4EJ4A

Structure of the delta opioid receptor bound to naltrindole
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
442
structure length
442
Chain Sequence
RSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRNIFEMLRIDEGLRLKIYKNTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the delta opioid receptor bound to naltrindole
pubmed doi rcsb
molecule keywords Delta-type opioid receptor, Lysozyme chimera
molecule tags Signaling protein, hydrolase/antagonist
source organism Mus musculus
total genus 156
structure length 442
sequence length 442
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 4ej4A02
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4ej4A01
1QHJA 3DN0A 1KG8A 1OWZA 4I7JA 1TN5A 1VJMA 1LWKA 114LA 2BRDA 1QUDA 182LA 3RFMA 2B6WA 4JR8A 3C9LA 1L93A 248LA 4XTNA 4QI1A 4EKRA 3OE0A 139LA 1L68A 1L19A 2O79A 1L09A 1L28A 1L56A 2YCZA 1G0QA 3DQBA 1Q5JA 1L00A 3C81A 1G06A 218LA 1L50A 3CDQA 3QJUB 1QSBA 5B6ZA 1QT8A 5A44A 1L66A 3SB9A 123LA 3UTYA 1CX6A 1G1VA 2Z6BA 4E97A 3HUKA 4UG2A 1L32A 1DZEA 1XEPA 3ABWA 129LA 216LA 4AMJA 257LA 4XTLA 1C6CA 3PXOA 2NTHA 3HUQA 3EH3B 1CU5A 4X31A 1L55A 3NYAA 1L15A 1L37A 2ANVA 4ARJA 3QBKA 200LA 1DYCA 3HASA 3DMXA 4G72B 4W57A 2RH1A 1P6YA 1DYBA 1XIOA 5H2JA 1C63A 1L88A 4ARMB 4DJHA 6LZMA 3T45A 3HANA 1L80A 1C6FA 2Y04A 1L21A 2LCBA 262LA 1KY0A 1L85A 4I7LA 5C1MA 3SBBC 2ZZLA 217LA 226LA 1SSWA 2L78A 5BR2A 3NSBA 3UZAA 2QB0B 4DKLA 3OE8A 4I7KA 4I7QA 149LA 1IW9A 1P8HA 4Y9HA 3CODA 1L74A 1L98A 3G3XA 1LYHA 215LA 180LA 5G53A 1L92A 2KSAA 4GPOA 1LI6A 128LA 2Y02A 3HAQA 5AX1A 1CV4A 3X3BA 1L10A 241LA 5B6WA 1L69A 3GUJA 239LA 152LA 1G0LA 1PXRA 3C82A 1O0AA 1NHBA 5H2OA 3SB5A 3HH6A 1L26A 3DN8A 1F88A 4MD1A 3CDRA 1CX7A 4YXCA 2KS9A 250LA 4KNFA 2HULA 1LGWA 5B6XA 1CU6A 1L60A 3D4SA 234LA 3CAPA 3NS0A 5LWEA 3GUNA 1QTZA 5KKHA 131LA 1L59A 1OWYA 4BV0A 159LA 4W56A 233LA 235LA 4G71B 1L64A 4XT1A 1OVJA 3SB6A 2RAZX 3AYMA 1SSYA 1L49A 1LYFA 1D2YA 5TGZA 5H2HA 1L70A 3UTXA 4W55A 2F95A 2ANXA 4AMIA 236LA 1P2RA 1H2SA 1L46A 1PQOA 3C83A 5H2KA 247LA 4MD2A 138LA 4GBRB 3GULA 4EA3A 1D3FA 3PBLA 4JQ6A 146LA 1JV6A 3LZMA 1F50A 1P3NA 1L31A 4I7MA 4PK0A 1P37A 1QS9A 184LA 3HTBA 240LA 1L25A 2I20A 3MBVA 1KW7A 5FJGA 5ITEA 1PXSA 2YCWA 1C66A 1L65A 258LA 1P36A 1BRDA 177LA 1PQKA 3VI0A 3UONA 2M3GA 3HARA 228LA 1L20A 4KLYA 3DN1A 1L07A 1JV7A 244LA 2RB1X 3C8SA 2QARC 2KSYA 1DYGA 3HAOA 4ARLA 5G2CA 1L04A 1VGOA 1L27A 4LDOA 1S52A 249LA 1H68A 214LA 256LA 2LC9A 2O4WA 4BWBA 2EI4A 4ARPA 1L05A 1QTCA 1IW6A 2L6XA 1C6NA 222LA 1L33A 4MQTA 1LYIA 3HH4A 4X32A 1C8SA 1KNIA 4EXMA 109LA 2I1XA 5JJNA 225LA 2RB0X 1CUPA 2KSBA 5EN0A 5DYSA 1XMEB 155LA 1E0PA 1WTHA 1L48A 4GBRA 3DN2A 1C61A 3QJRB 1OV5A 1ZURA 3DN3A 252LA 210LA 3HT6A 1TLAA 3L2XA 3ODUA 2I35A 5AWZA 1UAZA 1C3WA 1FBBA 1C6PA 4EPIA 1L72A 161LA 4W54A 2AT9A 198LA 188LA 1L34A 3X3CA 3BVDB 5A8EA 1D9WA 1DYFA 1QT6A 3GUPA 4HYXA 165LA 1L9HA 170LA 144LA 3HT9A 1L86A 1LWGA 1G1WA 1L62A 2OE4X 4EPFA 1MGYA 2R4RA 4N4YB 5ETZA 260LA 1L11A 1CV6A 237LA 1QUHA 3DNAA 1L30A 1QS5A 3NY8A 4XTOA 1DYDA 3C8RA 1L35A 3S8FB 143LA 4GP4B 4BEZA 5B6VA 3HT7A 108LA 2IGCA 4L6RA 4PXKA 1L89A 1L52A 1L29A 1QUGA 1DYAA 4IAQA 169LA 5G54A 1P64A 5H2MA 3HH3A 1I6SA 158LA 4A4MA 5H2IA 2OU9A 1L24A 2F47A 2Y00A 3C80A 4N4WA 5JJJA 4W58A 2Y03A 4J4QA 5G36A 1L67A 2RBOA 1C67A 126LA 1L71A 1L84A 3SN6R 4LDEA 4N6HA 2QPDB 4LDLA 2YCYA 148LE 1L0KA 3VW7A 3AYNA 1L77A 3HTDA 3DN6A 2OE9X 2YDOA 5J7AA 1L76A 141LA 1L36A 2B74A 242LA 4I7TA 3UZCA 1S53A 3FI5A 212LA 4W59A 251LA 1GU8A 5B0WA 4K5YA 1B6IA 1C6BA 1JTNA 1QTBA 110LA 1G0GA 1C65A 1CV5A 1L40A 127LA 1G07A 5G2AA 213LA 5AHYA 1C6QA 219LA 4L35A 5H2PA 130LA 4ARMA 5G28A 4I7RA 4EIYA 1PQMA 172LA 2OU8A 3QAPA 231LA 4QIDA 4OO9A 1CUQA 2F2QA 245LA 195LA 3F9LA 187LA 160LA 192LA 1LYEA 1P46A 1L41A 1T8AA 1L16A 1L91A 2B6ZA 3SB7A 1BRXA 1JGJA 3DKEX 1CU2A 1LYJA 3VHZA 102LA 3HDEA 2RB2X 3V2YA 1BRRA 3DMVA 104LA 4IB4A 3VG9A 191LA 1S51A 3AM6A 4UHRA 5JJEA 4EKPA 2ZIYA 1L57A 5AHZA 3VVKA 1L03A 2R4SA 3OE6A 1L02A 1L01A 1GUEA 1U19A 171LA 1CV1A 1KG9A 1CU3A 4AQNA 4I7PA 4W53A 1L53A 2LNLA 3HAPA 1QT7A 1L14A 1C6LA 1C64A 2B75A 1L22A 2HPYA 4BEYA 1XJTA 3QJQB 1T8FA 4I7SA 120LA 3C8QA 1KW5A 2PEDA 1AP9A 163LA 1T6HA 1X0I1 7LZMA 5DHGA 1QUOA 3QJSB 1R2NA 2B6YA 196LA 190LA 1D3NA 254LA 229LA 3G3VA 1UCQA 4X1HA 5H2LA 1AT9A 2WJLA 1L83A 3QJVB 4GRVA 4EJ4A 125LA 1LI2A 261LA 2NTUA 151LA 4WW3A 1L51A 4FA7B 1LYDA 3ZEVA 221LA 4HWLA 1L99A 1SWZA 137LA 1L23A 183LA 2OTYX 2O7AA 4IAPA 3PQRA 3S3CB 4XXJA 3QJTB 3QDCA 2QPEB 3RZEA 2RBQA 1C8RA 3HTGA 4QRYA 3CDOA 2A4TA 4G7QB 5H2NA 1JQUA 1L0MA 3JR6A 1LGUA 4GP8B 1P8IA 1G0KA 1P2LA 119LA 3ZPQA 1L79A 2NTGA 1CV0A 1QSQA 2B73A 3OAXA 3QBGA 3S8GB 2VT4A 4HYJA 2Y01A 5G2DA 3GUIA 174LA 1L39A 3EH4B 1BM1A 5ITCA 3EMLA 1OVHA 4MQSA 1L96A 1IXFA 1K28A 1XJIA 2HUMA 1HZXA 3P0GA 5B35A 1JTMA 1L47A 1CU0A 1L17A 3K2RA 3C7YA 1G0PA 4EKQA 2G87A 3C9MA 1CVKA 1L90A 2B70A 4OV0A 1D2WA 1QTHA 1L61A 1PQIA 3COCA 3DDLA 5F8UA 3A7KA 3GUKA 4YXAC 1S8JA 166LA 1SWYA 1SX7A 224LA 1QT5A 1E12A 1M0KA 3SB8A 1C6MA 4FPDA 1S54A 259LA 1L13A 2RAYX 230LA 156LA 2RBNA 2YDVA 3UG9A 5LZMA 1C60A 1LGXA 1L0JA 4S0WA 4DAJA 2RBPA 3HWLA 205LA 1GZMA 4LZMA 2J4YA 1QTVA 1C68A 1P7SA 1QT4A 2JAGA 3KJ6A 103LA 223LA 1L87A 4EKSA 5AX0A 3GUOA 3CDVA 232LA 1C6EA 1L75A 178LA 162LA 3C7WA 4I7OA 1L94A 4W52A 1EHKB 3FA0A 1L81A 1M0LA 3REYA 5AZDA 1OV7A 1LN6A 253LA 3RUNA 1LPYA 2LZMA 1C6AA 5A45A 3G3WA 4WAVA 185LA 115LA 112LA 4ARQB 3CDTA 197LA 4ZPUA 5B6YA 3DN4A 1L06A 4MBSA 1LW9A 2OE7X 4BVNA 1QTDA 1L12A 1QKPA 3QBIA 1L63A 4NC3A 4BUOA 1PY6A 1C62A 4GP5B 2NTWA 3S3BB 4I7NA 1L97A 4G7SB 1ZWNA 3WQJA 5B2NA 4XT3A 199LA 3NY9A 4G70B 1TN0A 5BR5A 189LA 3OE9A 3V2WA 1L38A 1G0JA 1QT3A 2JAFA 4TL3A 1L18A 2Q9EA 4G7RB 3PDSA 107LA 3GUMA 1S8LA 142LA 1L44A 1ZYTA 111LA 173LA 4PXFA 1L43A 2YCXA 209LA 3DMZA 1KY1A 1R84A 227LA 1D3JA 1KGBA 238LA 255LA 5B34A 1T97A 1CWQA 1P8UA 3HUAA 1C69A 1Q5IA 2ZFEA 3FADA 175LA 2B72A 3S3DB 2Z55A 3UTVA 1D3MA 2Z73A 1M0MA 2I21A 3SBAA 4IARA 186LA 1XJUA 157LA 1G0MA 4GYCA 2B6TA 1X0SA 1PQDA 1QKOA 220LA 4ARQA 2Q9DA 1L45A 2F32A 1JFPA 1QM8A 1X0K1 4FAAB 3ZPRA 1LLHA 243LA 3HT8A 1PQJA 1EPYA 1L95A 1P5CA 1P56A 2RBRA 2RBSA 246LA 201LA 1KMEA 2X72A 1OYUA 3F8VA 1C6KA 3UTWA 4W51A 1LI3A 122LA 3C7ZA 1C6DA 145LA 3HU9A 2B7XA 164LA 2WJKA 2F93A 2OU0X 3QAKA 206LA 5I14A 118LA 150LA 1L82A 1L54A 1C6GA 4PJZA 167LA 1DYEA 1CTWA 1L08A 1SX2A 1OVKA 3HH5A 3L64A 4FBZA 1FBKA 176LA 2OEAX 3HU8A 1KS3A 2OTZX 4YX7C 3PWHA 3QBLA 3HDFA 1L73A 1C6JA 1CV3A 147LA 1T8GA 4JKVA 1L58A 211LA 181LA 1C6HA 113LA 1LYGA 1C6IA 2B6XA 1F4ZA 2HUKA 5DHHA 3EH5B 2CUUA 3VGAA 168LA 1L42A 1C6TA 3HTFA 140LA
chains in the Genus database with same CATH superfamily
3DN0A 4D9ZA 2XQOA 4NGWA 4JR8A 4WLDA 1L93A 4QI1A 3QY4A 1IIZA 3OE0A 1RE2A 4QGZA 1FLWA 1L68A 1G7IC 5KXZA 1YAOA 4UWVA 4B1AA 1G0QA 3TXDA 2D6BA 4LT0A 1QT8A 2BLXA 1L66A 3WU7A 3SB9A 4NFVA 1HFXA 2D4IA 1SQ2L 1L32A 1DZEA 1XEPA 129LA 216LA 4IATA 4XTLA 1HNLA 1GAYA 3EH3B 1W08A 4X31A 3A8ZA 1LHHA 4KL7A 3B0OA 1L15A 1LSNA 2RH1A 4OWBA 5LVKA 2F30A 4H9HA 3T45A 2Y04A 3SBBC 3LN2A 3LYZA 2L78A 3NSBA 4DKLA 4I7QA 1P8HA 4Y9HA 4XJDA 3WH1A 1LYHA 180LA 1L92A 2KSAA 1LPIA 4HV2A 5AX1A 3X3BA 1DI3A 2HEAA 1PXRA 1F6RA 1B5VA 3TMUA 3SB5A 3HH6A 5DLAA 3DN8A 2I26L 3WU8A 4YXCA 1L60A 3D4SA 1BVKC 1QTZA 3P65A 3AZ7A 4YOPA 1KXYA 1TDYA 3AJNA 235LA 1FKQA 1L64A 1IY3A 1OUBA 1SSYA 4XN6A 1L49A 4W55A 4N9RA 1FBIX 2DQCY 4I0CA 1UICA 1H2SA 4IJ4A 1D3FA 3PBLA 4RDSA 3LZMA 1F50A 1P3NA 4I7MA 4PK0A 1L25A 4P2EA 5KXWA 5FJGA 1KW7A 3N9EA 4TX7A 2Q0MX 1HEOA 1JKBA 1BRDA 3A92A 3VI0A 3UONA 2AUBA 4G4CA 2KSYA 1GE4A 1YKZX 4QDNA 4LDOA 5FDJA 249LA 256LA 6LYTA 1JJ0A 5KXNA 222LA 4MQTA 2X0AA 3K3TA 1UUZC 2I1XA 4KPMA 5HNCA 2KSBA 5EN0A 1ZV5L 4TTDA 2XJWA 1REXA 3QJRB 4HTKA 4BS7A 1LKRA 1IC7Y 1OV5A 4WLYA 1MLCE 5AWZA 1C3WA 1LHLA 2W1LA 1L72A 4AGAA 4MBSA 5G36A 4N4YB 4DDCA 4HJVA 1CV6A 2BAAA 2BQNA 1QS5A 3VWOA 4BEZA 2DBTA 3HT7A 1BB3A 2Z39A 4N4WA 3W6AA 5FEKA 3HBEX 4QY9A 3CT0A 2Y03A 4WMGA 1OUDA 1VDSA 4N5RA 1YKXX 2DQDY 4LDEA 4N0JA 2QPDB 1L0KA 3AYNA 5F9XA 1L77A 3DN6A 5IELA 193LA 2YDOA 3W3EA 1L76A 1S53A 251LA 5B0WA 3LYMA 1JTNA 110LA 1B7RA 4XENA 1CV5A 1L40A 5G2AA 4W94A 5LVJA 1GFUA 2HU3A 4RLNA 130LA 2MEIA 4EIYA 3ZEKA 2HEEA 3QAPA 231LA 3CSZA 4OO9A 1IC5Y 1OUGA 2F2QA 160LA 1LYEA 4XJIA 4ML7A 1WQQA 4OWHA 2YBHA 2YBIA 1L16A 1LOZA 4DS7E 1GFGA 153LA 4AXTA 2G4PA 1CU2A 102LA 1NQIA 3V2YA 1D0LA 4NWHA 2Z2EA 104LA 2BQKA 4NHIA 4UHRA 5JJEA 5AHZA 4H9AA 3BKVA 4II8A 1L01A 1GUEA 171LA 1CU3A 1QSAA 3CSQA 3WMKA 1KXWA 3HAPA 4OWEA 1C6LA 3E3DA 2B75A 1L22A 2ZYCA 2ZQ4A 1B7MA 154LA 1AT5A 1LHIA 1T6HA 4LT1A 1A4VA 1VATA 1R2NA 196LA 4X1HA 2MEDA 1AT9A 1AM7A 3QJVB 4FA7B 1LYDA 3ZEVA 221LA 4HWLA 1SWZA 4M6DA 5T3FA 2I25L 4FDYA 3S3CB 1C43A 3QDCA 1FN5A 3RZ4A 4QRYA 4ET9A 2A4TA 1RI8B 1L0MA 1YL0X 2H9JA 1BWIA 1QSWA 2NTGA 1JEFA 2B73A 3LYTA 4NGYA 1HELA 1L39A 5ITCA 3AZ5A 1B7QA 1JUGA 1QDTA 1OUIA 1A2YC 1HZXA 5B35A 1LJEA 1G0PA 4EKQA 1C08C 4OV0A 1D2WA 1QTHA 3COCA 3DDLA 3A7KA 1ZVHL 4YXAC 1S8JA 166LA 1HSXA 1XGPC 1C6MA 133LA 1S54A 2YDVA 1B5XA 2RBNA 1OUCA 1RCMA 5LZMA 3TMVA 4ZEEA 5KY1A 205LA 1REYA 1GZMA 3ULRA 1QTVA 1C68A 1QT4A 1GF6A 2FYCA 1HEPA 4EKSA 2FBBA 1LZ4A 1M0LA 1EHKB 3REYA 5AZDA 4PHIA 1LN6A 2LYOA 197LA 4ZPUA 3W6CA 4Z46A 2CDSA 3GXRA 4J1AA 1LZEA 4H92A 4GP5B 3RU5A 1XGQC 4G70B 1D9UA 189LA 5BR5A 1I20A 3QE8A 2DQIY 4WM4A 5LIOA 3FE0A 2JAFA 4TL3A 2Z18A 4Z41A 1L18A 3WVYA 5G28A 107LA 4YEOA 3M3UA 1D6QA 111LA 209LA 5DN5A 1CKDA 1R84A 255LA 1WTMA 3HUAA 4DD1A 1VEDA 3UTVA 2BQIA 2BQFA 1M0MA 5C6LA 1G0MA 5I4XA 1QKOA 220LA 2ZIJA 5LVGA 5KKJA 1X0K1 4FAAB 3HT8A 1L95A 1KMEA 2XTHA 1OYUA 5LINA 122LA 1LSBA 145LA 2B7XA 1BWJA 4H90A 1B0DA 1P2CC 4YF2A 5I14A 2MEBA 1L54A 1IOQA 2LZTA 1C6GA 1CTWA 4WM6A 1J1XY 3TXEA 4MCKA 1B7OA 1RFPA 2OEAX 4NGZA 1TEWA 4HJZA 181LA 3P64A 1C6HA 1GF7A 4NGVA 1C6IA 4B4IA 168LA 1L42A 1LJGA 223LA 140LA 1KG8A 1HF4A 5A3ZA 4CHXA 3RFMA 2BQOA 2B6WA 1CNSA 2CJLA 2YBLA 4WM1A 2O79A 1L09A 1L28A 4LT2A 3DQBA 1Q5JA 1LZ1A 3WXUA 4B4EA 3CDQA 3QJUB 1J1OY 3WW6A 5B6ZA 1LHMA 5LAGA 1BB4A 5KXRA 3UTYA 123LA 4E97A 1IEEA 1B7SA 257LA 1GFJA 4ETEA 4EOFA 1UA6Y 3NYAA 1GAZA 4ARJA 1I56A 200LA 1DYCA 3QBKA 1KXXA 5KXYA 4DDBA 4HV1A 1P6YA 4ARMB 2G4NA 4DJHA 2YDGA 1FDLY 1L80A 1XGRC 1KY0A 5C1MA 5DM9A 1BGIA 2D4JA 217LA 226LA 1SSWA 1GFTA 2Z2FA 2QB0B 1NBZC 3OE8A 4I7KA 149LA 1L74A 2YBMA 1GFHA 5HMJA 3G3XA 5G53A 128LA 2Y02A 1XGTC 4WLTA 3HAQA 1CV4A 241LA 3GUJA 152LA 2BQAA 5H2OA 5LYZA 4MD1A 2HULA 5B6XA 1UC0A 5LWEA 1GF3A 1UIFA 1OWYA 3AZ6A 5L3HA 4W56A 233LA 4G71B 1IR7A 1GB2A 2FYDA 4XT1A 3SB6A 3EMSA 3IWRA 1NDGC 3A6BY 1LYFA 4DQ5A 4AMIA 236LA 4MD2A 4LFXA 1B2KA 146LA 3TXJA 1JV6A 1LMAA 1IO5A 4J0LA 1L31A 1P37A 184LA 1PXSA 2YCWA 3WW5A 4J7VA 2BLYA 1P36A 1L20A 1JV7A 1C45A 3P4ZA 4WM2A 5G2CA 3ATOA 4ARLA 4HP0A 1VGOA 2H9KA 3KAMA 2O4WA 5FELA 2EI4A 4ARPA 4I8SA 1L05A 1LSFA 4PRQA 1IW6A 1C6NA 4GN3A 1L33A 1UCOA 2YBJA 1NBYC 4OWAA 3HH4A 4X32A 1KNIA 155LA 1B5ZA 1WTNA 1EQ5A 1ZURA 3DN3A 1LSDA 3HT6A 2I35A 4CGEA 1YKYX 1C6PA 1FBBA 3HFMY 2AT9A 4W54A 188LA 1CJ9A 1QUSA 3X3CA 2D91A 1D9WA 1DYFA 165LA 1WVUA 3HT9A 1G1WA 1MGYA 4IASA 1L11A 1QUHA 4B0DA 1CKCA 3C8RA 4X3BA 4OOTA 5B6VA 1NKHA 4L6RA 1L52A 1L29A 1LKSA 1P64A 5H2MA 3HH3A 4A4MA 2OU9A 1J1PY 1L24A 3EXDA 3C80A 1UIEA 1YAMA 4W58A 5LYTA 1LSZA 3LYOA 4XJGA 1L67A 1BHZA 4NGKA 1L71A 3SN6R 148LE 1XSFA 1QQYA 5KXTA 2B74A 1GBSA 1DXJA 5I53A 4K5YA 1C6BA 1KIQC 1G0GA 2YVBA 5I4YA 5I4WA 5AHYA 219LA 1GE2A 4L35A 2YBNA 4G49A 2MEAA 1IP6A 245LA 195LA 187LA 4ET8A 1F6SA 2B6ZA 3SB7A 3FI7A 2Y8PA 4H8YA 1LYJA 3DMVA 2IHLA 3A3QA 132LA 1GE0A 1IP2A 4EKPA 3LZTA 5KXOA 1L57A 2ZIYA 3VVKA 1LMOA 5LAFA 2R4SA 1U19A 1CV1A 4AQNA 3A94A 1L53A 1C64A 1XJTA 3QJQB 3GXKA 3C8QA 2PEDA 5APEA 2DQFC 1JKAA 1QUOA 1UCQA 2B6YA 254LA 2I6ZA 151LA 1LSPA 1L99A 4IAPA 1OUJA 2O7AA 3PQRA 1BVXA 4XXJA 1YIKA 5B1FA 1UIDA 4GP8B 3J6KA 4TUNA 1UIAA 1IWWA 1CV0A 3OAXA 1GFKA 1D0KA 3A34A 1VDPA 1IWUA 5AMYA 4HYJA 1GB0A 3WPJA 3EH4B 5B59A 3EMLA 1OVHA 1L96A 1JTMA 1L17A 3C7YA 1L90A 3WUAA 1OP9B 4NHTA 2IFFY 1GBYA 1WQPA 1SWYA 4FPDA 1QT5A 5KXKA 3TXKA 5L9JA 3WUMA 259LA 230LA 1EQ4A 1VAUA 1C60A 2FBDA 2J4YA 4WO9A 5AX0A 3A93A 103LA 1L87A 194LA 1OUAA 1C6EA 178LA 162LA 2BQLA 4FJRA 4PGJB 3FA0A 2LYZA 1OV7A 253LA 5A45A 115LA 112LA 4DT3A 3CDTA 1L06A 4HPEA 5KXMA 2OE7X 4BVNA 1L12A 3QBIA 1QTKA 5F81A 1C62A 4I7NA 1ZWNA 5B2NA 4XT3A 1LZNA 3WVXA 4DQJA 1REZA 4U3XB 1KIPC 5I54A 1S8LA 142LA 173LA 1CJ7A 1LZCA 1CKFA 4HPIA 1KY1A 2ZYPA 1Z55A 1KGBA 2ZQ3A 1T97A 1P8UA 1B7NA 1Q5IA 2VB1A 3S3DB 3A3RX 3P66A 186LA 4UWNA 3P68A 4GYCA 3LZ2A 1X0SA 1LZ9A 2DQAA 1L45A 2F32A 2ZNWY 1QM8A 3ZPRA 243LA 2BPUA 1EPYA 1PQJA 1NHEA 246LA 201LA 2X72A 5I5QA 1GBOA 2MEHA 1LI3A 4DC4A 3IJVA 3TXBA 3C7ZA 1C6DA 1CJ6A 3HU9A 4H8XA 164LA 4ETCA 1LYZA 4GCFA 2F93A 1IOSA 134LA 150LA 1LJ3A 4PJZA 1L08A 4DD9A 3HH5A 4FBZA 1FBKA 1KS3A 1CV3A 4G4HA 1LMNA 1UIBA 1PZYA 4GCBA 3VGAA 1GWDA 5B6WA 1C6TA 1ZMYL 1QHJA 4L41A 4I7JA 4DQ7A 1VJMA 114LA 2BRDA 4C5FA 4H9FA 3C9LA 3TMXA 248LA 1LJ4A 3IJUA 4EKRA 139LA 4RLMA 1IP5A 2YCZA 1L00A 3C81A 1JISA 1UIHA 1L50A 1PS5A 4N8ZA 1CX6A 5L3IA 3LHMA 1JPOA 1YAQA 2C8OA 1OUEA 4AMJA 1C6CA 3PXOA 1YANA 1AZFA 2NTHA 4OW1A 1HENA 1GFEA 1OUHA 1CU5A 1LSEA 5LA5A 2HEFA 5LYMA 2ANVA 1LSAA 1LZ5A 3HASA 3W6DA 4W57A 3WPLA 4HSFA 1XIOA 1C63A 1L88A 5EBHA 1HFZA 3HANA 1C6FA 262LA 4I7LA 1ALCA 4ZIXA 1FLQA 3WXTA 1DKJA 3UZAA 1N4FA 4G9SA 3F6ZA 2BQEA 215LA 4CJ2A 4GPOA 1GFAA 1YQVY 1L10A 5FHWA 4NGJA 1DKKA 1LZ8A 4LGKA 3CQLA 1NHBA 5C6IA 1L26A 1F88A 3CDRA 2KS9A 250LA 4KNFA 3B72A 1LGWA 1CU6A 4H8ZA 234LA 3CAPA 3WU9A 1XEIA 3GUNA 5KKHA 4MSTA 4BV0A 159LA 3AW6A 1WQMA 3OJPA 4NG8A 1OVJA 2RAZX 4BAPA 1XEKA 3AYMA 4M4OA 1GB5A 5HNLA 5J7CA 5B07A 4H9BA 1XGUC 5H2HA 1L70A 3UTXA 2MEGA 1L46A 247LA 1QUTA 4GBRB 4JQ6A 4KT3A 1QS9A 1IVMA 3HTBA 2I20A 1LYOA 1WQNA 1C66A 258LA 1DZBX 2Z37A 1L07A 244LA 3AYQA 2RB1X 4ETBA 2QARC 3HAOA 1L27A 2DKVA 3A90A 4BWBA 1V7TA 3N9CA 1GDWA 3A96A 208LA 2L6XA 1LYIA 1C8SA 2G4QA 4EXMA 4LYCA 4YEMA 225LA 2RB0X 1LTMA 5DYSA 3CT1A 1G7JC 1WTHA 1GXV2 4GBRA 3DN2A 3WULA 2EQLA 4NSHA 1I1ZA 1GEVA 252LA 3ODUA 1TLAA 3CT5A 161LA 1H6MA 3BVDB 4UWUA 3WYHA 1LHKA 2NWDX 170LA 1X0I1 4EPFA 2R4RA 4H9EA 5ETZA 1XFPL 260LA 4LYOA 237LA 3DNAA 1L30A 1DPWA 1NWGA 3NY8A 5ILCA 4XTOA 1DYDA 3S8FB 143LA 4GP4B 108LA 5KKIA 2YSSC 4PXKA 3AGGG 4IAQA 1DYAA 5FSTA 4H91A 1IR8A 2F47A 1JTPL 3CB7A 4PRUA 1BWHA 4H93A 1JSEA 2MEEA 1IWXA 5ILFA 1G7MC 2HECA 1GFVA 4N6HA 4LDLA 2HU1A 4NHQA 4PPOA 3HTDA 4WG7A 4N1EI 1GBWA 2OE9X 4XJBA 141LA 1L36A 4I7TA 1HC0A 4W59A 1GU8A 1HEWA 3AGHA 3G3BB 2HEBA 1G07A 5F14A 3W6BA 1GDXA 4ARMA 1GEZA 4NEBA 4I7RA 2OU8A 2EKSC 1JJ3A 1CUQA 2B5ZA 1TBYA 1P46A 192LA 1XEJA 1L41A 5LA8A 4DWXA 1L91A 1C46A 1IWTA 3DKEX 1JITA 3HDEA 2RB2X 1BRRA 2BQJA 1KIRC 191LA 2XBSA 2ZIKA 3WPKA 4BADA 1L03A 1GXXA 4TSBA 4R6CA 3A95A 4I7PA 1JJ1A 1QT7A 4WO6A 5KXLA 4GCCA 4I7SA 120LA 1KW5A 1AP9A 3HBDA 163LA 5DHGA 7LZMA 4NHPA 4NWEA 3QJSB 5H2LA 190LA 1H87A 5APFA 1V7SA 2WJLA 1L83A 4EJ4A 125LA 1LI2A 1GE1A 261LA 2NTUA 3ZVQB 1FLUA 2EIZC 2OTYX 5D5CA 1ZVYB 1LSYA 2QPEB 1C8RA 2CGIA 5HMVA 135LA 4G7QB 1WQRA 5H2NA 1JQUA 2A7DA 2BQGA 1BB7A 1LZRA 1P2LA 119LA 207LA 1L79A 1LZTA 1INUA 1QSQA 1GB9A 3QBGA 3S8GB 2Y01A 1LSCA 3GUIA 174LA 2F2NA 1LJHA 3EO5A 1GPQC 1BM1A 4MQSA 1K28A 1IWVA 1XJIA 5LVHA 3W6EA 1L47A 2G87A 4WM3A 4NSIA 1L61A 4OWCA 4WM5A 5F8UA 3GUKA 1E12A 2BQHA 224LA 3ZVQA 1OQMA 1LZYA 1NDMC 1T3PA 4LYTA 1FLYA 1CKHA 4NHSA 1L0JA 2HTXA 2W1YA 4H9IA 4S0WA 4Z3MA 8LYZA 4PJ2C 3A6CY 4KXIA 2JAGA 1DI4A 3CDVA 1LJJA 1L75A 1B5WA 2C8PA 3C7WA 1L94A 4W52A 1GF8A 3G3WA 5F9UA 4WAVA 4NSJA 4XYYA 4ARQB 1B9OA 1LW9A 2BQMA 5KXXA 4GLAA 1QKPA 1L63A 4NC3A 1PY6A 5FCPA 4G7SB 3WQJA 199LA 1QTEA 3NY9A 1TN0A 3OE9A 3V2WA 1L38A 1G0JA 2F4AA 2Q9EA 1IWZA 4G7RB 3PDSA 3GUMA 5APDA 4PXFA 1L44A 2W1MA 5KXPA 1JKCA 1REMA 227LA 238LA 4N1CC 4R0FA 1CWQA 5B34A 1YROA 1C69A 2ZFEA 1HEMA 2B72A 2Z55A 1HFYA 2Z73A 1LZGA 1WQOA 2I21A 4XADA 1IP7A 4IARA 1XJUA 5HQ1A 1PQDA 1GD6A 4ARQA 4NY5A 1LJFA 1JFPA 1P56A 1C6KA 3UTWA 4DDAA 2W1XA 4W51A 1LJIA 1TAYA 5JENB 2OU0X 4NG1A 1JSFA 118LA 1L82A 4LYMA 1OVKA 176LA 2ZNXY 3HU8A 4B4JA 4HTNA 5LXWA 2OTZX 4YX7C 3PWHA 3HDFA 6LYZA 9LYZA 2HEDA 1L58A 211LA 3HBHA 113LA 1G7LC 1LYGA 1DI5A 2B6XA 2HUKA 5DHHA 2CUUA 3HTFA 1B7PA 1GBXA 1LJKA 4G4BA 1OWZA 1TN5A 1LWKA 1QUDA 182LA 1LZAA 1VFBC 3M18B 4WLXA 4XTNA 1GF4A 1IOCA 4CFOA 1LHJA 4W96A 1L19A 1L56A 1LZBA 1G06A 218LA 4XJHA 3N9AA 1QSBA 1UBZA 1HSWA 1G1VA 2Z6BA 1T6VL 3HUKA 4UG2A 4XJFA 3ABWA 1LZSA 2BQCA 1IX0A 3HUQA 5DL9A 1L55A 4DYGA 1L37A 2LYMA 4RW2A 4WL6A 3DMXA 4G72B 1DYBA 5H2JA 3T6UA 6LZMA 3TMWA 3J4GA 1L21A 2LCBA 1L85A 2F4GA 2ZZLA 1IOTA 1BQLY 1JWRA 4ETAA 2Z38A 5BR2A 4QEQA 1IW9A 3CODA 4GLVA 1L98A 4ANRA 1LI6A 2BQDA 2XBRA 2ZWBA 1TCYA 1D6PA 1L69A 239LA 5M1YA 1F10A 1G0LA 5HLLA 3C82A 1YAPA 1O0AA 1B5YA 4WOAA 4H9CA 1B7LA 1CX7A 1LMTA 3NS0A 131LA 1L59A 1IP1A 4O34A 2MECA 4C3WA 1D2YA 1GFRA 1HERA 4GN4A 5TGZA 2F95A 2ANXA 1P2RA 1UACY 3C83A 1PQOA 5H2KA 138LA 3GULA 4EA3A 1DPXA 240LA 4GCDA 5K7OA 5ITEA 3MBVA 1L65A 1IY4A 2D4KA 177LA 1PQKA 3HARA 2M3GA 228LA 4E3UA 4KLYA 3DN1A 2DQEY 3C8SA 5B06A 5DN4A 3A67Y 1DYGA 1L04A 1S52A 1H68A 214LA 1EL1A 2LC9A 4ETDA 2RSCA 1QTCA 3BKHA 3ATNA 4NGOA 4BAFA 3B0KA 109LA 4A7DA 5II3A 5JJNA 1CUPA 1HHLA 7LYZA 1E0PA 1XMEB 1L48A 1LJNA 1C61A 5F16A 1HEQA 210LA 3L2XA 3CSRA 5E9RA 3AW7A 1UAZA 1LAAA 2DQHY 4EPIA 5C6JA 198LA 5B05A 1L34A 3RNXA 5A8EA 3WUNA 1QT6A 3GUPA 4HYXA 1L9HA 144LA 1L86A 1LWGA 1L62A 2OE4X 5A44A 1FKVA 4DD3A 1JTTL 1L35A 1C7PA 1WVVA 2IGCA 3A91A 5G54A 1GBZA 1L89A 1QUGA 169LA 1DQJC 1I6SA 1IORA 158LA 5H2IA 2Y00A 1IR9A 5JJJA 4J4QA 1IWYA 1B5UA 2GV0A 4NSGA 5APCA 4LYBA 2A7FA 2RBOA 1C67A 126LA 5D5FA 1L84A 2YCYA 1YL1X 3VW7A 1GF5A 1GHLA 2DQJY 3D3DA 5J7AA 2CWIA 2BQBA 242LA 3UZCA 3FI5A 212LA 1B6IA 1QTBA 1C65A 4J1BA 127LA 4LT3A 213LA 1C6QA 1EQEA 4LZTA 3RW8A 1AT6A 5H2PA 4MR1A 1IC4Y 1PQMA 172LA 1C10A 4QIDA 1JTOL 3F9LA 5KXSA 5IHGA 1T8AA 5IDDA 1BB5A 2H5ZA 3D9AC 2LZ2A 1QIOA 1QDRA 2Z19A 1BRXA 1SLYA 1JIYA 1JGJA 3VHZA 4RW1A 1E8LA 4IB4A 3VG9A 1S51A 1LCNA 3AM6A 3W6FA 4YENA 4GCEA 4DD7A 3OE6A 1L02A 2WARA 1KG9A 4TSCA 1GB7A 4W53A 2LNLA 1L14A 2Z12A 4YM8A 2DQGY 1GF0A 2HPYA 4BEYA 2MEFA 1T8FA 4Z98A 3OK0A 1NF5A 3TXFA 1GB6A 1D3NA 3G3VA 1GB3A 229LA 4GRVA 1JKDA 4WW3A 1L51A 137LA 1L23A 183LA 1O23A 3QJTB 1F0WA 3RZEA 4TWSA 2RBQA 1RJCB 1GF9A 3HTGA 3CDOA 4LFPA 1VDQA 1G7HC 3JR6A 1LGUA 1P8IA 1G0KA 1LMQA 3QNGA 3ZPQA 3TXIA 3MGWA 2VT4A 3EBAB 5G2DA 3AGIA 3AZ4A 1LYYA 4EMNA 1VDTA 4ZFPA 1IXFA 1CJ8A 2HUMA 5KJ9A 3P0GA 3K2RA 1CU0A 1LMCA 3C9MA 1CVKA 1LZDA 2B70A 4NGIA 1PQIA 3RT5X 1SX7A 1M0KA 3SB8A 2RAYX 1L13A 3UG9A 156LA 1LGXA 4DD2A 4DAJA 2RBPA 3HWLA 4LZMA 1OUFA 1P7SA 3KJ6A 3GUOA 232LA 4I7OA 1L81A 4H94A 1MELL 3RUNA 1LPYA 2LZMA 1C6AA 1JHLA 185LA 4WG1A 4HTQA 3T36A 4B49A 1UIGA 3DN4A 5B6YA 1CKGA 4HJYA 1QTDA 4BUOA 2NTWA 3S3BB 1IP3A 1L97A 1GB8A 1NMMA 2PC2A 4GN5C 3SP3A 3G3AB 4H1PA 3B6LA 1QT3A 2EPEA 2ZILA 1HMLA 1ZYTA 3TXGA 1L43A 1AKIA 3DMZA 1D3JA 1LYSA 5A3EA 5E4PA 3FADA 175LA 4DD0A 1D3MA 1D0MA 1GE3A 3SBAA 4NGLA 4WL7A 157LA 4CFPA 2B6TA 3AB6A 3B0IA 4NIJA 1BB6A 2Q9DA 4OOOA 1IP4A 1YILA 1LLHA 1P5CA 2RBRA 2RBSA 1LSGA 3F8VA 5B1GA 1W6ZA 1LMPA 2WJKA 5LVIA 3TXHA 3QAKA 206LA 2HUBA 1LZ6A 167LA 1DYEA 1SX2A 3WL2A 1LSMA 3L64A 1HMKA 2LHMA 3QBLA 1L73A 1C6JA 1T8GA 147LA 4JKVA 1F4ZA 3EH5B 2YCXA 4LYZA 2N5ZA
chains in the Genus database with same CATH topology
3DN0A 4D9ZA 2XQOA 4NGWA 4JR8A 4WLDA 1L93A 4QI1A 3QY4A 1IIZA 3OE0A 1RE2A 4QGZA 1FLWA 1L68A 1G7IC 5KXZA 1YAOA 4UWVA 4B1AA 1G0QA 3TXDA 2D6BA 4LT0A 1QT8A 2BLXA 1L66A 3WU7A 3SB9A 4NFVA 1HFXA 2D4IA 1SQ2L 1L32A 1DZEA 1XEPA 129LA 216LA 4IATA 4XTLA 1HNLA 1GAYA 3EH3B 1W08A 4X31A 3A8ZA 1LHHA 4KL7A 3B0OA 1L15A 1LSNA 2RH1A 4OWBA 5LVKA 2F30A 4H9HA 3T45A 2Y04A 3SBBC 3LN2A 3LYZA 2L78A 3NSBA 4DKLA 4I7QA 1P8HA 4Y9HA 4XJDA 3WH1A 1LYHA 180LA 1L92A 2KSAA 1LPIA 4HV2A 5AX1A 3X3BA 1DI3A 2HEAA 1PXRA 1F6RA 1B5VA 3TMUA 3SB5A 3HH6A 5DLAA 3DN8A 2I26L 3WU8A 4YXCA 1L60A 3D4SA 1BVKC 1QTZA 3P65A 3AZ7A 4YOPA 1KXYA 1TDYA 3AJNA 235LA 1FKQA 1L64A 1IY3A 1OUBA 1SSYA 4XN6A 1L49A 4W55A 4N9RA 1FBIX 2DQCY 4I0CA 1UICA 1H2SA 4IJ4A 1D3FA 3PBLA 4RDSA 3LZMA 1F50A 1P3NA 4I7MA 4PK0A 1L25A 4P2EA 5KXWA 5FJGA 1KW7A 3N9EA 4TX7A 2Q0MX 1HEOA 1JKBA 1BRDA 3A92A 3VI0A 3UONA 2AUBA 4G4CA 2KSYA 1GE4A 1YKZX 4QDNA 4LDOA 5FDJA 249LA 256LA 6LYTA 1JJ0A 5KXNA 222LA 4MQTA 2X0AA 3K3TA 1UUZC 2I1XA 4KPMA 5HNCA 2KSBA 5EN0A 1ZV5L 4TTDA 2XJWA 1REXA 3QJRB 4HTKA 4BS7A 1LKRA 1IC7Y 1OV5A 4WLYA 1MLCE 5AWZA 1C3WA 1LHLA 2W1LA 1L72A 4AGAA 4MBSA 5G36A 4N4YB 4DDCA 4HJVA 1CV6A 2BAAA 2BQNA 1QS5A 3VWOA 4BEZA 2DBTA 3HT7A 1BB3A 2Z39A 4N4WA 3W6AA 5FEKA 3HBEX 4QY9A 3CT0A 2Y03A 4WMGA 1OUDA 1VDSA 4N5RA 1YKXX 2DQDY 4LDEA 4N0JA 2QPDB 1L0KA 3AYNA 5F9XA 1L77A 3DN6A 5IELA 193LA 2YDOA 3W3EA 1L76A 1S53A 251LA 5B0WA 3LYMA 1JTNA 110LA 1B7RA 4XENA 1CV5A 1L40A 5G2AA 4W94A 5LVJA 1GFUA 2HU3A 4RLNA 130LA 2MEIA 4EIYA 3ZEKA 2HEEA 3QAPA 231LA 3CSZA 4OO9A 1IC5Y 1OUGA 2F2QA 160LA 1LYEA 4XJIA 4ML7A 1WQQA 4OWHA 2YBHA 2YBIA 1L16A 1LOZA 4DS7E 1GFGA 153LA 4AXTA 2G4PA 1CU2A 102LA 1NQIA 3V2YA 1D0LA 4NWHA 2Z2EA 104LA 2BQKA 4NHIA 4UHRA 5JJEA 5AHZA 4H9AA 3BKVA 4II8A 1L01A 1GUEA 171LA 1CU3A 1QSAA 3CSQA 3WMKA 1KXWA 3HAPA 4OWEA 1C6LA 3E3DA 2B75A 1L22A 2ZYCA 2ZQ4A 1B7MA 154LA 1AT5A 1LHIA 1T6HA 4LT1A 1A4VA 1VATA 1R2NA 196LA 4X1HA 2MEDA 1AT9A 1AM7A 3QJVB 4FA7B 1LYDA 3ZEVA 221LA 4HWLA 1SWZA 4M6DA 5T3FA 2I25L 4FDYA 3S3CB 1C43A 3QDCA 1FN5A 3RZ4A 4QRYA 4ET9A 2A4TA 1RI8B 1L0MA 1YL0X 2H9JA 1BWIA 1QSWA 2NTGA 1JEFA 2B73A 3LYTA 4NGYA 1HELA 1L39A 5ITCA 3AZ5A 1B7QA 1JUGA 1QDTA 1OUIA 1A2YC 1HZXA 5B35A 1LJEA 1G0PA 4EKQA 1C08C 4OV0A 1D2WA 1QTHA 3COCA 3DDLA 3A7KA 1ZVHL 4YXAC 1S8JA 166LA 1HSXA 1XGPC 1C6MA 133LA 1S54A 2YDVA 1B5XA 2RBNA 1OUCA 1RCMA 5LZMA 3TMVA 4ZEEA 5KY1A 205LA 1REYA 1GZMA 3ULRA 1QTVA 1C68A 1QT4A 1GF6A 2FYCA 1HEPA 4EKSA 2FBBA 1LZ4A 1M0LA 1EHKB 3REYA 5AZDA 4PHIA 1LN6A 2LYOA 197LA 4ZPUA 3W6CA 4Z46A 2CDSA 3GXRA 4J1AA 1LZEA 4H92A 4GP5B 3RU5A 1XGQC 4G70B 1D9UA 189LA 5BR5A 1I20A 3QE8A 2DQIY 4WM4A 5LIOA 3FE0A 2JAFA 4TL3A 2Z18A 4Z41A 1L18A 3WVYA 5G28A 107LA 4YEOA 3M3UA 1D6QA 111LA 209LA 5DN5A 1CKDA 1R84A 255LA 1WTMA 3HUAA 4DD1A 1VEDA 3UTVA 2BQIA 2BQFA 1M0MA 5C6LA 1G0MA 5I4XA 1QKOA 220LA 2ZIJA 5LVGA 5KKJA 1X0K1 4FAAB 3HT8A 1L95A 1KMEA 2XTHA 1OYUA 5LINA 122LA 1LSBA 145LA 2B7XA 1BWJA 4H90A 1B0DA 1P2CC 4YF2A 5I14A 2MEBA 1L54A 1IOQA 2LZTA 1C6GA 1CTWA 4WM6A 1J1XY 3TXEA 4MCKA 1B7OA 1RFPA 2OEAX 4NGZA 1TEWA 4HJZA 181LA 3P64A 1C6HA 1GF7A 4NGVA 1C6IA 4B4IA 168LA 1L42A 1LJGA 223LA 140LA 1KG8A 1HF4A 5A3ZA 4CHXA 3RFMA 2BQOA 2B6WA 1CNSA 2CJLA 2YBLA 4WM1A 2O79A 1L09A 1L28A 4LT2A 3DQBA 1Q5JA 1LZ1A 3WXUA 4B4EA 3CDQA 3QJUB 1J1OY 3WW6A 5B6ZA 1LHMA 5LAGA 1BB4A 5KXRA 3UTYA 123LA 4E97A 1IEEA 1B7SA 257LA 1GFJA 4ETEA 4EOFA 1UA6Y 3NYAA 1GAZA 4ARJA 1I56A 200LA 1DYCA 3QBKA 1KXXA 5KXYA 4DDBA 4HV1A 1P6YA 4ARMB 2G4NA 4DJHA 2YDGA 1FDLY 1L80A 1XGRC 1KY0A 5C1MA 5DM9A 1BGIA 2D4JA 217LA 226LA 1SSWA 1GFTA 2Z2FA 2QB0B 1NBZC 3OE8A 4I7KA 149LA 1L74A 2YBMA 1GFHA 5HMJA 3G3XA 5G53A 128LA 2Y02A 1XGTC 4WLTA 3HAQA 1CV4A 241LA 3GUJA 152LA 2BQAA 5H2OA 5LYZA 4MD1A 2HULA 5B6XA 1UC0A 5LWEA 1GF3A 1UIFA 1OWYA 3AZ6A 5L3HA 4W56A 233LA 4G71B 1IR7A 1GB2A 2FYDA 4XT1A 3SB6A 3EMSA 3IWRA 1NDGC 3A6BY 1LYFA 4DQ5A 4AMIA 236LA 4MD2A 4LFXA 1B2KA 146LA 3TXJA 1JV6A 1LMAA 1IO5A 4J0LA 1L31A 1P37A 184LA 1PXSA 2YCWA 3WW5A 4J7VA 2BLYA 1P36A 1L20A 1JV7A 1C45A 3P4ZA 4WM2A 5G2CA 3ATOA 4ARLA 4HP0A 1VGOA 2H9KA 3KAMA 2O4WA 5FELA 2EI4A 4ARPA 4I8SA 1L05A 1LSFA 4PRQA 1IW6A 1C6NA 4GN3A 1L33A 1UCOA 2YBJA 1NBYC 4OWAA 3HH4A 4X32A 1KNIA 155LA 1B5ZA 1WTNA 1EQ5A 1ZURA 3DN3A 1LSDA 3HT6A 2I35A 4CGEA 1YKYX 1C6PA 1FBBA 3HFMY 2AT9A 4W54A 188LA 1CJ9A 1QUSA 3X3CA 2D91A 1D9WA 1DYFA 165LA 1WVUA 3HT9A 1G1WA 1MGYA 4IASA 1L11A 1QUHA 4B0DA 1CKCA 3C8RA 4X3BA 4OOTA 5B6VA 1NKHA 4L6RA 1L52A 1L29A 1LKSA 1P64A 5H2MA 3HH3A 4A4MA 2OU9A 1J1PY 1L24A 3EXDA 3C80A 1UIEA 1YAMA 4W58A 5LYTA 1LSZA 3LYOA 4XJGA 1L67A 1BHZA 4NGKA 1L71A 3SN6R 148LE 1XSFA 1QQYA 5KXTA 2B74A 1GBSA 1DXJA 5I53A 4K5YA 1C6BA 1KIQC 1G0GA 2YVBA 5I4YA 5I4WA 5AHYA 219LA 1GE2A 4L35A 2YBNA 4G49A 2MEAA 1IP6A 245LA 195LA 187LA 4ET8A 1F6SA 2B6ZA 3SB7A 3FI7A 2Y8PA 4H8YA 1LYJA 3DMVA 2IHLA 3A3QA 132LA 1GE0A 1IP2A 4EKPA 3LZTA 5KXOA 1L57A 2ZIYA 3VVKA 1LMOA 5LAFA 2R4SA 1U19A 1CV1A 4AQNA 3A94A 1L53A 1C64A 1XJTA 3QJQB 3GXKA 3C8QA 2PEDA 5APEA 2DQFC 1JKAA 1QUOA 1UCQA 2B6YA 254LA 2I6ZA 151LA 1LSPA 1L99A 4IAPA 1OUJA 2O7AA 3PQRA 1BVXA 4XXJA 1YIKA 5B1FA 1UIDA 4GP8B 3J6KA 4TUNA 1UIAA 1IWWA 1CV0A 3OAXA 1GFKA 1D0KA 3A34A 1VDPA 1IWUA 5AMYA 4HYJA 1GB0A 3WPJA 3EH4B 5B59A 3EMLA 1OVHA 1L96A 1JTMA 1L17A 3C7YA 1L90A 3WUAA 1OP9B 4NHTA 2IFFY 1GBYA 1WQPA 1SWYA 4FPDA 1QT5A 5KXKA 3TXKA 5L9JA 3WUMA 259LA 230LA 1EQ4A 1VAUA 1C60A 2FBDA 2J4YA 4WO9A 5AX0A 3A93A 103LA 1L87A 194LA 1OUAA 1C6EA 178LA 162LA 2BQLA 4FJRA 4PGJB 3FA0A 2LYZA 1OV7A 253LA 5A45A 115LA 112LA 4DT3A 3CDTA 1L06A 4HPEA 5KXMA 2OE7X 4BVNA 1L12A 3QBIA 1QTKA 5F81A 1C62A 4I7NA 1ZWNA 5B2NA 4XT3A 1LZNA 3WVXA 4DQJA 1REZA 4U3XB 1KIPC 5I54A 1S8LA 142LA 173LA 1CJ7A 1LZCA 1CKFA 4HPIA 1KY1A 2ZYPA 1Z55A 1KGBA 2ZQ3A 1T97A 1P8UA 1B7NA 1Q5IA 2VB1A 3S3DB 3A3RX 3P66A 186LA 4UWNA 3P68A 4GYCA 3LZ2A 1X0SA 1LZ9A 2DQAA 1L45A 2F32A 2ZNWY 1QM8A 3ZPRA 243LA 2BPUA 1EPYA 1PQJA 1NHEA 246LA 201LA 2X72A 5I5QA 1GBOA 2MEHA 1LI3A 4DC4A 3IJVA 3TXBA 3C7ZA 1C6DA 1CJ6A 3HU9A 4H8XA 164LA 4ETCA 1LYZA 4GCFA 2F93A 1IOSA 134LA 150LA 1LJ3A 4PJZA 1L08A 4DD9A 3HH5A 4FBZA 1FBKA 1KS3A 1CV3A 4G4HA 1LMNA 1UIBA 1PZYA 4GCBA 3VGAA 1GWDA 5B6WA 1C6TA 1ZMYL 1QHJA 4L41A 4I7JA 4DQ7A 1VJMA 114LA 2BRDA 4C5FA 4H9FA 3C9LA 3TMXA 248LA 1LJ4A 3IJUA 4EKRA 139LA 4RLMA 1IP5A 2YCZA 1L00A 3C81A 1JISA 1UIHA 1L50A 1PS5A 4N8ZA 1CX6A 5L3IA 3LHMA 1JPOA 1YAQA 2C8OA 1OUEA 4AMJA 1C6CA 3PXOA 1YANA 1AZFA 2NTHA 4OW1A 1HENA 1GFEA 1OUHA 1CU5A 1LSEA 5LA5A 2HEFA 5LYMA 2ANVA 1LSAA 1LZ5A 3HASA 3W6DA 4W57A 3WPLA 4HSFA 1XIOA 1C63A 1L88A 5EBHA 1HFZA 3HANA 1C6FA 262LA 4I7LA 1ALCA 4ZIXA 1FLQA 3WXTA 1DKJA 3UZAA 1N4FA 4G9SA 3F6ZA 2BQEA 215LA 4CJ2A 4GPOA 1GFAA 1YQVY 1L10A 5FHWA 4NGJA 1DKKA 1LZ8A 4LGKA 3CQLA 1NHBA 5C6IA 1L26A 1F88A 3CDRA 2KS9A 250LA 4KNFA 3B72A 1LGWA 1CU6A 4H8ZA 234LA 3CAPA 3WU9A 1XEIA 3GUNA 5KKHA 4MSTA 4BV0A 159LA 3AW6A 1WQMA 3OJPA 4NG8A 1OVJA 2RAZX 4BAPA 1XEKA 3AYMA 4M4OA 1GB5A 5HNLA 5J7CA 5B07A 4H9BA 1XGUC 5H2HA 1L70A 3UTXA 2MEGA 1L46A 247LA 1QUTA 4GBRB 4JQ6A 4KT3A 1QS9A 1IVMA 3HTBA 2I20A 1LYOA 1WQNA 1C66A 258LA 1DZBX 2Z37A 1L07A 244LA 3AYQA 2RB1X 4ETBA 2QARC 3HAOA 1L27A 2DKVA 3A90A 4BWBA 1V7TA 3N9CA 1GDWA 3A96A 208LA 2L6XA 1LYIA 1C8SA 2G4QA 4EXMA 4LYCA 4YEMA 225LA 2RB0X 1LTMA 5DYSA 3CT1A 1G7JC 1WTHA 1GXV2 4GBRA 3DN2A 3WULA 2EQLA 4NSHA 1I1ZA 1GEVA 252LA 3ODUA 1TLAA 3CT5A 161LA 1H6MA 3BVDB 4UWUA 3WYHA 1LHKA 2NWDX 170LA 1X0I1 4EPFA 2R4RA 4H9EA 5ETZA 1XFPL 260LA 4LYOA 237LA 3DNAA 1L30A 1DPWA 1NWGA 3NY8A 5ILCA 4XTOA 1DYDA 3S8FB 143LA 4GP4B 108LA 5KKIA 2YSSC 4PXKA 3AGGG 4IAQA 1DYAA 5FSTA 4H91A 1IR8A 2F47A 1JTPL 3CB7A 4PRUA 1BWHA 4H93A 1JSEA 2MEEA 1IWXA 5ILFA 1G7MC 2HECA 1GFVA 4N6HA 4LDLA 2HU1A 4NHQA 4PPOA 3HTDA 4WG7A 4N1EI 1GBWA 2OE9X 4XJBA 141LA 1L36A 4I7TA 1HC0A 4W59A 1GU8A 1HEWA 3AGHA 3G3BB 2HEBA 1G07A 5F14A 3W6BA 1GDXA 4ARMA 1GEZA 4NEBA 4I7RA 2OU8A 2EKSC 1JJ3A 1CUQA 2B5ZA 1TBYA 1P46A 192LA 1XEJA 1L41A 5LA8A 4DWXA 1L91A 1C46A 1IWTA 3DKEX 1JITA 3HDEA 2RB2X 1BRRA 2BQJA 1KIRC 191LA 2XBSA 2ZIKA 3WPKA 4BADA 1L03A 1GXXA 4TSBA 4R6CA 3A95A 4I7PA 1JJ1A 1QT7A 4WO6A 5KXLA 4GCCA 4I7SA 120LA 1KW5A 1AP9A 3HBDA 163LA 5DHGA 7LZMA 4NHPA 4NWEA 3QJSB 5H2LA 190LA 1H87A 5APFA 1V7SA 2WJLA 1L83A 4EJ4A 125LA 1LI2A 1GE1A 261LA 2NTUA 3ZVQB 1FLUA 2EIZC 2OTYX 5D5CA 1ZVYB 1LSYA 2QPEB 1C8RA 2CGIA 5HMVA 135LA 4G7QB 1WQRA 5H2NA 1JQUA 2A7DA 2BQGA 1BB7A 1LZRA 1P2LA 119LA 207LA 1L79A 1LZTA 1INUA 1QSQA 1GB9A 3QBGA 3S8GB 2Y01A 1LSCA 3GUIA 174LA 2F2NA 1LJHA 3EO5A 1GPQC 1BM1A 4MQSA 1K28A 1IWVA 1XJIA 5LVHA 3W6EA 1L47A 2G87A 4WM3A 4NSIA 1L61A 4OWCA 4WM5A 5F8UA 3GUKA 1E12A 2BQHA 224LA 3ZVQA 1OQMA 1LZYA 1NDMC 1T3PA 4LYTA 1FLYA 1CKHA 4NHSA 1L0JA 2HTXA 2W1YA 4H9IA 4S0WA 4Z3MA 8LYZA 4PJ2C 3A6CY 4KXIA 2JAGA 1DI4A 3CDVA 1LJJA 1L75A 1B5WA 2C8PA 3C7WA 1L94A 4W52A 1GF8A 3G3WA 5F9UA 4WAVA 4NSJA 4XYYA 4ARQB 1B9OA 1LW9A 2BQMA 5KXXA 4GLAA 1QKPA 1L63A 4NC3A 1PY6A 5FCPA 4G7SB 3WQJA 199LA 1QTEA 3NY9A 1TN0A 3OE9A 3V2WA 1L38A 1G0JA 2F4AA 2Q9EA 1IWZA 4G7RB 3PDSA 3GUMA 5APDA 4PXFA 1L44A 2W1MA 5KXPA 1JKCA 1REMA 227LA 238LA 4N1CC 4R0FA 1CWQA 5B34A 1YROA 1C69A 2ZFEA 1HEMA 2B72A 2Z55A 1HFYA 2Z73A 1LZGA 1WQOA 2I21A 4XADA 1IP7A 4IARA 1XJUA 5HQ1A 1PQDA 1GD6A 4ARQA 4NY5A 1LJFA 1JFPA 1P56A 1C6KA 3UTWA 4DDAA 2W1XA 4W51A 1LJIA 1TAYA 5JENB 2OU0X 4NG1A 1JSFA 118LA 1L82A 4LYMA 1OVKA 176LA 2ZNXY 3HU8A 4B4JA 4HTNA 5LXWA 2OTZX 4YX7C 3PWHA 3HDFA 6LYZA 9LYZA 2HEDA 1L58A 211LA 3HBHA 113LA 1G7LC 1LYGA 1DI5A 2B6XA 2HUKA 5DHHA 2CUUA 3HTFA 1B7PA 1GBXA 1LJKA 4G4BA 1OWZA 1TN5A 1LWKA 1QUDA 182LA 1LZAA 1VFBC 3M18B 4WLXA 4XTNA 1GF4A 1IOCA 4CFOA 1LHJA 4W96A 1L19A 1L56A 1LZBA 1G06A 218LA 4XJHA 3N9AA 1QSBA 1UBZA 1HSWA 1G1VA 2Z6BA 1T6VL 3HUKA 4UG2A 4XJFA 3ABWA 1LZSA 2BQCA 1IX0A 3HUQA 5DL9A 1L55A 4DYGA 1L37A 2LYMA 4RW2A 4WL6A 3DMXA 4G72B 1DYBA 5H2JA 3T6UA 6LZMA 3TMWA 3J4GA 1L21A 2LCBA 1L85A 2F4GA 2ZZLA 1IOTA 1BQLY 1JWRA 4ETAA 2Z38A 5BR2A 4QEQA 1IW9A 3CODA 4GLVA 1L98A 4ANRA 1LI6A 2BQDA 2XBRA 2ZWBA 1TCYA 1D6PA 1L69A 239LA 5M1YA 1F10A 1G0LA 5HLLA 3C82A 1YAPA 1O0AA 1B5YA 4WOAA 4H9CA 1B7LA 1CX7A 1LMTA 3NS0A 131LA 1L59A 1IP1A 4O34A 2MECA 4C3WA 1D2YA 1GFRA 1HERA 4GN4A 5TGZA 2F95A 2ANXA 1P2RA 1UACY 3C83A 1PQOA 5H2KA 138LA 3GULA 4EA3A 1DPXA 240LA 4GCDA 5K7OA 5ITEA 3MBVA 1L65A 1IY4A 2D4KA 177LA 1PQKA 3HARA 2M3GA 228LA 4E3UA 4KLYA 3DN1A 2DQEY 3C8SA 5B06A 5DN4A 3A67Y 1DYGA 1L04A 1S52A 1H68A 214LA 1EL1A 2LC9A 4ETDA 2RSCA 1QTCA 3BKHA 3ATNA 4NGOA 4BAFA 3B0KA 109LA 4A7DA 5II3A 5JJNA 1CUPA 1HHLA 7LYZA 1E0PA 1XMEB 1L48A 1LJNA 1C61A 5F16A 1HEQA 210LA 3L2XA 3CSRA 5E9RA 3AW7A 1UAZA 1LAAA 2DQHY 4EPIA 5C6JA 198LA 5B05A 1L34A 3RNXA 5A8EA 3WUNA 1QT6A 3GUPA 4HYXA 1L9HA 144LA 1L86A 1LWGA 1L62A 2OE4X 5A44A 1FKVA 4DD3A 1JTTL 1L35A 1C7PA 1WVVA 2IGCA 3A91A 5G54A 1GBZA 1L89A 1QUGA 169LA 1DQJC 1I6SA 1IORA 158LA 5H2IA 2Y00A 1IR9A 5JJJA 4J4QA 1IWYA 1B5UA 2GV0A 4NSGA 5APCA 4LYBA 2A7FA 2RBOA 1C67A 126LA 5D5FA 1L84A 2YCYA 1YL1X 3VW7A 1GF5A 1GHLA 2DQJY 3D3DA 5J7AA 2CWIA 2BQBA 242LA 3UZCA 3FI5A 212LA 1B6IA 1QTBA 1C65A 4J1BA 127LA 4LT3A 213LA 1C6QA 1EQEA 4LZTA 3RW8A 1AT6A 5H2PA 4MR1A 1IC4Y 1PQMA 172LA 1C10A 4QIDA 1JTOL 3F9LA 5KXSA 5IHGA 1T8AA 5IDDA 1BB5A 2H5ZA 3D9AC 2LZ2A 1QIOA 1QDRA 2Z19A 1BRXA 1SLYA 1JIYA 1JGJA 3VHZA 4RW1A 1E8LA 4IB4A 3VG9A 1S51A 1LCNA 3AM6A 3W6FA 4YENA 4GCEA 4DD7A 3OE6A 1L02A 2WARA 1KG9A 4TSCA 1GB7A 4W53A 2LNLA 1L14A 2Z12A 4YM8A 2DQGY 1GF0A 2HPYA 4BEYA 2MEFA 1T8FA 4Z98A 3OK0A 1NF5A 3TXFA 1GB6A 1D3NA 3G3VA 1GB3A 229LA 4GRVA 1JKDA 4WW3A 1L51A 137LA 1L23A 183LA 1O23A 3QJTB 1F0WA 3RZEA 4TWSA 2RBQA 1RJCB 1GF9A 3HTGA 3CDOA 4LFPA 1VDQA 1G7HC 3JR6A 1LGUA 1P8IA 1G0KA 1LMQA 3QNGA 3ZPQA 3TXIA 3MGWA 2VT4A 3EBAB 5G2DA 3AGIA 3AZ4A 1LYYA 4EMNA 1VDTA 4ZFPA 1IXFA 1CJ8A 2HUMA 5KJ9A 3P0GA 3K2RA 1CU0A 1LMCA 3C9MA 1CVKA 1LZDA 2B70A 4NGIA 1PQIA 3RT5X 1SX7A 1M0KA 3SB8A 2RAYX 1L13A 3UG9A 156LA 1LGXA 4DD2A 4DAJA 2RBPA 3HWLA 4LZMA 1OUFA 1P7SA 3KJ6A 3GUOA 232LA 4I7OA 1L81A 4H94A 1MELL 3RUNA 1LPYA 2LZMA 1C6AA 1JHLA 185LA 4WG1A 4HTQA 3T36A 4B49A 1UIGA 3DN4A 5B6YA 1CKGA 4HJYA 1QTDA 4BUOA 2NTWA 3S3BB 1IP3A 1L97A 1GB8A 1NMMA 2PC2A 4GN5C 3SP3A 3G3AB 4H1PA 3B6LA 1QT3A 2EPEA 2ZILA 1HMLA 1ZYTA 3TXGA 1L43A 1AKIA 3DMZA 1D3JA 1LYSA 5A3EA 5E4PA 3FADA 175LA 4DD0A 1D3MA 1D0MA 1GE3A 3SBAA 4NGLA 4WL7A 157LA 4CFPA 2B6TA 3AB6A 3B0IA 4NIJA 1BB6A 2Q9DA 4OOOA 1IP4A 1YILA 1LLHA 1P5CA 2RBRA 2RBSA 1LSGA 3F8VA 5B1GA 1W6ZA 1LMPA 2WJKA 5LVIA 3TXHA 3QAKA 206LA 2HUBA 1LZ6A 167LA 1DYEA 1SX2A 3WL2A 1LSMA 3L64A 1HMKA 2LHMA 3QBLA 1L73A 1C6JA 1T8GA 147LA 4JKVA 1F4ZA 3EH5B 2YCXA 4LYZA 2N5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QHJ A;  3DN0 A;  1KG8 A;  1OWZ A;  4I7J A;  1TN5 A;  1VJM A;  1LWK A;  114L A;  2BRD A;  1QUD A;  182L A;  3RFM A;  2B6W A;  4JR8 A;  3C9L A;  1L93 A;  248L A;  4XTN A;  4QI1 A;  4EKR A;  3OE0 A;  139L A;  1L68 A;  1L19 A;  2O79 A;  1L09 A;  1L28 A;  1L56 A;  2YCZ A;  1G0Q A;  3DQB A;  1Q5J A;  1L00 A;  3C81 A;  1G06 A;  218L A;  1L50 A;  3CDQ A;  3QJU B;  1QSB A;  5B6Z A;  1QT8 A;  5A44 A;  1L66 A;  3SB9 A;  123L A;  3UTY A;  1CX6 A;  1G1V A;  2Z6B A;  4E97 A;  3HUK A;  4UG2 A;  1L32 A;  1DZE A;  1XEP A;  3ABW A;  129L A;  216L A;  4AMJ A;  257L A;  4XTL A;  1C6C A;  3PXO A;  2NTH A;  3HUQ A;  3EH3 B;  1CU5 A;  4X31 A;  1L55 A;  3NYA A;  1L15 A;  1L37 A;  2ANV A;  4ARJ A;  3QBK A;  200L A;  1DYC A;  3HAS A;  3DMX A;  4G72 B;  4W57 A;  2RH1 A;  1P6Y A;  1DYB A;  1XIO A;  5H2J A;  1C63 A;  1L88 A;  4ARM B;  4DJH A;  6LZM A;  3T45 A;  3HAN A;  1L80 A;  1C6F A;  2Y04 A;  1L21 A;  2LCB A;  262L A;  1KY0 A;  1L85 A;  4I7L A;  5C1M A;  3SBB C;  2ZZL A;  217L A;  226L A;  1SSW A;  2L78 A;  5BR2 A;  3NSB A;  3UZA A;  2QB0 B;  4DKL A;  3OE8 A;  4I7K A;  4I7Q A;  149L A;  1IW9 A;  1P8H A;  4Y9H A;  3COD A;  1L74 A;  1L98 A;  3G3X A;  1LYH A;  215L A;  180L A;  5G53 A;  1L92 A;  2KSA A;  4GPO A;  1LI6 A;  128L A;  2Y02 A;  3HAQ A;  5AX1 A;  1CV4 A;  3X3B A;  1L10 A;  241L A;  5B6W A;  1L69 A;  3GUJ A;  239L A;  152L A;  1G0L A;  1PXR A;  3C82 A;  1O0A A;  1NHB A;  5H2O A;  3SB5 A;  3HH6 A;  1L26 A;  3DN8 A;  1F88 A;  4MD1 A;  3CDR A;  1CX7 A;  4YXC A;  2KS9 A;  250L A;  4KNF A;  2HUL A;  1LGW A;  5B6X A;  1CU6 A;  1L60 A;  3D4S A;  234L A;  3CAP A;  3NS0 A;  5LWE A;  3GUN A;  1QTZ A;  5KKH A;  131L A;  1L59 A;  1OWY A;  4BV0 A;  159L A;  4W56 A;  233L A;  235L A;  4G71 B;  1L64 A;  4XT1 A;  1OVJ A;  3SB6 A;  2RAZ X;  3AYM A;  1SSY A;  1L49 A;  1LYF A;  1D2Y A;  5TGZ A;  5H2H A;  1L70 A;  3UTX A;  4W55 A;  2F95 A;  2ANX A;  4AMI A;  236L A;  1P2R A;  1H2S A;  1L46 A;  1PQO A;  3C83 A;  5H2K A;  247L A;  4MD2 A;  138L A;  4GBR B;  3GUL A;  4EA3 A;  1D3F A;  3PBL A;  4JQ6 A;  146L A;  1JV6 A;  3LZM A;  1F50 A;  1P3N A;  1L31 A;  4I7M A;  4PK0 A;  1P37 A;  1QS9 A;  184L A;  3HTB A;  240L A;  1L25 A;  2I20 A;  3MBV A;  1KW7 A;  5FJG A;  5ITE A;  1PXS A;  2YCW A;  1C66 A;  1L65 A;  258L A;  1P36 A;  1BRD A;  177L A;  1PQK A;  3VI0 A;  3UON A;  2M3G A;  3HAR A;  228L A;  1L20 A;  4KLY A;  3DN1 A;  1L07 A;  1JV7 A;  244L A;  2RB1 X;  3C8S A;  2QAR C;  2KSY A;  1DYG A;  3HAO A;  4ARL A;  5G2C A;  1L04 A;  1VGO A;  1L27 A;  4LDO A;  1S52 A;  249L A;  1H68 A;  214L A;  256L A;  2LC9 A;  2O4W A;  4BWB A;  2EI4 A;  4ARP A;  1L05 A;  1QTC A;  1IW6 A;  2L6X A;  1C6N A;  222L A;  1L33 A;  4MQT A;  1LYI A;  3HH4 A;  4X32 A;  1C8S A;  1KNI A;  4EXM A;  109L A;  2I1X A;  5JJN A;  225L A;  2RB0 X;  1CUP A;  2KSB A;  5EN0 A;  5DYS A;  1XME B;  155L A;  1E0P A;  1WTH A;  1L48 A;  4GBR A;  3DN2 A;  1C61 A;  3QJR B;  1OV5 A;  1ZUR A;  3DN3 A;  252L A;  210L A;  3HT6 A;  1TLA A;  3L2X A;  3ODU A;  2I35 A;  5AWZ A;  1UAZ A;  1C3W A;  1FBB A;  1C6P A;  4EPI A;  1L72 A;  161L A;  4W54 A;  2AT9 A;  198L A;  188L A;  1L34 A;  3X3C A;  3BVD B;  5A8E A;  1D9W A;  1DYF A;  1QT6 A;  3GUP A;  4HYX A;  165L A;  1L9H A;  170L A;  144L A;  3HT9 A;  1L86 A;  1LWG A;  1G1W A;  1L62 A;  2OE4 X;  4EPF A;  1MGY A;  2R4R A;  4N4Y B;  5ETZ A;  260L A;  1L11 A;  1CV6 A;  237L A;  1QUH A;  3DNA A;  1L30 A;  1QS5 A;  3NY8 A;  4XTO A;  1DYD A;  3C8R A;  1L35 A;  3S8F B;  143L A;  4GP4 B;  4BEZ A;  5B6V A;  3HT7 A;  108L A;  2IGC A;  4L6R A;  4PXK A;  1L89 A;  1L52 A;  1L29 A;  1QUG A;  1DYA A;  4IAQ A;  169L A;  5G54 A;  1P64 A;  5H2M A;  3HH3 A;  1I6S A;  158L A;  4A4M A;  5H2I A;  2OU9 A;  1L24 A;  2F47 A;  2Y00 A;  3C80 A;  4N4W A;  5JJJ A;  4W58 A;  2Y03 A;  4J4Q A;  5G36 A;  1L67 A;  2RBO A;  1C67 A;  126L A;  1L71 A;  1L84 A;  3SN6 R;  4LDE A;  4N6H A;  2QPD B;  4LDL A;  2YCY A;  148L E;  1L0K A;  3VW7 A;  3AYN A;  1L77 A;  3HTD A;  3DN6 A;  2OE9 X;  2YDO A;  5J7A A;  1L76 A;  141L A;  1L36 A;  2B74 A;  242L A;  4I7T A;  3UZC A;  1S53 A;  3FI5 A;  212L A;  4W59 A;  251L A;  1GU8 A;  5B0W A;  4K5Y A;  1B6I A;  1C6B A;  1JTN A;  1QTB A;  110L A;  1G0G A;  1C65 A;  1CV5 A;  1L40 A;  127L A;  1G07 A;  5G2A A;  213L A;  5AHY A;  1C6Q A;  219L A;  4L35 A;  5H2P A;  130L A;  4ARM A;  5G28 A;  4I7R A;  4EIY A;  1PQM A;  172L A;  2OU8 A;  3QAP A;  231L A;  4QID A;  4OO9 A;  1CUQ A;  2F2Q A;  245L A;  195L A;  3F9L A;  187L A;  160L A;  192L A;  1LYE A;  1P46 A;  1L41 A;  1T8A A;  1L16 A;  1L91 A;  2B6Z A;  3SB7 A;  1BRX A;  1JGJ A;  3DKE X;  1CU2 A;  1LYJ A;  3VHZ A;  102L A;  3HDE A;  2RB2 X;  3V2Y A;  1BRR A;  3DMV A;  104L A;  4IB4 A;  3VG9 A;  191L A;  1S51 A;  3AM6 A;  4UHR A;  5JJE A;  4EKP A;  2ZIY A;  1L57 A;  5AHZ A;  3VVK A;  1L03 A;  2R4S A;  3OE6 A;  1L02 A;  1L01 A;  1GUE A;  1U19 A;  171L A;  1CV1 A;  1KG9 A;  1CU3 A;  4AQN A;  4I7P A;  4W53 A;  1L53 A;  2LNL A;  3HAP A;  1QT7 A;  1L14 A;  1C6L A;  1C64 A;  2B75 A;  1L22 A;  2HPY A;  4BEY A;  1XJT A;  3QJQ B;  1T8F A;  4I7S A;  120L A;  3C8Q A;  1KW5 A;  2PED A;  1AP9 A;  163L A;  1T6H A;  1X0I 1;  7LZM A;  5DHG A;  1QUO A;  3QJS B;  1R2N A;  2B6Y A;  196L A;  190L A;  1D3N A;  254L A;  229L A;  3G3V A;  1UCQ A;  4X1H A;  5H2L A;  1AT9 A;  2WJL A;  1L83 A;  3QJV B;  4GRV A;  4EJ4 A;  125L A;  1LI2 A;  261L A;  2NTU A;  151L A;  4WW3 A;  1L51 A;  4FA7 B;  1LYD A;  3ZEV A;  221L A;  4HWL A;  1L99 A;  1SWZ A;  137L A;  1L23 A;  183L A;  2OTY X;  2O7A A;  4IAP A;  3PQR A;  3S3C B;  4XXJ A;  3QJT B;  3QDC A;  2QPE B;  3RZE A;  2RBQ A;  1C8R A;  3HTG A;  4QRY A;  3CDO A;  2A4T A;  4G7Q B;  5H2N A;  1JQU A;  1L0M A;  3JR6 A;  1LGU A;  4GP8 B;  1P8I A;  1G0K A;  1P2L A;  119L A;  3ZPQ A;  1L79 A;  2NTG A;  1CV0 A;  1QSQ A;  2B73 A;  3OAX A;  3QBG A;  3S8G B;  2VT4 A;  4HYJ A;  2Y01 A;  5G2D A;  3GUI A;  174L A;  1L39 A;  3EH4 B;  1BM1 A;  5ITC A;  3EML A;  1OVH A;  4MQS A;  1L96 A;  1IXF A;  1K28 A;  1XJI A;  2HUM A;  1HZX A;  3P0G A;  5B35 A;  1JTM A;  1L47 A;  1CU0 A;  1L17 A;  3K2R A;  3C7Y A;  1G0P A;  4EKQ A;  2G87 A;  3C9M A;  1CVK A;  1L90 A;  2B70 A;  4OV0 A;  1D2W A;  1QTH A;  1L61 A;  1PQI A;  3COC A;  3DDL A;  5F8U A;  3A7K A;  3GUK A;  4YXA C;  1S8J A;  166L A;  1SWY A;  1SX7 A;  224L A;  1QT5 A;  1E12 A;  1M0K A;  3SB8 A;  1C6M A;  4FPD A;  1S54 A;  259L A;  1L13 A;  2RAY X;  230L A;  156L A;  2RBN A;  2YDV A;  3UG9 A;  5LZM A;  1C60 A;  1LGX A;  1L0J A;  4S0W A;  4DAJ A;  2RBP A;  3HWL A;  205L A;  1GZM A;  4LZM A;  2J4Y A;  1QTV A;  1C68 A;  1P7S A;  1QT4 A;  2JAG A;  3KJ6 A;  103L A;  223L A;  1L87 A;  4EKS A;  5AX0 A;  3GUO A;  3CDV A;  232L A;  1C6E A;  1L75 A;  178L A;  162L A;  3C7W A;  4I7O A;  1L94 A;  4W52 A;  1EHK B;  3FA0 A;  1L81 A;  1M0L A;  3REY A;  5AZD A;  1OV7 A;  1LN6 A;  253L A;  3RUN A;  1LPY A;  2LZM A;  1C6A A;  5A45 A;  3G3W A;  4WAV A;  185L A;  115L A;  112L A;  4ARQ B;  3CDT A;  197L A;  4ZPU A;  5B6Y A;  3DN4 A;  1L06 A;  4MBS A;  1LW9 A;  2OE7 X;  4BVN A;  1QTD A;  1L12 A;  1QKP A;  3QBI A;  1L63 A;  4NC3 A;  4BUO A;  1PY6 A;  1C62 A;  4GP5 B;  2NTW A;  3S3B B;  4I7N A;  1L97 A;  4G7S B;  1ZWN A;  3WQJ A;  5B2N A;  4XT3 A;  199L A;  3NY9 A;  4G70 B;  1TN0 A;  5BR5 A;  189L A;  3OE9 A;  3V2W A;  1L38 A;  1G0J A;  1QT3 A;  2JAF A;  4TL3 A;  1L18 A;  2Q9E A;  4G7R B;  3PDS A;  107L A;  3GUM A;  1S8L A;  142L A;  1L44 A;  1ZYT A;  111L A;  173L A;  4PXF A;  1L43 A;  2YCX A;  209L A;  3DMZ A;  1KY1 A;  1R84 A;  227L A;  1D3J A;  1KGB A;  238L A;  255L A;  5B34 A;  1T97 A;  1CWQ A;  1P8U A;  3HUA A;  1C69 A;  1Q5I A;  2ZFE A;  3FAD A;  175L A;  2B72 A;  3S3D B;  2Z55 A;  3UTV A;  1D3M A;  2Z73 A;  1M0M A;  2I21 A;  3SBA A;  4IAR A;  186L A;  1XJU A;  157L A;  1G0M A;  4GYC A;  2B6T A;  1X0S A;  1PQD A;  1QKO A;  220L A;  4ARQ A;  2Q9D A;  1L45 A;  2F32 A;  1JFP A;  1QM8 A;  1X0K 1;  4FAA B;  3ZPR A;  1LLH A;  243L A;  3HT8 A;  1PQJ A;  1EPY A;  1L95 A;  1P5C A;  1P56 A;  2RBR A;  2RBS A;  246L A;  201L A;  1KME A;  2X72 A;  1OYU A;  3F8V A;  1C6K A;  3UTW A;  4W51 A;  1LI3 A;  122L A;  3C7Z A;  1C6D A;  145L A;  3HU9 A;  2B7X A;  164L A;  2WJK A;  2F93 A;  2OU0 X;  3QAK A;  206L A;  5I14 A;  118L A;  150L A;  1L82 A;  1L54 A;  1C6G A;  4PJZ A;  167L A;  1DYE A;  1CTW A;  1L08 A;  1SX2 A;  1OVK A;  3HH5 A;  3L64 A;  4FBZ A;  1FBK A;  176L A;  2OEA X;  3HU8 A;  1KS3 A;  2OTZ X;  4YX7 C;  3PWH A;  3QBL A;  3HDF A;  1L73 A;  1C6J A;  1CV3 A;  147L A;  1T8G A;  4JKV A;  1L58 A;  211L A;  181L A;  1C6H A;  113L A;  1LYG A;  1C6I A;  2B6X A;  1F4Z A;  2HUK A;  5DHH A;  3EH5 B;  2CUU A;  3VGA A;  168L A;  1L42 A;  1C6T A;  3HTF A;  140L A; 
#chains in the Genus database with same CATH topology
 3DN0 A;  4D9Z A;  2XQO A;  4NGW A;  4JR8 A;  4WLD A;  1L93 A;  4QI1 A;  3QY4 A;  1IIZ A;  3OE0 A;  1RE2 A;  4QGZ A;  1FLW A;  1L68 A;  1G7I C;  5KXZ A;  1YAO A;  4UWV A;  4B1A A;  1G0Q A;  3TXD A;  2D6B A;  4LT0 A;  1QT8 A;  2BLX A;  1L66 A;  3WU7 A;  3SB9 A;  4NFV A;  1HFX A;  2D4I A;  1SQ2 L;  1L32 A;  1DZE A;  1XEP A;  129L A;  216L A;  4IAT A;  4XTL A;  1HNL A;  1GAY A;  3EH3 B;  1W08 A;  4X31 A;  3A8Z A;  1LHH A;  4KL7 A;  3B0O A;  1L15 A;  1LSN A;  2RH1 A;  4OWB A;  5LVK A;  2F30 A;  4H9H A;  3T45 A;  2Y04 A;  3SBB C;  3LN2 A;  3LYZ A;  2L78 A;  3NSB A;  4DKL A;  4I7Q A;  1P8H A;  4Y9H A;  4XJD A;  3WH1 A;  1LYH A;  180L A;  1L92 A;  2KSA A;  1LPI A;  4HV2 A;  5AX1 A;  3X3B A;  1DI3 A;  2HEA A;  1PXR A;  1F6R A;  1B5V A;  3TMU A;  3SB5 A;  3HH6 A;  5DLA A;  3DN8 A;  2I26 L;  3WU8 A;  4YXC A;  1L60 A;  3D4S A;  1BVK C;  1QTZ A;  3P65 A;  3AZ7 A;  4YOP A;  1KXY A;  1TDY A;  3AJN A;  235L A;  1FKQ A;  1L64 A;  1IY3 A;  1OUB A;  1SSY A;  4XN6 A;  1L49 A;  4W55 A;  4N9R A;  1FBI X;  2DQC Y;  4I0C A;  1UIC A;  1H2S A;  4IJ4 A;  1D3F A;  3PBL A;  4RDS A;  3LZM A;  1F50 A;  1P3N A;  4I7M A;  4PK0 A;  1L25 A;  4P2E A;  5KXW A;  5FJG A;  1KW7 A;  3N9E A;  4TX7 A;  2Q0M X;  1HEO A;  1JKB A;  1BRD A;  3A92 A;  3VI0 A;  3UON A;  2AUB A;  4G4C A;  2KSY A;  1GE4 A;  1YKZ X;  4QDN A;  4LDO A;  5FDJ A;  249L A;  256L A;  6LYT A;  1JJ0 A;  5KXN A;  222L A;  4MQT A;  2X0A A;  3K3T A;  1UUZ C;  2I1X A;  4KPM A;  5HNC A;  2KSB A;  5EN0 A;  1ZV5 L;  4TTD A;  2XJW A;  1REX A;  3QJR B;  4HTK A;  4BS7 A;  1LKR A;  1IC7 Y;  1OV5 A;  4WLY A;  1MLC E;  5AWZ A;  1C3W A;  1LHL A;  2W1L A;  1L72 A;  4AGA A;  4MBS A;  5G36 A;  4N4Y B;  4DDC A;  4HJV A;  1CV6 A;  2BAA A;  2BQN A;  1QS5 A;  3VWO A;  4BEZ A;  2DBT A;  3HT7 A;  1BB3 A;  2Z39 A;  4N4W A;  3W6A A;  5FEK A;  3HBE X;  4QY9 A;  3CT0 A;  2Y03 A;  4WMG A;  1OUD A;  1VDS A;  4N5R A;  1YKX X;  2DQD Y;  4LDE A;  4N0J A;  2QPD B;  1L0K A;  3AYN A;  5F9X A;  1L77 A;  3DN6 A;  5IEL A;  193L A;  2YDO A;  3W3E A;  1L76 A;  1S53 A;  251L A;  5B0W A;  3LYM A;  1JTN A;  110L A;  1B7R A;  4XEN A;  1CV5 A;  1L40 A;  5G2A A;  4W94 A;  5LVJ A;  1GFU A;  2HU3 A;  4RLN A;  130L A;  2MEI A;  4EIY A;  3ZEK A;  2HEE A;  3QAP A;  231L A;  3CSZ A;  4OO9 A;  1IC5 Y;  1OUG A;  2F2Q A;  160L A;  1LYE A;  4XJI A;  4ML7 A;  1WQQ A;  4OWH A;  2YBH A;  2YBI A;  1L16 A;  1LOZ A;  4DS7 E;  1GFG A;  153L A;  4AXT A;  2G4P A;  1CU2 A;  102L A;  1NQI A;  3V2Y A;  1D0L A;  4NWH A;  2Z2E A;  104L A;  2BQK A;  4NHI A;  4UHR A;  5JJE A;  5AHZ A;  4H9A A;  3BKV A;  4II8 A;  1L01 A;  1GUE A;  171L A;  1CU3 A;  1QSA A;  3CSQ A;  3WMK A;  1KXW A;  3HAP A;  4OWE A;  1C6L A;  3E3D A;  2B75 A;  1L22 A;  2ZYC A;  2ZQ4 A;  1B7M A;  154L A;  1AT5 A;  1LHI A;  1T6H A;  4LT1 A;  1A4V A;  1VAT A;  1R2N A;  196L A;  4X1H A;  2MED A;  1AT9 A;  1AM7 A;  3QJV B;  4FA7 B;  1LYD A;  3ZEV A;  221L A;  4HWL A;  1SWZ A;  4M6D A;  5T3F A;  2I25 L;  4FDY A;  3S3C B;  1C43 A;  3QDC A;  1FN5 A;  3RZ4 A;  4QRY A;  4ET9 A;  2A4T A;  1RI8 B;  1L0M A;  1YL0 X;  2H9J A;  1BWI A;  1QSW A;  2NTG A;  1JEF A;  2B73 A;  3LYT A;  4NGY A;  1HEL A;  1L39 A;  5ITC A;  3AZ5 A;  1B7Q A;  1JUG A;  1QDT A;  1OUI A;  1A2Y C;  1HZX A;  5B35 A;  1LJE A;  1G0P A;  4EKQ A;  1C08 C;  4OV0 A;  1D2W A;  1QTH A;  3COC A;  3DDL A;  3A7K A;  1ZVH L;  4YXA C;  1S8J A;  166L A;  1HSX A;  1XGP C;  1C6M A;  133L A;  1S54 A;  2YDV A;  1B5X A;  2RBN A;  1OUC A;  1RCM A;  5LZM A;  3TMV A;  4ZEE A;  5KY1 A;  205L A;  1REY A;  1GZM A;  3ULR A;  1QTV A;  1C68 A;  1QT4 A;  1GF6 A;  2FYC A;  1HEP A;  4EKS A;  2FBB A;  1LZ4 A;  1M0L A;  1EHK B;  3REY A;  5AZD A;  4PHI A;  1LN6 A;  2LYO A;  197L A;  4ZPU A;  3W6C A;  4Z46 A;  2CDS A;  3GXR A;  4J1A A;  1LZE A;  4H92 A;  4GP5 B;  3RU5 A;  1XGQ C;  4G70 B;  1D9U A;  189L A;  5BR5 A;  1I20 A;  3QE8 A;  2DQI Y;  4WM4 A;  5LIO A;  3FE0 A;  2JAF A;  4TL3 A;  2Z18 A;  4Z41 A;  1L18 A;  3WVY A;  5G28 A;  107L A;  4YEO A;  3M3U A;  1D6Q A;  111L A;  209L A;  5DN5 A;  1CKD A;  1R84 A;  255L A;  1WTM A;  3HUA A;  4DD1 A;  1VED A;  3UTV A;  2BQI A;  2BQF A;  1M0M A;  5C6L A;  1G0M A;  5I4X A;  1QKO A;  220L A;  2ZIJ A;  5LVG A;  5KKJ A;  1X0K 1;  4FAA B;  3HT8 A;  1L95 A;  1KME A;  2XTH A;  1OYU A;  5LIN A;  122L A;  1LSB A;  145L A;  2B7X A;  1BWJ A;  4H90 A;  1B0D A;  1P2C C;  4YF2 A;  5I14 A;  2MEB A;  1L54 A;  1IOQ A;  2LZT A;  1C6G A;  1CTW A;  4WM6 A;  1J1X Y;  3TXE A;  4MCK A;  1B7O A;  1RFP A;  2OEA X;  4NGZ A;  1TEW A;  4HJZ A;  181L A;  3P64 A;  1C6H A;  1GF7 A;  4NGV A;  1C6I A;  4B4I A;  168L A;  1L42 A;  1LJG A;  223L A;  140L A;  1KG8 A;  1HF4 A;  5A3Z A;  4CHX A;  3RFM A;  2BQO A;  2B6W A;  1CNS A;  2CJL A;  2YBL A;  4WM1 A;  2O79 A;  1L09 A;  1L28 A;  4LT2 A;  3DQB A;  1Q5J A;  1LZ1 A;  3WXU A;  4B4E A;  3CDQ A;  3QJU B;  1J1O Y;  3WW6 A;  5B6Z A;  1LHM A;  5LAG A;  1BB4 A;  5KXR A;  3UTY A;  123L A;  4E97 A;  1IEE A;  1B7S A;  257L A;  1GFJ A;  4ETE A;  4EOF A;  1UA6 Y;  3NYA A;  1GAZ A;  4ARJ A;  1I56 A;  200L A;  1DYC A;  3QBK A;  1KXX A;  5KXY A;  4DDB A;  4HV1 A;  1P6Y A;  4ARM B;  2G4N A;  4DJH A;  2YDG A;  1FDL Y;  1L80 A;  1XGR C;  1KY0 A;  5C1M A;  5DM9 A;  1BGI A;  2D4J A;  217L A;  226L A;  1SSW A;  1GFT A;  2Z2F A;  2QB0 B;  1NBZ C;  3OE8 A;  4I7K A;  149L A;  1L74 A;  2YBM A;  1GFH A;  5HMJ A;  3G3X A;  5G53 A;  128L A;  2Y02 A;  1XGT C;  4WLT A;  3HAQ A;  1CV4 A;  241L A;  3GUJ A;  152L A;  2BQA A;  5H2O A;  5LYZ A;  4MD1 A;  2HUL A;  5B6X A;  1UC0 A;  5LWE A;  1GF3 A;  1UIF A;  1OWY A;  3AZ6 A;  5L3H A;  4W56 A;  233L A;  4G71 B;  1IR7 A;  1GB2 A;  2FYD A;  4XT1 A;  3SB6 A;  3EMS A;  3IWR A;  1NDG C;  3A6B Y;  1LYF A;  4DQ5 A;  4AMI A;  236L A;  4MD2 A;  4LFX A;  1B2K A;  146L A;  3TXJ A;  1JV6 A;  1LMA A;  1IO5 A;  4J0L A;  1L31 A;  1P37 A;  184L A;  1PXS A;  2YCW A;  3WW5 A;  4J7V A;  2BLY A;  1P36 A;  1L20 A;  1JV7 A;  1C45 A;  3P4Z A;  4WM2 A;  5G2C A;  3ATO A;  4ARL A;  4HP0 A;  1VGO A;  2H9K A;  3KAM A;  2O4W A;  5FEL A;  2EI4 A;  4ARP A;  4I8S A;  1L05 A;  1LSF A;  4PRQ A;  1IW6 A;  1C6N A;  4GN3 A;  1L33 A;  1UCO A;  2YBJ A;  1NBY C;  4OWA A;  3HH4 A;  4X32 A;  1KNI A;  155L A;  1B5Z A;  1WTN A;  1EQ5 A;  1ZUR A;  3DN3 A;  1LSD A;  3HT6 A;  2I35 A;  4CGE A;  1YKY X;  1C6P A;  1FBB A;  3HFM Y;  2AT9 A;  4W54 A;  188L A;  1CJ9 A;  1QUS A;  3X3C A;  2D91 A;  1D9W A;  1DYF A;  165L A;  1WVU A;  3HT9 A;  1G1W A;  1MGY A;  4IAS A;  1L11 A;  1QUH A;  4B0D A;  1CKC A;  3C8R A;  4X3B A;  4OOT A;  5B6V A;  1NKH A;  4L6R A;  1L52 A;  1L29 A;  1LKS A;  1P64 A;  5H2M A;  3HH3 A;  4A4M A;  2OU9 A;  1J1P Y;  1L24 A;  3EXD A;  3C80 A;  1UIE A;  1YAM A;  4W58 A;  5LYT A;  1LSZ A;  3LYO A;  4XJG A;  1L67 A;  1BHZ A;  4NGK A;  1L71 A;  3SN6 R;  148L E;  1XSF A;  1QQY A;  5KXT A;  2B74 A;  1GBS A;  1DXJ A;  5I53 A;  4K5Y A;  1C6B A;  1KIQ C;  1G0G A;  2YVB A;  5I4Y A;  5I4W A;  5AHY A;  219L A;  1GE2 A;  4L35 A;  2YBN A;  4G49 A;  2MEA A;  1IP6 A;  245L A;  195L A;  187L A;  4ET8 A;  1F6S A;  2B6Z A;  3SB7 A;  3FI7 A;  2Y8P A;  4H8Y A;  1LYJ A;  3DMV A;  2IHL A;  3A3Q A;  132L A;  1GE0 A;  1IP2 A;  4EKP A;  3LZT A;  5KXO A;  1L57 A;  2ZIY A;  3VVK A;  1LMO A;  5LAF A;  2R4S A;  1U19 A;  1CV1 A;  4AQN A;  3A94 A;  1L53 A;  1C64 A;  1XJT A;  3QJQ B;  3GXK A;  3C8Q A;  2PED A;  5APE A;  2DQF C;  1JKA A;  1QUO A;  1UCQ A;  2B6Y A;  254L A;  2I6Z A;  151L A;  1LSP A;  1L99 A;  4IAP A;  1OUJ A;  2O7A A;  3PQR A;  1BVX A;  4XXJ A;  1YIK A;  5B1F A;  1UID A;  4GP8 B;  3J6K A;  4TUN A;  1UIA A;  1IWW A;  1CV0 A;  3OAX A;  1GFK A;  1D0K A;  3A34 A;  1VDP A;  1IWU A;  5AMY A;  4HYJ A;  1GB0 A;  3WPJ A;  3EH4 B;  5B59 A;  3EML A;  1OVH A;  1L96 A;  1JTM A;  1L17 A;  3C7Y A;  1L90 A;  3WUA A;  1OP9 B;  4NHT A;  2IFF Y;  1GBY A;  1WQP A;  1SWY A;  4FPD A;  1QT5 A;  5KXK A;  3TXK A;  5L9J A;  3WUM A;  259L A;  230L A;  1EQ4 A;  1VAU A;  1C60 A;  2FBD A;  2J4Y A;  4WO9 A;  5AX0 A;  3A93 A;  103L A;  1L87 A;  194L A;  1OUA A;  1C6E A;  178L A;  162L A;  2BQL A;  4FJR A;  4PGJ B;  3FA0 A;  2LYZ A;  1OV7 A;  253L A;  5A45 A;  115L A;  112L A;  4DT3 A;  3CDT A;  1L06 A;  4HPE A;  5KXM A;  2OE7 X;  4BVN A;  1L12 A;  3QBI A;  1QTK A;  5F81 A;  1C62 A;  4I7N A;  1ZWN A;  5B2N A;  4XT3 A;  1LZN A;  3WVX A;  4DQJ A;  1REZ A;  4U3X B;  1KIP C;  5I54 A;  1S8L A;  142L A;  173L A;  1CJ7 A;  1LZC A;  1CKF A;  4HPI A;  1KY1 A;  2ZYP A;  1Z55 A;  1KGB A;  2ZQ3 A;  1T97 A;  1P8U A;  1B7N A;  1Q5I A;  2VB1 A;  3S3D B;  3A3R X;  3P66 A;  186L A;  4UWN A;  3P68 A;  4GYC A;  3LZ2 A;  1X0S A;  1LZ9 A;  2DQA A;  1L45 A;  2F32 A;  2ZNW Y;  1QM8 A;  3ZPR A;  243L A;  2BPU A;  1EPY A;  1PQJ A;  1NHE A;  246L A;  201L A;  2X72 A;  5I5Q A;  1GBO A;  2MEH A;  1LI3 A;  4DC4 A;  3IJV A;  3TXB A;  3C7Z A;  1C6D A;  1CJ6 A;  3HU9 A;  4H8X A;  164L A;  4ETC A;  1LYZ A;  4GCF A;  2F93 A;  1IOS A;  134L A;  150L A;  1LJ3 A;  4PJZ A;  1L08 A;  4DD9 A;  3HH5 A;  4FBZ A;  1FBK A;  1KS3 A;  1CV3 A;  4G4H A;  1LMN A;  1UIB A;  1PZY A;  4GCB A;  3VGA A;  1GWD A;  5B6W A;  1C6T A;  1ZMY L;  1QHJ A;  4L41 A;  4I7J A;  4DQ7 A;  1VJM A;  114L A;  2BRD A;  4C5F A;  4H9F A;  3C9L A;  3TMX A;  248L A;  1LJ4 A;  3IJU A;  4EKR A;  139L A;  4RLM A;  1IP5 A;  2YCZ A;  1L00 A;  3C81 A;  1JIS A;  1UIH A;  1L50 A;  1PS5 A;  4N8Z A;  1CX6 A;  5L3I A;  3LHM A;  1JPO A;  1YAQ A;  2C8O A;  1OUE A;  4AMJ A;  1C6C A;  3PXO A;  1YAN A;  1AZF A;  2NTH A;  4OW1 A;  1HEN A;  1GFE A;  1OUH A;  1CU5 A;  1LSE A;  5LA5 A;  2HEF A;  5LYM A;  2ANV A;  1LSA A;  1LZ5 A;  3HAS A;  3W6D A;  4W57 A;  3WPL A;  4HSF A;  1XIO A;  1C63 A;  1L88 A;  5EBH A;  1HFZ A;  3HAN A;  1C6F A;  262L A;  4I7L A;  1ALC A;  4ZIX A;  1FLQ A;  3WXT A;  1DKJ A;  3UZA A;  1N4F A;  4G9S A;  3F6Z A;  2BQE A;  215L A;  4CJ2 A;  4GPO A;  1GFA A;  1YQV Y;  1L10 A;  5FHW A;  4NGJ A;  1DKK A;  1LZ8 A;  4LGK A;  3CQL A;  1NHB A;  5C6I A;  1L26 A;  1F88 A;  3CDR A;  2KS9 A;  250L A;  4KNF A;  3B72 A;  1LGW A;  1CU6 A;  4H8Z A;  234L A;  3CAP A;  3WU9 A;  1XEI A;  3GUN A;  5KKH A;  4MST A;  4BV0 A;  159L A;  3AW6 A;  1WQM A;  3OJP A;  4NG8 A;  1OVJ A;  2RAZ X;  4BAP A;  1XEK A;  3AYM A;  4M4O A;  1GB5 A;  5HNL A;  5J7C A;  5B07 A;  4H9B A;  1XGU C;  5H2H A;  1L70 A;  3UTX A;  2MEG A;  1L46 A;  247L A;  1QUT A;  4GBR B;  4JQ6 A;  4KT3 A;  1QS9 A;  1IVM A;  3HTB A;  2I20 A;  1LYO A;  1WQN A;  1C66 A;  258L A;  1DZB X;  2Z37 A;  1L07 A;  244L A;  3AYQ A;  2RB1 X;  4ETB A;  2QAR C;  3HAO A;  1L27 A;  2DKV A;  3A90 A;  4BWB A;  1V7T A;  3N9C A;  1GDW A;  3A96 A;  208L A;  2L6X A;  1LYI A;  1C8S A;  2G4Q A;  4EXM A;  4LYC A;  4YEM A;  225L A;  2RB0 X;  1LTM A;  5DYS A;  3CT1 A;  1G7J C;  1WTH A;  1GXV 2;  4GBR A;  3DN2 A;  3WUL A;  2EQL A;  4NSH A;  1I1Z A;  1GEV A;  252L A;  3ODU A;  1TLA A;  3CT5 A;  161L A;  1H6M A;  3BVD B;  4UWU A;  3WYH A;  1LHK A;  2NWD X;  170L A;  1X0I 1;  4EPF A;  2R4R A;  4H9E A;  5ETZ A;  1XFP L;  260L A;  4LYO A;  237L A;  3DNA A;  1L30 A;  1DPW A;  1NWG A;  3NY8 A;  5ILC A;  4XTO A;  1DYD A;  3S8F B;  143L A;  4GP4 B;  108L A;  5KKI A;  2YSS C;  4PXK A;  3AGG G;  4IAQ A;  1DYA A;  5FST A;  4H91 A;  1IR8 A;  2F47 A;  1JTP L;  3CB7 A;  4PRU A;  1BWH A;  4H93 A;  1JSE A;  2MEE A;  1IWX A;  5ILF A;  1G7M C;  2HEC A;  1GFV A;  4N6H A;  4LDL A;  2HU1 A;  4NHQ A;  4PPO A;  3HTD A;  4WG7 A;  4N1E I;  1GBW A;  2OE9 X;  4XJB A;  141L A;  1L36 A;  4I7T A;  1HC0 A;  4W59 A;  1GU8 A;  1HEW A;  3AGH A;  3G3B B;  2HEB A;  1G07 A;  5F14 A;  3W6B A;  1GDX A;  4ARM A;  1GEZ A;  4NEB A;  4I7R A;  2OU8 A;  2EKS C;  1JJ3 A;  1CUQ A;  2B5Z A;  1TBY A;  1P46 A;  192L A;  1XEJ A;  1L41 A;  5LA8 A;  4DWX A;  1L91 A;  1C46 A;  1IWT A;  3DKE X;  1JIT A;  3HDE A;  2RB2 X;  1BRR A;  2BQJ A;  1KIR C;  191L A;  2XBS A;  2ZIK A;  3WPK A;  4BAD A;  1L03 A;  1GXX A;  4TSB A;  4R6C A;  3A95 A;  4I7P A;  1JJ1 A;  1QT7 A;  4WO6 A;  5KXL A;  4GCC A;  4I7S A;  120L A;  1KW5 A;  1AP9 A;  3HBD A;  163L A;  5DHG A;  7LZM A;  4NHP A;  4NWE A;  3QJS B;  5H2L A;  190L A;  1H87 A;  5APF A;  1V7S A;  2WJL A;  1L83 A;  4EJ4 A;  125L A;  1LI2 A;  1GE1 A;  261L A;  2NTU A;  3ZVQ B;  1FLU A;  2EIZ C;  2OTY X;  5D5C A;  1ZVY B;  1LSY A;  2QPE B;  1C8R A;  2CGI A;  5HMV A;  135L A;  4G7Q B;  1WQR A;  5H2N A;  1JQU A;  2A7D A;  2BQG A;  1BB7 A;  1LZR A;  1P2L A;  119L A;  207L A;  1L79 A;  1LZT A;  1INU A;  1QSQ A;  1GB9 A;  3QBG A;  3S8G B;  2Y01 A;  1LSC A;  3GUI A;  174L A;  2F2N A;  1LJH A;  3EO5 A;  1GPQ C;  1BM1 A;  4MQS A;  1K28 A;  1IWV A;  1XJI A;  5LVH A;  3W6E A;  1L47 A;  2G87 A;  4WM3 A;  4NSI A;  1L61 A;  4OWC A;  4WM5 A;  5F8U A;  3GUK A;  1E12 A;  2BQH A;  224L A;  3ZVQ A;  1OQM A;  1LZY A;  1NDM C;  1T3P A;  4LYT A;  1FLY A;  1CKH A;  4NHS A;  1L0J A;  2HTX A;  2W1Y A;  4H9I A;  4S0W A;  4Z3M A;  8LYZ A;  4PJ2 C;  3A6C Y;  4KXI A;  2JAG A;  1DI4 A;  3CDV A;  1LJJ A;  1L75 A;  1B5W A;  2C8P A;  3C7W A;  1L94 A;  4W52 A;  1GF8 A;  3G3W A;  5F9U A;  4WAV A;  4NSJ A;  4XYY A;  4ARQ B;  1B9O A;  1LW9 A;  2BQM A;  5KXX A;  4GLA A;  1QKP A;  1L63 A;  4NC3 A;  1PY6 A;  5FCP A;  4G7S B;  3WQJ A;  199L A;  1QTE A;  3NY9 A;  1TN0 A;  3OE9 A;  3V2W A;  1L38 A;  1G0J A;  2F4A A;  2Q9E A;  1IWZ A;  4G7R B;  3PDS A;  3GUM A;  5APD A;  4PXF A;  1L44 A;  2W1M A;  5KXP A;  1JKC A;  1REM A;  227L A;  238L A;  4N1C C;  4R0F A;  1CWQ A;  5B34 A;  1YRO A;  1C69 A;  2ZFE A;  1HEM A;  2B72 A;  2Z55 A;  1HFY A;  2Z73 A;  1LZG A;  1WQO A;  2I21 A;  4XAD A;  1IP7 A;  4IAR A;  1XJU A;  5HQ1 A;  1PQD A;  1GD6 A;  4ARQ A;  4NY5 A;  1LJF A;  1JFP A;  1P56 A;  1C6K A;  3UTW A;  4DDA A;  2W1X A;  4W51 A;  1LJI A;  1TAY A;  5JEN B;  2OU0 X;  4NG1 A;  1JSF A;  118L A;  1L82 A;  4LYM A;  1OVK A;  176L A;  2ZNX Y;  3HU8 A;  4B4J A;  4HTN A;  5LXW A;  2OTZ X;  4YX7 C;  3PWH A;  3HDF A;  6LYZ A;  9LYZ A;  2HED A;  1L58 A;  211L A;  3HBH A;  113L A;  1G7L C;  1LYG A;  1DI5 A;  2B6X A;  2HUK A;  5DHH A;  2CUU A;  3HTF A;  1B7P A;  1GBX A;  1LJK A;  4G4B A;  1OWZ A;  1TN5 A;  1LWK A;  1QUD A;  182L A;  1LZA A;  1VFB C;  3M18 B;  4WLX A;  4XTN A;  1GF4 A;  1IOC A;  4CFO A;  1LHJ A;  4W96 A;  1L19 A;  1L56 A;  1LZB A;  1G06 A;  218L A;  4XJH A;  3N9A A;  1QSB A;  1UBZ A;  1HSW A;  1G1V A;  2Z6B A;  1T6V L;  3HUK A;  4UG2 A;  4XJF A;  3ABW A;  1LZS A;  2BQC A;  1IX0 A;  3HUQ A;  5DL9 A;  1L55 A;  4DYG A;  1L37 A;  2LYM A;  4RW2 A;  4WL6 A;  3DMX A;  4G72 B;  1DYB A;  5H2J A;  3T6U A;  6LZM A;  3TMW A;  3J4G A;  1L21 A;  2LCB A;  1L85 A;  2F4G A;  2ZZL A;  1IOT A;  1BQL Y;  1JWR A;  4ETA A;  2Z38 A;  5BR2 A;  4QEQ A;  1IW9 A;  3COD A;  4GLV A;  1L98 A;  4ANR A;  1LI6 A;  2BQD A;  2XBR A;  2ZWB A;  1TCY A;  1D6P A;  1L69 A;  239L A;  5M1Y A;  1F10 A;  1G0L A;  5HLL A;  3C82 A;  1YAP A;  1O0A A;  1B5Y A;  4WOA A;  4H9C A;  1B7L A;  1CX7 A;  1LMT A;  3NS0 A;  131L A;  1L59 A;  1IP1 A;  4O34 A;  2MEC A;  4C3W A;  1D2Y A;  1GFR A;  1HER A;  4GN4 A;  5TGZ A;  2F95 A;  2ANX A;  1P2R A;  1UAC Y;  3C83 A;  1PQO A;  5H2K A;  138L A;  3GUL A;  4EA3 A;  1DPX A;  240L A;  4GCD A;  5K7O A;  5ITE A;  3MBV A;  1L65 A;  1IY4 A;  2D4K A;  177L A;  1PQK A;  3HAR A;  2M3G A;  228L A;  4E3U A;  4KLY A;  3DN1 A;  2DQE Y;  3C8S A;  5B06 A;  5DN4 A;  3A67 Y;  1DYG A;  1L04 A;  1S52 A;  1H68 A;  214L A;  1EL1 A;  2LC9 A;  4ETD A;  2RSC A;  1QTC A;  3BKH A;  3ATN A;  4NGO A;  4BAF A;  3B0K A;  109L A;  4A7D A;  5II3 A;  5JJN A;  1CUP A;  1HHL A;  7LYZ A;  1E0P A;  1XME B;  1L48 A;  1LJN A;  1C61 A;  5F16 A;  1HEQ A;  210L A;  3L2X A;  3CSR A;  5E9R A;  3AW7 A;  1UAZ A;  1LAA A;  2DQH Y;  4EPI A;  5C6J A;  198L A;  5B05 A;  1L34 A;  3RNX A;  5A8E A;  3WUN A;  1QT6 A;  3GUP A;  4HYX A;  1L9H A;  144L A;  1L86 A;  1LWG A;  1L62 A;  2OE4 X;  5A44 A;  1FKV A;  4DD3 A;  1JTT L;  1L35 A;  1C7P A;  1WVV A;  2IGC A;  3A91 A;  5G54 A;  1GBZ A;  1L89 A;  1QUG A;  169L A;  1DQJ C;  1I6S A;  1IOR A;  158L A;  5H2I A;  2Y00 A;  1IR9 A;  5JJJ A;  4J4Q A;  1IWY A;  1B5U A;  2GV0 A;  4NSG A;  5APC A;  4LYB A;  2A7F A;  2RBO A;  1C67 A;  126L A;  5D5F A;  1L84 A;  2YCY A;  1YL1 X;  3VW7 A;  1GF5 A;  1GHL A;  2DQJ Y;  3D3D A;  5J7A A;  2CWI A;  2BQB A;  242L A;  3UZC A;  3FI5 A;  212L A;  1B6I A;  1QTB A;  1C65 A;  4J1B A;  127L A;  4LT3 A;  213L A;  1C6Q A;  1EQE A;  4LZT A;  3RW8 A;  1AT6 A;  5H2P A;  4MR1 A;  1IC4 Y;  1PQM A;  172L A;  1C10 A;  4QID A;  1JTO L;  3F9L A;  5KXS A;  5IHG A;  1T8A A;  5IDD A;  1BB5 A;  2H5Z A;  3D9A C;  2LZ2 A;  1QIO A;  1QDR A;  2Z19 A;  1BRX A;  1SLY A;  1JIY A;  1JGJ A;  3VHZ A;  4RW1 A;  1E8L A;  4IB4 A;  3VG9 A;  1S51 A;  1LCN A;  3AM6 A;  3W6F A;  4YEN A;  4GCE A;  4DD7 A;  3OE6 A;  1L02 A;  2WAR A;  1KG9 A;  4TSC A;  1GB7 A;  4W53 A;  2LNL A;  1L14 A;  2Z12 A;  4YM8 A;  2DQG Y;  1GF0 A;  2HPY A;  4BEY A;  2MEF A;  1T8F A;  4Z98 A;  3OK0 A;  1NF5 A;  3TXF A;  1GB6 A;  1D3N A;  3G3V A;  1GB3 A;  229L A;  4GRV A;  1JKD A;  4WW3 A;  1L51 A;  137L A;  1L23 A;  183L A;  1O23 A;  3QJT B;  1F0W A;  3RZE A;  4TWS A;  2RBQ A;  1RJC B;  1GF9 A;  3HTG A;  3CDO A;  4LFP A;  1VDQ A;  1G7H C;  3JR6 A;  1LGU A;  1P8I A;  1G0K A;  1LMQ A;  3QNG A;  3ZPQ A;  3TXI A;  3MGW A;  2VT4 A;  3EBA B;  5G2D A;  3AGI A;  3AZ4 A;  1LYY A;  4EMN A;  1VDT A;  4ZFP A;  1IXF A;  1CJ8 A;  2HUM A;  5KJ9 A;  3P0G A;  3K2R A;  1CU0 A;  1LMC A;  3C9M A;  1CVK A;  1LZD A;  2B70 A;  4NGI A;  1PQI A;  3RT5 X;  1SX7 A;  1M0K A;  3SB8 A;  2RAY X;  1L13 A;  3UG9 A;  156L A;  1LGX A;  4DD2 A;  4DAJ A;  2RBP A;  3HWL A;  4LZM A;  1OUF A;  1P7S A;  3KJ6 A;  3GUO A;  232L A;  4I7O A;  1L81 A;  4H94 A;  1MEL L;  3RUN A;  1LPY A;  2LZM A;  1C6A A;  1JHL A;  185L A;  4WG1 A;  4HTQ A;  3T36 A;  4B49 A;  1UIG A;  3DN4 A;  5B6Y A;  1CKG A;  4HJY A;  1QTD A;  4BUO A;  2NTW A;  3S3B B;  1IP3 A;  1L97 A;  1GB8 A;  1NMM A;  2PC2 A;  4GN5 C;  3SP3 A;  3G3A B;  4H1P A;  3B6L A;  1QT3 A;  2EPE A;  2ZIL A;  1HML A;  1ZYT A;  3TXG A;  1L43 A;  1AKI A;  3DMZ A;  1D3J A;  1LYS A;  5A3E A;  5E4P A;  3FAD A;  175L A;  4DD0 A;  1D3M A;  1D0M A;  1GE3 A;  3SBA A;  4NGL A;  4WL7 A;  157L A;  4CFP A;  2B6T A;  3AB6 A;  3B0I A;  4NIJ A;  1BB6 A;  2Q9D A;  4OOO A;  1IP4 A;  1YIL A;  1LLH A;  1P5C A;  2RBR A;  2RBS A;  1LSG A;  3F8V A;  5B1G A;  1W6Z A;  1LMP A;  2WJK A;  5LVI A;  3TXH A;  3QAK A;  206L A;  2HUB A;  1LZ6 A;  167L A;  1DYE A;  1SX2 A;  3WL2 A;  1LSM A;  3L64 A;  1HMK A;  2LHM A;  3QBL A;  1L73 A;  1C6J A;  1T8G A;  147L A;  4JKV A;  1F4Z A;  3EH5 B;  2YCX A;  4LYZ A;  2N5Z A; 
#chains in the Genus database with same CATH homology
 3DN0 A;  4D9Z A;  2XQO A;  4NGW A;  4JR8 A;  4WLD A;  1L93 A;  4QI1 A;  3QY4 A;  1IIZ A;  3OE0 A;  1RE2 A;  4QGZ A;  1FLW A;  1L68 A;  1G7I C;  5KXZ A;  1YAO A;  4UWV A;  4B1A A;  1G0Q A;  3TXD A;  2D6B A;  4LT0 A;  1QT8 A;  2BLX A;  1L66 A;  3WU7 A;  3SB9 A;  4NFV A;  1HFX A;  2D4I A;  1SQ2 L;  1L32 A;  1DZE A;  1XEP A;  129L A;  216L A;  4IAT A;  4XTL A;  1HNL A;  1GAY A;  3EH3 B;  1W08 A;  4X31 A;  3A8Z A;  1LHH A;  4KL7 A;  3B0O A;  1L15 A;  1LSN A;  2RH1 A;  4OWB A;  5LVK A;  2F30 A;  4H9H A;  3T45 A;  2Y04 A;  3SBB C;  3LN2 A;  3LYZ A;  2L78 A;  3NSB A;  4DKL A;  4I7Q A;  1P8H A;  4Y9H A;  4XJD A;  3WH1 A;  1LYH A;  180L A;  1L92 A;  2KSA A;  1LPI A;  4HV2 A;  5AX1 A;  3X3B A;  1DI3 A;  2HEA A;  1PXR A;  1F6R A;  1B5V A;  3TMU A;  3SB5 A;  3HH6 A;  5DLA A;  3DN8 A;  2I26 L;  3WU8 A;  4YXC A;  1L60 A;  3D4S A;  1BVK C;  1QTZ A;  3P65 A;  3AZ7 A;  4YOP A;  1KXY A;  1TDY A;  3AJN A;  235L A;  1FKQ A;  1L64 A;  1IY3 A;  1OUB A;  1SSY A;  4XN6 A;  1L49 A;  4W55 A;  4N9R A;  1FBI X;  2DQC Y;  4I0C A;  1UIC A;  1H2S A;  4IJ4 A;  1D3F A;  3PBL A;  4RDS A;  3LZM A;  1F50 A;  1P3N A;  4I7M A;  4PK0 A;  1L25 A;  4P2E A;  5KXW A;  5FJG A;  1KW7 A;  3N9E A;  4TX7 A;  2Q0M X;  1HEO A;  1JKB A;  1BRD A;  3A92 A;  3VI0 A;  3UON A;  2AUB A;  4G4C A;  2KSY A;  1GE4 A;  1YKZ X;  4QDN A;  4LDO A;  5FDJ A;  249L A;  256L A;  6LYT A;  1JJ0 A;  5KXN A;  222L A;  4MQT A;  2X0A A;  3K3T A;  1UUZ C;  2I1X A;  4KPM A;  5HNC A;  2KSB A;  5EN0 A;  1ZV5 L;  4TTD A;  2XJW A;  1REX A;  3QJR B;  4HTK A;  4BS7 A;  1LKR A;  1IC7 Y;  1OV5 A;  4WLY A;  1MLC E;  5AWZ A;  1C3W A;  1LHL A;  2W1L A;  1L72 A;  4AGA A;  4MBS A;  5G36 A;  4N4Y B;  4DDC A;  4HJV A;  1CV6 A;  2BAA A;  2BQN A;  1QS5 A;  3VWO A;  4BEZ A;  2DBT A;  3HT7 A;  1BB3 A;  2Z39 A;  4N4W A;  3W6A A;  5FEK A;  3HBE X;  4QY9 A;  3CT0 A;  2Y03 A;  4WMG A;  1OUD A;  1VDS A;  4N5R A;  1YKX X;  2DQD Y;  4LDE A;  4N0J A;  2QPD B;  1L0K A;  3AYN A;  5F9X A;  1L77 A;  3DN6 A;  5IEL A;  193L A;  2YDO A;  3W3E A;  1L76 A;  1S53 A;  251L A;  5B0W A;  3LYM A;  1JTN A;  110L A;  1B7R A;  4XEN A;  1CV5 A;  1L40 A;  5G2A A;  4W94 A;  5LVJ A;  1GFU A;  2HU3 A;  4RLN A;  130L A;  2MEI A;  4EIY A;  3ZEK A;  2HEE A;  3QAP A;  231L A;  3CSZ A;  4OO9 A;  1IC5 Y;  1OUG A;  2F2Q A;  160L A;  1LYE A;  4XJI A;  4ML7 A;  1WQQ A;  4OWH A;  2YBH A;  2YBI A;  1L16 A;  1LOZ A;  4DS7 E;  1GFG A;  153L A;  4AXT A;  2G4P A;  1CU2 A;  102L A;  1NQI A;  3V2Y A;  1D0L A;  4NWH A;  2Z2E A;  104L A;  2BQK A;  4NHI A;  4UHR A;  5JJE A;  5AHZ A;  4H9A A;  3BKV A;  4II8 A;  1L01 A;  1GUE A;  171L A;  1CU3 A;  1QSA A;  3CSQ A;  3WMK A;  1KXW A;  3HAP A;  4OWE A;  1C6L A;  3E3D A;  2B75 A;  1L22 A;  2ZYC A;  2ZQ4 A;  1B7M A;  154L A;  1AT5 A;  1LHI A;  1T6H A;  4LT1 A;  1A4V A;  1VAT A;  1R2N A;  196L A;  4X1H A;  2MED A;  1AT9 A;  1AM7 A;  3QJV B;  4FA7 B;  1LYD A;  3ZEV A;  221L A;  4HWL A;  1SWZ A;  4M6D A;  5T3F A;  2I25 L;  4FDY A;  3S3C B;  1C43 A;  3QDC A;  1FN5 A;  3RZ4 A;  4QRY A;  4ET9 A;  2A4T A;  1RI8 B;  1L0M A;  1YL0 X;  2H9J A;  1BWI A;  1QSW A;  2NTG A;  1JEF A;  2B73 A;  3LYT A;  4NGY A;  1HEL A;  1L39 A;  5ITC A;  3AZ5 A;  1B7Q A;  1JUG A;  1QDT A;  1OUI A;  1A2Y C;  1HZX A;  5B35 A;  1LJE A;  1G0P A;  4EKQ A;  1C08 C;  4OV0 A;  1D2W A;  1QTH A;  3COC A;  3DDL A;  3A7K A;  1ZVH L;  4YXA C;  1S8J A;  166L A;  1HSX A;  1XGP C;  1C6M A;  133L A;  1S54 A;  2YDV A;  1B5X A;  2RBN A;  1OUC A;  1RCM A;  5LZM A;  3TMV A;  4ZEE A;  5KY1 A;  205L A;  1REY A;  1GZM A;  3ULR A;  1QTV A;  1C68 A;  1QT4 A;  1GF6 A;  2FYC A;  1HEP A;  4EKS A;  2FBB A;  1LZ4 A;  1M0L A;  1EHK B;  3REY A;  5AZD A;  4PHI A;  1LN6 A;  2LYO A;  197L A;  4ZPU A;  3W6C A;  4Z46 A;  2CDS A;  3GXR A;  4J1A A;  1LZE A;  4H92 A;  4GP5 B;  3RU5 A;  1XGQ C;  4G70 B;  1D9U A;  189L A;  5BR5 A;  1I20 A;  3QE8 A;  2DQI Y;  4WM4 A;  5LIO A;  3FE0 A;  2JAF A;  4TL3 A;  2Z18 A;  4Z41 A;  1L18 A;  3WVY A;  5G28 A;  107L A;  4YEO A;  3M3U A;  1D6Q A;  111L A;  209L A;  5DN5 A;  1CKD A;  1R84 A;  255L A;  1WTM A;  3HUA A;  4DD1 A;  1VED A;  3UTV A;  2BQI A;  2BQF A;  1M0M A;  5C6L A;  1G0M A;  5I4X A;  1QKO A;  220L A;  2ZIJ A;  5LVG A;  5KKJ A;  1X0K 1;  4FAA B;  3HT8 A;  1L95 A;  1KME A;  2XTH A;  1OYU A;  5LIN A;  122L A;  1LSB A;  145L A;  2B7X A;  1BWJ A;  4H90 A;  1B0D A;  1P2C C;  4YF2 A;  5I14 A;  2MEB A;  1L54 A;  1IOQ A;  2LZT A;  1C6G A;  1CTW A;  4WM6 A;  1J1X Y;  3TXE A;  4MCK A;  1B7O A;  1RFP A;  2OEA X;  4NGZ A;  1TEW A;  4HJZ A;  181L A;  3P64 A;  1C6H A;  1GF7 A;  4NGV A;  1C6I A;  4B4I A;  168L A;  1L42 A;  1LJG A;  223L A;  140L A;  1KG8 A;  1HF4 A;  5A3Z A;  4CHX A;  3RFM A;  2BQO A;  2B6W A;  1CNS A;  2CJL A;  2YBL A;  4WM1 A;  2O79 A;  1L09 A;  1L28 A;  4LT2 A;  3DQB A;  1Q5J A;  1LZ1 A;  3WXU A;  4B4E A;  3CDQ A;  3QJU B;  1J1O Y;  3WW6 A;  5B6Z A;  1LHM A;  5LAG A;  1BB4 A;  5KXR A;  3UTY A;  123L A;  4E97 A;  1IEE A;  1B7S A;  257L A;  1GFJ A;  4ETE A;  4EOF A;  1UA6 Y;  3NYA A;  1GAZ A;  4ARJ A;  1I56 A;  200L A;  1DYC A;  3QBK A;  1KXX A;  5KXY A;  4DDB A;  4HV1 A;  1P6Y A;  4ARM B;  2G4N A;  4DJH A;  2YDG A;  1FDL Y;  1L80 A;  1XGR C;  1KY0 A;  5C1M A;  5DM9 A;  1BGI A;  2D4J A;  217L A;  226L A;  1SSW A;  1GFT A;  2Z2F A;  2QB0 B;  1NBZ C;  3OE8 A;  4I7K A;  149L A;  1L74 A;  2YBM A;  1GFH A;  5HMJ A;  3G3X A;  5G53 A;  128L A;  2Y02 A;  1XGT C;  4WLT A;  3HAQ A;  1CV4 A;  241L A;  3GUJ A;  152L A;  2BQA A;  5H2O A;  5LYZ A;  4MD1 A;  2HUL A;  5B6X A;  1UC0 A;  5LWE A;  1GF3 A;  1UIF A;  1OWY A;  3AZ6 A;  5L3H A;  4W56 A;  233L A;  4G71 B;  1IR7 A;  1GB2 A;  2FYD A;  4XT1 A;  3SB6 A;  3EMS A;  3IWR A;  1NDG C;  3A6B Y;  1LYF A;  4DQ5 A;  4AMI A;  236L A;  4MD2 A;  4LFX A;  1B2K A;  146L A;  3TXJ A;  1JV6 A;  1LMA A;  1IO5 A;  4J0L A;  1L31 A;  1P37 A;  184L A;  1PXS A;  2YCW A;  3WW5 A;  4J7V A;  2BLY A;  1P36 A;  1L20 A;  1JV7 A;  1C45 A;  3P4Z A;  4WM2 A;  5G2C A;  3ATO A;  4ARL A;  4HP0 A;  1VGO A;  2H9K A;  3KAM A;  2O4W A;  5FEL A;  2EI4 A;  4ARP A;  4I8S A;  1L05 A;  1LSF A;  4PRQ A;  1IW6 A;  1C6N A;  4GN3 A;  1L33 A;  1UCO A;  2YBJ A;  1NBY C;  4OWA A;  3HH4 A;  4X32 A;  1KNI A;  155L A;  1B5Z A;  1WTN A;  1EQ5 A;  1ZUR A;  3DN3 A;  1LSD A;  3HT6 A;  2I35 A;  4CGE A;  1YKY X;  1C6P A;  1FBB A;  3HFM Y;  2AT9 A;  4W54 A;  188L A;  1CJ9 A;  1QUS A;  3X3C A;  2D91 A;  1D9W A;  1DYF A;  165L A;  1WVU A;  3HT9 A;  1G1W A;  1MGY A;  4IAS A;  1L11 A;  1QUH A;  4B0D A;  1CKC A;  3C8R A;  4X3B A;  4OOT A;  5B6V A;  1NKH A;  4L6R A;  1L52 A;  1L29 A;  1LKS A;  1P64 A;  5H2M A;  3HH3 A;  4A4M A;  2OU9 A;  1J1P Y;  1L24 A;  3EXD A;  3C80 A;  1UIE A;  1YAM A;  4W58 A;  5LYT A;  1LSZ A;  3LYO A;  4XJG A;  1L67 A;  1BHZ A;  4NGK A;  1L71 A;  3SN6 R;  148L E;  1XSF A;  1QQY A;  5KXT A;  2B74 A;  1GBS A;  1DXJ A;  5I53 A;  4K5Y A;  1C6B A;  1KIQ C;  1G0G A;  2YVB A;  5I4Y A;  5I4W A;  5AHY A;  219L A;  1GE2 A;  4L35 A;  2YBN A;  4G49 A;  2MEA A;  1IP6 A;  245L A;  195L A;  187L A;  4ET8 A;  1F6S A;  2B6Z A;  3SB7 A;  3FI7 A;  2Y8P A;  4H8Y A;  1LYJ A;  3DMV A;  2IHL A;  3A3Q A;  132L A;  1GE0 A;  1IP2 A;  4EKP A;  3LZT A;  5KXO A;  1L57 A;  2ZIY A;  3VVK A;  1LMO A;  5LAF A;  2R4S A;  1U19 A;  1CV1 A;  4AQN A;  3A94 A;  1L53 A;  1C64 A;  1XJT A;  3QJQ B;  3GXK A;  3C8Q A;  2PED A;  5APE A;  2DQF C;  1JKA A;  1QUO A;  1UCQ A;  2B6Y A;  254L A;  2I6Z A;  151L A;  1LSP A;  1L99 A;  4IAP A;  1OUJ A;  2O7A A;  3PQR A;  1BVX A;  4XXJ A;  1YIK A;  5B1F A;  1UID A;  4GP8 B;  3J6K A;  4TUN A;  1UIA A;  1IWW A;  1CV0 A;  3OAX A;  1GFK A;  1D0K A;  3A34 A;  1VDP A;  1IWU A;  5AMY A;  4HYJ A;  1GB0 A;  3WPJ A;  3EH4 B;  5B59 A;  3EML A;  1OVH A;  1L96 A;  1JTM A;  1L17 A;  3C7Y A;  1L90 A;  3WUA A;  1OP9 B;  4NHT A;  2IFF Y;  1GBY A;  1WQP A;  1SWY A;  4FPD A;  1QT5 A;  5KXK A;  3TXK A;  5L9J A;  3WUM A;  259L A;  230L A;  1EQ4 A;  1VAU A;  1C60 A;  2FBD A;  2J4Y A;  4WO9 A;  5AX0 A;  3A93 A;  103L A;  1L87 A;  194L A;  1OUA A;  1C6E A;  178L A;  162L A;  2BQL A;  4FJR A;  4PGJ B;  3FA0 A;  2LYZ A;  1OV7 A;  253L A;  5A45 A;  115L A;  112L A;  4DT3 A;  3CDT A;  1L06 A;  4HPE A;  5KXM A;  2OE7 X;  4BVN A;  1L12 A;  3QBI A;  1QTK A;  5F81 A;  1C62 A;  4I7N A;  1ZWN A;  5B2N A;  4XT3 A;  1LZN A;  3WVX A;  4DQJ A;  1REZ A;  4U3X B;  1KIP C;  5I54 A;  1S8L A;  142L A;  173L A;  1CJ7 A;  1LZC A;  1CKF A;  4HPI A;  1KY1 A;  2ZYP A;  1Z55 A;  1KGB A;  2ZQ3 A;  1T97 A;  1P8U A;  1B7N A;  1Q5I A;  2VB1 A;  3S3D B;  3A3R X;  3P66 A;  186L A;  4UWN A;  3P68 A;  4GYC A;  3LZ2 A;  1X0S A;  1LZ9 A;  2DQA A;  1L45 A;  2F32 A;  2ZNW Y;  1QM8 A;  3ZPR A;  243L A;  2BPU A;  1EPY A;  1PQJ A;  1NHE A;  246L A;  201L A;  2X72 A;  5I5Q A;  1GBO A;  2MEH A;  1LI3 A;  4DC4 A;  3IJV A;  3TXB A;  3C7Z A;  1C6D A;  1CJ6 A;  3HU9 A;  4H8X A;  164L A;  4ETC A;  1LYZ A;  4GCF A;  2F93 A;  1IOS A;  134L A;  150L A;  1LJ3 A;  4PJZ A;  1L08 A;  4DD9 A;  3HH5 A;  4FBZ A;  1FBK A;  1KS3 A;  1CV3 A;  4G4H A;  1LMN A;  1UIB A;  1PZY A;  4GCB A;  3VGA A;  1GWD A;  5B6W A;  1C6T A;  1ZMY L;  1QHJ A;  4L41 A;  4I7J A;  4DQ7 A;  1VJM A;  114L A;  2BRD A;  4C5F A;  4H9F A;  3C9L A;  3TMX A;  248L A;  1LJ4 A;  3IJU A;  4EKR A;  139L A;  4RLM A;  1IP5 A;  2YCZ A;  1L00 A;  3C81 A;  1JIS A;  1UIH A;  1L50 A;  1PS5 A;  4N8Z A;  1CX6 A;  5L3I A;  3LHM A;  1JPO A;  1YAQ A;  2C8O A;  1OUE A;  4AMJ A;  1C6C A;  3PXO A;  1YAN A;  1AZF A;  2NTH A;  4OW1 A;  1HEN A;  1GFE A;  1OUH A;  1CU5 A;  1LSE A;  5LA5 A;  2HEF A;  5LYM A;  2ANV A;  1LSA A;  1LZ5 A;  3HAS A;  3W6D A;  4W57 A;  3WPL A;  4HSF A;  1XIO A;  1C63 A;  1L88 A;  5EBH A;  1HFZ A;  3HAN A;  1C6F A;  262L A;  4I7L A;  1ALC A;  4ZIX A;  1FLQ A;  3WXT A;  1DKJ A;  3UZA A;  1N4F A;  4G9S A;  3F6Z A;  2BQE A;  215L A;  4CJ2 A;  4GPO A;  1GFA A;  1YQV Y;  1L10 A;  5FHW A;  4NGJ A;  1DKK A;  1LZ8 A;  4LGK A;  3CQL A;  1NHB A;  5C6I A;  1L26 A;  1F88 A;  3CDR A;  2KS9 A;  250L A;  4KNF A;  3B72 A;  1LGW A;  1CU6 A;  4H8Z A;  234L A;  3CAP A;  3WU9 A;  1XEI A;  3GUN A;  5KKH A;  4MST A;  4BV0 A;  159L A;  3AW6 A;  1WQM A;  3OJP A;  4NG8 A;  1OVJ A;  2RAZ X;  4BAP A;  1XEK A;  3AYM A;  4M4O A;  1GB5 A;  5HNL A;  5J7C A;  5B07 A;  4H9B A;  1XGU C;  5H2H A;  1L70 A;  3UTX A;  2MEG A;  1L46 A;  247L A;  1QUT A;  4GBR B;  4JQ6 A;  4KT3 A;  1QS9 A;  1IVM A;  3HTB A;  2I20 A;  1LYO A;  1WQN A;  1C66 A;  258L A;  1DZB X;  2Z37 A;  1L07 A;  244L A;  3AYQ A;  2RB1 X;  4ETB A;  2QAR C;  3HAO A;  1L27 A;  2DKV A;  3A90 A;  4BWB A;  1V7T A;  3N9C A;  1GDW A;  3A96 A;  208L A;  2L6X A;  1LYI A;  1C8S A;  2G4Q A;  4EXM A;  4LYC A;  4YEM A;  225L A;  2RB0 X;  1LTM A;  5DYS A;  3CT1 A;  1G7J C;  1WTH A;  1GXV 2;  4GBR A;  3DN2 A;  3WUL A;  2EQL A;  4NSH A;  1I1Z A;  1GEV A;  252L A;  3ODU A;  1TLA A;  3CT5 A;  161L A;  1H6M A;  3BVD B;  4UWU A;  3WYH A;  1LHK A;  2NWD X;  170L A;  1X0I 1;  4EPF A;  2R4R A;  4H9E A;  5ETZ A;  1XFP L;  260L A;  4LYO A;  237L A;  3DNA A;  1L30 A;  1DPW A;  1NWG A;  3NY8 A;  5ILC A;  4XTO A;  1DYD A;  3S8F B;  143L A;  4GP4 B;  108L A;  5KKI A;  2YSS C;  4PXK A;  3AGG G;  4IAQ A;  1DYA A;  5FST A;  4H91 A;  1IR8 A;  2F47 A;  1JTP L;  3CB7 A;  4PRU A;  1BWH A;  4H93 A;  1JSE A;  2MEE A;  1IWX A;  5ILF A;  1G7M C;  2HEC A;  1GFV A;  4N6H A;  4LDL A;  2HU1 A;  4NHQ A;  4PPO A;  3HTD A;  4WG7 A;  4N1E I;  1GBW A;  2OE9 X;  4XJB A;  141L A;  1L36 A;  4I7T A;  1HC0 A;  4W59 A;  1GU8 A;  1HEW A;  3AGH A;  3G3B B;  2HEB A;  1G07 A;  5F14 A;  3W6B A;  1GDX A;  4ARM A;  1GEZ A;  4NEB A;  4I7R A;  2OU8 A;  2EKS C;  1JJ3 A;  1CUQ A;  2B5Z A;  1TBY A;  1P46 A;  192L A;  1XEJ A;  1L41 A;  5LA8 A;  4DWX A;  1L91 A;  1C46 A;  1IWT A;  3DKE X;  1JIT A;  3HDE A;  2RB2 X;  1BRR A;  2BQJ A;  1KIR C;  191L A;  2XBS A;  2ZIK A;  3WPK A;  4BAD A;  1L03 A;  1GXX A;  4TSB A;  4R6C A;  3A95 A;  4I7P A;  1JJ1 A;  1QT7 A;  4WO6 A;  5KXL A;  4GCC A;  4I7S A;  120L A;  1KW5 A;  1AP9 A;  3HBD A;  163L A;  5DHG A;  7LZM A;  4NHP A;  4NWE A;  3QJS B;  5H2L A;  190L A;  1H87 A;  5APF A;  1V7S A;  2WJL A;  1L83 A;  4EJ4 A;  125L A;  1LI2 A;  1GE1 A;  261L A;  2NTU A;  3ZVQ B;  1FLU A;  2EIZ C;  2OTY X;  5D5C A;  1ZVY B;  1LSY A;  2QPE B;  1C8R A;  2CGI A;  5HMV A;  135L A;  4G7Q B;  1WQR A;  5H2N A;  1JQU A;  2A7D A;  2BQG A;  1BB7 A;  1LZR A;  1P2L A;  119L A;  207L A;  1L79 A;  1LZT A;  1INU A;  1QSQ A;  1GB9 A;  3QBG A;  3S8G B;  2Y01 A;  1LSC A;  3GUI A;  174L A;  2F2N A;  1LJH A;  3EO5 A;  1GPQ C;  1BM1 A;  4MQS A;  1K28 A;  1IWV A;  1XJI A;  5LVH A;  3W6E A;  1L47 A;  2G87 A;  4WM3 A;  4NSI A;  1L61 A;  4OWC A;  4WM5 A;  5F8U A;  3GUK A;  1E12 A;  2BQH A;  224L A;  3ZVQ A;  1OQM A;  1LZY A;  1NDM C;  1T3P A;  4LYT A;  1FLY A;  1CKH A;  4NHS A;  1L0J A;  2HTX A;  2W1Y A;  4H9I A;  4S0W A;  4Z3M A;  8LYZ A;  4PJ2 C;  3A6C Y;  4KXI A;  2JAG A;  1DI4 A;  3CDV A;  1LJJ A;  1L75 A;  1B5W A;  2C8P A;  3C7W A;  1L94 A;  4W52 A;  1GF8 A;  3G3W A;  5F9U A;  4WAV A;  4NSJ A;  4XYY A;  4ARQ B;  1B9O A;  1LW9 A;  2BQM A;  5KXX A;  4GLA A;  1QKP A;  1L63 A;  4NC3 A;  1PY6 A;  5FCP A;  4G7S B;  3WQJ A;  199L A;  1QTE A;  3NY9 A;  1TN0 A;  3OE9 A;  3V2W A;  1L38 A;  1G0J A;  2F4A A;  2Q9E A;  1IWZ A;  4G7R B;  3PDS A;  3GUM A;  5APD A;  4PXF A;  1L44 A;  2W1M A;  5KXP A;  1JKC A;  1REM A;  227L A;  238L A;  4N1C C;  4R0F A;  1CWQ A;  5B34 A;  1YRO A;  1C69 A;  2ZFE A;  1HEM A;  2B72 A;  2Z55 A;  1HFY A;  2Z73 A;  1LZG A;  1WQO A;  2I21 A;  4XAD A;  1IP7 A;  4IAR A;  1XJU A;  5HQ1 A;  1PQD A;  1GD6 A;  4ARQ A;  4NY5 A;  1LJF A;  1JFP A;  1P56 A;  1C6K A;  3UTW A;  4DDA A;  2W1X A;  4W51 A;  1LJI A;  1TAY A;  5JEN B;  2OU0 X;  4NG1 A;  1JSF A;  118L A;  1L82 A;  4LYM A;  1OVK A;  176L A;  2ZNX Y;  3HU8 A;  4B4J A;  4HTN A;  5LXW A;  2OTZ X;  4YX7 C;  3PWH A;  3HDF A;  6LYZ A;  9LYZ A;  2HED A;  1L58 A;  211L A;  3HBH A;  113L A;  1G7L C;  1LYG A;  1DI5 A;  2B6X A;  2HUK A;  5DHH A;  2CUU A;  3HTF A;  1B7P A;  1GBX A;  1LJK A;  4G4B A;  1OWZ A;  1TN5 A;  1LWK A;  1QUD A;  182L A;  1LZA A;  1VFB C;  3M18 B;  4WLX A;  4XTN A;  1GF4 A;  1IOC A;  4CFO A;  1LHJ A;  4W96 A;  1L19 A;  1L56 A;  1LZB A;  1G06 A;  218L A;  4XJH A;  3N9A A;  1QSB A;  1UBZ A;  1HSW A;  1G1V A;  2Z6B A;  1T6V L;  3HUK A;  4UG2 A;  4XJF A;  3ABW A;  1LZS A;  2BQC A;  1IX0 A;  3HUQ A;  5DL9 A;  1L55 A;  4DYG A;  1L37 A;  2LYM A;  4RW2 A;  4WL6 A;  3DMX A;  4G72 B;  1DYB A;  5H2J A;  3T6U A;  6LZM A;  3TMW A;  3J4G A;  1L21 A;  2LCB A;  1L85 A;  2F4G A;  2ZZL A;  1IOT A;  1BQL Y;  1JWR A;  4ETA A;  2Z38 A;  5BR2 A;  4QEQ A;  1IW9 A;  3COD A;  4GLV A;  1L98 A;  4ANR A;  1LI6 A;  2BQD A;  2XBR A;  2ZWB A;  1TCY A;  1D6P A;  1L69 A;  239L A;  5M1Y A;  1F10 A;  1G0L A;  5HLL A;  3C82 A;  1YAP A;  1O0A A;  1B5Y A;  4WOA A;  4H9C A;  1B7L A;  1CX7 A;  1LMT A;  3NS0 A;  131L A;  1L59 A;  1IP1 A;  4O34 A;  2MEC A;  4C3W A;  1D2Y A;  1GFR A;  1HER A;  4GN4 A;  5TGZ A;  2F95 A;  2ANX A;  1P2R A;  1UAC Y;  3C83 A;  1PQO A;  5H2K A;  138L A;  3GUL A;  4EA3 A;  1DPX A;  240L A;  4GCD A;  5K7O A;  5ITE A;  3MBV A;  1L65 A;  1IY4 A;  2D4K A;  177L A;  1PQK A;  3HAR A;  2M3G A;  228L A;  4E3U A;  4KLY A;  3DN1 A;  2DQE Y;  3C8S A;  5B06 A;  5DN4 A;  3A67 Y;  1DYG A;  1L04 A;  1S52 A;  1H68 A;  214L A;  1EL1 A;  2LC9 A;  4ETD A;  2RSC A;  1QTC A;  3BKH A;  3ATN A;  4NGO A;  4BAF A;  3B0K A;  109L A;  4A7D A;  5II3 A;  5JJN A;  1CUP A;  1HHL A;  7LYZ A;  1E0P A;  1XME B;  1L48 A;  1LJN A;  1C61 A;  5F16 A;  1HEQ A;  210L A;  3L2X A;  3CSR A;  5E9R A;  3AW7 A;  1UAZ A;  1LAA A;  2DQH Y;  4EPI A;  5C6J A;  198L A;  5B05 A;  1L34 A;  3RNX A;  5A8E A;  3WUN A;  1QT6 A;  3GUP A;  4HYX A;  1L9H A;  144L A;  1L86 A;  1LWG A;  1L62 A;  2OE4 X;  5A44 A;  1FKV A;  4DD3 A;  1JTT L;  1L35 A;  1C7P A;  1WVV A;  2IGC A;  3A91 A;  5G54 A;  1GBZ A;  1L89 A;  1QUG A;  169L A;  1DQJ C;  1I6S A;  1IOR A;  158L A;  5H2I A;  2Y00 A;  1IR9 A;  5JJJ A;  4J4Q A;  1IWY A;  1B5U A;  2GV0 A;  4NSG A;  5APC A;  4LYB A;  2A7F A;  2RBO A;  1C67 A;  126L A;  5D5F A;  1L84 A;  2YCY A;  1YL1 X;  3VW7 A;  1GF5 A;  1GHL A;  2DQJ Y;  3D3D A;  5J7A A;  2CWI A;  2BQB A;  242L A;  3UZC A;  3FI5 A;  212L A;  1B6I A;  1QTB A;  1C65 A;  4J1B A;  127L A;  4LT3 A;  213L A;  1C6Q A;  1EQE A;  4LZT A;  3RW8 A;  1AT6 A;  5H2P A;  4MR1 A;  1IC4 Y;  1PQM A;  172L A;  1C10 A;  4QID A;  1JTO L;  3F9L A;  5KXS A;  5IHG A;  1T8A A;  5IDD A;  1BB5 A;  2H5Z A;  3D9A C;  2LZ2 A;  1QIO A;  1QDR A;  2Z19 A;  1BRX A;  1SLY A;  1JIY A;  1JGJ A;  3VHZ A;  4RW1 A;  1E8L A;  4IB4 A;  3VG9 A;  1S51 A;  1LCN A;  3AM6 A;  3W6F A;  4YEN A;  4GCE A;  4DD7 A;  3OE6 A;  1L02 A;  2WAR A;  1KG9 A;  4TSC A;  1GB7 A;  4W53 A;  2LNL A;  1L14 A;  2Z12 A;  4YM8 A;  2DQG Y;  1GF0 A;  2HPY A;  4BEY A;  2MEF A;  1T8F A;  4Z98 A;  3OK0 A;  1NF5 A;  3TXF A;  1GB6 A;  1D3N A;  3G3V A;  1GB3 A;  229L A;  4GRV A;  1JKD A;  4WW3 A;  1L51 A;  137L A;  1L23 A;  183L A;  1O23 A;  3QJT B;  1F0W A;  3RZE A;  4TWS A;  2RBQ A;  1RJC B;  1GF9 A;  3HTG A;  3CDO A;  4LFP A;  1VDQ A;  1G7H C;  3JR6 A;  1LGU A;  1P8I A;  1G0K A;  1LMQ A;  3QNG A;  3ZPQ A;  3TXI A;  3MGW A;  2VT4 A;  3EBA B;  5G2D A;  3AGI A;  3AZ4 A;  1LYY A;  4EMN A;  1VDT A;  4ZFP A;  1IXF A;  1CJ8 A;  2HUM A;  5KJ9 A;  3P0G A;  3K2R A;  1CU0 A;  1LMC A;  3C9M A;  1CVK A;  1LZD A;  2B70 A;  4NGI A;  1PQI A;  3RT5 X;  1SX7 A;  1M0K A;  3SB8 A;  2RAY X;  1L13 A;  3UG9 A;  156L A;  1LGX A;  4DD2 A;  4DAJ A;  2RBP A;  3HWL A;  4LZM A;  1OUF A;  1P7S A;  3KJ6 A;  3GUO A;  232L A;  4I7O A;  1L81 A;  4H94 A;  1MEL L;  3RUN A;  1LPY A;  2LZM A;  1C6A A;  1JHL A;  185L A;  4WG1 A;  4HTQ A;  3T36 A;  4B49 A;  1UIG A;  3DN4 A;  5B6Y A;  1CKG A;  4HJY A;  1QTD A;  4BUO A;  2NTW A;  3S3B B;  1IP3 A;  1L97 A;  1GB8 A;  1NMM A;  2PC2 A;  4GN5 C;  3SP3 A;  3G3A B;  4H1P A;  3B6L A;  1QT3 A;  2EPE A;  2ZIL A;  1HML A;  1ZYT A;  3TXG A;  1L43 A;  1AKI A;  3DMZ A;  1D3J A;  1LYS A;  5A3E A;  5E4P A;  3FAD A;  175L A;  4DD0 A;  1D3M A;  1D0M A;  1GE3 A;  3SBA A;  4NGL A;  4WL7 A;  157L A;  4CFP A;  2B6T A;  3AB6 A;  3B0I A;  4NIJ A;  1BB6 A;  2Q9D A;  4OOO A;  1IP4 A;  1YIL A;  1LLH A;  1P5C A;  2RBR A;  2RBS A;  1LSG A;  3F8V A;  5B1G A;  1W6Z A;  1LMP A;  2WJK A;  5LVI A;  3TXH A;  3QAK A;  206L A;  2HUB A;  1LZ6 A;  167L A;  1DYE A;  1SX2 A;  3WL2 A;  1LSM A;  3L64 A;  1HMK A;  2LHM A;  3QBL A;  1L73 A;  1C6J A;  1T8G A;  147L A;  4JKV A;  1F4Z A;  3EH5 B;  2YCX A;  4LYZ A;  2N5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...