 4CSZA 3C6LD 2GI0A 3OKDA 3JZYA 4QRTB 4D0DB 2BIPA 4IRSA 4I5BA 3ULUE 3DVIA 2I5YH 4G6FD 3LNFA 2EICA 3VCLA 4M5YL 4Z9KB 4ZUTB 2Y72A 1N0LA 4R4ND 3OKMB 3GMOB 4KRPC 3AREB 1OALA 1GYWA 5IHHA 1QEXA 1AQ8A 1TU2A 3S8FB 1DEEB 2CDFA 2E47A 5C0CA 4QRPD 4G70B 1KXTB 4KK5D 4GW4A 2CMRH 4KDVA 4W4NA 1WE5A 4NUJB 2XG5B 5F9JA 2CGZA 4R26L 4LSRL 4A2HA 3UH8A 5KWYC 5I76B 4P5SA 3O3EB 4JREB 3M17B 1N5AB 1NCDH 2NNFA 2BHUA 1I8LA 3HS0C 4G6JL 2VIRA 4L4TA 4XTRC 3VGBA 4JM0A 5JXAL 5GIRB 2QV4A 3B4NA 3DO7B 3ZIMA 3JV4A 1OY3B 1VFBA 3BEVB 3UBXG 3PP4L 1NCAL 3D18A 1W0WA 5LCVA 3O0RL 5JPMA 3MRLA 2GFBA 4R0LA 1MQ8A 3PV7A 5IB3B 5A40E 3K6FA 4W6YB 3KLLA 2Q86A 1JF1B 2V7HA 4MRCA 4WENB 1CICD 4JB9L 4JN1L 4AYSA 4XCEB 5ITBH 1P7QA 4MS8C 4JUTA 1A7NL 1O0VA 2QV2A 4MNHA 4PJ7A 4X6CF 5HYJB 5F70A 5FYJU 4GAGH 1FE8L 4WU7B 3ZTJH 2PWHA 4ZOCA 1OQXA 5IBTL 1XCXA 4WEBH 5DEFA 2ZOTA 3TNMB 5T1LA 2NY3B 4LHUG 2FUQA 1HZHL 3PNRB 4L4VA 2VGLM 4XGZA 3UBHA 4ZMYA 1GGUA 4DW2L 3AXLB 5C2UB 2YPVL 4AYBA 1SQMA 1QR1B 1IBFA 4LL4A 3DPBA 5T1DL 1A5FH 2DD8H 1E90A 2YGOA 2J2ZB 5I74C 4YDVB 4FTVE 3CDCA 5IM7A 2F19H 2Z6FA 1WZAA 2E7CA 4GRWE 2QKIC 2QSTA 5DQDH 1MW2A 3EDFA 3Q6FB 3N55A 4K07A 4PGCA 4X4XB 3CBJB 4UQBA 1V10A 5FM4A 5E6IA 2WSKA 3ULVC 3C08H 2RB8A 3BT0A 1KIQB 5SWZE 3BW9B 1IBGH 4NQED 2EABA 5EUKA 5CEZD 3PWLA 3BP5A 1SMDA 5INDB 1CIUA 3FFDA 2CU9A 4MVBD 5D7JC 4QIRA 3CFQA 4JFED 1MHPL 2W0FA 3QFJA 4YN3A 1SEQH 3QZOA 1Q0EA 3CDFA 3QCTH 3RUGE 2W0FB 1UHVA 1ZGLA 1BM3H 3NPZB 5ADPL 2XICA 3MV8E 2BIOA 1JVOA 1NOFA 3CU7A 5GGRY 2WQAA 1ZLVK 4YQXL 3BP5B 2WKOF 4OZHE 5EUKB 2YXFA 4MAYB 2BVQB 5DMYA 1KEMH 2A38A 2QSCL 3WOVA 3DGGA 4A68A 5L2JB 1JHKL 2IQ9L 3GBMH 3IFPA 5I26A 1ZVNA 2X4RA 3ELQA 4Y5VB 3SPCA 2R4SH 4R2GD 3VXSA 1SJXA 1DQLL 2PPEA 2YD5A 2F8OA 4B60A 5F1NB 3RP1A 2J5LB 1PJ9A 4FP8L 4YLBA 2X6UA 1D9KC 1CICC 4U3XA 2LTQB 2EH8H 3DPBB 1L6PA 4Z0XB 2L0DA 2CJ3A 3FTSA 5I0VA 4DAGL 5EA0L 3LKRB 1DBBL 2GEEA 3MBEB 5EORL 1LO2H 5FGCE 4KNTA 4WKZB 4YIQA 4ZI8A 2IJ0C 1SXNA 3TNMA 4MA3B 1IB5A 2HJFA 3WJJA 5JMRA 1EVTC 3LEVH 3RPIB 1E5YA 3VDCA 2EIZB 2KYIA 4HJJH 4N68A 3QUZB 5A6IA 2ZCKL 3SYQA 1HEJC 3MUY1 2VO8A 2DWEA 4E9YA 4BFJA 1NDGB 3I9IA 3N1PC 1HXMA 1S5HA 1W9XA 2Y3AA 4PMFA 2Y36L 1FZOA 2ZXGA 2WXHA 2BMKB 5H2BB 1AMYA 5E8EB 4OZGE 3NCMA 5CR8A 1PY9A 4N2GA 1G7IB 4X98A 2NY0C 1N70A 3NIFF 4FJ6A 3H9SB 4GKSA 5DJ6A 3FCTA 2BRRL 3N43B 3DXAE 1XB6A 4NUJA 5F9JB 1KGWA 2NY4D 3U0PA 1Q9KB 1ROCA 3H3PH 1L7IL 5FYKH 1KGYE 4GAGL 5C2BH 5EU6D 3HRZA 1RZIA 3ECQA 3MQIA 1MFUA 4OGZA 1QLEH 3QUXA 4HWNA 3FONB 4UNTA 2ZCZA 1CDHA 2C4FU 2GUOA 3SODB 4ZX6A 3K7UA 1GGIL 4GKOA 3VXOA 2JCCF 2VCOA 4LEXL 3NCEB 4NN6C 4ESKA 2LFEA 4M4RA 2V5SA 3EG9B 4R6UA 5LBSA 4RQQB 3H1ZA 4F2EA 4X6DF 2OMTA 1AXSA 4JBSA 4N87A 4ELMB 1N8ZB 1EAOA 5FOBB 4R7DA 1A0QL 2Z34A 3GHBH 3ZTEA 2X4OB 1OAYL 4NM8H 4MAUL 2E76C 4KU1A 4YDLC 4QLWA 3ULVH 2MCPL 1AGBA 2BVYA 1V7MH 4JO3L 1TLKA 4I77H 4FABL 5I1LB 4R84A 3KH3A 4LKXA 4ALAH 3RE0A 1Z5YD 3CXHK 4PJIE 3REWA 3QO0B 4TSAH 3MLTA 4WCYL 4FQPA 4OLXL 3B37A 2J8OA 3X1EA 2XTLA 5E6SB 4IU2A 5KSVA 2ZSVB 2DQFB 5MEQB 1T7YA 4LCYA 2QSQA 4OUUB 5DD1L 2DWDA 3E80A 3SPHA 4BDVA 5LKNA 3D07A 2OI9B 3OXRB 1UM6H 4QR7A 4H8PA 3MDJA 2MQGA 2AXGB 4DVBB 3V0FA 2FBJL 2BOCB 3LQAH 2E0PA 2DQMA 4PJFA 3VFNB 2ZKHL 1WLHA 1MFEH 3DMMB 1X9UA 2IO5A 1BD2D 2VQ1A 3CFEA 5CU5A 4Z3JA 2B59A 4FQ2L 3T3PF 4N0UE 5LBSH 3RDTD 1H3WM 1ZANH 3C2SA 5DK0B 4LSPL 1DQIA 5C0BA 4KZEL 4ONOA 5F3BA 4CN6A 1PX3A 2QT6A 4JO1L 5BRQA 3MLSH 4KKBC 1PFCA 5DD5H 1GAFL 2F58H 3F64A 1AXTH 3S37X 4TSBH 1BJ8A 3D2UB 4UZGA 5J7CC 2IH3A 5DJXA 2FB4L 4J2XA 3HA0A 3B7TA 2QPUA 4Y4KB 2Z93A 3AROA 3IMTA 3MJ9A 3BPNB 3ARDB 1LP9B 5L88H 5FA3A 1UM4H 2GHWB 2OL3L 5DJAB 4DKTA 3P3SA 1OHQA 3FO9A 4LASL 2H2SC 4ECNA 3S8WA 5ILTH 4AENA 2VJ8A 3DTDA 1ZS8A 4Y5XB 5KBLA 5TPWH 3TEZA 1TQSA 4KAQL 1MJJA 4X8CA 3HI1A 4NKMB 4PN6A 3VSVA 2YUWA 4BE6A 3U9WA 3TO2B 4XAWL 3KXFE 1WDAA 4ONGL 1G7PB 1WEJH 2X3AA 3AM8C 4UQ3A 4B96A 3WY4A 2NT1A 3BAEH 2LLGA 5GJTH 2MRYA 4RAUA 4EI0A 3PQYA 3GSXB 4JFEB 4LDLB 2VLRA 1G1OA 2JJSC 3BO8A 3KYNA 4P5MA 4S1RL 1LO4H 4X9FA 3H3PL 5K59E 3HI5H 2LGNA 1HQRB 4I48A 4OIBA 3VXMA 3WGVB 1D5ZB 1KELH 4OLWH 4R7XA 2NQDA 3I6GB 1YAIA 1EERB 1OPOA 5HHNB 2W0KA 1PLAA 1LE9B 3C6LB 1E4WL 1O7VA 4N1HB 4RMTA 2W0LA 2RMNA 5TDOB 3CBKB 5TDPA 2AZUA 3CVDA 1QBMH 1NZRA 4YDKH 4KXAA 1C5CH 3KDPB 1LO0H 3SDDA 5MHSE 3MBED 3ULVF 1E6OH 4OLUH 3HHSB 2D03H 5DURD 3V0AC 1CDCA 2B2XL 3Q2CA 4WGWB 2R9HD 2YPLB 1TUPA 4IGBD 4HKZA 4NYLB 4K15A 1U8CB 4C83B 4BE5A 5CUSH 1HSAB 2UWEA 5IWLC 4MB3A 4ES8A 1NBYA 4XWGL 1AQKH 4EZLA 4PPTA 5C9KA 4XZUB 1TITA 3V9EA 4B9IA 2Y1ZA 3LX9A 1VACB 1FLRL 3DJTA 4QOKA 4Y4FC 1AGFA 1S7RB 1QO3A 1T4WA 3CFCL 1J87A 2VDKL 4NKIH 4G9FA 5ALCL 5L88L 4YDIL 5FC9A 4ZXBC 3DHUA 5B7MA 2Y7QB 3QDGA 1X6LA 5FYJH 4E9TA 4GXFA 4X7CC 2AP2A 2CLRB 5AAMC 4M5ZL 4Z7UB 5CZXC 1L7TL 3ZT7A 3W81A 2WP3O 5DC2A 3ZE1F 4HXAH 1KXQA 4CJ1A 1EHKB 3QDAA 4WUUA 1AXIB 4KUCF 3UJJH 2PN5A 4HEMA 4ODSH 2JKXA 4XAWH 1R5WA 2ZCHH 3ARUA 3FHQA 4GQZA 2XXMB 5DD1H 2VUYA 2VLJD 5BZWB 4TUUA 2YR3A 3D85B 4XCNA 3KVPA 4G9FE 5IESH 2NT0A 3SY6A 2YN5A 4P2QD 3O9WA 1M42A 3CFKA 5I1DB 2B8OT 3CU1A 1LNUB 2WVVB 5CP3H 1SDAB 2ZWNA 1T89C 4DN4H 1OLLA 4GXUM 1BOYA 4AVKA 2PCPB 1HI6A 1MJ8L 5JHMA 2DBLH 2AJVH 2XA8H 2ATKA 2XKNB 4LRNL 4YR6A 3OR6A 4BA8A 2XT1B 2VJ0A 2A74C 3RU8H 2C34A 3MTXA 4TUKH 1TCRB 3MRKA 4ZD3L 3BISA 2NYYC 3WAKA 3AG2B 4UIMB 5AOKA 1CE6A 2W80C 2VDOH 4HGWB 1MLCB 3OB0H 4ZAKC 4MHHG 3L9YA 1T0PB 4JL1A 5D9SA 4PS7A 3SIKA 4HLJA 1HAUA 4MDJA 4OQTA 5CBEA 3FQXA 4IBQA 4LLWB 1TTBA 1X5MA 4UUJA 2UXTA 3VWKC 1T7WA 4J8RA 3BD5A 5I24A 4FX5A 4DERA 1UTDA 1AXTL 2EVJA 1RP8A 3PUUA 4RAVB 5CD3A 1LWJA 1U8NB 1KYOK 3VTMA 4M6OL 3I3DA 1N10A 2WB7A 2P8LB 1VAHA 1BD2E 4Y5XC 4PEEA 2R56L 3VVVA 1C16A 2PTTB 4F33B 2EDJA 5I16B 4XRCB 5IGXH 4LHJB 3QNFA 2XVLA 5G4OA 3TPUB 1ZTXE 1YC7A 4LHUB 3QEQA 3MNWB 3HR5A 5CSBA 4I1PA 1CTNA 2BNRB 2H32A 1QSVA 3ZKMD 3TV8A 5D70L 4ZMLA 4B50A 4ZQKB 5J9PB 1FL6A 2HP4A 4N2EA 3D4GA 2KDGA 1O5PA 5KOVC 2BS71 3TFKC 5J11C 5IW1B 5KS9F 3JWNE 4Y9GA 1WWWX 3MRMB 3WFDL 2X4NA 3WHE1 3UBXB 4WEUD 4WJ5A 1RZQA 3Q5OA 3F7VB 4QRQB 1QAWA 5EBWB 3UJTH 1AR1C 4PD4J 3I85A 3Q8CA 4N8VB 3VH8G 4NQTA 3T4AC 1JMXA 2Q8AH 4H8WL 1OZTG 3SPVB 4HZLA 4BWUA 4LVNB 1S7SA 4OZGB 4TN9A 1SVBA 3VFMA 3N9GL 1QNZH 2OTUB 3RWFB 1NLBH 2OJZH 5CGYC 2PTVA 1RJLB 1W72B 3O3BA 1MCPL 4GG8A 3BC9A 1A6AB 1WIPA 1JNHA 5B21A 1M7IA 4JRXD 4CKVX 2VITB 4LAQL 4IBSA 1PY4A 1U58A 1H15B 1LVEA 3ZQ9A 3SE8L 3PLYA 1RVFH 3APCA 1BBJA 1XXFC 2CJUH 1OGAB 3IGUA 3L7EB 2TSAA 1JGDA 4XCFL 4Y5VC 3NRPA 3BP6B 4BA0A 4PWGA 3CTTA 4P4RA 4OF7A 3BQUB 5CEXB 1SZNA 3CPUA 2XVGA 4KK9C 4X7FC 3PWUA 1LD9A 3O4OC 1QKZH 2FLRT 3N0PB 3KW8A 3QJVB 5I1CL 4IMKA 1TZ8A 3MRRB 1JHTB 1XGYL 3S35X 3L08A 1G7QB 1FWXA 4KUZH 3QEHB 5D4HA 5SV3A 4YSTA 3L9BA 3M1OA 4Z3FA 4RBPK 5HHME 3V0HA 4I0CC 1A7PL 1A3RL 1WPCA 4Z0BH 4BH7A 6TAAA 2ROXA 5KUKA 2P5WA 3DOSB 3MUHL 4ZOAA 1DANT 2F15A 4EDXB 1FGNH 4WW2A 5EUOE 1KBGH 4UOW1 1DN2A 1H6EA 3ZL4L 4CGUB 1F4YL 3H53A 2GJPA 2FO1A 1F4WH 4HWUA 5CM1A 3ZSSA 2ZAIA 1MCQA 4FLHA 4NWUL 4ABVA 5CIPA 3WD5H 2H2PD 1IE5A 3U1SL 3NIGF 1TO4A 2Z64C 2G2RB 2P7TA 3HN8A 3O3DA 5HI5C 2R1WB 4UIKL 3O2WH 4ZD3H 5DVPA 1I75A 3E7JA 2MHAB 3PHOB 3CVIH 1CT8B 1E6JH 3QULB 2AJSH 1QLFB 2GKIA 4RIRB 5AKVA 5JW4R 4IU3B 4KROD 3CZLA 4Z7OB 4B9PA 5H35A 2OCFD 3HE7A 2EVGA 3GRGA 2OMUA 3JWOL 3L17A 3RGVC 4YGVB 3CGTA 3Q01A 4P2YA 4JCMA 3QXAB 4PRIA 1WRFA 4XCFH 5EUOF 4YFEA 1B9ZA 3NDZE 4E5XB 1ZWIA 3CZKA 4QXTB 1RLBA 1WBXB 5KG9B 3QARA 3TBVA 1ZSHA 5DJDA 5DZVA 5KVDL 4XC1H 1JYVA 3V4VA 5IJVB 1AHWC 5AB0A 2EYRA 5E6UB 15C8H 3WIHL 3DUSA 2V9UA 1TQBB 4NZRL 3GLEA 2HT4D 1XZ0A 4BZYA 2R4RH 2Z8RA 4P46B 3DOIA 5F1SA 4Q4IA 1P4BL 2P5ED 3V0WH 4UT6H 1AZUA 3QJUB 1CVSC 4QTIL 5DR5L 4PJDF 4DFIA 3L9RA 1U8QB 3ARWA 3QEUA 5D5MA 2EDRA 3RVUD 3OGCB 2NW3A 5ISZD 4X5WA 1CR9H 1RZJL 2OMVB 4G7VL 4PRBA 3GSRB 1SYVA 4OF8A 4TXVB 4R8WH 3I6SA 2EKJA 4YSSA 3EFFA 3KEHA 2AEWA 2G4GA 3IJYB 4WK0B 5ESQA 1EMTH 1P0SE 5KBKA 2IH1B 4G42B 4PY8I 2PUQT 4XNMA 4HXBL 3Q48A 3WI9A 4ZFGL 4AGQA 1XWVA 3C5XA 1RUPH 1A6UH 3BH9B 5D6CB 1BQHB 3NP4A 5DMKB 3M86A 1D5XB 1ZIAA 1XL6A 3D06A 5D7JB 3T8VA 5MEOA 2NY7H 4OTXH 2ZX6A 2K45A 1J88A 2R0KL 5ITFB 1DO6A 2OZ4L 3MRGA 4NT6B 5EU5A 4HOZA 5M7QA 3C6EA 4RA3A 4JDEA 2BCMA 4MX7B 1JN6B 2BSBA 2XWBB 2K70A 4NQEA 5HGHA 3N2JA 1N59B 2GJ6E 3H9HA 3O4LE 2OL3A 1MVUB 1XVSA 4PRHE 3NVQA 4HS8H 1I8MB 5C0FA 1ZTXH 3L3JB 3VRIA 3MJ9L 4K5LA 1DQMH 4QRRE 4C4KO 4AKQA 3EYVA 4NCDA 5JIIA 2OTWB 3W5MA 1ZCRA 1YMMD 3TIEA 1N7ML 3HE6D 4X6BB 3SOTA 4RZCB 4ENED 4PJ9B 4JRYA 5JDJA 2J88L 1COBA 2HJKA 1NEUA 2WCSA 4NPKA 4NQDA 3UBGA 2Z4QB 5ERWB 3IGAA 3QDMA 4WSGA 4RESB 5DVNA 5TD4A 4MXQC 4OJAA 1ZK9A 3VRLF 5E1AB 4R3SA 1UXSB 2YHGA 4U7MA 2ATPA 2EH7H 3RZWA 5LQBL 3QS2A