4EJNA

Crystal structure of autoinhibited form of akt1 in complex with n-(4-(5-(3-acetamidophenyl)-2-(2-aminopyridin-3-yl)-3h-imidazo[4,5-b]pyridin-3-yl)benzyl)-3-fluorobenzamide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
435
structure length
376
Chain Sequence
VAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery and optimization of a series of 3-(3-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amines: orally bioavailable, selective, and potent ATP-independent Akt inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords RAC-alpha serine/threonine-protein kinase
total genus 106
structure length 376
sequence length 435
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ejnA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4ejnA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ejnA02
2C6LA 1J1BA 2OJ9A 4IX3A 4HDQA 4FICA 4FT7A 4UZHA 5J9LA 2FO0A 5JZJA 3QTXA 1U5RA 4DEHA 4QMLA 4RJ8A 4F99A 1FMOE 2XNMA 4O7LA 4I0RA 4QP9A 3BBTB 5DIAA 5LVLA 4DCEA 1KOAA 3MPTA 3NPCA 3DPKA 3VIDA 2XK6A 1AGWA 3LCKA 4ASXA 4LL0A 3KCKA 2COFA 3EB0A 4X3FB 2XNOA 2W1DA 3IW4A 1PXNA 3QL8A 1YXSA 3QFVA 5CEMA 5AUZA 4EQUA 4BTFA 4PQ0A 5FWKK 5IISA 1V88A 1YHVA 1PMVA 2X7GA 4OLIA 4V01A 5AP1A 3ZRKA 4BWKA 3NUAA 3OZ6A 2OF2A 3UC3A 3KY2A 3SGCA 4ACMA 1FPUA 3KF4A 3V8WA 2UVZA 2X8EA 5M4CA 4C57A 4OW8A 5CI6A 4EWQA 4C4HA 5DI9B 5H8EA 1X86A 4K81A 2RLOA 4C4IA 3L8XA 2CLQA 1R39A 2BAQA 2VGOA 1OY2A 2RNRB 4XG6A 3Q4TA 1UKHA 4L7SA 1Z5MA 1Q8WA 3O71A 2X2LA 5CZHA 4YO6A 3W16A 4BDAA 1Q99A 4WNPA 4AOJA 3FLYA 3N9XA 2QO2A 5BPYA 4XNEA 3DXDA 3RZFA 4RJ6A 2XA4A 4ZEGA 3H30A 5IQAA 3COKA 2Z60A 3PLAE 2C5YA 1YDRE 3QQKA 4G3CA 1WFCA 3KC3A 3HDMA 3ELJA 4FNZA 4HPUE 4BI1A 3NEWA 5HKMA 4EHVA 2YM5A 4BTMA 2I1JA 3QXPA 1W84A 4TNDA 3F3ZA 4FV5A 5LARA 1NA7A 4YJTA 2FA2A 1NVRA 3OS3A 4HCVA 4D2RA 4TL0A 5LVPA 2Y6MA 4TW9A 3DTWA 3QKMA 1PHKA 3NCGA 3P78A 4GMYA 3SXFA 1TJ6A 3SO6A 5GINE 3F3TA 2JIUA 2Y7JA 4GVAA 3KZ1A 3D9VA 2OH0E 3I5NA 4O7TA 4Q5EA 3CTHA 1P5TA 3TDWA 2P0FA 5C4KA 2HY0A 2AC5A 1SNUA 2IJMA 2J0KA 4ZS4A 5JRSA 3SXRA 4NT4A 1WBOA 4M0ZA 5AV0A 4XG8A 5LMBA 1KWPA 4FOCA 3QKLA 4WRGA 2RFEA 3PXQA 4PDYA 4F0GA 4GJ3A 4ALWA 1DBHA 4OTDA 5AM6A 2WTDA 3HMNA 3PXYA 4FV9A 2WMQA 5CQWA 4F4PA 3VF9A 2W99B 4HCTA 2CRFA 4FG9A 2W9FB 2N23A 3R30A 3MTLA 4ONAA 4PPAA 4EH6A 1EF1A 2VO7A 3RMFA 4E73A 5GOWB 5E9EA 3PP2A 4KD1A 4KUJA 3POOA 5EM5A 3RPRA 4DFXE 4C61A 4CVAA 4FG7A 4OBQA 3I0OA 4X3JA 4B4LA 4DH7A 5CVHA 1U5FA 1WJ1A 3A7IA 4NY0A 1WAKA 1NW1A 3R9RA 2XP2A 4XUFA 5ETCA 4IH8A 4G34A 3SC1A 4GN1A 5JHHA 4YL8A 3DNDA 3SG9A 2BPMA 3ORIA 5EDQA 2CN5A 2G1TA 2VO3A 3FZTA 4JI9A 3DLZA 3U87A 3BE9A 2WU7A 2WEIA 2D9ZA 2PVNA 4I4EA 1SHCA 4JNWA 3OOGA 2CJMA 2NPQA 3QKKA 4CZYB 4R3PA 1U54A 4HOKA 3EZRA 2BROA 4WG5A 2PK9A 4G16A 2R0UA 5CEIA 3JR1A 4MD8E 1BL6A 4H1JA 4BBEA 1GZKA 2ZM4A 4FZ7A 4H39A 2YZLA 4R5SA 2Q0NA 3ORTA 3VBVA 3T9IA 4FX3A 4QMTA 4A07A 4PTGA 3E3PA 3HMPA 4EOIA 4FL1A 4DH1A 2QVSE 2BRNA 4NM3A 3CGOA 3ZEWA 3FJQE 3P5KA 5EYKA 3ROYA 5IG1A 4BYJA 3R9HA 5FXSA 5M51A 2XKEA 5EDRA 3FWQA 4C3FA 5I0BA 4FTJA 2LYDA 3TUDA 3QX2A 3P7CA 3MFUA 2VTSA 3RINA 4BZDA 1FVTA 1MP8A 3IK3A 4M14A 4GK4A 1XBCA 4RJ5A 3L8PA 4WSFA 3JXWA 4I6FA 3AU5A 1TQPA 4L3JA 2XF0A 5GZ9A 3V5TA 4HVSA 2WOTA 3CQUA 1B6CB 4U79A 4MF0A 4EH5A 2PHKA 2EB3A 3ZSHA 2F57A 2W1CA 4DGOA 4XV1A 3VRZA 5D3VA 2OIBA 4A5KA 4E4MA 1NVSA 2BRMA 4L9IA 4XV2A 5HE0A 3GOKA 4C2WA 2RGPA 3ZFXA 4EZ5A 5BUJA 5M4FA 2OZAB 4IDTA 5E8WA 4DG0E 3I5ZA 1KUTA 4JQEA 2PE1A 3ET7A 4O91A 4R3CA 5HVYA 5AEPA 1KSWA 5LONB 1I44A 2Y4IC 4J98A 4K6ZA 1WCCA 2VTIA 4QNAA 2OTXA 1Z57A 2EVAA 2RL5A 4I22A 4NM5A 4AW1A 3BELA 1APME 5K5NA 1KV1A 5IQDA 4FNYA 3F66A 3FHIA 1F3MC 4P5ZA 3DY7A 1LR4A 3ODZX 4NWMA 2VWZA 3HV5A 4WG4A 4C35A 4E26A 2VKIA 3CKWA 4BWPA 4E6QA 3NNUA 4DEDA 5B2KA 3PVUA 4DTKA 2QKWB 1OECA 1UNRA 3PZHA 4PF4A 5AM7A 2XIXA 4DX90 5IQEA 2FVDA 4ZXTA 4FKVA 3TNWA 2PE0A 2CN8A 2F7ZE 4FVPA 2IW8A 4EC9A 1W1GA 3MIAA 5C4LA 3MFTA 1ZVRA 4AP7A 4G3FA 2H7DA 4DFYA 4TZRA 4IWPA 1J1CA 3DGKA 4FKGA 5HGIA 3UBDA 3MVHA 1YHSA 3HGKA 5M4UA 4JBVA 3H4JA 4WHZA 2W9ZB 3UZRA 1B39A 1UNQA 2PSQA 4BCPA 2XK7A 2YWPA 3B2TA 4M97A 5D7AA 5E90A 4C62A 4ZY5A 4HB4B 2NNWB 2X6DA 2LULA 3TACA 2IVSA 4OR5A 3LFSA 4MQ1A 4PL4A 3UC4A 3G15A 5M4IA 2VGPA 1A06A 2V76A 4YSMA 4CMOA 2GS6A 3COIA 1ATPE 4Y85A 2B53A 1UNHA 3AMBA 3GBZA 4W9WA 3V5QA 2WQMA 5AP6A 3GCVA 2OJJA 4CRLA 3C5IA 4KWPA 2HZ4A 4LGDA 4RGJA 2OZAA 4GFMA 4U43A 5HI2A 4AE6A 1OL6A 2GNHA 4I0SA 5EHLA 3QF9A 3LM5A 5J87A 4X0MA 3RNIA 3BHTA 3GCPA 3KN6A 3UZPA 2YVCA 1BI7A 1VZOA 3A7FA 5IPJA 4FSMA 4G1WA 4RC4A 1ZYCA 2QO7A 4NJDA 3GCSA 3P86A 5H9BA 4YMJA 1PMSA 2YS1A 2UZNA 3MVLA 4LUDA 2I0VA 3FXWA 3MB6A 3Q5IA 4NZWB 5E7RA 4ZZOA 3GC9A 1JWHA 2VTTA 4QTAA 4WD5A 2PVHA 5TKDA 5DHAB 4C59A 4B9DA 2XJ0A 3VUTA 2DQ7X 4LOPA 4KABA 5DT0A 2KTYA 3FSKA 5DOSA 3ETAA 4ZLOA 3WYFB 4XMOA 4OTIA 4TYIA 4IAFA 2VTPA 4XG3A 4ZSEA 3C0HA 3ZLWA 4O0TA 2ONLC 4JQ7A 1YOLA 4RQKA 5GJFA 3VBTA 3ZLSA 2D9XA 3O17A 5AP5A 3C9WA 4CZUA 3V5PA 4AA5A 4QMVA 3FZSA 3PY3A 2C3IB 5L8KA 5L4QA 3UYTA 1PMUA 2HTHB 4ZJJA 3TCAA 3I7BA 2R9SA 3EQDA 2XRUA 4EK6A 1V61A 2ZOQA 3ULBA 2I5CA 4EJNA 5EDPA 3QQGA 4KKEA 5C79A 4ACGA 2XKFA 4LI5A 4ANBA 4GT5A 3GXLA 3FZ1A 2IN6A 2OJIA 4E6DA 5CZIA 3KXGA 3KREA 1YVJA 5L6PA 3FZPA 4XX9A 3D4QA 3DA6A 2CGXA 4I1ZA 2QG7A 1XD4A 4HAWB 2J6MA 2O0UA 2WD1A 2ZMDA 4KVGB 1M2PA 4BCJA 4FUYA 4Y8DA 5HESA 3SXSA 3ZDUA 5M08A 2G9XA 4D0WA 1E1XA 3E7VA 4CNHA 3C5UA 3FMHA 4U81A 3VS0A 1XCGA 4U44A 5AADA 4FT0A 3RVGA 2D9YA 3PG1A 2ROVA 2NRUA 4L6EA 3BLQA 2NZ8B 5CU4A 4FGRA 4K2PA 1GOLA 4GG5A 3EQFA 3BHHA 3VBXA 4F1MA 4GU6A 2PZ1A 1H01A 3AC8A 2X4FA 3R04A 4I20A 3NW7A 2OZOA 4MEDA 2C4GA 4CQGA 5HG8A 3W1FA 1RJ2A 2RG5A 4L01A 4FNWA 5M44A 1G8SA 4KAOA 3ZRMA 5KNJA 1WBVA 4A9SA 3MN3A 4NKAA 2YISA 3QBNA 3AJ4A 4ZRKA 3W2OA 2VZ6A 1BAKA 5CI7A 5A4QA 1RE8A 4IADA 3HZTA 3QTWA 2MDXA 5JN2A 3MJ2A 3BYMA 2PVLA 2OG8A 3OXTA 4AW0A 3ODXA 3GCQA 1DAYA 3PDTA 2B9FA 2SRCA 4MXCA 5KKRC 4O7YA 4O96A 3UQCA 3UPZA 5IQGA 4D5KA 5A9UA 4KA3A 3BIZA 3BU6A 3FKOA 4IVDA 4V04A 5C26A 4TNBA 3GC8A 2XNPA 4BGQA 4RG0A 4NM0A 4PPBA 3F2AA 4O0WA 5JRQA 3F61A 2R3LA 2WB8A 5DH9B 1U46A 2VWBA 2JAVA 3TI1A 1BL7A 2P0CA 2NO3A 4GUEA 3IDBA 3HUCA 4QTDA 4F6SA 3BGPA 3FHRA 4FSQA 4MXXA 4YZDA 3U55A 3Q53A 1KE9A 4ANNA 2C47A 4CFUA 3MDYA 4AWIA 2COCA 3E3BX 3IDCA 3I79A 4GS6A 5FLFA 1W1DA 1ZYJA 3OBJA 1SYKA 1R3CA 3TZMA 5FXRA 2ZDUA 3PIZA 4JDIA 3UNJA 5L2SA 2DX5A 4IWQA 4DINA 4F7GA 2F4JA 5BMMA 2WZJA 2J5FA 4L68A 3F88A 2HZ0A 4R7HA 1VEBA 2H96A 3MFRA 3QRTA 4G5JA 4HJOA 1GZOA 4IM0A 5JFSA 2JC6A 2EU9A 3EFWA 5E8SA 1LEZA 4MNEB 1WGQA 3MBLA 4TYHA 2ETKA 3LJ2A 4X2JA 3LJUX 5FXQA 3KXHA 5E1SA 5G6VA 3ODWA 4FIFA 4U97A 3TCPA 3UOLA 4L3LA 4R77A 2UZRA 4FK6A 5TR6A 3TXOA 4DBBA 4AT4A 1H1PA 1A48A 5EK7A 2YERA 4PV0A 5AV3A 4QMUA 4BCMA 2YAKA 3MS9A 4FA2A 2LGCA 4WNMA 5GJGA 2EXEA 2EUFB 4U8ZA 3EQRA 4CD0A 4HVDA 1MIZB 3QTSA 4B99A 1UPRA 2B52A 1GAGA 5JKGA 3UIMA 3IW6A 2WOUA 3L1SA 4E4XA 1PLSA 4FKRA 3TNIA 3PA3A 5L2TA 2HELA 4O0VA 3DFAA 4R7IA 5B2MA 5LVNA 3A7JA 2BCJA 5L6WL 5DNRA 3EH9A 4ZJVA 5IEVA 4YNEA 2IVUA 3PRFA 4YR8A 1CKIA 4Q2AA 3VBWA 5HG9A 4C8BA 2YM7A 4PWNA 5HBEA 4V0GB 2RG6A 2JDVA 4HZSA 1OITA 3ZH8A 4K0YA 5JT2A 4FMQA 3CS9A 4EKUA 4LRKA 1LEWA 4LV8A 5AP7A 1U5GA 3VWAA 5GIPE 1YXXA 5HG7A 3WZJA 3QYWA 4MCVA 4ZZNA 3BEGA 4ZTQA 5AV1A 1MK9B 4PMSA 2JDSA 3E62A 4MBJA 5HICA 4ZK5A 3UPXA 4F7JA 5ITAA 2A27A 1DI9A 1BTNA 4K33A 3ZONA 4GKHA 3KVWA 4BZOA 4IIRA 4HB2B 2UW4A 3EQPA 4ZLYA 2WIHA 1GIHA 2IZUA 2W1GA 1K9AA 4O0XA 4LUEA 4U3YA 3FKNA 4BCQA 3BWJA 4UB7A 3ORMA 3DBQA 3FQSA 3BU3A 3R83A 2J2IB 3MWUA 4NTSA 2W96B 1DI8A 1OPKA 4Z7HA 3VUKA 4EOLA 4U45A 2ZMCA 3DBEA 3FMKA 4ZP5A 4EUUA 3ACKA 4DYMA 2M38A 3R7IA 3HW2B 3W2CA 2RVBB 4EHGA 3A4OX 2PZPA 4IAAA 3BU5A 3GEQA 1AQCA 4BDJA 2CGUA 3IO7A 3HVCA 4QPMA 5K4IA 2JFMA 3D8DA 1Q67A 4MYGA 4MK0A 1REKA 4C0AA 4GSBA 4YPSA 4NKSA 3MJ1A 5GZAA 3Q32A 3S00A 4D0NB 5DI1A 4CMUA 3DK6A 2YT0A 1PKDA 3SAYA 5HTIA 4G3GA 2BHEA 4A6FB 3DXPA 4DFBA 2ESMA 4ACHA 4FVQA 2XNEA 3ZS5A 4HYHA 2YITA 5GNKA 1ZY5A 4E4NA 4EQMA 1FGZA 4EK5A 1H25A 4FKUA 1QPCA 4A9TA 2EB2A 4IB0A 2ITUA 5A4CA 5DR9A 4Q5HA 1BYGA 1YRPA 4G2FA 2QU6A 3F3WA 2DYQA 3G0EA 4O0UA 3BINA 4O2ZA 2DWBA 2P8VA 2XK4A 2UZOA 3HP2A 3ODYX 4USFA 4EOOA 2X7FA 4I21A 5HU9A 2F2CB 5BMSA 1W98A 5I9UA 2IVVA 2ROZB 1W83A 5AP4A 3I0QA 3WOWA 4NK9A 4XV9A 4F9BA 1M7EA 2PVRA 1XBAA 5LXMA 4AXAA 4GW8A 2HW6A 5ANGA 4YTIA 3RPSA 5BVFA 1Q97A 2R3MA 2XVDA 3G5DA 3QC4A 3MH2A 5AP0A 1DYNA 1OIQA 3IONA 3PJ2A 4JR3A 2QKRA 3DXNA 1S9JA 3ERKA 4IAYA 4O6LA 4QO9A 3VAPA 1Q8YA 4QYGA 3TN8A 5IU2A 1Z87A 4R7BA 3MPMA 5AR5A 3GNIB 2ELAA 5HIDA 4RJ7A 4YTFA 2ETRA 3FMDA 4M67A 2B1PA 4HYSA 4BY9E 2UZTA 3A8WA 3O8UA 2W4KA 3OCBA 4TWOA 3RHXA 3QGYA 1OL7A 4RVLA 5D1JA 3RCPA 2QCSA 4KINA 4GRBA 5HG5A 3F5GA 1V89A 4FTKA 2C0IA 1Q5KA 5HTBA 2R09A 2VRWB 3KA0A 4DEBA 3HK0A 3B2WA 5HE1A 4TRLA 3BYUA 4QNYA 5HCZA 4XBUA 3L8SA 2G2FA 4AAAA 3NYVA 4ERWA 3ZO1A 1WG7A 2CKOA 4FTIA 2BHHA 4D4RA 4C02A 4I5HA 3GU8A 1ZRZA 5J7HA 1XBBA 2Z7LA 4M68A 1XKKA 3HP5A 3QIJA 2R0DA 5BX0A 4X6QC 4J71A 4CG9A 4TN6A 5HLNA 4MXOA 4PUZA 4O7VA 4N4SA 1R1WA 5HORA 5FEDA 3RGFA 4JLCA 1ZARA 3RWPA 2DA0A 4BZNA 2YDKA 4U0IA 2W2XD 3FSFA 3NVMB 3OEFX 4RRVA 4WIHA 2CODA 1Q61A 2D2QA 1FQ1B 2UZLA 4JR7A 4YZCA 3DOGA 3U4WA 4BDFA 3SD0A 4F9YA 4RBLA 5AX3A 3Q4CA 2I1KA 3DV3A 4I23A 1OL1A 5HVKA 5FD2A 3RWQA 3DZQA 1ZY4A 4EH4A 4ALVA 3EZVA 3R00A 2OICA 3E7OA 3C4FA 4JX3A 4DLIA 4JX7A 5CLPA 2OSCA 4O21A 4QMQA 4QYYA 4UBAA 3ORXA 4FTRA 4AG8A 2RFNA 3II5A 1F5QA 1IEPA 5ICPA 1UPQA 4EJ7A 4L45A 3P0MA 5JZNA 1ZSQA 2Y7BA 3FKLA 3NDMA 4E93A 3NIEA 3H9FA 4AT5A 3K5VA 1VYWA 1J3HA 1KE8A 3E92A 1JLUE 4X2KA 1P4OA 5A4LA 2C1BA 3R1NA 4RLLA 4E4LA 5GZ8A 2AEHA 2MFQA 5M09A 5KHXA 4FSTA 3VBQA 4FSYA 3TM0A 3UDBA 3E8DA 3ZO2A 2GDOA 2Z2WA 4HGTA 1WZYA 3TNPC 4N70A 5HO7A 3GOPA 4DT8A 1N3HA 3LCTA 4J95A 4XLVA 1I7AA 5EKOA 1RW8A 1K3AA 3KRWA 3QCYA 3OWKA 3U8WA 4X7QA 4R6VA 4ZY4A 2GS7A 4FKLA 2PVKA 3C4CA 4IAKA 4A9UA 3LFQA 3PJ8A 3Q9YA 4H3PA 3KU2A 4BKYA 5E8YA 4IVCA 5D10A 3TTJA 1PY5A 4F1OA 5D3YA 4DF3A 4K8AA 1H8FA 5J95A 1P2AA 3R22A 4FR4A 3QRUA 4HCUA 2L2IA 4IFSA 2YDIA 5EI8A 1Q8ZA 5CT7A 5HIBA 3W8LA 3UODA 1XR1A 4DX8A 3QU0A 4F1TA 1JKLA 5D9HA 1R0EA 4FV6A 2BUJA 2IZSA 4M8TA 4UEUA 3VQUA 2W1HA 4BDKA 5J5SA 3E88A 2OFVA 4L43A 5L8JA 5ACKA 2DLWA 3U4UA 1ZWSA 1LPUA 3VF8A 2O5KA 5E8UA 3MESA 4H1MA 5JGAA 2J0JA 2J0MA 5KKRB 2MWNB 5CLQB 5LVMA 2YCFA 3BCEA 3R7OA 3F5PA 5CYIA 5A3XA 3Q60A 1X05A 3ZHPC 2A19B 3UIBA 2XCKA 3G0FA 4JDKA 5HBHA 2CNQA 4JXFA 3OW4A 2F7XE 5AR3A 2Z0QA 4CHMA 3DJ7A 3G9LX 3U51A 2O3PA 3V5WA 4BDDA 2X0GA 2PPQA 5HHWA 3PWDA 3UP2A 3KMMA 3CXBB 3TZ7A 4RZWA 3WBLA 3AQVA 3QD0A 5CEQA 3W8QA 4DAWA 3HMMA 4QP8A 3BLRA 2YDJA 3F7ZA 2JITA 2JAMA 2GTMA 3GU5A 3G33A 3RK5A 3AC3A 3EIDA 3E87A 1OKZA 3NW6A 2NP8A 3BYSA 4F7UP 3BJIA 4FSRA 5FRIA 3UNKA 4D1ZA 4L8MA 3FPQA 3HV4A 4MVFA 5J79A 5F94A 1WVYA 2FUMA 3VQHA 4O2PA 4UMUA 2FYSA 3LW0A 1NXKA 3QC9A 4PNKA 5LCKA 3RCDA 3EKNA 3FL4A 4G6LA 3GGFA 4IB3A 4D9UA 3R9OA 4JQ8A 3RZBA 3TV7A 4F7LA 3RJCA 3UOHA 2WMRA 3DK3A 5E8ZA 3UE4A 4J53A 3ZO4A 5CAOA 5LQFA 1VJYA 4WBOA 3F9NA 4ZTLA 5TF9A 2EXCX 4BICA 3JVRA 3EL7A 5LVOA 1YQJA 4IW0A 3FY2A 4K2OA 5JK3A 2XK3A 1YKRA 3E8NA 3EN4A 3NNXA 3UVQA 3RAWA 3K3IA 3RK9A 5HNIX 3F82A 5DHJA 4H3QA 4AOTA 5IA3A 5IUGA 1J7UA 3PA4A 4C4JA 3PSBA 2PUIA 1ZOHA 2GFSA 2DS1A 3GFWA 2RSVA 4M0YA 4CZTA 5AAEA 5TO8A 1SMHA 3BKBA 3RAHA 3DXCA 4NTTA 3WILA 2W5BA 2VAGA 1QMZA 4W9XA 4DC2A 1U54B 3WF6A 4FV3A 2XIRA 1OMWA 2PZRA 4IZ5A 4R8QA 5F20A 4YLJA 2JDTA 4BI2A 2RFSA 2YSZA 3DJ6A 3CD3A 3PIYA 4UYAA 2L1CA 3MVJA 1ZMVA 3KEXA 4RPVA 4HAZB 3DBCA 1KZGA 2I0HA 3D94A 1JSTA 3E63A 4O6EA 2VTJA 3HA8A 4S30A 4CT2A 3F5RA 2Z8CA 3QYZA 2V7AA 2QOFA 2OXYA 5BVKA 5T6KA 5DPVA 5AIKA 1OKVA 4O0RA 1PFJA 4F6WA 4PMTA 1U29A 3ZBFA 4UN0C 4XOZA 3FMEA 3H0ZA 2C68A 2YCSA 3DDQA 4H8SA 3F6XA 2R3HA 3THBA 3NIZA 3E8EA 5KMNA 4WRSA 4QP7A 3AXWA 4RIYA 4X3FA 2F7EE 3B8RA 3IDPA 3CD8A 4F9WA 2YM6A 1QPDA 3SX9A 4OAUC 2FSLX 3AC4A 4LGGA 3D7ZA 4XOYA 4Z2NA 3EFKA 1CTPE 1HOWA 3QTRA 3RAKA 1FAOA 3O50A 5CSPA 3QZIA 4MT7A 5J3QA 2UZBA 1MK7B 2ZJWA 4LMNA 3AG9A 3CLYA 2B54A 3P6AA 4S33A 3L9LA 4F0FA 2WELA 2VTAA 2DKPA 5L2IA 5M53A 5T3QA 4PNIA 2GQRA 4XP3A 4JVGA 1GIIA 2QOLA 3A4PA 4FKIA 4PL3A 3FE3A 5HBJA 3VUHA 3QA0A 3O96A 4UWCA 4BHNA 2QKLA 3U9CA 5I9YA 2EC1A 3FBVA 3K54A 4YU2A 2JFLA 5FDXA 5IH6A 5AAGA 4CCUA 4FYOA 4IX5A 2YIXA 3F3UA 3O7LD 5HE2A 4J8MA 3UQFA 2Z02A 1UVRA 3OCSA 4YHFA 4WKQA 5D11A 3O2MA 4GFGA 2QODA 4Q9SA 4R1VA 1F0QA 4ZAUA 3LFFA 5IDPA 1CMKE 2JIIA 2YIRA 4ASZA 5J7BA 4XBRA 3OUKA 4YZMA 1SZMA 3FMNA 5AP2A 2X18A 4RVTA 3A8PA 2Y8OA 2XJ2A 3PRIA 3KMUA 2UW9A 5KZ0A 3C51A 4B8MA 4FT5A 4BCFA 4DCAA 5FEEA 2W2XC 4I0TA 3NUNA 3OROA 1U4DA 3QWKA 4MTAA 4MWIA 3DKCA 3PJ1A 5DFPA 5AV2A 4BGGA 3D8FA 3C4XA 3FEGA 4ZLZA 3SUZA 4U80A 4LGHA 3PP1A 4W4VA 2YFXA 5HO6A 4FEUA 2GQGA 1TQMA 2QHMA 1OL2A 5LCJA 2C6OA 2X9FA 3S2PA 5FGKA 2M14A 5FI0A 1NVQA 3O8PA 5AR4A 4A4LA 4USDA 1M7RA 3D0EA 4PDOA 3W18A 4ENXA 4D28A 1KE6A 2G35A 1UU3A 3CEKA 2QC6A 5DRDA 3ZVRA 5KQ4A 3VJNA 4K2RA 4O84A 3R7GA 4DGGA 4WUAA 4FTOA 5FG8A 2OI4X 4EOKA 4MXAA 4N57A 2OJFE 1XJDA 4YC6A 4U9AA 5JGBA 2WXVA 5HCXA 3DU8A 4D4SA 2YAAA 2R64A 2OIQA 4HNIA 5CU3A 4C4GA 4BC6A 1Y8GA 3DTCA 2J0MB 1OVEA 4CSVA 1V0OA 5IQCA 1MUOA 1IG1A 4XG7A 4R78A 2Z7SA 4O82A 1G3NA 4EK4A 3I7CA 4RMZA 4AS0A 1U59A 3E93A 5FTQA 1O6YA 4KBKA 4ZTMA 5A54A 2CCHA 4QYHA 4Z55A 2R4BA 4IWOA 2QLUA 4IACA 4S2ZA 1A9UA 5DIFB 2PU8A 3ZLYA 1SGHA 4FSZA 2W4OA 3FMLA 2HZIA 4E8AA 4FIJA 4OTHA 5H8GA 4EH2A 5KUPA 2YWVA 4A4XA 5EI6A 4RFZA 3MB7A 3EWHA 3F69A 4C3RA 4P7IA 4YZBA 5CF8A 2PTKA 4NSWA 3TNQB 3QAME 5AR8A 4WVFB 2CGWA 2XKDA 3PJ3A 3C7QA 3QQFA 3VHEA 4MXZA 5EQYA 2JBOA 4IC8A 2JKQA 3CR0A 3UO4A 4M84A 3BWFA 2QI8A 2R3QA 5HLWA 4BCOA 3CQWA 1BMKA 3KB7A 4O1OA 5J1WA 1PXJA 4JAJA 2C1AA 3Q3BA 3UNZA 1ND4A 5M56A 3KN5A 4O0YA 2CGVA 3ZC6A 4QRCA 2DHJA 1H00A 4FOBA 3TKIA 4DITA 4IFCA 3PVBA 4BKZA 3TZ8A 4HAXB 4RWLA 2P55A 2XBJA 4OBOA 3S3IA 4D58A 1V0PA 4ZOGA 3I1AA 4BCNA 2BFXA 2YLFA 4GMVA 1BLXA 1ZYSA 5KO1A 2C5OA 2X2KA 4D1SA 3K2LA 5ANDA 1O9UA 4EONA 1Q3WA 2XB7A 1OZ1A 3CSVA 1BUHA 3SW4A 1V5UA 3RK7A 3N51A 4AX8A 2YIQA 1UKIA 3BX5A 2BDWA 3PXRA 4FT3A 2P2IA 3N4UA 2V0DA 4BR3A 3LFEA 4M13A 4EOQA 2VTOA 1EAZA 2VTRA 4XRJA 3HECA 5I9WA 4APCA 3LXLA 4FKOA 3D2IA 2BR1A 4GVJA 5CS6A 2Y4IB 2IZTA 2O63A 2GFCA 5JQ5A 3PPKA 4G9RA 4KSQA 4YTCA 2V62A 4RIXB 4FKQA 2G01A 3M11A 4ZJIA 3FL5A 4TWNA 3M1SA 1JAMA 2P2HA 1J7IA 4V05A 3G51A 3LAUA 3ORNA 1UNGA 3VS5A 2GPHA 4TYJA 5CAVA 3FLWA 3AGMA 3WF9A 4S32A 4O27B 5DEWA 4AN9A 4BHZA 2R3FA 3ORZA 4Y72A 4HB0B 2AL6A 2C3JA 1YW2A 1NT2A 4YJSA 4DE4A 3EQGA 4FTAA 3PZDA 4EBVA 2QU5A 5AP3A 4PL5A 4W4WA 1M7NA 4NJ3A 4IJ9A 2GCDA 4BDBA 3ULIA 2FH9A 3OANA 5BNJA 5FM3A 3UGCA 2WGJA 4KS7A 2QOQA 2X39A 3WARA 4ZTSA 1Y6AA 2B9IA 4P5QA 4PDPA 5BUIA 3UMXA 2VU3A 4AZWA 4X2FA 4O7NA 4JL9A 3TKUA 4I3ZA 2YCQA 4EQCA 4NEUA 4UMQA 4WUNA 3IOPA 4JIKA 2HIWA 5FP6A 3T06A 2DFKA 2BZHB 3MH0A 2LOXA 5IA1A 2C6EA 2C6DA 4GK3A 3S95A 3NSUA 4IVAA 2UUEA 5DGZA 2YACA 2DHIA 1OB3A 5LWNA 5CQUA 1H28A 2OIDA 2C0TA 2O64A 3W33A 3PVGA 4GMXB 2JBPA 3RHKA 4DFZE 3UVRA 3OG7A 3IKAA 4PP9A 4YZNA 5K0XA 4LRMA 4R5YA 5E8VA 3HUBA 1XKEA 1V1KA 3TO1A 4Y95A 4YUQA 5LOPB 4X2NA 1Y5OA 3TV6A 4NM7A 4HGLA 5AR2A 2WQBA 2JLDA 5J8IA 4I5MA 1WBWA 3SV0A 4UMPA 2LKOA 1VR2A 3R1QA 4HB3B 4IAIA 3LCDA 1Q24A 2XIYA 4I41A 3WI6A 4D55A 4IEBA 4CMTA 5C03A 3PG7A 3V5JA 5FP5A 4WSYA 3VO3A 3SOAA 2DUVA 1JKKA 4S34A 5EOBA 1M52A 4D2SA 2HW7A 1IR3A 3OMVA 1J7LA 3RI1A 4DTAA 2Y4PA 4DA5A 5HQ0A 2FSMX 5J1VA 3ZUTA 2CSNA 2PZ5A 3DNEA 3NWWA 3ZO3A 3KRRA 4QMSA 4C3PA 5F9EA 4O86A 5I9ZA 3N4VA 3QLFA 1PW2A 2R3PA 1BKXA 3DB8A 3ZUUA 1FVRA 1GZ8A 4FV8A 5AIRA 5FQDC 4QMWA 2ZDTA 2QONA 1ZZ2A 3R0TA 2W7XA 3VW6A 5CY3A 1XH4A 5EOLA 4CCBA 2QOCA 3ANQA 5CSHA 2BMCA 4EUTA 1GY3A 1MQ4A 4C4EA 2P3GX 3FI4A 1FHXA 1KE7A 4BDCA 2LAVA 4DGLC 4DEIA 3QHRA 4L00A 4YHTA 2YA9A 4E3CA 3EFJA 4ANQA 3LPBA 4FV7A 2UW3A 3A61A 4G5PA 4GL9A 5CENA 4TWPA 3V04A 3VW8A 3CBLA 4UZDA 2HENA 5KX8A 5D12A 5C8KA 2YT1A 4AZVA 3I81A 3CGFA 4Z7GA 1IA8A 2CMWA 2WHBA 2YN8A 3FZRA 4EOPA 4FK3A 4CV9A 4GXBA 2GNJA 3BPRA 3R8VA 2C6IA 3JUHA 3O0GA 2OXDA 4IAZA 4OT5A 4BCKA 4HAUB 4F64A 5FTGA 2XIZA 4PMMA 3WIGA 3DJ5A 2XMYA 4GCJA 5EW9A 2CNVA 2HXQA 3R28A 3AGLA 4OTQA 4ENYA 2A0CX 3FV8A 1K5DB 4Y94A 4CG8A 4D4VA 2HXLA 2W1ZA 4PY1A 3QTIA 3TZ9A 4C7TA 4W8EA 2IW6A 4G6NA 4YJOA 4KHBB 5J3TA 2R3GA 4YTHA 4KIKB 3LKMA 4RVKA 3QUPA 4PMPA 4Y73A 5HU3A 3G2FA 2D9WA 4ZRJA 3KXMA 4O81A 1MIXA 1J0WA 2DKQA 2BRGA 2VWIA 4II5A 4KRCA 1X11A 4A6KA 3ATTA 5HZNA 5AUXA 1ZYDA 3DFCB 5ETFA 4ITJA 5CEOA 1WBPA 2X7OA 4ANSA 4GPTB 2BZKB 4G3EA 3NMUF 2K00A 5H2UA 4EYMA 3FEHA 1WBNA 3GYOA 2BAKA 3T3UA 2DYNA 3Q5ZA 1G5SA 3VS3A 4BTJA 3LZBA 1LW3A 1H27A 3HX4A 4UY9A 5I3OA 4XJ0A 3OXIA 1JPAA 4PTEA 4EC8A 5K9IA 5LMKA 3W2RA 2BKKA 3VUGA 3CPCA 2W1FA 3OUNB 3H9OA 4CYJA 1EVHA 3QXOA 2HK5A 4QYEA 4APPA 5CAQA 1GC6A 1KZ7A 3WZUA 4DEGA 4BCGA 4EHEA 3OWLA 4QP6A 4YC8A 4B6LA 4M12A 4EH9A 5M57A 3PY1A 5HE3A 4DEEA 3FDNA 2ZB0A 3EN6A 4MD7E 3HV3A 1URCA 2HY81 4OTFA 4DH3A 4GV1A 5KQ1A 3OBGA 3TL8A 1GIJA 4PTCA 4LFIA 3P7BA 2XUUA 4N6YA 3LFDA 2OWBA 2C3KA 4WNKA 3MH1A 1RDQE 4ZIMA 3OFMA 3LQ3A 1W8CA 1XHAA 3S4QA 1YOJA 4X2GA 3DDPA 3ZSGA 4DGMA 3RKBA 5IA4A 4JOAA 2BALA 2E9UA 3O23A 5EYDA 3UG2A 4Q9ZA 5A6NA 3WA0A 3IW5A 4TYZA 3MPXA 2UV2A 4JBOA 4ZSGA 5F95A 3COHA 4E5AX 4FKTA 2C30A 1WVWA 2WQEA 2XBAA 4IC7A 3CPBA 1UA2A 4KKGA 1RRPB 4KHAA 1H0WA 3LHJA 2IWIA 4FF8A 4FKPA 3QCSA 1XH5A 2R7BA 4RJ3A 4CKJA 1YI3A 4NW6A 4RWKA 2XKCA 2IYBA 2VNWA 4ASDA 2C5XA 1P5EA 3QCQA 4WA9A 3R7YA 4DEAA 4HATB 4FUXA 3NNWA 3SVVA 3KRJA 3U54A 2W5AA 2OLCA 3AC5A 5BUEA 2VTLA 4HVIA 5I3RA 2IG7A 3OD6X 4QQ5A 2UW6A 4AFEA 5A14A 3G9NA 3G6HA 4BVUA 4AUAA 3P4KA 3R6XA 4IWDA 2AC3A 3HKOA 2QOKA 5KE0A 1XX0A 3VVHA 4I93A 3Q4ZA 2PZIA 1IAHA 1P4FA 4ZTRA 4ORKA 3NVKI 4EZ7A 3DK7A 3LFAA 2WMXA 2UW0A 3PE1A 2WMVA 1CSNA 4C4FA 4QPSA 3NS9A 4BDEA 3RAIA 5C6RA 4MBIA 2XIKA 2VWYA 3LVPA 4FEQA 3H9RA 4J7BA 5L2QA 4FNXA 4RX9A 2W5HA 4F6UA 2YZAA 2WU6A 1S9IA 3Q9ZA 2HWPA 5FDPA 1EGXA 1R78A 1BWNA 2UZEA 4RX5A 4EYJA 5AUUA 3R7EA 2ZV7A 1FGKA 3D5VA 3NLBA 2X2MA 1YOMA 3QGWA 4QTBA 4ERKA 1IRSA 3PZEA 4DHFA 3BLHA 3SHEA 4W8DA 4EORA 1XH7A 4NYEA 2J59M 2CDZA 3LFCA 1KE5A 1EH4A 2UZSA 3CCNA 3PPZA 3LCOA 4G9CA 4LRJA 1FVVA 2D10A 2FSOX 3Q96A 1Y19B 3TVVA 5IQBA 1M2RA 2PMOX 2YM4A 3LM0A 4FZ6A 3EN5A 2DHKA 1NU2A 1OBDA 3M2WA 1ZLTA 2VTMA 2WMWA 3POZA 3R63A 1I09A 4IB1A 4KHOA 4RQVA 4U6RA 2QHNA 5K4JA 2X81A 3SG8A 1UWHA 3QTQA 2REIA 2VV9A 3QRJA 2ETMA 3MY5A 1ZC4B 2I0YA 3ITZA 2GJYA 1CDKA 2BRHA 3JYAA 2YCRA 3HRFA 3IPHA 3IS5A 3KF7A 3EKKA 2GHGA 4UMRA 2ZM3A 3BV2A 3ZXTA 1JKTA 4CLJA 4NCTC 4NU1A 3FM8C 1M17A 4AZEA 3R8ZA 2O2UA 3GQIA 3GFEA 4L52A 5DH3A 2Q13A 3NW5A 2UW8A 3NUXA 1VYZA 3O8TA 2QURA 4CKRA 4J52A 2YF0A 4DTBA 2X1NA 4F09A 4FKJA 4C36A 2CKPA 3UQGA 2VSZA 2B55A 2WMAA 1TQZA 3QA8A 3ZFYA 3MA6A 1PXIA 3RPYA 3HAVA 3WF8A 1WGUA 3RBWA 2BIKB 4B7TA 4TYEA 3EQHA 3AD6A 5DEYA 1Y91A 3OP5A 4P4CA 4I92A 4X6RA 4CFVA 4ID7A 4QP4A 4WT6A 4YJRA 2W0JA 5CANA 5DVRA 3ENMA 1FHWA 5JP4A 2A4LA 2VRXA 1AQ1A 3WZKA 2Q83A 4JRNA 3PXKA 1OPJA 2R3JA 1B55A 3R01A 5AFVA 4R1YA 2ZVAA 1IA9A 1FBNA 4YJVA 4I94A 3ZZWA 2GMXA 3I6UA 3CTQA 4MXYA 3TJCA 2BDJA 3KK9A 2GNFA 4H3BA 4U40A 1PKGA 3FPMA 5GJDA 3GC0A 2OQBA 1OUKA 5DE2A 1YWVA 4EH7A 3QCXA 1E9HA 4NUSA 4NH1A 5B0XA 3FQEA 3Q9XA 3SKCA 3VS7A 4GIHA 2BFYA 1U5DA 5L3AA 4AA4A 3WIKA 3ZXZA 3ZFMA 2B4SB 3ZM9A 2J0IA 4FIHA 4OTPA 5AAFA 5ANOA 5J9ZA 3TUCA 3GCUA 1L8TA 3MH3A 3HV6A 2BAJA 1Q8TA 2K2UA 2BKZA 5CSWA 1H1QA 1GZNA 1QL6A 5FEQA 1U5EA 4ZTNA 4M69B 4KB8A 1X8BA 2E9VA 2PWLA 4F08A 5I4NA 4FTNA 3TKHA 2XEYA 2DYLA 2Z7RA 5IA5A 4QMYA 4CTCA 5JLJB 3X23A 1T46A 2UVXA 2I7QA 1PXMA 1FINA 1OL5A 2YM3A 5LMAA 2H7EA 3PSDA 4QD6A 1YWNA 4UXLA 3OF0A 3NRMA 4AGCA 5CSVA 3ZLXA 4WSQA 4E5BA 3PUPA 3R9DA 2WTKB 3RPVA 2BZIB 3MPAA 4BCHA 4V0GA 4CV8A 2D9VA 2GTNA 2HWOA 4XS2A 4I24A 3R8MA 1JKSA 3AT2A 4QP3A 2EJ8A 3FMJA 2VX0A 3JS2A 3ORPA 1PRYA 5L2WA 4IHPA 4A7CA 5CX9A 3C4EA 2JDOA 4IVBA 4EK8A 2GS0A 2GCJA 3MYGA 1QPJA 3N4TA 1JBPE 3KMWA 5C8NA 1YXTA 4KIQA 4HHVA 3SDJA 3L8VA 4P7EA 3CP9A 3BE2A 3VS4A 5KMMA 2PULA 1PYXA 4A6FA 4RWIA 3KULA 2XS0A 3FLNC 1OKYA 1ERKA 4AZTA 3KKVA 2PYWA 4KBAA 3FXZA 4NW5A 4YJPA 1U5QA 1PMEA 1WBTA 3D83A 3QUEA 4L44A 4YHJA 3ZEPA 3E64A 4FSUA 3UO5A 5EHYA 5CF6A 3P9JA 5EKNA 2GNGA 4O38A 5AR7A 4U5JA 3FY0A 4CFMA 3OOMA 4JAIA 4YC3A 5CNNA 2ITWA 3ZUVA 5HVJA 3W2SA 5CF5A 1JQHA 2OW3A 3TIYA 1MRYA 4GIIA 3QZFA 3F0WA 4E7WA 2I6LA 4K77A 3O51A 2WEVA 2ZB1A 3KRXA 3OT8A 4FZFB 4KIOA 5CVFA 2VNYA 4BDIA 4BFMA 5IZFA 3UZTA 1X1FA 5C5BA 2ACXA 3UYSA 4PDSA 4L46A 2OF4A 4O7ZA 2HYYA 4GH2A 4WOVA 4BTKA 4YJUA 4JS8A 3VRYA 3FI3A 1MRUA 4CHJA 5CASA 3AOXA 5DG5A 5CT0A 2PL0A 2PMLX 4E20A 2N0YA 3HEGA 4QMPA 3LMGA 3OXZA 3TT0A 3Q6UA 5EYMA 2DX1A 2VO0A 5E8TA 2R5TA 5DR2A 4BBKA 4QTCA 5LOHA 3OWPA 4ARKA 4FV0A 2ADZA 5EFQA 3IOKA 4AGUA 2E9PA 4K9YA 3H10A 3A60A 3PY0A 4F9AA 5DMZA 3PWYA 1H08A 1FOTA 4BRXA 4AW5A 4DXAB 2Z0PA 3NGAA 4E6CA 1K2PA 2J7TA 2QR8A 2VWUA 3TNHA 3CIKA 3LIJA 3Q9WA 5I5ZA 3DQWA 1JOWB 4Y46A 3GENA 3C13A 4D9TA 3KXXA 1TXDA 1UU9A 3QD3A 4EI4A 2XJ1A 2YM8A 4KS8A 4D5HA 5C9CA 4Y5QA 5G1XA 3MGYA 3BZ3A 3R73A 4Z2MB 5D27A 4BBMA 3GC7A 2E2BA 1FHOA 3VOQA 2OH4A 2OBJA 2J51A 3R1YA 3PYYA 4BYIA 5L81A 4NIFB 2I5FA 5FTOA 2QOIA 1W0XC 4MNFA 3IW7A 3OW3A 3M1IB 4B8LA 4FG8A 2J4ZA 3UVPA 3VN9A 3RM7A 3R71A 4GK2A 3V6SA 2A1AB 3IECA 3PJCA 4IZ7A 1CKPA 3MW1A 4GYGA 2WNTA 3ZYAA 4OBPA 3R2YA 4HYUA 3ROCA 4DBNA 1MPHA 2YRYA 4HGEA 5H8BA 4E1ZA 4UXQA 2JP2A 1IASA 4GZUA 2BDFA 4YJQA 3V8TA 3SLSA 4DG2E 5A6OA 3AU4A 2D4QA 3PVLA 3FI2A 3PP0A 4D2VA 2B9JA 3FLZA 5KCVA 1WMKA 2YIYA 3TWJA 3P7AA 2B7AA 1YDTE 3BGQA 4DG3E 5LWMA 3OWJA 3U6IA 3KSYA 1AWEA 3CQEA 3JVSA 3DS6A 2GHMA 3ATSA 4ANMA 2UVYA 2E9NA 5EI2A 4TT7A 4USEA 1XODA 1ZOEA 5L6OA 1DAWA 3C50A 2KUPA 2R3OA 4AACA 5JGDA 5AV4A 3QALE 3EJ1A 2VN9A 3OC1A 4D2WA 2UZVA 3KXNA 4TYHB 1P6SA 4FEWA 5C8MA 4DT9A 5J3YA 3AC2A 2R3KA 1RQQA 4PQNA 2WTIA 5DHFB 4GG7A 5JQ8A 4YPDA 3MV5A 4FL2A 5HNGA 1I2HA 4H36A 1Q4LA 4XP0A 5EQEA 4F63A 2QKMA 2WMBA 2EWAA 3DAEA 1Y8YA 1CKJA 3LXPA 4ZRIA 1H10A 2OKRA 5E1EA 2PZYA 2ZV8A 3AMAA 3ORLA 2XK9A 2WQNA 4LG4A 3V6RA 4BIEA 2C5NA 3PXFA 2UVMA 4MWHA 3QRIA 3RNYA 2V5QA 4E6AA 1OUYA 2V55A 5IMEA 2GU8A 3UOKA 3TTIA 3ID6C 3ZSIA 1ZMUA 1O6KA 3HNGA 2VUWA 4FE2A 1UV5A 3AD5A 4FSNA 2C3LA 3KGAA 4YLLA 1L3RE 5JFVA 1Q62A 4C37A 2XEZA 2PMNX 3BEAA 3DBDA 3HYHA 3MIYA 3NUYA 4FZAB 2RSGA 2VTQA 1E1VA 1CM8A 4UV0A 5IEXA 3IQ7A 2IVTA 3LQ5A 5D3WA 4TKSA 4CFXA 1ISNA 1KI1B 4FGBA 3VS6A 2XYUA 1WI1A 4G6OA 5KBRA 3EN9A 5CEPA 2Q0BA 1OIRA 4YSJA 4K18A 4O0SA 1H07A 3GVUA 2UZDA 4TKNA 5L8LA 4GU9A 4PPCA 4ZMFA 4ITIA 3R9NA 4XH6A 4EOMA 2ERKA 3FUPA 4GJ2A 4M69A 3UIUA 3DKOA 3U7DA 4IZYA 1GNGA 3E5AA 5DBXA 4QP2A 3C0GA 2AUHA 5AUYA 2CY4A 4R3RA 1WVXA 3RPOA 3F2NA 3NR9A 4FTLA 2RIOA 3EQIA 4IQ6A 4CYIA 3KQ7A 2C6KA 3TUBA 2ZYBA 4KKHA 5D41A 4IX6A 3VS1A 3AT4A 5EH0A 5DT3A 2KULA 4RT7A 5FBNC 2XNGA 3FC2A 3D5WA 3QRKA 1W82A 3S1HA 3HRCA 2WMUA 4DLJA 4YBJA 3QWJA 5IUHA 2GS2A 1TKIA 4FTUA 1DDVA 5EG3A 3MY1A 1MKEA 4AGDA 4YNOA 4HNFA 2KCJA 2PVJA 3BQRA 5K3YA 3ZOSA 2G15A 4L6QA 2W1EA 3QHWA 1JVPP 4F0IA 5JMSA 4RA5A 3LJ0A 4EK3A 1RJBA 2V7OA 2XK8A 3MY0A 3BBWA 2HOGA 4CLIA 4FTQA 3CY2A 4AFJA 3KRLA 4AQCA 3LFBA 2IO6A 4D1XA 1NY3A 1J91A 3JY9A 3W2PA 5DRBA 2ITVA 4NIFA 4QPAA 5BVOA 3ALNA 4FIGA 4D2TA 3LCSA 3CJFA 2P33A 4U42A 3VUIA 3WYXA 3ZBXA 4XCUA 2EMTA 4IJPA 3UIXA 2PUNA 4I6QA 2VD5A 2PVFA 3AD4A 4MHAA 3TDVA 5E91A 1JNKA 4IZAA 4D2PA 4DGNA 4FTCA 2WTJA 5D7VA 5CEKA 4ZTHA 2QLQA 3U8ZA 3MVMA 3QTZA 3NZ0A 5IUIA 4U7ZA 4YBKA 3ORKA 1MRVA 4FKWA 4Z16A 2YS3A 3AT3A 3KCFA 5IKWA 5EYCA 3PG3A 1FB8A 5A4EA 3ML4A 4HDOA 4K1BA 5IEYA 3G90X 3SNHA 3LMHA 4O7RA 1XH9A 5J9YA 4OUCA 3OT3A 3CE3A 4QP1A 5CTPA 2NMBA 4YP8A 4CGAA 3Q4UA 4RC3A 5DA3A 3V51A 3ZU7A 1QCFA 3GQLA 3R21A 3OTVA 4JDJA 5ANKA 2RGNB 4QT1A 2YABA 4AU8A 1STCE 3WF5A 3WYYA 1AD5A 3F7WA 3L9NA 4IE9A 4O22A 2C69A 4QYFA 3H3CA 2XCHA 4AZFA 2MKRA 3WE4A 4IMYA 1H1SA 1OPLA 1UU8A 4AW2A 4EOJA 5CAPA 2ZPYA 4HZRA 4ACDA 4B6HA 1OBGA 3I6WA 4MBLA 5HEZA 4D4YA 5JFXA 3IGOA 3RCJA 4HVHA 3QWMA 1KOBA 5KMJA 1E5WA 2OXXA 2AYPA 3EFLA 4W4XA 4MH7A 2JKOA 5HD7A 5EW3A 4FTTA 4AF3A 5BVWA 2BIYA 1P3RA 3GU4A 1YDSE 3EHAA 2FB8A 4GFOA 5DN3A 2Z7QA 2ITYA 4Y5HA 1XWSA 2QG5A 3BYOA 4HGSA 3ZDIA 5CXHA 3WZEA 1UU7A 1MQBA 3BHYA 5AX9A 3U9NA 5CAUA 1YWRA 2CHLA 4GT4A 4HAVB 2CLXA 2Y0AA 4RSSA 2YS5A 3GB2A 3SW7A 4UWBA 2I1MA 2RUKB 2A2AA 1Q3DA 2YLEA 4IM3A 3D8EA 2RKUA 2P0DA 5GIOE 1B38A 1PXOA 3DXEA 3ALOA 5EW8A 4CQEA 2CY5A 4GKIA 1OKWA 3ANRA 2R2PA 3FSSA 3PA5A 3QZHA 4IDVA 4BDGA 5KHWA 5C5BB 2COAA 2F9GA 4KBCA 3VNTA 3GU7A 3MFSA 5AJQA 3MDBC 5DT4A 4K17A 4G3DA 3R8UA 5AA9A 5TT7A 3VBYA 4G31A 4EH8A 5EQPA 3FQHA 3LJ1A 5CALA 3TIZA 4I4FA 4JG7A 3AMYA 5KMLA 3T3VA 3K3JA 1FMKA 4TTHB 4ZS0A 3LMIA 2W17A 1BI8A 3CJGA 4FV4A 4CFFA 5IMXA 2GCLA 2HAKA 3VUMA 3QBVB 4LMUA 2H6DA 5BQ0A 4DFUA 4J96A 1XH6A 2Y8GA 1OI9A 2JIVA 3TJDA 1YI4A 4O7WA 5K0KA 3BI6A 3VULA 5JSMA 3ODOA 3OVVA 5CVGA 4BI0A 5IH4A 4YONA 4IB5A 2FJLA 4H58A 3BGZA 2HZNA 3P1AA 3OCTA 3OY3A 5J5TA 3LXKA 3ENHA 5ACBC 3A7GA 3MA3A 4RIXA 5HNBA 3UMWA 4A6HA 4XP2A 5HLPA 3C1XA 3VS2A 1V5PA 2YEXA 2UZUE 1JSUA 3LLTA 4BIBA 4EMOA 2ERZE 4CXAA 3UJGA 4F7SA 3U6JA 4MAOA 5BVEA 5KZIA 3UO6A 2ITTA 1TQIA 3HA6A 4ITHA 4QMXA 2ITZA 4MX9A 4O1PA 1FGYA 4Z3VA 2HE7A 3H0YA 3R7VA 1YHWA 1H1WA 3REPA 2WFYA 3F5UA 2QQ7A 3VJOA 4RVMA 3EN7A 4WNOA 5JEBA 2KGXB 1M14A 1OIYA 2CPKE 3ZC5A 2QNJA 5FI1A 2PMIA 4U3ZA 2GQSA 4NSTA 3AC1A 4NFMA 5FM2A 4J97A 4I5PA 3RP9A 3A98B 4FEXA 3HV7A 3Q2MA 1OM1A 3QUDA 1G8AA 4YZ9A 5EM7A 1BX6A 3WZDA 2PVMA 4FEVA 4EKLA 3EMGA 4ZSLA 3GYPA 4AE9A 4QQTA 3BYVA 4ASEA 4AN2A 4RX7A 5JH6A 4MQ2A 2ITXA 4L7FA 2WMSA 1M2QA 1PYEA 2E9OA 3HLLA 2YIWA 4TY1A 2J50A 3NSZA 4XG9A 5H3QA 4ZMEA 4G17A 2JGZA 1URWA 3QD4A 3QQJA 4L3PA 4CT1A 5IQIA 3EOCA 3NYOA 2OK1A 3ACJA 4QQCA 3A2CA 2XRWA 3HRBA 3EYGA 4FC0A 3BHUA 4IXPA 4CKIA 3S0OA 4ANLA 1LUFA 4KNBA 4BBFA 2XNBA 1JSVA 5BYLA 3LFNA 5HTCA 5F4NA 3TEIA 4KIKA 3RALA 2OO8X 3BHVA 5C16A 4QMNA 4YO4A 3CKXA 5AUTA 4XG4A 2GSFA 1ZC3B 2CKQA 2CKEA 3NNVA 5IA2A 4JBQA 2J90A 5E8XA 5EHOA 3COMA 2R7IA 3HDNA 3P23A 4ALUA 4BGHA 3GI3A 5BYZA 3PTGA 4EEVA 3LLAA 3LE6A 2C6MA 1U27A 1ZYLA 1HCKA 2QOHA 3C4ZA 3IG7A 4XHKB 5B2LA 4GUBA 1R0PA 2F2UA 4FYNA 1H4LA 4RLKA 4X21A 3FI8A 1OQNA 1OIUA 4GT3A 2W4JA 4FV1A 3DKGA 3QD2B 3FXXA 5CWZA 4FKSA 1REJA 2ONLA 2R3NA 3SYXA 4F65A 2ITNA 1UWJA 4L42A 2X8DA 3O7LB 4KRDA 4E5WA 1X1GA 2QR7A 4DFNA 1GG3A 3TW1A 4CYEA 4RIYB 1PXKA 1O6LA 3QX4A 5ANIA 4D0XA 1NTYA 3IVFA 4O7SA 5KMIA 5E4HA 4N6ZA 1WBSA 3ZZEA 4C33A 3F3VA 2V22A 3WE8A 4F9CA 3DZOA 3KL8A 3R7UA 2IPXA 4MNEA 4HW7A 2YHVA 3IGGA 2R3IA 5CU6A 3LQ8A 4QMMA 2QD9A 3LOKA 3R2BA 4AT3A 3FMMA 4BL1A 3GP0A 4IX4A 4LV5A 3CC6A 1U2BA 5IQFA 2UZWE 3D5UA 2VX3A 3DLSA 4M66A 4L53A 3L9MA 2O8YA 4LQMA 3V3VA 3TG1A 4XG2A 2WQOA 1IRKA 3D15A 2OU7A 3I4BA 5CXZA 4CRSA 4MY6A 5A4TA 4I6BA 3W10A 4XRLA 1UEFA 4AZSA 4BB4A 4UMTA 4MKCA 4CEGA 3P7ZA 3VIAA 4J8NA 3DBFA 3OCGA 4NL0A 3GUBA 3IW8A 1PXPA 3EYHA 1NTVA 4NFNA 4QMZA 1DS5A 1HCLA 4F7HA 2K2JA 4JJRA 2ITQA 2WMTA 4FSWA 2XYNA 4A9YA 4FIIA 2C6TA 4ZZMA 4WBBB 2G2IA 3SV1A 2D11A 4IAPA 5CSXA 2X4ZA 4YGAA 4OTGA 4ZSJA 4EL9A 3DXQA 2ZAZA 2WKMA 1H26A 1ZMWA 5CU2A 4BF2A 4HVGA 2BVAA 4JRVA 5DR6A 3UOJA 1V5MA 1XH8A 3BQCA 5ANEA 2GNLA 4TWCA 4LL5A 1XR0B 2XNNA 5HCYA 4F70A 3KY9A 1DDMA 3D7TA 4OAVB 3GT8A 4WO5A 5B7VA 3V8SA 3W55A 3QQLA 4A4OA 3EL8A 5A46A 1IAJA 3TFMA 3D5XA 3R1SA 4OTWA 3ZTXA 2FGIA 2OFUA 3EQCA 3TV4A 4CFWA 4W4YA 3OHTA 3I60A 1XO2B 3CY3A 2JD5A 5M55A 2OGVA 2DTCA 2VTHA 2P0HA 1UNLA 2IZRA 3NUUA 3QQHA 1T45A 2NRYA 3PFQA 3NAYA 2RFDA 3FYKX 5CLLB 3W2QA 2ITOA 4LM5A 4RFYA 3V5LA 5I9XA 5IA0A 4UALA 3PPJA 1Q8UA 5IF1A 1W7HA 4QQJA 1J19A 1GJOA 3QQUA 3NX8A 4P90A 4BCIA 1H4RA 1XQZA 3PLSA 4EZ3A 4MD9E 3JY0A 4FL3A 2ZV2A 2X6EA 3P79A 3Q04A 4HPTE 3VHKA 5HD4A 1QQGA 3MI9A 1ZM0A 4GYIA 3PEGA 2BRBA 2IW9A 4UX9A 2JEDA 4J99A 5C27A 5BVNA 2YJSA 4DH5A 4PRJA 3F5XA 5AMNA 5GHVA 4M3QA 4RJ4A 4DFLA 4ZY6A 4YURA 2XM9A 4AOIA 1SVHA 5FUTA 4FODA 2CCIA 5ANJA 5LMKC 3SRVB 2H9VA 4AN3A 1H0VA 2GHLA 1TVOA 2CAYA 3KVXA 3G9WA 2I0EA 2VWVA 4I6HA 5EM8A 5AWMA 3NUPA 3HL7A 1PF8A 5EM6A 3E8CA 4JIAA 3Q52A 4JDHA 2WTKC 3PE2A 5LJJA 3ZMMA 3PSCA 4FZDB 5CNOA 1QPEA 2BTRA 3D14A 2R3RA 3K5UA 4LOOA 4RC2A 3SRVA 3A99A 1QC6A 4XWXA 5M07A 3L9PA 2XZSA 5KBQA 4J1RA 4TPTA 1P14A 1SVGA 2H8HA 4RWJA 2G2HA 2W06A 5KMOA 4EWHA 2O65A 2QOOA 3UG1A 2UW5A 1KV2A 2C0OA 4WJ7A 3Q2JA 3QTUA 3U6HA 4IFGA 3FLQA 5T68A 5M06A 2X9EA 1SNXA 4OT6A 3RM6A 4C38A 3VUDA 3HQCA 3W32A 2ZM1A 1ZAOA 4KIPA 3B8QA 3ZRLA 5BYYA 2EMSA 4A9RA 2Y9QA 4BIDA 3KXZA 2Y8FA 1LB1A 4AGWA 4HAYB 3T9TA 3SOCA 2ITPA 1Y57A 4Y83A 2PY3A 4ANOA 3GU6A 2FSTX 2C5VA 4C0TA 3R02A 4EBWA 1H1RA 4ZSAA 1DROA 2I40A 4JG6A 3UTOA 4H05A 5DWRA 1UNPA 3D2KA 1PMNA 1PJKA 3HAMA 4YJNA 3ZCLA 3NAXA 5TE0A 2BILB 4O83A 2B9HA 3KFAA 1LP4A 3BRBA 2J0LA 5JHGA 1PXLA 3BV3A 4KAXB 4YLKA 1Q41A 4QOXA 5HX6A 3CTJA 3OEZA 4N0SA 1FGIA 4HYIA 3DAJA 4OGRA 5TOZA 3OTUA 3A8XA 3A7HA 3C4WA 1YI6A 3KK8A 1SM2A 2WTVA 3KULB 2W1IA 5DLSA 1V0BA 2QO9A 2UW7A 2VX1A 3PVWA 4BDHA 3DKFA 2W05A 3HMIA 3PIXA 3R8LA 5CF4A 3FYJX 4PX6A 5D3XA 3PXZA 4DBXA 5IQHA 3Q6WA 5EFXA 4BKJA 2XM8A 4FTMA 4LOQA 1DM2A 4XLIA 3WF7A 3N7CA 4JG8A 2PE2A 2IFSA 2JKKA 4BN1A 5C1QB 2WTWA 4FIEA 4XEYA 2PVYA 4GEOA 2Y6OA 5KMKA 4IOYX 2BZJA 3ZDTA 4RIOA 1DDWA 1ZZLA 4L67A 4XV3A 4B0GA 4F7NA 3ULCA 2GNIA 5ETAA 2W2WA 2ZV9A 4EOSA 3F2RA 2VWXA 3FC1X 4JBPA 3EQBA 4FT9A 4FVRA 2YJRA 4XYFA 4MF1A 1WJMA 5HOAA 3FLSA 1M7QA 2VO6A 3OY1A 4RIWB 5HX8A 1NI2A 1YXVA 4FBXA 1W1HA 4AA0A 3V01A 3QZGA 1OGUA 3RTPA 4CTBA 1ZOGA 2PUUA 2F49A 3NYNA 2OJGA 4FV2A 4LYNA 4RZVA 2BTSA 5I9VA 1MAIA 4QTEA 3DCVA 2PUPA 4K11A 2WPAA 2JDRA 3UP7A 2J5EA 2LG1A 4U41A 5AUWA 4RFMA 4DH8A 3QLGA 2QOBA 5DYJA 1H24A 4TXCA 5HIEA 1GC7A 4RX8A 4UWYA 5E92A 2HCKA 5JFWA 5K5XA 5C01A 4C2VA 3DB6A 2EXMA 3R8PA 4KSPA 3NYXA 1ZXEA 3C0IA 1Z9XA 4RA4A 4A06A 2LOZA 2WO6A 4P2KA 3MSSA 2XQNM 2XH5A 3SA0A 5ETIA 4DN5A 4ACCA 3NCZA 2E2XA 3FZOA 1Y6BA 4UYNA 2CNUA 3JPVA 4I5CA 4PP7A 1WVHA 2JKMA 3DAKA 4IANA 3VC4A 2X8IA 3ZM4A 4C34A 5IH5A 4M7IA 3A8QA 3FAAA 2H34A 4WG3A 5IDNA 2WTCA 3ULZA 4BWXA 4NCTA 4C58A 2J9MA 3LXNA 3CXWA 2P4IA 2WIPA 3P08A 4OTRA 2B0QA 3A62A 4IM2A 3DT1A 4S31A 3MTFA 4JT3A 2VWWA 5AUVA 3HMOA 4X3FC 2R0IA 4CFNA 2RF9A 1BTKA 4EKKA 3D7TB 1YXUA 1SVEA 2WAJA 4EHZA 3SQQA 4QMOA 2VTNA 4IBMA 2DN6A 4TYGA 2Z0OA 3DQXA 5BVDA 1FOEA 4M15A 4Z9LA 4FI1A 4EH3A 5F1ZA 3T8OA 5AA8A 5CU0A 3NUSA 1K5GB 2ELBA 4RIWA 3M42A 5FBOA 3G6GA 5HO8A
chains in the Genus database with same CATH superfamily
2C6LA 1J1BA 2OJ9A 4IX3A 4HDQA 4FICA 4FT7A 4UZHA 5J9LA 2FO0A 5JZJA 3QTXA 1U5RA 4DEHA 4QMLA 4RJ8A 4F99A 1FMOE 2XNMA 4O7LA 4I0RA 4QP9A 3BBTB 2A98A 5DIAA 5LVLA 4DCEA 1KOAA 3MPTA 3NPCA 3DPKA 3VIDA 2XK6A 1AGWA 3LCKA 4ASXA 4LL0A 3KCKA 2COFA 3EB0A 4X3FB 2XNOA 2W1DA 3IW4A 1PXNA 4QDEA 3QL8A 1YXSA 3QFVA 5CEMA 5AUZA 4EQUA 4BTFA 4PQ0A 5FWKK 5IISA 1V88A 1YHVA 1PMVA 2X7GA 4OLIA 4V01A 5AP1A 3ZRKA 4BWKA 3NUAA 3OZ6A 2OF2A 3UC3A 3KY2A 3SGCA 4ACMA 1FPUA 3KF4A 3V8WA 2UVZA 2X8EA 5M4CA 4C57A 4OW8A 5CI6A 4EWQA 4C4HA 5DI9B 5H8EA 1X86A 4K81A 2RLOA 4C4IA 3L8XA 2CLQA 1R39A 2BAQA 2VGOA 1OY2A 2RNRB 5BV3A 4XG6A 3Q4TA 1UKHA 4L7SA 1Z5MA 1Q8WA 3O71A 2X2LA 5CZHA 4YO6A 3W16A 4BDAA 1Q99A 4WNPA 4AOJA 3FLYA 3N9XA 2QO2A 5BPYA 4XNEA 3DXDA 3RZFA 4RJ6A 2XA4A 4ZEGA 3H30A 5IQAA 3COKA 2Z60A 3PLAE 2C5YA 1YDRE 3QQKA 4G3CA 1WFCA 3KC3A 3HDMA 3ELJA 4FNZA 4HPUE 4BI1A 3NEWA 5HKMA 4O4CA 2YM5A 4BTMA 4EHVA 2I1JA 3QXPA 3UDZA 1W84A 4TNDA 3F3ZA 4FV5A 5LARA 1NA7A 4YJTA 2FA2A 1NVRA 3OS3A 4HCVA 4D2RA 4TL0A 5LVPA 2Y6MA 4TW9A 3DTWA 3QKMA 2GUMA 1PHKA 3NCGA 3P78A 4GMYA 3SXFA 1TJ6A 2R2YA 3SO6A 5GINE 3F3TA 2JIUA 2Y7JA 4GVAA 3KZ1A 3D9VA 2OH0E 3I5NA 4O7TA 4Q5EA 3CTHA 1P5TA 3TDWA 2P0FA 5C4KA 2HY0A 2AC5A 1SNUA 2IJMA 2J0KA 4ZS4A 5JRSA 3SXRA 4NT4A 1WBOA 4M0ZA 5AV0A 4XG8A 5LMBA 1KWPA 4FOCA 3QKLA 4WRGA 2RFEA 3PXQA 4PDYA 4F0GA 4GJ3A 4ALWA 1DBHA 4OTDA 5AM6A 2WTDA 3HMNA 3PXYA 4FV9A 2WMQA 5CQWA 4F4PA 3VF9A 2W99B 4HCTA 2CRFA 4FG9A 2W9FB 2N23A 3R30A 3MTLA 4ONAA 4PPAA 4EH6A 1EF1A 2VO7A 3RMFA 4E73A 5GOWB 5E9EA 3PP2A 4KD1A 4KUJA 3POOA 5EM5A 3RPRA 4DFXE 4C61A 4CVAA 4FG7A 4OBQA 3I0OA 4X3JA 4B4LA 4DH7A 5CVHA 1U5FA 1WJ1A 3A7IA 4NY0A 1WAKA 1NW1A 3R9RA 2XP2A 4XUFA 5ETCA 4IH8A 4G34A 3SC1A 4GN1A 5JHHA 4YL8A 3DNDA 3SG9A 2BPMA 3ORIA 5EDQA 2CN5A 2G1TA 2VO3A 3FZTA 4JI9A 3DLZA 3U87A 3BE9A 2WU7A 2WEIA 2D9ZA 2PVNA 4I4EA 1SHCA 4JNWA 3OOGA 2CJMA 2NPQA 3QKKA 4CZYB 4R3PA 1U54A 4HOKA 3EZRA 2BROA 4WG5A 2PK9A 4G16A 2R0UA 5CEIA 3JR1A 4MD8E 1BL6A 4H1JA 4BBEA 1GZKA 2ZM4A 4FZ7A 4H39A 2YZLA 4R5SA 2Q0NA 3ORTA 3VBVA 3T9IA 4FX3A 4QMTA 4A07A 4PTGA 3E3PA 3HMPA 4EOIA 4FL1A 2X0QA 4DH1A 2QVSE 2BRNA 4NM3A 3CGOA 3ZEWA 3FJQE 3P5KA 5EYKA 3ROYA 5IG1A 4BYJA 3R9HA 5FXSA 5M51A 2XKEA 5EDRA 3FWQA 4C3FA 5I0BA 4FTJA 2LYDA 1OGYA 3TUDA 3QX2A 3P7CA 3MFUA 2VTSA 3RINA 4BZDA 1FVTA 1MP8A 3IK3A 4M14A 4GK4A 1XBCA 4RJ5A 3L8PA 4WSFA 3JXWA 4I6FA 1MI1A 3AU5A 5M4YB 1TQPA 4L3JA 2XF0A 5GZ9A 3V5TA 4HVSA 4FJVA 2WOTA 3CQUA 1B6CB 4U79A 4MF0A 4EH5A 2PHKA 2EB3A 3ZSHA 2F57A 3AKKA 2W1CA 4DGOA 3VONA 4XV1A 3VRZA 5D3VA 2OIBA 4A5KA 4E4MA 1NVSA 2BRMA 4L9IA 4XV2A 5HE0A 3GOKA 4C2WA 2RGPA 3ZFXA 4EZ5A 5BUJA 5M4FA 2OZAB 4ZRIA 4IDTA 5E8WA 4DG0E 3I5ZA 1KUTA 4JQEA 2PE1A 3ET7A 4O91A 4R3CA 5HVYA 5AEPA 1KSWA 5LONB 1I44A 2Y4IC 4J98A 4K6ZA 1WCCA 2VTIA 4QNAA 2OTXA 4LDTA 1Z57A 2EVAA 2RL5A 4I22A 4NM5A 4AW1A 3BELA 1APME 5K5NA 1KV1A 5IQDA 4FNYA 3F66A 3FHIA 1F3MC 4P5ZA 3DY7A 1LR4A 3ODZX 4NWMA 2VWZA 3HV5A 4WG4A 4C35A 4E26A 2VKIA 3CKWA 4BWPA 4E6QA 3NNUA 4DEDA 5B2KA 3PVUA 4DTKA 2QKWB 1OECA 1UNRA 3PZHA 4PF4A 5AM7A 2XIXA 4DX90 5IQEA 2FVDA 4ZXTA 4FKVA 3TNWA 2PE0A 2CN8A 2F7ZE 4FVPA 2IW8A 4EC9A 1W1GA 3MIAA 5C4LA 3MFTA 1ZVRA 4AP7A 4G3FA 2H7DA 4DFYA 4TZRA 4IWPA 1J1CA 3DGKA 4FKGA 5HGIA 3UBDA 3MVHA 1YHSA 3HGKA 5M4UA 4JBVA 3H4JA 4WHZA 2W9ZB 3UZRA 1B39A 1UNQA 2PSQA 4BCPA 2XK7A 2YWPA 3B2TA 4M97A 5D7AA 5E90A 4C62A 4ZY5A 4HB4B 2NNWB 2X6DA 2LULA 3TACA 2IVSA 4OR5A 3LFSA 4MQ1A 4PL4A 3UC4A 3G15A 5M4IA 2VGPA 1A06A 2V76A 4YSMA 4CMOA 2GS6A 3COIA 1G8JA 1ATPE 4Y85A 2B53A 1UNHA 3AMBA 3GBZA 4W9WA 3V5QA 2WQMA 5AP6A 3GCVA 2OJJA 4CRLA 3C5IA 4KWPA 2HZ4A 4LGDA 4RGJA 2OZAA 4GFMA 4U43A 5HI2A 4AE6A 1OL6A 2GNHA 4I0SA 5EHLA 3QF9A 3LM5A 5J87A 4X0MA 3RNIA 3BHTA 3GCPA 3KN6A 3UZPA 2YVCA 3PFYA 1BI7A 1VZOA 3A7FA 5IPJA 4FSMA 4G1WA 4RC4A 1ZYCA 2QO7A 4NJDA 3GCSA 3P86A 5H9BA 4YMJA 1PMSA 2YS1A 2UZNA 3MVLA 4LUDA 2I0VA 3FXWA 3MB6A 3Q5IA 4NZWB 5E7RA 4ZZOA 3GC9A 1JWHA 2VTTA 4QTAA 4WD5A 2PVHA 5TKDA 5DHAB 4C59A 4B9DA 2XJ0A 3VUTA 2DQ7X 4LOPA 4KABA 5DT0A 2KTYA 3FSKA 5DOSA 3ETAA 4ZLOA 3WYFB 4XMOA 4OTIA 4TYIA 4IAFA 2VTPA 4XG3A 4ZSEA 3C0HA 3ZLWA 4O0TA 3O5AA 2ONLC 4JQ7A 1YOLA 4RQKA 5GJFA 3VBTA 3ZLSA 2D9XA 3O17A 5AP5A 3C9WA 4CZUA 3V5PA 4AA5A 4QMVA 3FZSA 3PY3A 2C3IB 5L8KA 5L4QA 3UYTA 1PMUA 2HTHB 4ZJJA 3TCAA 3I7BA 2R9SA 3EQDA 2XRUA 4EK6A 1V61A 2ZOQA 3ULBA 2I5CA 4EJNA 5EDPA 3QQGA 4KKEA 5C79A 4ACGA 2XKFA 4LI5A 4ANBA 4GT5A 3GXLA 3FZ1A 2IN6A 2OJIA 4E6DA 2X0OA 5CZIA 3KXGA 3KREA 1YVJA 5L6PA 3FZPA 4XX9A 3D4QA 3DA6A 2CGXA 4I1ZA 2QG7A 1XD4A 4HAWB 2J6MA 2O0UA 2WD1A 2ZMDA 4KVGB 1M2PA 4BCJA 4FUYA 4Y8DA 5HESA 3SXSA 3ZDUA 5M08A 2G9XA 4D0WA 1E1XA 3E7VA 4CNHA 3C5UA 3FMHA 4U81A 3VS0A 1XCGA 2ZKMX 2YT2A 4U44A 5AADA 4FT0A 3RVGA 2D9YA 3PG1A 2ROVA 2NRUA 4L6EA 3BLQA 2NZ8B 5CU4A 4FGRA 4K2PA 1GOLA 4GG5A 3EQFA 3BHHA 3VBXA 4F1MA 4GU6A 2PZ1A 1H01A 3AC8A 2X4FA 3R04A 4I20A 3NW7A 2OZOA 4MEDA 2C4GA 4CQGA 5HG8A 3W1FA 1RJ2A 2RG5A 4L01A 4FNWA 5M44A 1G8SA 4KAOA 3ZRMA 5KNJA 1WBVA 4A9SA 3MN3A 4NKAA 2YISA 3QBNA 3AJ4A 4ZRKA 3AKLA 3W2OA 2VZ6A 1BAKA 5CI7A 5A4QA 1RE8A 4IADA 3HZTA 3QTWA 2MDXA 5JN2A 3MJ2A 3BYMA 2PVLA 2OG8A 3OXTA 4AW0A 3ODXA 3GCQA 1DAYA 3PDTA 2B9FA 2SRCA 4MXCA 5KKRC 4O7YA 4O96A 3UQCA 3UPZA 5IQGA 4D5KA 5A9UA 4KA3A 3BIZA 3BU6A 3FKOA 4IVDA 4V04A 5C26A 4TNBA 3GC8A 2XNPA 4BGQA 2KR0A 4RG0A 4NM0A 4PPBA 3F2AA 4O0WA 5JRQA 3F61A 2R3LA 2WB8A 5DH9B 1U46A 2VWBA 2JAVA 3TI1A 1BL7A 2P0CA 2NO3A 4GUEA 3IDBA 3HUCA 4QTDA 4F6SA 3BGPA 3FHRA 4FSQA 4MXXA 4YZDA 3U55A 3Q53A 1KE9A 1W2DA 2C47A 4ANNA 3MDYA 4AWIA 4CFUA 3E3BX 3IDCA 3I79A 4GS6A 5FLFA 1W1DA 1ZYJA 3OBJA 2COCA 1SYKA 1R3CA 3TZMA 5FXRA 2ZDUA 3PIZA 4JDIA 3UNJA 5L2SA 2DX5A 4IWQA 4DINA 4F7GA 2F4JA 5BMMA 2WZJA 2J5FA 4L68A 3F88A 2HZ0A 4R7HA 1VEBA 2H96A 3MFRA 3QRTA 4G5JA 4HJOA 1GZOA 4IM0A 5JFSA 2JC6A 2EU9A 3EFWA 5E8SA 1LEZA 4MNEB 1WGQA 3MBLA 4TYHA 2ETKA 1W2CA 3LJ2A 4X2JA 5FXQA 3KXHA 5E1SA 5G6VA 3LJUX 3ODWA 4FIFA 4U97A 3TCPA 3UOLA 4L3LA 4R77A 2UZRA 4FK6A 5TR6A 3TXOA 4DBBA 4AT4A 1H1PA 1A48A 5EK7A 2YERA 4PV0A 5AV3A 4QMUA 4BCMA 2YAKA 3MS9A 4FA2A 2LGCA 4QJ3B 4WNMA 5GJGA 2EXEA 2EUFB 4U8ZA 3W0SA 3EQRA 4CD0A 4HVDA 1MIZB 3QTSA 4B99A 1UPRA 2B52A 1GAGA 2IEWA 3BL9A 5JKGA 3UIMA 3IW6A 2WOUA 3L1SA 4E4XA 1PLSA 4OSNA 4FKRA 3TNIA 3PA3A 5L2TA 2HELA 4O0VA 3DFAA 4R7IA 5B2MA 5LVNA 3A7JA 2BCJA 5L6WL 5DNRA 3EH9A 4ZJVA 5IEVA 4YNEA 2IVUA 4DHZA 3PRFA 4YR8A 1CKIA 4Q2AA 3VBWA 5HG9A 4C8BA 2YM7A 4PWNA 2IF8A 5HBEA 4V0GB 2RG6A 2JDVA 4HZSA 1OITA 3ZH8A 4K0YA 5JT2A 4FMQA 3CS9A 4EKUA 4LRKA 1LEWA 4LV8A 5AP7A 1U5GA 3VWAA 5GIPE 1YXXA 5HG7A 3WZJA 3QYWA 4MCVA 4ZZNA 3BEGA 4ZTQA 5AV1A 1MK9B 4PMSA 2JDSA 3E62A 4MBJA 5HICA 4ZK5A 3UPXA 4F7JA 5ITAA 2A27A 1DI9A 1BTNA 4K33A 3ZONA 4GKHA 3KVWA 4BZOA 4IIRA 4HB2B 2UW4A 3EQPA 4ZLYA 2WIHA 1GIHA 2IZUA 2W1GA 1K9AA 4O0XA 4LUEA 4U3YA 3FKNA 4BCQA 3BWJA 4UB7A 3ORMA 3DBQA 3FQSA 3BU3A 3R83A 2J2IB 3MWUA 4NTSA 2W96B 1DI8A 1OPKA 4Z7HA 3VUKA 4EOLA 4U45A 2ZMCA 3DBEA 3FMKA 4ZP5A 4EUUA 3ACKA 4DYMA 2M38A 3R7IA 3HW2B 4O4FA 3W2CA 2RVBB 4EHGA 3A4OX 2PZPA 4IAAA 3BU5A 3GEQA 1AQCA 4BDJA 2CGUA 3IO7A 3HVCA 4QPMA 3PUFC 5K4IA 2JFMA 3D8DA 1Q67A 4MYGA 4MK0A 1REKA 4C0AA 4GSBA 4YPSA 4NKSA 3MJ1A 5GZAA 3Q32A 3S00A 4D0NB 5DI1A 4CMUA 3DK6A 2YT0A 1PKDA 3SAYA 5HTIA 4G3GA 2BHEA 4A6FB 3DXPA 4DFBA 2ESMA 4ACHA 4FVQA 2XNEA 3ZS5A 4HYHA 3P5JC 2YITA 5GNKA 1ZY5A 4E4NA 4EQMA 1FGZA 4EK5A 1H25A 4FKUA 1QPCA 4A9TA 2EB2A 4IB0A 2ITUA 5A4CA 5DR9A 4Q5HA 1BYGA 1YRPA 4G2FA 2QU6A 3F3WA 2DYQA 3G0EA 4O0UA 3BINA 4O2ZA 2DWBA 2P8VA 2XK4A 2UZOA 3HP2A 3ODYX 4USFA 4EOOA 2X7FA 4I21A 5HU9A 2F2CB 5BMSA 1W98A 5I9UA 2IVVA 2ROZB 1W83A 5AP4A 3I0QA 3WOWA 4NK9A 4XV9A 4F9BA 1M7EA 2PVRA 1XBAA 5LXMA 4AXAA 4GW8A 2HW6A 5ANGA 4YTIA 3RPSA 5BVFA 1Q97A 2R3MA 3NFGB 2XVDA 3G5DA 3QC4A 3MH2A 5AP0A 1DYNA 1OIQA 3IONA 3PJ2A 4JR3A 2QKRA 3DXNA 1S9JA 3ERKA 4IAYA 4O6LA 4QO9A 3VAPA 1Q8YA 4QYGA 3TN8A 5IU2A 1Z87A 4R7BA 3MPMA 5AR5A 3GNIB 2ELAA 5HIDA 4RJ7A 4YTFA 2ETRA 3FMDA 4M67A 2B1PA 4HYSA 4BY9E 2UZTA 3A8WA 3O8UA 2W4KA 2NYAA 3OCBA 4TWOA 3RHXA 3QGYA 1OL7A 4RVLA 5D1JA 3RCPA 2QCSA 4KINA 4GRBA 5HG5A 3F5GA 1V89A 4FTKA 2C0IA 1Q5KA 5HTBA 2R09A 2VRWB 3KA0A 4DEBA 3HK0A 3B2WA 5HE1A 4TRLA 3BYUA 4QNYA 5HCZA 4XBUA 3L8SA 2G2FA 4AAAA 3NYVA 4ERWA 3ZO1A 1WG7A 2CKOA 1XMLA 2XAMA 4FTIA 2BHHA 4D4RA 4C02A 4I5HA 3GU8A 1ZRZA 5J7HA 1XBBA 2Z7LA 4M68A 1XKKA 3HP5A 3QIJA 2R0DA 5BX0A 4X6QC 4J71A 4CG9A 4TN6A 5HLNA 4MXOA 4PUZA 4O7VA 4N4SA 1R1WA 5HORA 5FEDA 3RGFA 4JLCA 1ZARA 3RWPA 2DA0A 4BZNA 2YDKA 4U0IA 2W2XD 3FSFA 3NVMB 3OEFX 4RRVA 4WIHA 2CODA 1Q61A 2D2QA 1FQ1B 2UZLA 4JR7A 4YZCA 3DOGA 3U4WA 4BDFA 4O4EA 3SD0A 4F9YA 4RBLA 5AX3A 3Q4CA 2I1KA 3DV3A 4I23A 1OL1A 5HVKA 5FD2A 3RWQA 3DZQA 1ZY4A 4EH4A 4ALVA 3EZVA 3R00A 2OICA 3E7OA 3C4FA 4JX3A 4DLIA 4JX7A 5CLPA 2OSCA 4O21A 4QMQA 4QYYA 4UBAA 3ORXA 4FTRA 4AG8A 2RFNA 3II5A 1F5QA 1IEPA 5ICPA 1UPQA 4EJ7A 4L45A 3P0MA 5JZNA 1ZSQA 2Y7BA 3FKLA 3NDMA 4E93A 3NIEA 3H9FA 4AT5A 3K5VA 1VYWA 1J3HA 1KE8A 3E92A 1JLUE 4X2KA 1P4OA 5A4LA 2C1BA 3R1NA 4RLLA 4E4LA 5GZ8A 2AEHA 2MFQA 5M09A 5KHXA 4FSTA 3VBQA 4FSYA 3TM0A 3UDBA 3E8DA 3ZO2A 2GDOA 2Z2WA 4HGTA 1WZYA 3TNPC 1ST0A 4N70A 5HO7A 3GOPA 4DT8A 1N3HA 3LCTA 4J95A 4XLVA 1I7AA 5EKOA 1RW8A 1K3AA 3KRWA 3QCYA 4LV7A 3OWKA 3U8WA 4X7QA 4R6VA 4ZY4A 2GS7A 2K8EA 4FKLA 2PVKA 3C4CA 4IAKA 4A9UA 3LFQA 3PJ8A 3Q9YA 4H3PA 3KU2A 4BKYA 5E8YA 4IVCA 5D10A 3TTJA 3W0QA 1PY5A 4F1OA 5D3YA 4DF3A 4K8AA 1H8FA 5J95A 1P2AA 3R22A 4FR4A 3QRUA 4HCUA 2L2IA 4IFSA 2YDIA 5EI8A 1Q8ZA 5CT7A 5HIBA 3W8LA 3UODA 1XR1A 4DX8A 3QU0A 4F1TA 4AXCA 1JKLA 5D9HA 1R0EA 4FV6A 4AXDA 2BUJA 2IZSA 4M8TA 4UEUA 3VQUA 2W1HA 4BDKA 5J5SA 3E88A 2OFVA 4L43A 5L8JA 5ACKA 2DLWA 3U4UA 1ZWSA 1LPUA 3VF8A 2O5KA 5E8UA 3MESA 4H1MA 5JGAA 2J0JA 2J0MA 5KKRB 2MWNB 5CLQB 5LVMA 2YCFA 3BCEA 3R7OA 3F5PA 5CYIA 5A3XA 1T77A 3Q60A 1X05A 3ZHPC 2A19B 3UIBA 2XCKA 3G0FA 4JDKA 5HBHA 2CNQA 4JXFA 3OW4A 2F7XE 5AR3A 2Z0QA 4CHMA 3DJ7A 3G9LX 3U51A 2O3PA 3V5WA 4BDDA 2X0GA 2PPQA 5HHWA 3PWDA 3UP2A 3KMMA 3CXBB 3TZ7A 4RZWA 3WBLA 3AQVA 3QD0A 5CEQA 3W8QA 4DAWA 3HMMA 4QP8A 3BLRA 2YDJA 3F7ZA 2JITA 2JAMA 2GTMA 3GU5A 3G33A 3RK5A 3AC3A 3EIDA 3E87A 1OKZA 3NW6A 2NP8A 3BYSA 4F7UP 3BJIA 4FSRA 5FRIA 3UNKA 4D1ZA 4L8MA 3FPQA 3HV4A 4MVFA 5J79A 2XARA 5F94A 1WVYA 2FUMA 3VQHA 4O2PA 4UMUA 2FYSA 3LW0A 1NXKA 3QC9A 4PNKA 4L1RA 5LCKA 3RCDA 3EKNA 3FL4A 4G6LA 3GGFA 4IB3A 4D9UA 3R9OA 4JQ8A 3RZBA 3TV7A 4F7LA 3RJCA 3UOHA 2WMRA 3DK3A 5E8ZA 3UE4A 4J53A 3ZO4A 5CAOA 5LQFA 1VJYA 4WBOA 3F9NA 4FRFA 4ZTLA 5TF9A 2EXCX 4BICA 3JVRA 3EL7A 5LVOA 1YQJA 4IW0A 3FY2A 4K2OA 5JK3A 2XK3A 1YKRA 3E8NA 3EN4A 3NNXA 3UVQA 3RAWA 3K3IA 3RK9A 5HNIX 3F82A 5DHJA 4H3QA 4AOTA 5IA3A 5IUGA 1J7UA 3PA4A 4C4JA 3PSBA 2PUIA 1ZOHA 2GFSA 2DS1A 3GFWA 2RSVA 4M0YA 4CZTA 5AAEA 5TO8A 1SMHA 3BKBA 3RAHA 3DXCA 4NTTA 3WILA 2W5BA 2VAGA 1QMZA 4W9XA 4DC2A 1U54B 3WF6A 4FV3A 3W0NA 2XIRA 1OMWA 2PZRA 4IZ5A 4R8QA 5F20A 4YLJA 2JDTA 4BI2A 2RFSA 2YSZA 3DJ6A 3CD3A 3PIYA 4UYAA 2L1CA 3MVJA