4EJNA

Crystal structure of autoinhibited form of akt1 in complex with n-(4-(5-(3-acetamidophenyl)-2-(2-aminopyridin-3-yl)-3h-imidazo[4,5-b]pyridin-3-yl)benzyl)-3-fluorobenzamide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
435
structure length
376
Chain Sequence
VAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-alpha serine/threonine-protein kinase
publication title Discovery and optimization of a series of 3-(3-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amines: orally bioavailable, selective, and potent ATP-independent Akt inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 106
structure length 376
sequence length 435
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ejnA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4ejnA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ejnA02
4E8AA 1PXKA 1ZYJA 2W9FB 4HYUA 3F0WA 5L2IA 4JX3A 5H8BA 3TM0A 5BUEA 4IANA 2AL6A 2Y7BA 3FLZA 3RTPA 1UEFA 3AT4A 3FZOA 3FAAA 5C26A 2P55A 5LVPA 1CM8A 3V6SA 4K18A 3UMXA 2ESMA 3I6WA 3JYAA 1UU7A 2IWIA 1IAJA 2X4FA 2XYUA 2UZVA 4WG5A 4C35A 1TJ6A 1FVTA 2GS0A 3R9NA 5I9VA 3QYWA 1JKLA 2X2MA 4BZNA 1H0WA 3M1IB 4ZSGA 2PMLX 4GYGA 5IDNA 4YC8A 1UNRA 2CKPA 2X8EA 4CMOA 2R9SA 3HUCA 4XRLA 4YZNA 4F7SA 2QHMA 1H08A 5IUGA 5GJFA 5A6NA 1W98A 4RJ8A 2IW6A 3NPCA 1MUOA 2BIKB 1WAKA 3C0GA 4FVQA 3THBA 5DT4A 3R8VA 4QMNA 5A54A 1PRYA 3SV0A 3ZBXA 3X23A 4FTIA 3A8XA 3PFQA 4DEHA 2YWPA 3KREA 2P0CA 2J2IB 4NW6A 4CYEA 3RPVA 3NIEA 5M07A 4IX5A 1YOMA 3DK7A 2ONLC 1OPJA 2JC6A 2YLEA 4IB5A 4ANBA 5I9XA 5J9ZA 2O63A 2QOBA 3GBZA 2QVSE 5LMKC 5C8KA 4JDKA 1KV2A 3LQ8A 4G1WA 3V5TA 3OEFX 4EH4A 1ZWSA 2XVDA 3HW2B 5E4HA 1TQPA 2CKEA 3VBQA 4E26A 5C1QB 2DKQA 2LKOA 2YA9A 3P7ZA 5LONB 2W2WA 1L3RE 4TRLA 2OK1A 4RIWA 1EVHA 3ATTA 4O7SA 4XG6A 4BDEA 3PZHA 2IVUA 4QMTA 4UALA 1MAIA 5IEVA 3FDNA 3ROCA 1UKHA 3AC2A 3DJ5A 1Q62A 5IU2A 2PVJA 2HE7A 3C4XA 4GMXB 4BBMA 2VN9A 3SW7A 4O96A 3M1SA 4YR8A 2BALA 1RJBA 3V6RA 5D41A 3K3JA 5CSXA 3CPBA 3BLHA 5GIOE 3UODA 3LCOA 2YIQA 4OTPA 2YDIA 5CU4A 5I9ZA 4HW7A 4HJOA 2BZKB 3PXYA 3BKBA 4D4YA 3ZH8A 3GC8A 4B8MA 2OJ9A 1Q41A 3DTCA 3R2BA 3LXNA 1OL6A 4JDHA 4A9TA 4IZYA 4DBBA 3TZMA 3KU2A 5EDQA 2VWYA 3W32A 3GI3A 1FHWA 1A9UA 4Y83A 3CY2A 3QQHA 5ANEA 2B53A 5CU0A 3QBVB 4F65A 3C0HA 3AGMA 2Y8OA 5DVRA 5LWMA 4O7ZA 2GHGA 2Y4IC 3UG1A 3P08A 2WU6A 2V7AA 1YXSA 4QMXA 2RGNB 5AM6A 3K5UA 3G6GA 4FIGA 5KMJA 4R7BA 1HOWA 3BGQA 4MVFA 4JIKA 3ZLWA 3HK0A 2QOIA 1OB3A 2R3JA 4Q9ZA 5A46A 5CAUA 4L52A 4YBKA 5IQHA 3TXOA 2OXYA 2HYYA 3TCAA 3FV8A 3QD2B 3QWJA 4RPVA 2UW3A 4R1VA 3G33A 4XMOA 1BI7A 4BCMA 1OQNA 5ANJA 5FI0A 3SV1A 1CKJA 1FVRA 3LQ5A 3LXKA 1ZY4A 4E3CA 1ZZ2A 3QF9A 2B0QA 4W4YA 1WVWA 1JLUE 3ORNA 2DLWA 4CKJA 1ZSQA 2JAMA 3BLQA 2CDZA 2FGIA 2C6LA 3E8DA 1PMEA 3PY1A 3FC2A 4U8ZA 2X2KA 5JRQA 2PPQA 2WO6A 3HZTA 3QRTA 1MPHA 3LCKA 3HRBA 1APME 1YXVA 1QC6A 2EXEA 4KB8A 4O1OA 1U54B 4XG9A 4E6AA 5J5TA 4FTRA 4W9WA 1BL6A 1IA8A 4FKLA 3TACA 5E8YA 4A7CA 1IG1A 2GFSA 1N3HA 3COMA 4AOTA 4J71A 3HRFA 3HEGA 4H58A 4FSQA 1OI9A 4MF0A 3TL8A 3T06A 2O0UA 5HO8A 4FKGA 4BCPA 5H9BA 3GFWA 5CTPA 4ZSEA 4WNPA 3C51A 3PWDA 2HELA 5E8WA 2W96B 3AD4A 2BZHB 2HW6A 1WI1A 4U5JA 3T3VA 3DNEA 3NUSA 4EQUA 4KWPA 3OT3A 4O0UA 4EQMA 2RGPA 2FSLX 3F5GA 3OD6X 5AWMA 4Z7GA 1M7RA 1DS5A 3NGAA 3W2SA 5AUUA 5D27A 3UP7A 3GU4A 3ODYX 2XIYA 1SVHA 2I0VA 3OG7A 4ANMA 3M42A 3R9HA 4FKVA 5F9EA 4BCGA 4E4NA 4F0FA 3FQEA 2HAKA 4IHPA 3R2YA 2VNWA 1E1VA 4CFMA 4C4JA 5L2SA 1R39A 4FL1A 2R3GA 4U0IA 4EH8A 4XWXA 4LYNA 3H30A 4XJ0A 4DEGA 5M55A 5CEQA 4E4XA 4BDHA 2C6OA 1WFCA 4OAVB 1P5TA 4BR3A 4CT1A 1UVRA 2OJFE 5CZHA 5K9IA 2PZRA 3G2FA 3QKMA 5L2TA 5LOPB 4NM7A 3F3TA 1JKTA 4PNIA 4ANQA 3EYGA 3R1NA 5BMSA 1LP4A 2UW0A 3NUUA 3P78A 4WD5A 1UNGA 4ZTHA 3KXXA 5AR3A 4F99A 3KSYA 2PVFA 2UZWE 5AUWA 2WQMA 3SOAA 5C79A 4IWDA 5M4FA 2GCLA 2R64A 2HZ0A 3SD0A 4OTDA 2C3IB 3ACJA 3N4TA 3UVPA 4QPAA 4ENXA 2WZJA 3OROA 2YF0A 1WBNA 4NY0A 5I9UA 3KF7A 4YPDA 4ZTSA 2X1NA 5KBQA 4RWLA 3VBVA 4QQJA 4X21A 5J95A 4JXFA 4X2GA 5AR5A 5JK3A 2XZSA 2CNQA 3F2AA 4G3FA 3BYMA 4LOPA 5HHWA 5CQUA 2VUWA 4EH7A 2OICA 4MXCA 5JN2A 4WRSA 3BU3A 2BRNA 1GJOA 4HB3B 4PL5A 5LXMA 5HD4A 4USFA 4I0SA 4H1MA 4ZRIA 5CVFA 4ZSAA 3WZJA 2JEDA 3CBLA 2IZTA 4F6UA 3OEZA 4AGDA 3OXTA 5HG7A 4KRCA 1Y8YA 1YDSE 3UIUA 4GKIA 3WILA 1H10A 3E8NA 3DAJA 3RAKA 4I24A 2A1AB 5TT7A 3B2TA 1MRVA 4BZOA 4TNDA 1JWHA 4HAZB 3MYGA 3HP2A 5L6WL 4ZLZA 1ZXEA 2C3KA 4OTIA 1S9JA 4G3EA 3G90X 5E8ZA 4KIKA 4F7LA 5HU3A 2JKMA 2LULA 4AGCA 1WZYA 5FXSA 5CF8A 3P79A 3PVWA 4G34A 5M53A 2CHLA 2JIUA 3C4FA 4DC2A 3EYHA 5H2UA 2ITXA 3GCPA 4O0YA 2DYQA 3VOQA 3ZLSA 4QMQA 1MRUA 2IJMA 4QTDA 3SW4A 1O9UA 4CEGA 4HGTA 5J1VA 5CU2A 3H9FA 1BLXA 4QPMA 4U3ZA 4UEUA 3K54A 3QALE 4YP8A 4CFUA 3QBNA 4DAWA 1OKZA 5JFVA 1LEWA 2YJRA 4P7EA 4YJNA 1UNLA 3LFFA 2HXQA 3BQCA 2DUVA 4NH1A 2WTIA 4YUQA 1U5DA 4ZIMA 4I6BA 5C8NA 5JZJA 3A7IA 4HAXB 2RG6A 4O22A 2HIWA 3EJ1A 2Z60A 2VZ6A 4D2WA 1XH7A 2FSTX 5AV3A 3OXIA 3VRZA 3DXEA 4BHNA 4AS0A 3SX9A 3EQRA 3MSSA 4M0YA 4FIFA 5AJQA 2PVNA 4DH7A 4R5YA 5I3RA 3AQVA 3EWHA 4TWNA 4V01A 4QQCA 2PY3A 3FLNC 4G3GA 5D3XA 3PVUA 4OTQA 4L43A 4U80A 3LW0A 5J3QA 3I4BA 5CWZA 3RPOA 1P3RA 4RMZA 3BZ3A 4QTEA 2Y4PA 4FZ6A 2XNBA 4BYJA 2KCJA 4UYNA 3GNIB 1UPRA 5GJGA 3SQQA 4U97A 3KZ1A 4AZTA 4MD7E 3WBLA 1UKIA 5DI1A 2YIWA 4DITA 2B9IA 5AM7A 3WOWA 5LVLA 4WG4A 5JKGA 2UW9A 1Q3DA 2R2PA 4BYIA 5J7HA 1XKEA 4MCVA 1URCA 2HK5A 3NYXA 3P5KA 5EHYA 5HIEA 1B39A 5A14A 1I44A 4ZJIA 5A4QA 3F5PA 2JBPA 4FZAB 3GYPA 1DDMA 4LUDA 3WZEA 3PLSA 4E4MA 3EQPA 4KKGA 3FMHA 4DT8A 1FPUA 3P86A 3W33A 4PY1A 1NTVA 4JS8A 3LJ0A 3V5LA 5L6PA 4CCUA 3V3VA 4FR4A 4U45A 2UVMA 2Z0QA 4NT4A 4CTCA 1Q97A 3PJCA 1DAWA 2B9HA 4UZDA 3VBWA 4YO4A 4R6VA 1GY3A 2C30A 4EEVA 3U8WA 5HLWA 4BI2A 2Y6OA 5HTIA 3CKWA 3O8PA 3MDBC 5AA9A 3NLBA 2WTCA 1XBCA 4UXLA 4CRSA 1OVEA 3K5VA 3BWFA 4A9SA 2BR1A 4IAZA 4E5WA 4QTCA 4XNEA 3QZHA 2C5VA 2BZJA 3VBYA 4G3DA 1K3AA 4AW2A 3COHA 4ZK5A 3D8FA 3TDWA 1TQMA 1Y5OA 3BGZA 4E1ZA 2YM4A 3SGCA 1H00A 3U4WA 2BHHA 3P23A 2F57A 5KX8A 1V5MA 5GINE 4ZZNA 4UV0A 2UW4A 2YJSA 1GIIA 3DJ6A 3PXFA 5DBXA 2WELA 2GTMA 5FTOA 2C6MA 4RIXB 3QTXA 3BYUA 4BCIA 3D4QA 4B7TA 5IF1A 1J1BA 3UQFA 1MIXA 2R0IA 3GQIA 4BWKA 4HHVA 5JFWA 2JBOA 5HORA 2XK7A 4BDDA 4QRCA 2XYNA 4ZTNA 2EJ8A 1ZZLA 4DE4A 3TIYA 4U42A 1NA7A 3OWKA 5CASA 2MDXA 4ITJA 4EC9A 4IJPA 3DBEA 2COCA 2WAJA 1FOTA 2NO3A 2X7OA 3GC7A 3PUPA 5BVWA 4HPUE 4BDJA 1Q5KA 2GPHA 5B2LA 3KRWA 4W4WA 3UDBA 2G1TA 4YONA 2DHKA 3G15A 5M44A 1W1HA 4CLJA 3RCPA 3NCZA 3AMYA 2RSGA 2WTKC 4FKTA 2VWUA 4E20A 3OWPA 2ITVA 5C4KA 3KKVA 5J8IA 2UW5A 4F9YA 5A4EA 2YS1A 4CRLA 3UYSA 2I40A 4IJ9A 4FVRA 1OMWA 1WBWA 4FTKA 1YHVA 2DX5A 1Q8UA 3B8QA 3RINA 3TZ7A 1ZY5A 1JOWB 4NIFB 3R8MA 4F4PA 2GS6A 2RG5A 5J1WA 5L4QA 2UZBA 2XNMA 2WMBA 3C4WA 3D94A 4YO6A 3IW7A 3TNHA 5JMSA 5JRSA 2BROA 3HNGA 4FTAA 3GCQA 3D2KA 3LFQA 4XG3A 3R7IA 2C1BA 4EORA 4FEWA 3DQXA 5EQYA 3C50A 5BYZA 2VTQA 4QOXA 4ZLOA 3W1FA 3U55A 4L6EA 4QT1A 1J1CA 4PL3A 3UPXA 5C5BB 3FMJA 1DI9A 2DYNA 4BTMA 5EHLA 4IWQA 4EI4A 4MAOA 5D11A 2GQGA 4JI9A 5C4LA 2V62A 3CJGA 3VO3A 2OH0E 1PYXA 2BHEA 2UZUE 3BV3A 4J8MA 3RPSA 5JFSA 4WUAA 4CZYB 4DTAA 4F9BA 3OANA 4Y72A 4CFVA 5CAVA 4P5ZA 4WT6A 4I3ZA 1M7QA 4FV6A 2Y8FA 3TCPA 4C37A 4Z2MB 1V88A 4O91A 1NU2A 4DEIA 3S3IA 4AX8A 3B2WA 5KMOA 3UNKA 1U29A 2QKLA 3P9JA 3U87A 3OP5A 1XH5A 2CGUA 3WI6A 1KZGA 4ZTRA 4HCTA 4LGHA 1IEPA 5HQ0A 2YT0A 2BRGA 5HTCA 3CEKA 3ORZA 5KMKA 4DBXA 4LOOA 1H4LA 2NP8A 2R0UA 4CV8A 3TVVA 2G15A 2GJYA 3BYOA 3KGAA 2C5YA 2JKOA 3A2CA 3JY0A 4KKEA 5CSWA 5EM5A 1JSUA 4FKPA 3SRVB 4DFNA 3UPZA 3Q4TA 2E9VA 4I92A 3HYHA 4KBCA 5AR2A 4QPSA 5AR4A 4YLKA 3NNVA 3DNDA 4FOBA 4DX8A 1KE5A 4ZTQA 5JZNA 3L1SA 3TZ8A 3R04A 3AMAA 4IAYA 1SVEA 4A9YA 3VJOA 4YLJA 3QTQA 4FK3A 3CXWA 4KS7A 3LCDA 3Q52A 4EK3A 3KMUA 2YCSA 3PWYA 3R22A 4LFIA 4USDA 2D11A 3PZDA 5FBOA 1JQHA 2HW7A 2IZRA 3MH0A 3GU5A 3V8TA 1OPLA 3HQCA 4MBJA 4MYGA 2NRUA 4C7TA 5AFVA 3ZM9A 4AN9A 3QX4A 5DH3A 4JT3A 5IUHA 1OIRA 1REJA 4IZAA 4AGWA 5IA4A 1U59A 3L9NA 4IADA 3R8UA 3WZKA 4ZZOA 3DDQA 3OY1A 2CY4A 2FUMA 2FYSA 2BZIB 4X6RA 4MQ2A 5HCZA 4PPBA 4EOKA 1ZYDA 3ZUTA 2CPKE 1MP8A 4GPTB 1RE8A 2ITPA 2Y7JA 3C13A 4ZTLA 5JEBA 1Q8TA 4CKRA 4QO9A 5AP0A 3UMWA 4RX8A 4MBLA 3JVSA 2XJ1A 4D4RA 4FT7A 4OBQA 3EQFA 4J96A 2UVYA 4FIEA 5FTGA 1K9AA 4C3PA 3R73A 4CFXA 3S0OA 2GTNA 2B4SB 5JFXA 4XV3A 1UWJA 4MY6A 4EH9A 3QQKA 2OI4X 2X8IA 1M14A 4O0XA 5I9YA 1WVXA 2Z2WA 4FZ7A 4XCUA 3HV5A 2XIKA 3NW6A 4L7SA 3C0IA 3KC3A 2W99B 1B55A 2F4JA 4M68A 5FD2A 5CY3A 5JGDA 2D9XA 4IE9A 5JGBA 3QXPA 3BBTB 4LL5A 5HVJA 5GHVA 4DEBA 3WA0A 1U54A 4WRGA 5CF4A 2C47A 2CCIA 3KRXA 1V1KA 2GDOA 4MF1A 3VUMA 4OTWA 5IPJA 3MDYA 3FPQA 3A99A 5FP5A 3G5DA 3SXSA 1BYGA 2Z7RA 3G0EA 1GZKA 3MH2A 5FGKA 3NYOA 2JITA 2BRBA 2UZSA 4H3BA 3KA0A 4D1SA 5HG8A 3EN4A 1DDVA 2MFQA 1YWNA 4J52A 1H1PA 4W8DA 4F9AA 4BDFA 2J5EA 4FT0A 3O71A 3A8PA 4WUNA 3E3PA 3SO6A 4IM0A 4K2RA 2C0OA 3C4EA 4EUTA 2R3NA 3KMMA 4LGGA 4CHMA 4QYGA 1VZOA 4RJ6A 4AA0A 2OIDA 5IQIA 1NTYA 4MNFA 3COIA 2B54A 4BIDA 2Z7SA 5CLPA 2GQRA 4ZTMA 4FKJA 4FKRA 4EHEA 2OJJA 4FV8A 5CANA 4J95A 2X18A 5HG5A 3ZLXA 4I6QA 1J91A 4OUCA 3QU0A 2MKRA 2X6EA 4IB1A 4XH6A 4YL8A 4RX9A 3OOMA 4C3FA 3PDTA 2Y0AA 4FSTA 4N0SA 3HECA 5IMEA 4A9UA 4KHOA 3HDNA 4YC3A 3E8CA 4F6WA 1AD5A 2ZJWA 1W83A 4EBVA 3BE9A 3F66A 3QYZA 2RIOA 5FDXA 4K1BA 3QQFA 3ZUUA 4BFMA 1OUYA 2OFUA 1M52A 3PJ1A 3D8EA 4HOKA 2UZOA 4I23A 2XS0A 4D5KA 1AWEA 4I41A 3EFLA 2YCRA 2UZEA 3KF4A 4TXCA 1TQIA 3T9IA 1X05A 4WA9A 1NXKA 3GCVA 4RVLA 1SVGA 1XHAA 3GCSA 4I6FA 4E6CA 4ZZMA 2EMTA 4X6QC 4ZS0A 4F6SA 2KULA 3CD3A 4HDQA 2YN8A 3LHJA 3LMIA 4RC2A 4MX9A 4FKSA 1PFJA 3PG1A 5BVFA 3LFNA 5TE0A 1IASA 3PLAE 4YJUA 5LARA 1PKGA 3DLSA 5L81A 4J7BA 1FB8A 4B4LA 2WOUA 3BHYA 2W7XA 4YSMA 3FEHA 3F82A 3Q2MA 2AYPA 4NSTA 3RVGA 3TN8A 1QPCA 2ITNA 3HV7A 5FQDC 3SC1A 4BDBA 1BI8A 1JVPP 5GOWB 3VAPA 3BHVA 2JGZA 1LEZA 5J7BA 3IPHA 3ZBFA 2PUUA 3FJQE 1PYEA 3A7FA 3I6UA 2OZOA 3OTVA 3QD0A 3VIAA 2NNWB 2PYWA 3VULA 2HY0A 2UVXA 4JRVA 2Y8GA 2A2AA 2L2IA 4NZWB 3PSDA 5EFXA 1QMZA 3V5WA 4GRBA 4WJ7A 1W82A 2QO9A 1FVVA 4AZFA 2ITOA 5KQ4A 2WHBA 1PY5A 3KMWA 1IR3A 3ZO4A 1YXXA 3KY2A 4XP3A 3DPKA 4EOSA 1YWVA 3HAMA 1XKKA 4C59A 1DROA 4Z9LA 5HX6A 1FOEA 3QZFA 1Y6AA 3PXQA 1E1XA 3MFSA 5TO8A 1KZ7A 1K5GB 2D9WA 3E5AA 5C27A 4XG8A 2WQOA 5DRDA 1WBVA 4FL2A 4N6YA 3CGOA 3D0EA 3E63A 1BWNA 4KS8A 2VRXA 4LMUA 5L3AA 5M4CA 2ZPYA 3TJDA 2WMRA 4ZP5A 2ITQA 4JLCA 5M51A 3BHTA 3MVLA 3TFMA 4U44A 4APPA 4F0GA 3ZXZA 4EH6A 2QU6A 3BPRA 3EKKA 4RLLA 2RNRB 3DY7A 4PX6A 3DDPA 3AG9A 3EZVA 4PMTA 4MHAA 5KMIA 3KRLA 1YI3A 3DKOA 4JG6A 3VUGA 4EBWA 3IW5A 5K4IA 1TXDA 5HEZA 2BVAA 1SYKA 4YU2A 1V0BA 1OKWA 4OT5A 3W10A 4TPTA 3HX4A 2JFLA 4BWXA 1NVSA 3V04A 3ZVRA 3MJ1A 4L46A 2YABA 4H39A 2D4QA 4G6OA 2UVZA 5IQCA 2VTJA 4OTGA 3IDBA 1CKIA 2IFSA 5ETIA 2O5KA 2Z7QA 3DKGA 4WNKA 3R63A 4HYIA 4ITHA 5AX3A 1P14A 1WMKA 1FGIA 4FODA 4YTFA 4TL0A 1ZC3B 1VEBA 4Y8DA 4ACGA 3QCSA 4CZUA 2P0FA 4PL4A 4JG8A 1PXJA 4TYEA 1R0EA 4AT4A 1HCLA 2VWZA 5E8VA 3BEAA 4I20A 5L8KA 4RA4A 4KNBA 3CKXA 4QMMA 1W7HA 5EYKA 4LRKA 5EOBA 5AV1A 4IFSA 3QC9A 3TTJA 3D14A 4PWNA 4ZS4A 4DH5A 4FKOA 5EG3A 4AFJA 3BHUA 3PPJA 4RWKA 4BDKA 5C9CA 4LV8A 4GT3A 1WGUA 1IA9A 1EF1A 3EL7A 4TNBA 3NS9A 3QTRA 4YZBA 4U9AA 3DA6A 4HVGA 4HAUB 2QCSA 2C5NA 3FMDA 3UOLA 2RFDA 5BVDA 4IAPA 3R6XA 4TN6A 1H1RA 4GK2A 5HESA 1PW2A 4YTHA 4TKSA 3I81A 4CYIA 3CXBB 1WBTA 1S9IA 3NVMB 5EQEA 3VBTA 3VF9A 4AZWA 2H34A 2AEHA 4D5HA 4H8SA 4C38A 1H07A 4NTTA 2EVAA 3Q6UA 2ACXA 4TWPA 3ODXA 3H3CA 4LL0A 2ZV2A 3W18A 2PVHA 5E8UA 4EYMA 3U8ZA 4D28A 5DH9B 4MTAA 5L2WA 1Y19B 4RQKA 3MW1A 3LFBA 4MEDA 2JLDA 5AUVA 4CVAA 4RC3A 5J9YA 3NRMA 3V8SA 4NCTA 4D1ZA 3R00A 2I1JA 3QC4A 2J0MB 3BU6A 2O3PA 5E90A 2QOOA 4JRNA 4TTHB 4JBQA 3FSFA 3R01A 4RIXA 4AE9A 2W1FA 4M3QA 1K5DB 4CT2A 4O84A 4JJRA 4R3PA 4FTJA 3G9WA 4Y46A 2QOQA 3SA0A 3CGFA 5A4LA 3RNIA 1JAMA 3L8PA 3KRJA 4M84A 2FB8A 3BINA 2XM8A 3HMPA 5AUZA 4AOJA 4YMJA 3F3ZA 3Q60A 2EB3A 3QLFA 3VIDA 4EHZA 3NW7A 3BWJA 3KCFA 3VQUA 4KINA 3EFKA 5AV4A 3I0OA 5HG9A 2CLXA 5CALA 5D10A 5JT2A 1A48A 4RIYB 3E3BX 4M8TA 5DR9A 3WE8A 3O8UA 2YISA 4U7ZA 3OWLA 2CNVA 4J98A 2QHNA 2BDWA 3V5JA 2DHIA 5AUXA 5CYIA 2EU9A 1J7IA 3MY1A 1V5UA 3CQEA 3QCYA 4EL9A 4X2KA 2GNGA 3SKCA 3UGCA 4BDIA 4JDIA 4C57A 4D1XA 3DU8A 4L3PA 1T45A 2CCHA 1F0QA 4QMOA 3UO6A 1V5PA 3JR1A 5E9EA 2ROZB 5CU6A 4F1TA 4MNEA 4C8BA 2VTTA 3OCTA 3Q32A 3RK7A 3VUTA 3WIKA 1XCGA 3CQUA 1KI1B 3MS9A 1MKEA 2PHKA 3N9XA 2QU5A 5LWNA 1Q67A 4NIFA 3PRIA 3S95A 4O1PA 5FG8A 5EDRA 4C33A 4TYJA 5DIFB 4IAAA 4HAVB 1IRSA 1B6CB 5K3YA 3R7GA 5T3QA 3FWQA 3EQCA 3DXCA 3SYXA 2FSOX 3UJGA 3L8XA 4QTBA 4Q5EA 4EH5A 1ZRZA 2IZUA 3FQSA 2WMQA 3F88A 3FHRA 2ZM4A 4FTMA 1J19A 3FZTA 3R8LA 4PMPA 1ZVRA 5IA0A 2BPMA 2ZVAA 1GG3A 5C5BA 4ZRKA 4PPCA 4FKIA 2GHMA 5IEXA 3LIJA 3PPZA 2XK9A 1Q3WA 3RM7A 3O50A 1WJMA 4RZVA 4C4FA 3NMUF 4HVSA 2YM5A 3DFCB 3AD6A 3EN5A 3FI3A 3OS3A 5EOLA 5B2KA 4EKKA 4UMPA 3WYXA 5AA8A 3TV4A 4FUYA 3ZC6A 3H0YA 1KV1A 3BU5A 3D7ZA 3MB6A 4JQEA 3WYYA 4CD0A 4KVGB 5TF9A 3DKFA 5HVYA 4RZWA 3REPA 3IONA 3HGKA 3MY5A 4IX3A 3ZSIA 2WFYA 1Z5MA 1I7AA 3A7GA 3R21A 1SMHA 5AAEA 2VTNA 2N23A 3VS2A 3WF7A 2OW3A 2Z7LA 5AP4A 5HE1A 2CY5A 3EQDA 4FUXA 5EW3A 2F9GA 4FGRA 4V04A 1V0OA 4I5PA 5T68A 1IAHA 3Q53A 2QOLA 3IOPA 5DEYA 3CPCA 3W2RA 4BKZA 3JPVA 3MPXA 2VTPA 1I09A 3BCEA 4RBLA 2W06A 3FZPA 2OIQA 4KHBB 2WMVA 4NJ3A 3RNYA 3G51A 2PMOX 3UIBA 3LM0A 2A0CX 4MXXA 4EH2A 1FAOA 4TYHB 3Q5IA 3SRVA 3R9RA 4BGGA 2CODA 5DE2A 4ASEA 2OQBA 5G1XA 3GC0A 1OGUA 4HVIA 2ERZE 5M4UA 4AACA 2XCKA 3DTWA 1YI6A 3TZ9A 5JP4A 4CG8A 2R7BA 5CEMA 3R0TA 1QPEA 4RLKA 4K8AA 2HZ4A 4DH1A 4FV7A 5GIPE 4Q9SA 3NUXA 3ELJA 3TJCA 2BAKA 3QRKA 1GZOA 1KWPA 2QO7A 3EFJA 3O23A 3E92A 1BX6A 2O8YA 2JKQA 5G6VA 4TT7A 2X7GA 5FXQA 4FOCA 3Q96A 2W4OA 3NX8A 1H4RA 4GS6A 3O0GA 4BBEA 4FTCA 2VTLA 5BVOA 1OBGA 3NR9A 1QQGA 4UY9A 4HB4B 5EKOA 2P4IA 4FTUA 4F08A 4BVUA 1WG7A 3E88A 3QRJA 3GXLA 3ULIA 2ITZA 3AGLA 4P5QA 3UIMA 4DF3A 1X86A 4LUEA 3EQIA 5BNJA 3QQJA 4GFMA 3RWQA 1F5QA 2WTJA 3FE3A 1Q8YA 2GNJA 2I0YA 2ZMCA 3F7ZA 3OT8A 4LMNA 3ZDIA 2OZAA 3OCBA 4RFYA 2J0KA 4XG2A 5TR6A 4AXAA 3LKMA 3KFAA 2QNJA 3ZMMA 1EH4A 5I3OA 1STCE 3C5IA 1H25A 4U6RA 1MRYA 1ZM0A 2VRWB 1YKRA 3SXRA 4IZ7A 5HIDA 2CNUA 1YWRA 2XMYA 4AW1A 4P4CA 2UZNA 3EZRA 2XK8A 4ASDA 1SM2A 1XH6A 2ZB0A 4DFZE 4BBFA 2COAA 1LB1A 3HA6A 4ORKA 4QTAA 4CKIA 3P7CA 3KXMA 4FICA 4GXBA 4BBKA 4W4XA 3EB0A 4C58A 1U5RA 3ORTA 3Q9WA 4I21A 2V55A 2YZAA 3GFEA 5DN3A 3W2OA 5CEKA 1BUHA 2I0HA 2JAVA 2R5TA 2W9ZB 3LLTA 4PTCA 3ORXA 4YTIA 5T6KA 2PUIA 4WHZA 3KULB 3TI1A 2XB7A 1XODA 3SXFA 2XBAA 4P2KA 4QP1A 1MQBA 3KB7A 4FNYA 3BHHA 4MK0A 3V5PA 4FSNA 1A06A 5DR6A 4FV1A 2J9MA 2WQBA 4RG0A 1ZOEA 4O6LA 4OBPA 4AW0A 2EXMA 1BL7A 3VN9A 4X2FA 3DS6A 3MFRA 4I22A 2K2JA 4O82A 1XJDA 4QP6A 4DBNA 4FTOA 5GZAA 5TOZA 4CCBA 1OECA 4XV1A 1B38A 5D1JA 5CXZA 1LUFA 2XK4A 4GKHA 1BMKA 5E8SA 4IFGA 3U6HA 4F1MA 1ZYCA 3II5A 2JDSA 4FSZA 4PP7A 1REKA 4QP9A 4DEDA 4A5KA 2C5OA 5KUPA 3R8PA 1MIZB 3DGKA 4GJ2A 4HVDA 3ZM4A 4AA5A 2QQ7A 2YCFA 2QLUA 4FI1A 2XK3A 4C2WA 4D2RA 3M11A 4FYOA 3CTHA 3F7WA 2W5HA 1NT2A 5KE0A 4UXQA 2XK6A 4X3FB 3CC6A 3ULZA 3W8LA 5C03A 4FIJA 4YC6A 2LYDA 3OBJA 2PU8A 1P5EA 2YWVA 2RVBB 4XEYA 5DEWA 4HAWB 3FY0A 2L1CA 3F3WA 3ORLA 4DG0E 4EOMA 5C16A 2VX3A 2BRMA 2HZNA 2DQ7X 3VQHA 4AGUA 5E8XA 1FGKA 3Q9ZA 1UPQA 5FM3A 3UZPA 3UNJA 5J3YA 3U9CA 3VC4A 5IQGA 3W16A 5HVKA 3NZ0A 3TV7A 5FTQA 3EKNA 2QC6A 1PMVA 2H8HA 3PVBA 3PTGA 1U5QA 5CT7A 2W2XD 4M15A 4RA5A 2UZTA 3TT0A 2XKCA 2B9FA 3D7TB 2I1MA 2Q0BA 4FA2A 3AU4A 3KXNA 3ZLYA 4DEEA 4YHJA 3WYFB 4RX7A 3VUHA 3FLQA 3BI6A 1PMSA 4ANOA 2PMNX 1JPAA 5FLFA 4BGQA 3PEGA 2H9VA 2PE0A 2FH9A 2W4JA 1WBPA 3P0MA 3QAME 3IW4A 3O2MA 3PXZA 2UW7A 4D2SA 4ZJVA 1M17A 2OH4A 3ORMA 2C3JA 3PG7A 2ITTA 3AMBA 4Y5QA 3RK5A 4MQ1A 5HBJA 4IAFA 4O7VA 5C6RA 4FYNA 4S33A 3R1SA 3VNTA 5LMBA 5M57A 3C7QA 4RVTA 3RK9A 4XP0A 1OZ1A 5F4NA 4DN5A 3FC1X 4NCTC 2KGXB 4G5PA 5AADA 5DR2A 3FLSA 3EIDA 2YDKA 3VS7A 3ERKA 4ZY6A 2HZIA 1YDRE 4IX4A 4ASXA 2O64A 2JP2A 3UC3A 2XJ2A 5JSMA 1JBPE 4K2OA 3LFAA 4RWJA 1P4FA 2GMXA 4GK3A 2BTSA 3UVQA 4APCA 2BAJA 4IOYX 3COKA 3PPKA 4M69B 5FWKK 4QMWA 3PP2A 3FZ1A 3NW5A 4IM3A 2P0DA 3DLZA 2G2FA 3MBLA 5DLSA 3FEGA 3E8EA 4MNEB 4C2VA 3FMKA 4EKUA 2JIIA 5H8EA 5HGIA 2DHJA 4GUBA 3JXWA 2YAKA 2R3MA 5HO6A 3CR0A 2WD1A 4RJ5A 2IPXA 4UWBA 3VS6A 4G31A 3BIZA 3I5NA 3RMFA 4Z3VA 4JBOA 4RJ4A 3U6JA 1J7UA 3FPMA 5D7AA 3IOKA 3P1AA 5IA2A 2XNPA 4IVCA 5JGAA 3DK3A 3NNWA 4EK5A 4UX9A 2E2XA 3GEQA 1BTKA 3BE2A 4FMQA 4B6LA 4D0NB 5FEEA 4AQCA 3PP0A 4PDPA 2HOGA 2J0JA 3N7CA 2KTYA 4GT5A 2PUNA 3TUCA 2Z0PA 3OZ6A 1PJKA 5CX9A 4FT3A 2YAAA 1J3HA 3FKNA 3LFSA 5L6OA 2JDRA 3FYJX 3QL8A 2F7XE 3R30A 2ZOQA 2ZV9A 5BVEA 5A6OA 4R78A 1ZARA 4EOJA 4EWQA 3KN5A 4S32A 5L8JA 3F9NA 4WVFB 5F95A 5DWRA 1M7EA 3TNWA 4GMYA 3OCGA 3ZTXA 3RAIA 3BLRA 3KQ7A 2QKWB 4FNZA 2J90A 2RSVA 4A4OA 5ICPA 4C0AA 4O83A 2P3GX 2ETMA 2W1HA 2X7FA 4O0VA 5KMLA 1ZMVA 3MJ2A 4GFGA 3UC4A 3MIYA 4AU8A 5JHHA 4YJVA 4RQVA 1X1FA 3ZO3A 4BRXA 2C4GA 2X0GA 4QMYA 3VUIA 4EOPA 2C6DA 4H1JA 1Q24A 5I9WA 2RFSA 2QOCA 5ANIA 3D15A 4RWIA 4IX6A 5M4IA 4KIOA 3PSBA 2B1PA 4EK4A 4DGLC 3VVHA 1PXPA 2OXXA 5CEPA 4XG7A 3UOKA 4YNEA 3UG2A 3TDVA 2Q0NA 1CDKA 1H27A 3PA3A 2PZIA 3QRUA 4O0TA 4D0WA 1DYNA 5FRIA 4ZLYA 1XX0A 2R3QA 3Q4UA 1G3NA 2WGJA 3C4CA 1FINA 3FBVA 3HMNA 4OW8A 5LQFA 5EW9A 2VNYA 5DYJA 3BJIA 4PTGA 4K0YA 2YCQA 2FSMX 3QTUA 2V0DA 3R1YA 1O6LA 4FZFB 3ZFXA 5IQDA 4F1OA 5CLQB 5KKRB 1WJ1A 5JHGA 4JAJA 4PDYA 1OUKA 2J7TA 5HICA 3FM8C 5TKDA 4BF2A 2P8VA 3I79A 3NUYA 3E7OA 4EOLA 3LFCA 4DGOA 2B52A 5EI2A 3KEXA 4UMRA 5ITAA 2FA2A 5HZNA 5HIBA 1LPUA 4R3CA 3NDMA 4F64A 2DWBA 3PXKA 3Q9XA 2GNLA 4YNOA 4EONA 3QUDA 4RX5A 5AUTA 2C6IA 2ZMDA 4FKUA 5BX0A 4FV0A 3Q6WA 2G9XA 4WNMA 2OTXA 2G35A 3FMEA 3IGOA 3MY0A 3KXZA 2AC3A 3OWJA 3EQGA 4IB0A 3ALOA 3UIXA 1ND4A 4GVJA 2UZDA 3GQLA 3V01A 5CEIA 3ANRA 4QMVA 3NAXA 1XWSA 3LOKA 3SDJA 3TKUA 3UE4A 5CI6A 4R3RA 1EAZA 3QA8A 4DXAB 3BEGA 2NRYA 4JBVA 5JH6A 2OF2A 5HNGA 5BYLA 2R09A 4FIIA 2OLCA 4YJQA 1EGXA 4UN0C 2OZAB 1ISNA 2J0MA 1OL5A 4B6HA 4KRDA 3QXOA 2EMSA 4CMTA 2OG8A 4HNFA 3ORKA 4OTHA 4CG9A 2ZYBA 2EXCX 3ODZX 1UA2A 4GIIA 4ASZA 5KNJA 2X2LA 4NM3A 4O21A 3EMGA 5DT0A 5CAOA 1FGZA 3L8SA 5IQAA 4FGBA 4CGAA 4YTCA 1H1WA 4DHFA 5H3QA 2R3LA 4L3LA 3VS5A 4GU9A 2PVYA 1M2RA 1KSWA 2F2UA 5IA3A 3GUBA 3ITZA 4JG7A 4PV0A 5C01A 2QOKA 2VO6A 2XEZA 3FYKX 1OKVA 2A4LA 2QO2A 2OIBA 4I0RA 4RIYA 4DG3E 2C69A 3GENA 4MWIA 3QKKA 5KZIA 3T9TA 5CVGA 1M2PA 2V76A 2JDOA 4CLIA 3A60A 3QD4A 5HO7A 4K33A 3O17A 5LMAA 1JKKA 4A4LA 4JQ8A 2HTHB 2VO7A 3FLYA 5HKMA 4MXYA 1QCFA 2WPAA 3POZA 5LOHA 3TIZA 1X8BA 3N51A 3R83A 5CF6A 3QCXA 5F20A 1CSNA 4FSUA 3RHXA 4F7HA 3DXPA 3OY3A 2OSCA 2F2CB 3GGFA 3PJ2A 3POOA 4D4VA 2W2XC 3CS9A 4EK8A 5DI9B 2W05A 1XH9A 3NUNA 3CY3A 2W1GA 3I5ZA 5A3XA 2BUJA 1R1WA 3V8WA 1OIYA 4FEUA 1PLSA 4L8MA 4WSFA 4NM0A 3MVJA 4AA4A 4IEBA 2QODA 2JFMA 2YIXA 4FSWA 5AX9A 1GIHA 3ZDUA 3WZDA 3UNZA 2CAYA 4IWPA 5CQWA 2PVMA 2QD9A 3A61A 5EK7A 4CYJA 4A06A 4IACA 1YXUA 3ALNA 5IUIA 3ENHA 3PP1A 4J1RA 4AZVA 1TKIA 3QD3A 2YFXA 2QR7A 5DMZA 3BX5A 3O7LB 3IG7A 3RPRA 5IDPA 4Y95A 2OXDA 2ETKA 3ZXTA 2OO8X 3KY9A 4FZDB 3PJ8A 4DINA 1P6SA 4TY1A 3M2WA 1UWHA 2B7AA 2VKIA 3RHKA 3EN9A 2VTOA 4FSRA 4CMUA 5DHFB 3I60A 4FV2A 2X8DA 4I5HA 4NFMA 4R8QA 4TW9A 2QOFA 5GZ9A 4BI1A 4OTRA 5AP1A 3LCTA 1PXLA 4BWPA 4FSMA 4E7WA 3QTWA 5E7RA 3OFMA 4CFFA 3U9NA 3CTJA 4EJ7A 4LOQA 4LV5A 1KE7A 2X39A 3E64A 1GNGA 4J53A 4FT5A 3NAYA 3LCSA 2YM7A 4AFEA 2WMUA 3AC5A 4E5BA 5EM8A 4AN3A 4ZY5A 2WQNA 1SHCA 2Z8CA 2R3OA 1WGQA 5K0XA 2COFA 4HB0B 4JVGA 5DGZA 1PMUA 2XCHA 4LI5A 3F3UA 2V7OA 5BUIA 3TO1A 4EHGA 2C0IA 3FSSA 2YHVA 2PZ5A 2HY81 3I0QA 1ZYSA 2QR8A 3IQ7A 3UVRA 3ZEWA 4DG2E 2G2HA 4M12A 4ZY4A 4OR5A 4CXAA 2VTHA 4QYFA 3ZO2A 3MGYA 2VAGA 2W1EA 3MVMA 1YW2A 3TEIA 5CEOA 4ZRJA 3R1QA 4TYHA 2BKZA 2QURA 2VWWA 3ZSGA 4XLIA 2H96A 5M09A 4D0XA 5B0XA 4YSJA 5KZ0A 4BDAA 4D4SA 1WCCA 2E2BA 4QMPA 4GYIA 4D58A 3BELA 4ANSA 5IH4A 4HDOA 3OXZA 3U7DA 2A27A 3HUBA 4EYJA 2YSZA 1MQ4A 1WBSA 4O7NA 4KHAA 2OJIA 1J0WA 1RJ2A 4O7TA 4BI0A 3RCJA 2VWBA 1UU3A 4S30A 3F5XA 3PY0A 4E6QA 1GC6A 4PUZA 3ZUVA 2IVTA 5IH6A 2R3FA 2ZM1A 3QKLA 4UWYA 2E9UA 3MA3A 3UO5A 4LM5A 4KUJA 4I1ZA 4F7NA 3D5VA 1FGYA 3QX2A 3WIGA 4FTQA 5IKWA 5J87A 3QQGA 3V5QA 2D9YA 2DYLA 4RJ3A 2BILB 3AT3A 3EH9A 5JQ5A 3UOJA 5L8LA 4HVHA 1UNHA 2VTRA 5KBRA 2I5FA 4HCVA 3NNUA 4B0GA 4M13A 2IYBA 4LQMA 4U41A 2ELBA 2NPQA 3HV4A 5IISA 2ROVA 4BL1A 3HDMA 4O27B 3RALA 5D3VA 3OCSA 2CJMA 4I5CA 1NVQA 4ZSLA 2WB8A 2UZLA 5DFPA 4NL0A 3QUPA 4J8NA 5IG1A 1NI2A 3B8RA 3RP9A 3FI2A 4NKSA 4M66A 3MFUA 4XUFA 4NYEA 3SOCA 4ZJJA 4CZTA 5AP3A 5EM6A 3ZZWA 3A7JA 1QPDA 2I6LA 3K3IA 3OUNB 3LJ2A 4DFLA 2I7QA 4L44A 4WNOA 4BCOA 4GUEA 3FMLA 3QHWA 5IQFA 3DOGA 1YQJA 1PXMA 3OW4A 4M14A 3HV3A 3A98B 1H0VA 2BFYA 2PMIA 2JDTA 3PIXA 3QQUA 2WTWA 3HKOA 3PYYA 5M08A 3TNIA 4FBXA 4ANNA 5J9LA 4ENYA 5E91A 2YM6A 3QTZA 3D83A 4ZOGA 5DA3A 2PVKA 5EH0A 5CLLB 2ELAA 3KULA 1KOAA 5CXHA 4AT3A 4EJNA 4HYSA 4DCAA 2CGXA 5JQ8A 5E8TA 3TUDA 4OAUC 3Q5ZA 2V22A 3KK8A 4EOIA 2XA4A 4DYMA 3DV3A 5IA1A 4RVMA 2VU3A 3SUZA 4JBPA 3ZS5A 4P7IA 2WMAA 3FY2A 4QQ5A 3F5RA 1M7NA 1V0PA 4FV3A 3LJUX 2XNOA 4LG4A 4ZMFA 4ALUA 3P7BA 1OL2A 2CKOA 1H1QA 2R3HA 4KIPA 2GS2A 3A62A 3FXZA 4IVBA 3ZFMA 4R7IA 4F7UP 3RJCA 2W5AA 4IZ5A 2XBJA 2YS3A 4S31A 3S2PA 5CAQA 5AP7A 3MTFA 5CF5A 3W55A 5IA5A 4DTKA 5FXRA 3P4KA 4K77A 3HV6A 2BTRA 4JDJA 3FL5A 2XRUA 3E87A 3E7VA 4MXZA 4AF3A 5BPYA 4XV2A 5CI7A 2OWBA 4X3FA 2ZV8A 2PK9A 4GN1A 4FNWA 4BKYA 2F49A 2XQNM 1UNQA 1VJYA 4CHJA 4YJTA 1Q8WA 2OF4A 5C8MA 4GK4A 3MB7A 3MPMA 5EKNA 3FMMA 4UMTA 3MPAA 3A4PA 3UYTA 1ZLTA 4FEXA 5ACKA 3D5WA 3G9LX 4I93A 2W4KA 4J99A 4WIHA 3TKIA 5E92A 2IVVA 4ZAUA 4DT9A 2UV2A 2GNIA 4K9YA 1NY3A 2R3KA 1GAGA 4FKWA 2REIA 5EDPA 3CD8A 1X11A 4ITIA 2WNTA 3D7TA 3AT2A 4DX90 4ONAA 1U46A 3KL8A 4L00A 1YI4A 3I7CA 4GCJA 4L7FA 2WTDA 3TWJA 1TVOA 4PDOA 2LGCA 3CLYA 2H7EA 1Q99A 2XM9A 4TYIA 4ACCA 4R77A 4PP9A 3OMVA 1W0XC 1YOLA 4U81A 5DPVA 5KCVA 3ZONA 4RGJA 4QNYA 4FV9A 4IVAA 5AIRA 4BZDA 3H0ZA 3R7VA 1PXNA 4RC4A 1WVHA 3V51A 4DFBA 2Y4IB 4E6DA 4H36A 3ETAA 4XBUA 4YZ9A 2X9EA 3WF6A 2PTKA 2BMCA 4LRMA 4NUSA 3DBDA 3UTOA 2QI8A 3VS0A 4D2PA 4DEAA 5FP6A 2YM3A 4UMUA 1SGHA 4PMSA 1XD4A 2BFXA 2ZDTA 3KK9A 2W17A 1PHKA 1W84A 2XIRA 3LXLA 4U43A 4KIQA 3R8ZA 2P2IA 4GZUA 4MD8E 2Q13A 3DK6A 5AP5A 5HBHA 2HCKA 3Q3BA 5IMXA 2ZB1A 2WIPA 3NCGA 3AJ4A 4MD9E 3QHRA 3VHKA 5K5XA 4XLVA 4BIEA 5EQPA 1VR2A 4H3PA 3IO7A 5GJDA 4FKQA 1Z87A 2ZV7A 2QLQA 3PA5A 4ACDA 3F2RA 4IWOA 4IW0A 2B55A 4GU6A 4EUUA 1FHXA 4DGMA 2OU7A 1ATPE 3G6HA 3NSZA 4M69A 4AG8A 5LCJA 4Z55A 2XNNA 3LFDA 1OKYA 3IVFA 2CGWA 2YRYA 3GP0A 4O38A 4EKLA 2C6EA 3OBGA 3ZSHA 1KE8A 3ZU7A 3AD5A 4FV5A 4H3QA 3IECA 4S34A 4W4VA 3C5UA 1ZYLA 5ANOA 5HCYA 2XNEA 4PF4A 4XHKB 5AR7A 4BTJA 3TTIA 4BCHA 3MVHA 5AIKA 5KMMA 2QONA 2HWPA 3BQRA 3EQBA 5CZIA 4U40A 4A6FB 4GEOA 4R1YA 5AV2A 3LMHA 4N57A 3AC1A 4XS2A 2PZYA 4L53A 3F6XA 1XH8A 1NVRA 2YEXA 4PPAA 4L01A 3D5UA 4QP4A 4A07A 1PMNA 1XO2B 3HMOA 4KBKA 1U5GA 2X6DA 3F2NA 3F61A 1OL1A 1JSTA 3ZRMA 2GU8A 3FKLA 4Z16A 2GNFA 1XR0B 1YOJA 5LVOA 1BAKA 2OKRA 3MTLA 3NIZA 2W5BA 4YBJA 5ANKA 2YS5A 4GMVA 1JKSA 2YT1A 1CMKE 4BKJA 4IVDA 3ML4A 2YLFA 2J6MA 3A7HA 4L9IA 2GFCA 3IGGA 3IS5A 4JR7A 4AUAA 3CP9A 1U2BA 1FQ1B 3TNQB 2WQEA 3VW8A 5CNOA 4C36A 2XUUA 4XRJA 2BDFA 4O0RA 3OTUA 1JSVA 2BRHA 4BTFA 5DHJA 4EK6A 4TWCA 4E4LA 4FG7A 3SG8A 3LAUA 4G5JA 4QMUA 4QYHA 3RKBA 3LM5A 2CN5A 2P0HA 4I6HA 4UMQA 4JL9A 5CAPA 3UQCA 2WIHA 3D9VA 3R9OA 4K11A 4R5SA 1XH4A 1GIJA 2BDJA 4E5AX 4F9CA 4GG7A 5IQEA 5DRBA 3QUEA 4HYHA 4B8LA 1V61A 4PNKA 2PSQA 4O2PA 1UV5A 2BAQA 2N0YA 3CTQA 1E9HA 2AUHA 1F3MC 2PVRA 2GCJA 5DG5A 3VJNA 4AT5A 3S1HA 4QMZA 4GV1A 1AGWA 2IZSA 1W1GA 3FQHA 3FZSA 4GVAA 4KAOA 4PDSA 4QP7A 1Z57A 3DJ7A 5AP6A 4ZSJA 3R7EA 3ZCLA 4MT7A 3AC4A 1RW8A 3AC3A 3IDPA 4DA5A 3FLWA 1DDWA 3CJFA 5AV0A 4A9RA 3N4UA 1SNXA 4WBBB 4OTFA 4IDVA 5AUYA 3ACKA 5CSVA 3BYVA 4WSYA 4RFZA 4TYGA 3ZYAA 4DGNA 4O81A 4MXOA 4KAXB 2H7DA 4UWCA 3QZIA 4TYZA 3HAVA 3K2LA 3HL7A 3A4OX 1RDQE 4KKHA 4DCEA 2YZLA 3MH1A 2RFEA 4FG9A 4A4XA 3FXWA 4B99A 2MWNB 3PSCA 4C4EA 3WZUA 2I5CA 1YXTA 2O65A 3MPTA 2RL5A 3QGYA 3PIYA 3PA4A 4I0TA 4ERKA 4Z7HA 4TKNA 4HAYB 2OBJA 3QWMA 2VO0A 3FUPA 4KA3A 1YVJA 4C61A 3ULBA 3ZZEA 3MH3A 4BTKA 3WF5A 2HENA 3ANQA 2R0DA 2CN8A 1M2QA 1DM2A 3OVVA 1XQZA 4OBOA 4DLIA 2XKEA 4WO5A 4Q5HA 2B9JA 2RLOA 1BTNA 2DN6A 2D9ZA 3QFVA 3ODOA 4O7YA 3EHAA 5IZFA 5EM7A 4WBOA 3VUDA 4D9UA 1P4OA 3VW6A 3FSKA 3L9MA 1KE9A 4CQEA 4U79A 1OITA 3C4ZA 3VS1A 3RAHA 4FX3A 4DTBA 2YIYA 3VHEA 4QYYA 3U54A 2HWOA 1YHSA 3AC8A 1DI8A 4X3JA 4YZCA 5CS6A 1OPKA 3R7YA 1U27A 3ATSA 2JD5A 1Y8GA 3LPBA 4F7JA 3NWWA 2VWXA 4FTTA 2Z02A 2VX0A 4BIBA 2QKRA 1GZNA 1QL6A 3TNPC 4YURA 2C68A 5EYMA 2XEYA 3Q4ZA 4FTLA 1GC7A 3AU5A 2XNGA 4M97A 4V05A 2QG7A 3N4VA 4C4GA 4TWOA 3GOPA 4HNIA 5M56A 4YJPA 2J0IA 4EMOA 4G9CA 5I0BA 4IXPA 4IH8A 1OIUA 4RSSA 5ETFA 3LQ3A 4M67A 3LMGA 3MIAA 2CKQA 3NYNA 4IAKA 3CSVA 5D3WA 3HMMA 5K0KA 1FBNA 2IW9A 5HLPA 4XBRA 2YM8A 4ERWA 4L6QA 4JAIA 4QMLA 5EHOA 4JR3A 1O6YA 2WOTA 3W8QA 3ZFYA 1G5SA 2CLQA 3LXPA 3DT1A 1H1SA 4HCUA 4NJDA 4RT7A 3TG1A 3CCNA 3VRYA 2XIZA 3JUHA 5ETAA 5LVNA 1U4DA 2FJLA 1J7LA 3QLGA 4JNWA 4ALVA 5AEPA 1G8AA 2X4ZA 2W1DA 2F7EE 2WMTA 4I4EA 4NU1A 5DT3A 4QQTA 4WOVA 2ITWA 3EL8A 2G2IA 2EUFB 2A19B 2WMSA 4NTSA 3EFWA 2YVCA 4FG8A 2WEIA 5LJJA 4C4HA 2W1ZA 5HNBA 4HGLA 4RIWB 3ZOSA 2KUPA 5CNNA 5ETCA 3W2PA 3ZDTA 4X3FC 4UZHA 4EZ3A 1W8CA 4I5MA 2AC5A 4NWMA 4R7HA 5ANDA 2D9VA 3HVCA 5BVKA 1AQCA 2PULA 4F09A 1UU9A 3R7OA 5DIAA 1PF8A 3LLAA 4U3YA 4XOZA 3AXWA 4IFCA 4J97A 5A4TA 3NUPA 4CSVA 4NEUA 4EOQA 3TW1A 1K2PA 3HRCA 3MFTA 5EI6A 3I1AA 4D2TA 4A6HA 2YDJA 4FE2A 3H10A 4ZXTA 5LVMA 3PE1A 4Y5HA 2GNHA 4EH3A 4LGDA 4YHTA 4BCJA 5AAGA 4V0GA 2LOZA 3GYOA 5FEQA 3C9WA 4ZMEA 3DBQA 2ZM3A 1CKPA 3GOKA 4K6ZA 5L2QA 4E93A 4EQCA 3FL4A 2M38A 2EB2A 3UBDA 3MESA 2FVDA 2WMXA 5M06A 4BICA 5FDPA 3OW3A 2WMWA 2ADZA 1O6KA 2ZDUA 3DXDA 4AZEA 4NSWA 3SNHA 1Y57A 5GZ8A 2I1KA 5FBNC 3O7LD 2UZRA 1G8SA 2DKPA 3GB2A 1OL7A 2CMWA 3UOHA 3HP5A 1KOBA 4MXAA 4C4IA 3U6IA 3SLSA 4IB3A 1U5EA 4K17A 1KE6A 4HGSA 3PJ3A 1FHOA 3ZHPC 3RBWA 1OIQA 1BKXA 2WTKB 3IKAA 4FEVA 3AOXA 2JIVA 1YDTE 4C0TA 5HOAA 2PZ1A 1Q4LA 2J5FA 3DZOA 2VO3A 4CFWA 5JLJB 3OF0A 4QD6A 4HZSA 3SG9A 1Y91A 4UBAA 1FMOE 3Q4CA 3WARA 2OFVA 3UQGA 4AAAA 3Q9YA 4FNXA 3MWUA 4O7LA 3H9RA 3PZEA 3RM6A 5CSPA 1H26A 3KXHA 1H8FA 4IIRA 2VGOA 3RAWA 4DFUA 5HNIX 1W1DA 2DS1A 4X2NA 4QMSA 2WXVA 1OBDA 2XKFA 5HCXA 3ZEPA 3A8QA 1V89A 4GFOA 3OOGA 3PRFA 4L67A 4C34A 2JDVA 3R28A 2DA0A 4G9RA 4NKAA 4O0SA 2IO6A 3HLLA 1URWA 3NEWA 4HGEA 2GCDA 2PZPA 1MK9B 3PVLA 1L8TA 3BBWA 4WKQA 4MKCA 5BVNA 4Z2NA 5CU3A 3UZRA 5H8GA 3GCUA 2QOHA 3DAEA 3IDCA 3PY3A 4GW8A 4P90A 1QPJA 4KSQA 3QIJA 5HE2A 3HMIA 2ERKA 4WSQA 5DNRA 2RFNA 2LG1A 2XRWA 1PKDA 4IAIA 4JOAA 1LR4A 2BKKA 4Y85A 1SZMA 3F5UA 4E73A 2R3RA 2RF9A 1WVYA 4JX7A 4BB4A 4FVPA 4AW5A 4BDCA 2BCJA 3OC1A 2PE1A 3QWKA 1PXIA 2R3PA 4FT9A 2XH5A 3LVPA 4G6LA 3R9DA 3TKHA 3ZC5A 4AWIA 2DX1A 3KXGA 3QTSA 4QP3A 5GNKA 4B9DA 3MI9A 1MK7B 3JY9A 3S4QA 4EZ5A 1Z9XA 4N4SA 3IK3A 3JVRA 2LAVA 4BCNA 2QKMA 3ID6C 3QRIA 2XJ0A 2Y9QA 4D2VA 2J50A 4DFXE 4HPTE 2IW8A 4FEQA 4W8EA 3GU7A 3A8WA 3SHEA 4NK9A 2UW8A 3T8OA 2W1IA 4D55A 4HB2B 2OJGA 2ONLA 2CRFA 2K2UA 3PIZA 5KHXA 1R0PA 4GSBA 2J59M 1PXOA 3D8DA 2CGVA 5LMKA 2YITA 4RVKA 4YHFA 2D2QA 3UO4A 4X2JA 3W2CA 5A9UA 2M14A 5FI1A 3QCQA 4G2FA 3BRBA 5CENA 1CTPE 4GG5A 4II5A 4XV9A 4FIHA 5BQ0A 3EN6A 4A6KA 1JNKA 3BV2A 3TUBA 3G0FA 5AR8A 4AE6A 2VSZA 3MV5A 4NM5A 1ZOGA 2VTMA 2XF0A 1AQ1A 5E1EA 4DH3A 3O96A 2VV9A 2IG7A 2Q83A 2IVSA 2WTVA 2E9OA 3O51A 4PQ0A 5FM2A 4I94A 4MWHA 2RKUA 3R7UA 4GIHA 5BYYA 1ERKA 5IH5A 4EZ7A 3DKCA 5D9HA 4QP2A 4BCFA 5KKRC 3UP2A 3DB8A 4YLLA 4WG3A 4G16A 3VUKA 4Y73A 4BY9E 3E93A 3DQWA 5D12A 5HE0A 3GVUA 3R71A 3RZFA 3WF8A 4C02A 1P2AA 3T3UA 4ACMA 3QGWA 2VTIA 3CE3A 4Q2AA 1LW3A 5FEDA 4C62A 4HATB 4F7GA 4EWHA 2VWIA 3ORPA 4I4FA 4DGGA 3KVWA 2P2HA 1RQQA 4CFNA 3CQWA 3EQHA 3FI8A 1ZAOA 2H6DA 3LFEA 3L8VA 4BGHA 5DHAB 4XOYA 4G6NA 5J3TA 1UU8A 4YZDA 2ITUA 2I0EA 3PG3A 3DB6A 3TV6A 3W2QA 3OHTA 5AP2A 3O8TA 5CT0A 4FTNA 2EC1A 4OT6A 3R02A 4H05A 2C1AA 4MBIA 3NYVA 2YIRA 3VF8A 4AN2A 4KIKB 4ACHA 3PXRA 3OUKA 3LE6A 4DLJA 5J79A 4F0IA 2V5QA 5KO1A 2CSNA 2WKMA 4GT4A 4NW5A 5DOSA 3VBXA 2EWAA 5D7VA 2OGVA 1GZ8A 2VWVA 3UZTA 1XR1A 3E62A 3L9PA 4M7IA 4ZEGA 5HE3A 4IC8A 2ZAZA 3RI1A 4C3RA 5F94A 2YERA 3NUAA 5F1ZA 5HTBA 2C6KA 4O2ZA 4FV4A 4YZMA 2PUPA 3GU6A 3RPYA 3RCDA 3H4JA 4GH2A 4BCKA 2G01A 4EOOA 3S00A 1OM1A 4F63A 1TQZA 4KD1A 4XP2A 2NMBA 3ET7A 3G9NA 4N70A 4USEA 5I5ZA 1E5WA 5EI8A 1ZMWA 1YRPA 3EN7A 3GT8A 3WF9A 1H24A 4BHZA 5BUJA 2RUKB 5HI2A 4KBAA 2BIYA 3ORIA 4MH7A 1FMKA 1VYWA 5HD7A 5B7VA 3SVVA 4A6FA 5IEYA 4RFMA 2FO0A 2GHLA 2R3IA 4S2ZA 4EHVA 4M0ZA 4PTEA 3VWAA 2C5XA 1U5FA 2VTSA 3BYSA 1Q61A 3NNXA 4GL9A 4L3JA 3QQLA 4QYEA 3RZBA 5KMNA 4O7RA 4EC8A 5I4NA 5EFQA 2VTAA 3FI4A 3Q2JA 3FKOA 3F3VA 5HLNA 2X81A 3ULCA 4FC0A 2SRCA 4JQ7A 2YACA 3IW8A 4FSYA 5HBEA 4AP7A 3QA0A 4QNAA 4ARKA 1R3CA 5AAFA 4K2PA 4PRJA 3GU8A 3QZGA 3DCVA 4KABA 4X7QA 3ZO1A 5E1SA 3PVGA 2PVLA 2IN6A 3LZBA 2X9FA 1H01A 3DZQA 5EW8A 4CV9A 4X0MA 1T46A 2VX1A 5AMNA 2GQSA 2JKKA 4OGRA 2J51A 3ROYA 3CIKA 3DFAA 4FL3A 4PMMA 5K5NA 1KUTA 2NZ8B 5A4CA 3DXQA 4YJSA 3F69A 4XG4A 4LRJA 2XP2A 2VD5A 5B2MA 2UW6A 3LJ1A 2XKDA 4ALWA 2Y6MA 4OLIA 3KN6A 2DTCA 4IMYA 3DBCA 3HA8A 3KVXA 4QP8A 4KSPA 5LCKA 2P33A 4UB7A 2J0LA 3VS3A 4BC6A 4F70A 2F7ZE 4L68A 3WE4A 2DFKA 2PL0A 3NSUA 2WU7A 4YPSA 4RIOA 1WBOA 3PE2A 2PE2A 3BGPA 3DXNA 5CSHA 3ZRLA 4F9WA 2HXLA 3VS4A 4L42A 4V0GB 1Y6BA 4BN1A 5KHWA 4D9TA 4CNHA 5J5SA 1X1GA 4IC7A 2LOXA 4ID7A 4IDTA 4AZSA 4YJOA 3EOCA 3FZRA 4G17A 5FUTA 2W0JA 4O6EA 3ENMA 4DFYA 2PWLA 3IW6A 1UNPA 3FHIA 3KCKA 3P7AA 4IM2A 4JIAA 4XX9A 2D10A 4YJRA 3MA6A 3FMNA 5D3YA 4N6ZA 1YHWA 5K4JA 4DH8A 1Q8ZA 1OY2A 2C0TA 1R78A 4YGAA 3RWPA 4O7WA 2E9PA 4Y94A 1HCKA 4IQ6A 3NVKI 3DAKA 2Z0OA 2GS7A 4ANLA 3ODWA 2UUEA 1NW1A 4GJ3A 4FK6A 2QG5A 5BMMA 2C6TA 1ZOHA 2J4ZA 3RGFA 5IQBA 2R7IA 1H28A 3ZRKA 3H9OA 4NFNA 1SNUA 3U4UA 5ACBC 4PQNA 1DBHA 4FF8A 3KRRA 1DAYA 4O0WA 1VYZA 4W9XA 3QTIA 2WEVA 4TZRA 4XYFA 5ANGA 3L9LA 3I7BA 2E9NA 5EYDA 5EYCA 3Q04A 4CTBA 3SAYA 5CVHA 2ETRA 4BDGA 2K00A 2R4BA 4IBMA 4L45A 4G3CA 2XIXA 4RJ7A 5HX8A 4HZRA 1ZMUA 1XBBA 3GC9A 3FXXA 4AOIA 3P6AA 2GSFA 4RRVA 2VGPA 3DBFA 4O86A 1XBAA 2C3LA 5KQ1A 3C1XA 1IRKA 4CQGA 3MN3A 2ITYA 3D5XA 1RRPB 5HU9A 2W1CA 4BCQA 3D2IA 3JS2A 3U51A 4UYAA 4K81A 1I2HA 1ZC4B 2O2UA 1GOLA
chains in the Genus database with same CATH superfamily
4E8AA 1PXKA 1ZYJA 2R2YA 2W9FB 4HYUA 3F0WA 5L2IA 4JX3A 5H8BA 3TM0A 5BUEA 3TMOA 4IANA 2AL6A 2Y7BA 3FLZA 3RTPA 1UEFA 3AT4A 3FZOA 3FAAA 5C26A 2P55A 5LVPA 1CM8A 2Z13A 3V6SA 4K18A 3UMXA 2ESMA 3I6WA 3JYAA 1UU7A 2IWIA 1IAJA 2X4FA 2XYUA 2UZVA 4WG5A 4C35A 1TJ6A 1FVTA 2GS0A 3R9NA 5I9VA 3QYWA 1JKLA 2X2MA 4BZNA 1H0WA 3M1IB 4ZSGA 2PMLX 4GYGA 5IDNA 4YC8A 1UNRA 2CKPA 2X8EA 4CMOA 2R9SA 3HUCA 4XRLA 4YZNA 4F7SA 2QHMA 1H08A 5IUGA 5GJFA 5A6NA 1W98A 4RJ8A 2IW6A 3NPCA 1MUOA 2BIKB 1WAKA 3C0GA 4FVQA 3THBA 5DT4A 3R8VA 4QMNA 5A54A 1PRYA 3SV0A 3ZBXA 3X23A 4FTIA 3A8XA 3PFQA 4DEHA 2YWPA 3KREA 2P0CA 4BJJB 2J2IB 4NW6A 4CYEA 3RPVA 3NIEA 5M07A 4IX5A 1YOMA 3DK7A 2ONLC 1OPJA 2JC6A 2YLEA 4IB5A 4ANBA 5I9XA 5J9ZA 2O63A 2QOBA 3GBZA 2QVSE 5LMKC 4AXFA 5C8KA 4JDKA 1KV2A 3LQ8A 4G1WA 3V5TA 3OEFX 4EH4A 1ZWSA 2XVDA 3HW2B 4L1RA 1TQPA 2CKEA 5E4HA 3VBQA 4E26A 5C1QB 2DKQA 2LKOA 2YA9A 3P7ZA 5LONB 2W2WA 1L3RE 4TRLA 2OK1A 4RIWA 1EVHA 3ATTA 4O7SA 4XG6A 4BDEA 3PZHA 2IVUA 4QMTA 4UALA 1MAIA 5IEVA 3FDNA 3ROCA 1UKHA 3AC2A 3DJ5A 1Q62A 5IU2A 2PVJA 2HE7A 3C4XA 4GMXB 4BBMA 2VN9A 3SW7A 4O96A 2KIGA 3M1SA 4YR8A 2BALA 4O4CA 1RJBA 3V6RA 5D41A 3K3JA 5CSXA 3CPBA 3BLHA 5GIOE 3UODA 3LCOA 2YIQA 4OTPA 2YDIA 5CU4A 5I9ZA 4HW7A 4HJOA 2BZKB 3PXYA 3BKBA 4D4YA 3ZH8A 3GC8A 4B8MA 2KIEA 2OJ9A 1Q41A 3DTCA 3R2BA 3LXNA 1OL6A 4JDHA 4A9TA 4IZYA 4DBBA 3TZMA 3KU2A 5EDQA 2VWYA 3W32A 3GI3A 1FHWA 1A9UA 4Y83A 3CY2A 3QQHA 5ANEA 2B53A 5CU0A 3QBVB 4F65A 4AQKA 3C0HA 3AGMA 2Y8OA 5DVRA 5LWMA 4O7ZA 2GHGA 2Y4IC 3UG1A 3P08A 2WU6A 2V7AA 1YXSA 4QMXA 2RGNB 5AM6A 3K5UA 3G6GA 4FIGA 5KMJA 4R7BA 1HOWA 3BGQA 4MVFA 4JIKA 3ZLWA 3HK0A 2QOIA 1OB3A 2R3JA 4Q9ZA 5A46A 5CAUA 4L52A 4YBKA 5IQHA 3TXOA 2OXYA 2HYYA 3TCAA 3FV8A 3QD2B 3QWJA 4RPVA 2UW3A 4R1VA 3G33A 4XMOA 1BI7A 4BCMA 1OQNA 5ANJA 5FI0A 3SV1A 1CKJA 1FVRA 3LQ5A 3LXKA 3W0PA 1ZY4A 4E3CA 1ZZ2A 3QF9A 2B0QA 4W4YA 1WVWA 1JLUE 3ORNA 2DLWA 4CKJA 1ZSQA 2JAMA 3BLQA 2CDZA 2FGIA 2C6LA 3E8DA 1PMEA 3PY1A 3FC2A 4U8ZA 2X2KA 5JRQA 2PPQA 2WO6A 3HZTA 3QRTA 1MPHA 3LCKA 3HRBA 1APME 1YXVA 1QC6A 2EXEA 4KB8A 4O1OA 1U54B 4XG9A 4E6AA 5J5TA 4FTRA 4W9WA 1BL6A 1IA8A 4FKLA 3TACA 5E8YA 4A7CA 1IG1A 2GFSA 1N3HA 3COMA 4AOTA 4J71A 3HRFA 3HEGA 4H58A 4FSQA 1OI9A 4MF0A 3TL8A 3T06A 2O0UA 5HO8A 4FKGA 4BCPA 5H9BA 3GFWA 5CTPA 4ZSEA 4WNPA 3C51A 3PWDA 2HELA 5E8WA 2W96B 3AD4A 2BZHB 2HW6A 1WI1A 4U5JA 3T3VA 3DNEA 3NUSA 4EQUA 4KWPA 3OT3A 4O0UA 4EQMA 4DHZA 2RGPA 2FSLX 3F5GA 3OD6X 5AWMA 4Z7GA 1M7RA 1DS5A 3NGAA 3W2SA 5AUUA 5D27A 3UP7A 3GU4A 3ODYX 2XIYA 1SVHA 2I0VA 3OG7A 4ANMA 3M42A 3R9HA 4FKVA 5F9EA 4BCGA 4E4NA 4F0FA 3FQEA 2HAKA 4IHPA 3R2YA 2VNWA 1E1VA 4CFMA 4C4JA 5L2SA 1R39A 4FL1A 2R3GA 4U0IA 4EH8A 4XWXA 4LYNA 3H30A 4XJ0A 4DEGA 5M55A 5CEQA 4E4XA 4BDHA 2C6OA 1WFCA 4OAVB 1P5TA 4BR3A 4CT1A 1UVRA 2OJFE 5CZHA 5K9IA 2PZRA 3G2FA 3QKMA 5L2TA 5LOPB 4NM7A 3F3TA 1JKTA 4PNIA 4ANQA 3EYGA 3R1NA 5BMSA 1LP4A 2UW0A 3NUUA 3P78A 4WD5A 1UNGA 4ZTHA 3KXXA 5AR3A 4F99A 3KSYA 2PVFA 2UZWE 5AUWA 2WQMA 3SOAA 5C79A 4IWDA 5M4FA 2GCLA 2R64A 2HZ0A 3SD0A 4OTDA 2C3IB 3ACJA 3N4TA 3UVPA 4QPAA 4ENXA 2WZJA 3OROA 2YF0A 1WBNA 4NY0A 5I9UA 3KF7A 4YPDA 4ZTSA 2X1NA 5KBQA 4RWLA 3VBVA 4QQJA 4X21A 5J95A 4JXFA 4X2GA 5AR5A 5JK3A 2XZSA 2CNQA 3F2AA 4G3FA 3BYMA 4LOPA 5HHWA 5CQUA 2VUWA 4EH7A 2X0QA 1TZDA 2OICA 4MXCA 5JN2A 4WRSA 3BU3A 2BRNA 1GJOA 4HB3B 4PL5A 5LXMA 5HD4A 4USFA 4I0SA 4H1MA 4ZRIA 5CVFA 4ZSAA 3WZJA 2JEDA 3CBLA 2IZTA 4F6UA 3OEZA 4AGDA 3OXTA 5HG7A 4KRCA 1Y8YA 1YDSE 3UIUA 4GKIA 4AAYA 3WILA 1H10A 3E8NA 3DAJA 3RAKA 4I24A 2A1AB 5TT7A 3B2TA 1MRVA 4BZOA 4TNDA 1JWHA 4HAZB 3MYGA 3HP2A 5L6WL 4ZLZA 1ZXEA 2C3KA 4OTIA 1S9JA 4G3EA 3G90X 5E8ZA 4KIKA 4F7LA 5HU3A 2JKMA 2LULA 4AGCA 1WZYA 5FXSA 5CF8A 3P79A 3PVWA 4G34A 5M53A 2CHLA 2JIUA 3C4FA 4DC2A 3EYHA 5H2UA 2ITXA 3GCPA 4O0YA 2DYQA 3VOQA 3ZLSA 4QMQA 1MRUA 2IJMA 4QTDA 3SW4A 1O9UA 4CEGA 4HGTA 5J1VA 5CU2A 3H9FA 1BLXA 4QPMA 4U3ZA 4UEUA 3K54A 4QDVA 3QALE 4YP8A 4CFUA 3QBNA 4DAWA 1OKZA 5JFVA 1LEWA 2YJRA 4P7EA 4YJNA 1UNLA 3LFFA 2HXQA 3BQCA 2DUVA 4NH1A 2WTIA 4YUQA 1U5DA 3NW8A 4ZIMA 4I6BA 5C8NA 5JZJA 3A7IA 4HAXB 2RG6A 4O22A 2HIWA 3EJ1A 2Z60A 2VZ6A 4D2WA 1XH7A 2FSTX 5AV3A 3OXIA 3VRZA 3DXEA 4BHNA 4AS0A 3SX9A 3EQRA 3MSSA 4M0YA 4FIFA 5AJQA 2PVNA 4DH7A 4R5YA 5I3RA 3AQVA 3EWHA 4TWNA 4V01A 4QQCA 2PY3A 4AXCA 3FLNC 4G3GA 5D3XA 3PVUA 4OTQA 4L43A 4OSNA 4U80A 3LW0A 5J3QA 3I4BA 5CWZA 3RPOA 1P3RA 4RMZA 3BZ3A 4DDIA 4QTEA 2Y4PA 4FZ6A 2XNBA 4BYJA 2KCJA 4UYNA 2IF8A 3GNIB 5GJGA 3SQQA 4U97A 1UPRA 3KZ1A 4AZTA 4MD7E 3WBLA 1UKIA 2ZKMX 5DI1A 2YIWA 4DITA 2B9IA 5AM7A 3WOWA 5LVLA 4WG4A 5JKGA 2UW9A 1Q3DA 2R2PA 4BYIA 5J7HA 1XKEA 4MCVA 1URCA 2HK5A 3NYXA 3P5KA 5EHYA 5HIEA 1B39A 5A14A 1I44A 4ZJIA 5A4QA 3F5PA 2JBPA 4FZAB 3GYPA 1DDMA 4LUDA 3WZEA 3PLSA 4E4MA 3EQPA 4KKGA 3FMHA 4DT8A 1FPUA 3P86A 3W33A 4PY1A 1NTVA 4JS8A 3LJ0A 3V5LA 5L6PA 4CCUA 3V3VA 4FR4A 4U45A 2UVMA 2Z0QA 4NT4A 4CTCA 1Q97A 3PJCA 1DAWA 2B9HA 4UZDA 3VBWA 4YO4A 4R6VA 1GY3A 2C30A 4EEVA 3U8WA 5HLWA 4BI2A 2Y6OA 5HTIA 3CKWA 3O8PA 3MDBC 5AA9A 3NLBA 2WTCA 1XBCA 4UXLA 4CRSA 1OVEA 3K5VA 3BWFA 4A9SA 2BR1A 4IAZA 4E5WA 4QTCA 4XNEA 3QZHA 2C5VA 2BZJA 3VBYA 4G3DA 1K3AA 4AW2A 3COHA 4ZK5A 3D8FA 3TDWA 1TQMA 1Y5OA 3BGZA 4E1ZA 2YM4A 3SGCA 1H00A 3U4WA 2BHHA 3P23A 2F57A 5KX8A 1V5MA 5GINE 4ZZNA 4UV0A 2UW4A 2YJSA 1GIIA 3DJ6A 3PXFA 5DBXA 2WELA 2GTMA 5FTOA 2C6MA 4RIXB 3QTXA 3BYUA 4BCIA 4F78A 3D4QA 4B7TA 5IF1A 1J1BA 3UQFA 1MIXA 2R0IA 3GQIA 4BWKA 4AXEA 4HHVA 5JFWA 2JBOA 5HORA 2XK7A 4BDDA 4QRCA 2XYNA 4ZTNA 2EJ8A 1ZZLA 4DE4A 3TIYA 4U42A 1NA7A 3OWKA 5CASA 2MDXA 4ITJA 4EC9A 4IJPA 3DBEA 2COCA 2WAJA 1FOTA 2NO3A 2X7OA 3GC7A 3PUPA 5BVWA 4HPUE 4BDJA 1Q5KA 2GPHA 5B2LA 3KRWA 4W4WA 3UDBA 2G1TA 4YONA 2DHKA 3G15A 5M44A 1W1HA 4CLJA 3RCPA 3NCZA 3AMYA 2RSGA 2WTKC 4FKTA 2VWUA 4E20A 3OWPA 2ITVA 5C4KA 3KKVA 5J8IA 3KIOC 2UW5A 4F9YA 5A4EA 2YS1A 4CRLA 3UYSA 2I40A 4IJ9A 4FVRA 1OMWA 1WBWA 4FTKA 1YHVA 2DX5A 1Q8UA 3B8QA 3RINA 3TZ7A 1ZY5A 1JOWB 4NIFB 3R8MA 4F4PA 2GS6A 2RG5A 5J1WA 5L4QA 2UZBA 2XNMA 2WMBA 3C4WA 3D94A 4YO6A 3IW7A 3TNHA 5JMSA 5JRSA 2BROA 3HNGA 4FTAA 3GCQA 3D2KA 3LFQA 4XG3A 3R7IA 2C1BA 4EORA 4FEWA 3DQXA 5EQYA 3C50A 5BYZA 2VTQA 4QOXA 4ZLOA 3W1FA 3U55A 4L6EA 4QT1A 1J1CA 4PL3A 3UPXA 5C5BB 3FMJA 1DI9A 2DYNA 3BL7A 4BTMA 5EHLA 4IWQA 4EI4A 4MAOA 5D11A 2GQGA 4JI9A 5C4LA 2V62A 3CJGA 3VO3A 2OH0E 1PYXA 2BHEA 2UZUE 3BV3A 4J8MA 3RPSA 5JFSA 4WUAA 4CZYB 4DTAA 4F9BA 3OANA 4Y72A 4CFVA 5CAVA 4P5ZA 4WT6A 4I3ZA 1M7QA 4FV6A 2Y8FA 3A58A 3TCPA 4C37A 3NFFB 4Z2MB 1V88A 4O91A 1NU2A 4DEIA 3S3IA 4AX8A 3B2WA 5KMOA 3UNKA 1U29A 2QKLA 3P9JA 3U87A 3OP5A 1XH5A 2CGUA 3WI6A 1KZGA 4ZTRA 4HCTA 4LGHA 1IEPA 5HQ0A 2YT0A 2BRGA 5HTCA 3CEKA 3ORZA 5KMKA 4DBXA 4LOOA 1H4LA 2NP8A 2R0UA 4CV8A 3TVVA 2G15A 2GJYA 3BYOA 3KGAA 2C5YA 2JKOA 3A2CA 3JY0A 4KKEA 5CSWA 5EM5A 1JSUA 4FKPA 3SRVB 4DFNA 3UPZA 3Q4TA 2E9VA 1ZYIA 4I92A 3HYHA 2FJUB 4KBCA 5AR2A 4QPSA 5AR4A 4YLKA 3NNVA 3DNDA 4FOBA 4DX8A 1KE5A 4ZTQA 5JZNA 3L1SA 3TZ8A 3R04A 3AMAA 4IAYA 1SVEA 4A9YA 3VJOA 4YLJA 3QTQA 4FK3A 3CXWA 4KS7A 3LCDA 3Q52A 4EK3A 3KMUA 2YCSA 3PWYA 3R22A 4LFIA 4USDA 2D11A 3PZDA 5FBOA 1JQHA 2HW7A 2IZRA 3MH0A 3GU5A 3V8TA 1OPLA 3HQCA 4MBJA 4MYGA 2NRUA 4C7TA 5AFVA 3ZM9A 4AN9A 3QX4A 5DH3A 4JT3A 5IUHA 1OIRA 1REJA 4IZAA 4AGWA 5IA4A 1U59A 3L9NA 4IADA 3R8UA 3WZKA 4ZZOA 3DDQA 3OY1A 2CY4A 2FUMA 2FYSA 2BZIB 4X6RA 4MQ2A 5HCZA 4PPBA 4EOKA 1T77A 1ZYDA 3ZUTA 2CPKE 1MP8A 4GPTB 1RE8A 2ITPA 2Y7JA 3C13A 4ZTLA 5JEBA 1Q8TA 4CKRA 4QO9A 5AP0A 3UMWA 4RX8A 4MBLA 3JVSA 2XJ1A 4D4RA 4FT7A 4OBQA 3EQFA 4J96A 2UVYA 4FIEA 5FTGA 1K9AA 4C3PA 3R73A 4CFXA 3S0OA 2ZFYA 2GTNA 2B4SB 5JFXA 4XV3A 1UWJA 4MY6A 4EH9A 3QQKA 2OI4X 2X8IA 1M14A 4O0XA 5I9YA 1WVXA 2Z2WA 4FZ7A 4XCUA 3HV5A 2XIKA 3NW6A 4L7SA 3C0IA 3KC3A 2W99B 1B55A 2F4JA 4M68A 5FD2A 5CY3A 5JGDA 2D9XA 4IE9A 5JGBA 3QXPA 3BBTB 4LL5A 5HVJA 5GHVA 4DEBA 3WA0A 1U54A 4WRGA 5CF4A 2C47A 2CCIA 3KRXA 1V1KA 2GDOA 4MF1A 3VUMA 4OTWA 5IPJA 3MDYA 3FPQA 3A99A 5FP5A 3G5DA 3SXSA 1BYGA 2Z7RA 3G0EA 1GZKA 3MH2A 4DDGA 5FGKA 3NYOA 5I2MA 2JITA 2BRBA 2UZSA 4H3BA 3KA0A 4D1SA 5HG8A 3EN4A 1DDVA 2MFQA 1YWNA 4J52A 1H1PA 4W8DA 4F9AA 4BDFA 2J5EA 4FT0A 3O71A 3A8PA 4WUNA 3E3PA 3SO6A 4IM0A 4K2RA 2C0OA 3C4EA 4EUTA 2R3NA 3KMMA 4LGGA 4CHMA 4QYGA 1VZOA 4RJ6A 4AA0A 2OIDA 5IQIA 1NTYA 4MNFA 3COIA 2B54A 4BIDA 2Z7SA 5CLPA 2GQRA 4ZTMA 4FKJA 4FKRA 4EHEA 2OJJA 4FV8A 5CANA 4J95A 2X18A 5HG5A 3ZLXA 4I6QA 1J91A 4OUCA 3QU0A 2MKRA 2X6EA 4IB1A 4XH6A 4YL8A 4RX9A 3OOMA 4C3FA 3PDTA 2Y0AA 4FSTA 4N0SA 3HECA 5IMEA 4A9UA 4KHOA 3HDNA 4YC3A 3E8CA 4F6WA 1AD5A 2ZJWA 1W83A 4EBVA 2XAOA 3BE9A 3F66A 3QYZA 2RIOA 5FDXA 4K1BA 3QQFA 3ZUUA 4BFMA 1OUYA 2OFUA 1M52A 3PJ1A 3D8EA 4HOKA 2UZOA 4I23A 2XS0A 4D5KA 1AWEA 4I41A 3EFLA 2YCRA 2UZEA 3KF4A 4TXCA 1TQIA 3T9IA 1X05A 4WA9A 1NXKA 3GCVA 4RVLA 1SVGA 1XHAA 3GCSA 4I6FA 4E6CA 4ZZMA 2EMTA 4X6QC 4ZS0A 4F6SA 2KULA 3CD3A 4HDQA 2YN8A 3LHJA 3LMIA 4RC2A 4MX9A 4FKSA 1PFJA 4KHBA 3PG1A 5BVFA 3LFNA 5TE0A 1IASA 3PLAE 4YJUA 5LARA 1PKGA 3DLSA 5L81A 4J7BA 1FB8A 4B4LA 2WOUA 3BHYA 2AQXA 2W7XA 4YSMA 3FEHA 3F82A 3Q2MA 2AYPA 4NSTA 3RVGA 3TN8A 1QPCA 2ITNA 3HV7A 5FQDC 3SC1A 4BDBA 1BI8A 1JVPP 5GOWB 3VAPA 3BHVA 2JGZA 1LEZA 5J7BA 3IPHA 3ZBFA 2PUUA 3FJQE 1PYEA 3A7FA 3I6UA 2OZOA 3OTVA 3QD0A 3VIAA 4CSQA 2NNWB 3VULA 2HY0A 2UVXA 4JRVA 2Y8GA 2A2AA 2L2IA 4NZWB 3PSDA 5EFXA 1QMZA 3V5WA 5M4YB 4GRBA 4WJ7A 1W82A 2QO9A 1FVVA 4AZFA 2ITOA 5KQ4A 2WHBA 1PY5A 3KMWA 4AXDA 1IR3A 3ZO4A 1YXXA 3KY2A 4XP3A 3DPKA 4EOSA 1YWVA 3HAMA 1XKKA 4C59A 1DROA 4Z9LA 5HX6A 1FOEA 3QZFA 1Y6AA 3PXQA 1E1XA 3MFSA 5TO8A 1KZ7A 1K5GB 2D9WA 3E5AA 5C27A 4XG8A 2WQOA 5DRDA 1WBVA 4FL2A 4N6YA 3CGOA 3D0EA 3E63A 1BWNA 4KS8A 2VRXA 4LMUA 5L3AA 5M4CA 2ZPYA 3TJDA 2WMRA 4ZP5A 2ITQA 4JLCA 5M51A 3W0RA 3BHTA 3MVLA 3TFMA 4U44A 4APPA 4F0GA 3ZXZA 4EH6A 2QU6A 3BPRA 3EKKA 4RLLA 2RNRB 3DY7A 4PX6A 4FJVA 3DDPA 3AG9A 3EZVA 4DIXA 4PMTA 4MHAA 5KMIA 3KRLA 1YI3A 3DKOA 4JG6A 3VUGA 4EBWA 3IW5A 5K4IA 1TXDA 2GUMA 5HEZA 2BVAA 1SYKA 4YU2A 1V0BA 1OKWA 4OT5A 3W10A 4TPTA 3HX4A 2JFLA 4BWXA 1NVSA 2Z59A 3V04A 3ZVRA 3MJ1A 4L46A 2YABA 4H39A 2D4QA 4G6OA 2UVZA 5IQCA 2VTJA 4OTGA 3IDBA 1CKIA 2IFSA 5ETIA 2O5KA 2Z7QA 3DKGA 4WNKA 3R63A 4HYIA 4ITHA 5AX3A 1G8JA 1P14A 1WMKA 1FGIA 4FODA 4YTFA 4TL0A 1ZC3B 1VEBA 4Y8DA 4ACGA 3QCSA 4CZUA 2P0FA 4PL4A 4JG8A 1PXJA 4TYEA 1R0EA 4AT4A 1HCLA 2VWZA 5E8VA 3BEAA 4I20A 5L8KA 4RA4A 1XMLA 4KNBA 3CKXA 4QMMA 1W7HA 5EYKA 4LRKA 5EOBA 5AV1A 4IFSA 3QC9A 3TTJA 3D14A 4PWNA 4ZS4A 4DH5A 4FKOA 5EG3A 4AFJA 3BHUA 3PPJA 4RWKA 4BDKA 5C9CA 4LV8A 4GT3A 1WGUA 1IA9A 1EF1A 3EL7A 4TNBA 3NS9A 3QTRA 4YZBA 4U9AA 3DA6A 4HVGA 4HAUB 2QCSA 2C5NA 3FMDA 3UOLA 2RFDA 5BVDA 4IAPA 3R6XA 4TN6A 2RRFA 1H1RA 4GK2A 5HESA 1PW2A 4YTHA 4TKSA 3I81A 4CYIA 3CXBB 1WBTA 1S9IA 3NVMB 5EQEA 3VBTA 3VF9A 4AZWA 2H34A 2AEHA 4D5HA 4H8SA 4C38A 1H07A 2X0OA 4NTTA 2EVAA 3Q6UA 3AKJA 2ACXA 4TWPA 3ODXA 3H3CA 4LL0A 2ZV2A 3W18A 2PVHA 5E8UA 4EYMA 3U8ZA 4D28A 5DH9B 4MTAA 5L2WA 1Y19B 4RQKA 3MW1A