4EJNA

Crystal structure of autoinhibited form of akt1 in complex with n-(4-(5-(3-acetamidophenyl)-2-(2-aminopyridin-3-yl)-3h-imidazo[4,5-b]pyridin-3-yl)benzyl)-3-fluorobenzamide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
435
structure length
376
Chain Sequence
b'VAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-alpha serine/threonine-protein kinase
publication title Discovery and optimization of a series of 3-(3-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amines: orally bioavailable, selective, and potent ATP-independent Akt inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 106
structure length 376
sequence length 435
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ejnA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4ejnA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ejnA02
1Q24A 4JOAA 2HW7A 5EG3A 2Y7JA 5BUIA 2VTIA 1BI8A 4I5HA 3KGAA 5TE0A 2IWIA 2OXXA 3WF7A 4ACHA 4YC6A 3T3VA 3Q32A 2XIRA 4PMPA 4DH8A 2YJRA 4PTGA 3TTJA 5AUTA 3N4TA 2QCSA 3DDQA 4GYGA 5AUVA 4ASZA 5HTIA 4ZRIA 3DXCA 4FIFA 4E1ZA 3LJ0A 2Z8CA 3OTUA 4RIOA 4RIYA 2KGXB 4PQNA 4CHMA 2XCKA 4FT9A 3BE9A 3WZJA 4DFBA 3CY2A 4YTFA 4FV5A 4QP8A 3KSYA 4EOPA 1YOLA 3JYAA 3R8UA 1OKWA 3OOMA 2AC5A 4FSTA 2RLOA 5JHGA 1WG7A 5L2SA 5AR8A 5KMLA 2H8HA 4JBQA 4XG8A 5HG5A 5M06A 2XK6A 3IDBA 4R1VA 3HGKA 3Q3BA 4FGBA 4BCHA 1DI8A 4AACA 3ZFYA 3VOQA 3VVHA 3QGWA 4UB7A 3RMFA 3NZ0A 1RQQA 4AW0A 3EN5A 3VHKA 3MVMA 4MH7A 5H8EA 5HLPA 3P6AA 1ZYJA 3IW8A 4M12A 3V8TA 4LL0A 5I4NA 2O0UA 4FI1A 5IA5A 5C8NA 2YDIA 4RWLA 3LLAA 2DYQA 5ETIA 4Z2MB 4F9AA 3PLSA 4QMPA 4FEUA 4A9TA 1U46A 1IA9A 3SKCA 2XK8A 1TKIA 4Q9SA 5EQEA 3LAUA 5AAGA 4L8MA 3MB7A 3THBA 4CFXA 2ITUA 2C4GA 5AM7A 1N3HA 4FTRA 3W8LA 3QQHA 2OG8A 2W4KA 4NFNA 2FH9A 1VZOA 4R5YA 4U3ZA 4EH8A 2IVTA 3Q5ZA 1VYWA 2P3GX 4PY1A 4XHKB 2FB8A 4ZP5A 3BEAA 1Z57A 3AC2A 3ERKA 3FLWA 3RAIA 3F2AA 3QYWA 3SGCA 4I23A 1OPJA 2C5OA 3R30A 4IAPA 4GSBA 5EDQA 1PXKA 2XNNA 2ZM3A 1Y91A 4X0MA 3BLHA 3WIGA 1WBVA 3ZU7A 4ZLOA 1O6YA 1WBPA 2B1PA 3H9OA 4FG7A 4D1XA 4DH5A 4AXAA 1OMWA 2WEVA 1GZOA 4B9DA 2G1TA 2HK5A 4WT6A 3ZRLA 3E8DA 2J90A 4MNEA 4AE9A 1YOMA 5AV3A 3FYJX 2DQ7X 2NRYA 3R9HA 2VX0A 3VBWA 1NI2A 3MV5A 4NSWA 1P2AA 4WNMA 3QQUA 4X3FC 4I6HA 5CANA 2OGVA 3KMWA 3FLZA 5JT2A 3UBDA 5JFXA 2VUWA 4F7HA 2VTAA 3GFEA 5CLPA 3C9WA 5LVLA 5J79A 3TZ8A 2EUFB 4EUTA 5KQ4A 1XR0B 2ZDTA 2BTSA 3UOJA 4BBKA 4CYIA 5AA9A 3HL7A 4TXCA 1WZYA 5HKMA 5ACBC 3TNPC 2Z7RA 2DUVA 1OBGA 3DBCA 4JG6A 4QMQA 4FTCA 2EB3A 2J0KA 5F1ZA 4DYMA 3HV3A 4CT1A 3C50A 3CGFA 4RWIA 3ZEPA 4F7NA 4F99A 2YAAA 2JDSA 4Q2AA 2J59M 3FY2A 2BIKB 2D10A 5CF8A 2EC1A 3WYYA 4O1OA 5E8ZA 4UZDA 3ORPA 4UMPA 5FXRA 2VRWB 5F94A 5KMOA 2H9VA 1FHWA 1XKEA 5EHOA 3W33A 4L6EA 5DHAB 2XK9A 1R1WA 4F0GA 3MDYA 3MSSA 3ZEWA 2PVJA 3VJOA 1U5GA 2W4JA 1W8CA 2OF4A 5E1SA 3TI1A 5GHVA 2N23A 3VBQA 5LOPB 3GU8A 4NY0A 4DH7A 4ZTQA 2IG7A 4L7FA 2DWBA 1YDTE 3MIYA 5DEWA 4YTCA 3UVRA 5CAVA 5KCVA 3HRFA 3A62A 3G90X 1Q5KA 4D5HA 4P5ZA 1Z5MA 3SA0A 4K2OA 4UXLA 3PVGA 1XBAA 3QALE 3IO7A 3R28A 4GFGA 4TYHA 5FDXA 4JDKA 4PV0A 4RX7A 4A9YA 3KVWA 3NYVA 4MD9E 5TKDA 5BVNA 2ZOQA 4G2FA 3FZRA 1MIXA 2PE0A 2W7XA 3SXFA 3NSUA 4NT4A 3GQIA 3JS2A 5BPYA 1FMOE 1UPRA 4AA5A 3GOPA 3NAXA 3QFVA 4BIDA 1OZ1A 1Q41A 4MNFA 1J1BA 2WMBA 1DAWA 2XCHA 3SUZA 3LXPA 3K5UA 1T46A 4UYNA 5TOZA 2ELBA 3TN8A 4K17A 4JR7A 4DCEA 4WOVA 3DKOA 1FVVA 3LFDA 5A4EA 2QG5A 3NMUF 4RSSA 3VF8A 3KY2A 4CKIA 3KKVA 2O5KA 4AG8A 2RL5A 3UNZA 4ORKA 4LL5A 1FHXA 2E9PA 5KUPA 1LPUA 4YZNA 3F5PA 4UMQA 5I9VA 1XKKA 5A9UA 4BCFA 3DKGA 4NW5A 4RMZA 4MXZA 2Y4PA 2WMUA 4AX8A 1OECA 4F9WA 1OY2A 4O7LA 3TJCA 4AT3A 4FR4A 4CYEA 3C5IA 3ODWA 3COMA 3D83A 3HV7A 2WIHA 3MS9A 5E7RA 4DG2E 2YLFA 3BYUA 1ZOHA 1P4OA 3H9FA 3UVQA 4D28A 3NX8A 3KRLA 3BV2A 4FKIA 4X2JA 4EH7A 4FIIA 4DX8A 4ANNA 4IM3A 2QHNA 3FLQA 2OKRA 5AX3A 1AGWA 3UE4A 5GJGA 4C3FA 2DLWA 3VC4A 4HAUB 4QP4A 3LXKA 1SMHA 3LCOA 5B0XA 3TV6A 1LB1A 5D9HA 1YRPA 4BKZA 3RPOA 4OTWA 4XV3A 3EYHA 5HI2A 3FJQE 5DT0A 3KL8A 2VSZA 2CNUA 4XJ0A 5EHYA 3FC1X 1KE9A 1UU3A 3UPZA 2RG5A 4DEHA 2XK4A 3FE3A 2DYNA 2PPQA 2HZNA 2W96B 4HCVA 2X2KA 4FV1A 2Y9QA 1PLSA 3DXNA 3A99A 4FZ6A 4L67A 5FTOA 3SOCA 4EL9A 5L6PA 4GVJA 1OITA 4JQ7A 5AUYA 2EJ8A 1XH6A 5CEMA 1UU8A 4N0SA 3M2WA 3MPMA 1U5DA 3H0ZA 5CSHA 3DK3A 4O7TA 4BF2A 2Q83A 4O81A 1PMUA 4FVRA 1V0BA 5LXMA 2X9FA 4V04A 3RAKA 3NUNA 3U4UA 3DOGA 2GNJA 2G2FA 4YTIA 4MD7E 5AR7A 3BI6A 3BYOA 2WQEA 3G0EA 4FOCA 4FNZA 4JIAA 4R5SA 4AN3A 3LLTA 2YF0A 4TWCA 2EVAA 3PWDA 3VUIA 1PXPA 3BZ3A 2VO6A 3C4CA 1DS5A 1O9UA 3REPA 4AA0A 2Z0PA 1J7LA 1WGUA 3CSVA 1HCKA 1V61A 4W4YA 2YS3A 1Y6BA 5JGDA 1YOJA 2C3IB 3NAYA 4FV8A 2CN5A 1OPKA 2Z7LA 3PPJA 4BWPA 3BYVA 4FYOA 4M14A 4BBMA 4L42A 5CSXA 3T3UA 1BTNA 3FXWA 2DHKA 1EGXA 4DITA 5KZIA 2GS7A 1WVYA 4MWHA 4Y46A 5AEPA 1Q8YA 3JPVA 3JXWA 4IWDA 1U5FA 3NRMA 4HAYB 2PE2A 4KIQA 1FOTA 2QOIA 4PTCA 3CCNA 1NVQA 2X2MA 2OJJA 3ZO1A 1J1CA 4XG6A 4FTUA 5LQFA 3BGZA 3FAAA 4FV3A 3QZHA 2W2WA 5AUXA 2O2UA 1KE5A 3KRWA 2Y4IB 3E87A 3ZLSA 5JQ5A 5C8KA 4NSTA 4IIRA 3KF7A 4A6HA 5TT7A 1Q62A 2R3JA 5CWZA 3PJ8A 2HY0A 3MTLA 4D2TA 1XH9A 4HPTE 3SV1A 4BDDA 4ZY5A 5L2IA 3QUDA 5CVHA 1QPJA 4I24A 3E88A 3SHEA 2ZYBA 4P90A 5AMNA 2JBPA 4NM3A 2RNRB 3UOHA 3BU5A 3CJGA 4BCGA 2ITQA 2X39A 3BKBA 3C4WA 5AIRA 2LOXA 3WA0A 3R1SA 3V5PA 1NXKA 3AU5A 1OKZA 3L9LA 3MI9A 1DI9A 4M7IA 3V5LA 4C7TA 4P7IA 1H1QA 4AE6A 2CCHA 2OH0E 2QOOA 4FF8A 3VS0A 2MKRA 4RIWB 3TZMA 1YI4A 3MTFA 4YZBA 1SNUA 2XIZA 4NWMA 4N70A 3PG7A 3HA8A 2PY3A 3RAHA 1H10A 2W4OA 3ZLWA 2QU5A 4D2SA 4AOJA 3MY0A 1MQ4A 2UVYA 3LFFA 4C34A 4XG2A 4HCTA 3DB8A 3OC1A 3DXDA 3DGKA 3PIZA 3R7VA 2PE1A 3VN9A 4RFYA 3ZMMA 3LCSA 5L2TA 4M97A 1PXIA 4KAOA 3E3PA 3UVPA 3L8SA 3V04A 4H05A 4BGGA 1OKYA 4F7GA 4F4PA 1J7IA 4C33A 4ANBA 5CI7A 3OW3A 1X1FA 3I5NA 4L00A 5IH4A 5F9EA 3U54A 2LOZA 5HO6A 4BL1A 3HKOA 5I9WA 4G9RA 4Q5HA 4BGQA 1FVTA 5CU2A 5L8JA 4L53A 3IOKA 3ACKA 1P6SA 1JSTA 3EQIA 3EQDA 3O51A 3OOGA 4FSUA 3D2IA 3NUPA 5GZ9A 4AT4A 4EH2A 1MPHA 2CY4A 4B99A 2FSMX 3ZZWA 4BDAA 3O7LB 2D9YA 3ZFMA 3COKA 3QKLA 4QMXA 1URWA 3MH3A 3SVVA 5JFVA 2BAJA 3D15A 4O21A 4R1YA 4UY9A 2RIOA 4RT7A 5AUUA 3R6XA 3EOCA 3VS2A 4YZMA 2A1AB 5JEBA 5KKRC 2BKKA 4YO6A 3HX4A 3ZFXA 3LQ5A 3NVMB 2C6IA 5FBOA 3DXQA 3DDPA 2HZ0A 2NO3A 4YHTA 3MB6A 4CXAA 4H8SA 5IG1A 2WMWA 3WZEA 3OXIA 2JIVA 2BZKB 3OS3A 4BZDA 4BN1A 1E1VA 3PTGA 4CTCA 1YWVA 3V5WA 1PHKA 4GV1A 5CZHA 1P4FA 5K0KA 3RGFA 3ML4A 4TZRA 5BQ0A 2R3LA 1YHVA 4YJRA 4EOSA 2PULA 2QO9A 2YM5A 4Z9LA 2P2HA 3BINA 4YZDA 3AC5A 5IA4A 4TKNA 3KFAA 4JR3A 4CKJA 4HB4B 4A6FB 2XJ2A 1Q8ZA 2C3LA 3UIMA 2COFA 3ENMA 4K2PA 4X21A 1OIQA 3QIJA 5DG5A 3KRJA 4WKQA 4BCNA 4LRJA 3CLYA 2B55A 1UA2A 3P4KA 3EFJA 4G6LA 2AEHA 4ANQA 4NW6A 1RRPB 5IMXA 2VTJA 2X6EA 4JJRA 4KD1A 2W1HA 2BUJA 5C26A 5I9YA 2R7IA 2XH5A 3L9PA 5H2UA 3MW1A 2WIPA 5CEPA 5JSMA 2YCQA 4CLIA 2G9XA 4USEA 2QR8A 4YJTA 4FBXA 2W5AA 4KIKB 1FGIA 3GC0A 3Q4TA 5EFXA 1GZKA 4XRLA 3HDMA 4NYEA 1H24A 4UALA 4QPMA 3QWMA 3BLRA 5J3QA 3E8CA 4RJ8A 2C3KA 3IDCA 2PVLA 1AQCA 4TW9A 4QQCA 5M57A 4OBOA 3MFSA 3WYFB 3O0GA 1IG1A 4FT7A 1UVRA 3UYSA 4C62A 5C1QB 3SW4A 4DGMA 3FEHA 1F3MC 5AR5A 4TYGA 2WTKB 4YJUA 3NS9A 2WMTA 2I0HA 4MXCA 2W0JA 1Z9XA 1ZOEA 4AFEA 2P0FA 3EMGA 4F1OA 3TCPA 2EMTA 4ZS4A 1AQ1A 5IUHA 2UZWE 3OF0A 1WBSA 3UMWA 5C6RA 1PXLA 2IW9A 3ODZX 4DFZE 5L3AA 3G51A 2BAQA 3RM6A 3W10A 4EORA 3DTWA 4E6DA 1I2HA 2I7QA 3Q2MA 4BWKA 4J97A 3F88A 2IFSA 2C6DA 4ZSLA 2PSQA 3FLNC 1LUFA 3HV6A 5AP2A 3CBLA 5K0XA 1YI6A 4RFMA 3OUNB 2UZNA 5JZNA 2P2IA 4R3PA 1EH4A 3LJUX 1YXXA 3B2TA 1YXUA 2W5HA 5BYLA 4EYMA 4D4SA 3U6JA 3W18A 3ULZA 2XEZA 2XNGA 4CNHA 2CGVA 1FBNA 2HZ4A 5IQBA 2CODA 2ZMDA 3BU6A 2GJYA 2GS2A 5F4NA 1CDKA 4I6BA 2I1MA 4L44A 5ETFA 2YM8A 4QMLA 2CGUA 3UP2A 3VS4A 2XS0A 3DBEA 3SG9A 2XYNA 1REJA 4ZEGA 3A7JA 1ZMWA 2WMQA 4MHAA 1WAKA 5ICPA 2WMVA 4PNKA 4FTOA 2EMSA 1KZ7A 5EKOA 4AGCA 4FT0A 5L8KA 4EJ7A 5CU3A 3SOAA 3T9TA 2JKOA 2PMLX 4BICA 4F6WA 3L1SA 3PSDA 3RK9A 1OKVA 4D2RA 5CALA 1MKEA 3F5XA 3L8VA 4LOQA 2RSVA 4Y5HA 3U8WA 1Y57A 5DN3A 4ANSA 3TWJA 4GU6A 4FKSA 5AUZA 2BPMA 4BC6A 2W05A 1YWRA 4QMWA 1WVXA 4NJ3A 3K54A 3S4QA 3VBYA 2O65A 1LW3A 5DFPA 4YPDA 5BVKA 5CASA 4TL0A 5T3QA 4ZMFA 3S2PA 1T45A 3QA0A 2GS6A 4NM7A 5DBXA 2XNOA 5E90A 3CE3A 4U0IA 2X7OA 3HAVA 3QWKA 5HU9A 3PA3A 3CQUA 3TIYA 4J53A 1SVHA 5E8VA 1TVOA 5CEIA 4F7UP 1PW2A 3DBQA 3G6GA 1GAGA 4ASEA 4AU8A 1PXMA 1UV5A 4RZWA 3RAWA 4YURA 4E26A 4JBOA 4DGLC 2DN6A 2VGPA 3TZ9A 4MBIA 1URCA 3GC7A 2R64A 2J6MA 4OT6A 5FBNC 5C5BB 2V62A 4HNFA 3RK7A 5AX9A 2DHJA 3D5WA 4NKAA 3UQFA 4BDGA 3RHKA 3KZ1A 3VS6A 3K2LA 3O17A 4FNXA 5FXSA 4AOTA 4X6RA 5DR6A 4YO4A 3T8OA 4CRSA 2B7AA 5IF1A 3UGCA 2W1FA 1R78A 3RNIA 3LCKA 4FTKA 4GMXB 3M11A 3AMBA 4FZ7A 1J0WA 3MY5A 3QCSA 5DI9B 2XMYA 4YJPA 5HU3A 4UN0C 5I3RA 3W16A 2YM3A 5DIFB 3NUAA 3VQUA 3RPSA 4FTQA 3TXOA 4EOKA 3C7QA 3GU6A 3H10A 4EEVA 5AAEA 5CEQA 3Q52A 5D3XA 4OTRA 2R0UA 1W1GA 4U41A 2HCKA 3PXZA 4RJ6A 1Q8TA 3U9CA 4R77A 5HOAA 2W2XD 1IAJA 2VO0A 3O23A 4JDJA 3BE2A 4OUCA 5C03A 4UMUA 1NY3A 4CSVA 2Y6MA 4ITIA 3PUPA 4MY6A 4BDFA 2I0VA 3UTOA 4QPAA 4PMTA 4M84A 3RHXA 3TFMA 4BCOA 3TVVA 3PZDA 3LW0A 3D14A 3KVXA 5I9ZA 4S30A 4MCVA 4YMJA 5M56A 4RX8A 2RFNA 3F2RA 4QD6A 1JKSA 4E3CA 4JG7A 4YJQA 4AZVA 1R3CA 2QONA 4J7BA 1P14A 4FEVA 3U55A 2X18A 3Q53A 4BDHA 1IR3A 4GW8A 4QYFA 3PJ3A 4ACCA 2KUPA 3QZGA 5LVMA 2VWBA 3O7LD 3QUEA 2X4ZA 4FSQA 4RGJA 4F0FA 4F7LA 4S32A 5TO8A 3R9RA 1AD5A 2J5EA 4FZAB 5D7AA 4HAZB 1K5DB 3S0OA 5IA3A 2MDXA 3I4BA 3LFEA 2GQGA 3UIXA 3WILA 1UNGA 1REKA 4QP7A 4FIEA 4IW0A 5IEYA 4O82A 2OJ9A 1NA7A 2F2CB 3DPKA 4IHPA 2J50A 3OBGA 1U29A 2X81A 4TKSA 5A6NA 3EL8A 3QRJA 4D55A 4F64A 1NW1A 3PZEA 1Q61A 3FY0A 2J0IA 1XH5A 2GDOA 4LG4A 3VS5A 3Q6WA 1OIUA 4C3RA 4BDCA 1KI1B 1F5QA 3VULA 2CPKE 3VW6A 4QMTA 2DTCA 2BDFA 4UXQA 3HMIA 2FSTX 2XYUA 5IEXA 3GU7A 3W2SA 4WIHA 2VWXA 4L01A 3C0IA 4BHZA 2B9HA 2ITNA 5HIEA 2UUEA 1RJBA 2YERA 1GZ8A 4R3RA 1MK9B 5EK7A 3C51A 3ITZA 2BMCA 4OBQA 5CAOA 3CY3A 4KINA 4BDBA 1PMVA 2A0CX 3OY1A 3ZTXA 2C5YA 4YSJA 3Q96A 2JGZA 4OTFA 1UKHA 4BCKA 5JZJA 1XX0A 4IFSA 4IEBA 4FKOA 3RCDA 2R3PA 2NRUA 5FTGA 5HD7A 5E1EA 4GKIA 3Q9ZA 1TQZA 4FODA 4O83A 1DAYA 1UNQA 4FTLA 1M2PA 4O0XA 1V88A 5EW3A 4X3FB 5EM8A 2V5QA 4H1MA 1A06A 3OUKA 4AW2A 2X0GA 2CGXA 2P0CA 3D2KA 1BUHA 4WD5A 5KQ1A 2XQNM 2V0DA 1JLUE 3ZUTA 1KE7A 4ALWA 1V0OA 2CJMA 2WB8A 2VRXA 4RRVA 1WCCA 3KXZA 3BRBA 3OCTA 1M7QA 2UW8A 2WOUA 2GCDA 1V0PA 4IVDA 4IB1A 1BLXA 4IZYA 1DDVA 3GYOA 4X2NA 4EHEA 4UWBA 3QKKA 4RVTA 4QP1A 4U5JA 4CD0A 4E5WA 3A7IA 3MY1A 2FJLA 1ZZLA 1U5QA 2VTQA 1F0QA 4BKYA 3FWQA 5EFQA 4XEYA 4Z55A 4JIKA 2VTLA 3OP5A 4NFMA 4FSRA 1K3AA 5CTPA 4EMOA 4IJ9A 3FMNA 2BZJA 2YLEA 5LONB 3R21A 4O7YA 4X7QA 4GT5A 4GRBA 3EFKA 4L7SA 4HB0B 1UPQA 2VWIA 2PZIA 3CKXA 4JLCA 3NUSA 3JY9A 1DYNA 4MX9A 5LMKA 3NIZA 4G3EA 1RE8A 4XBUA 3R71A 4ONAA 3CPCA 3PY3A 4WNOA 2WTCA 2YITA 5AR3A 4O2ZA 5KBRA 3HECA 3GBZA 5ANKA 2C68A 2C1BA 2AYPA 4QMSA 1CKIA 1UNPA 2CKOA 4ZJIA 3HNGA 4CFVA 4OTHA 4AW5A 4KAXB 4FK3A 4KBCA 3R02A 5J9LA 2B9IA 2BFXA 4LOPA 4RC2A 2YS1A 3HYHA 3IW6A 4EHGA 3R7UA 3IS5A 4BIEA 3FZOA 1V1KA 4O6EA 3BGPA 4IB0A 4V01A 4EK4A 1FGZA 2HWOA 3CEKA 4M15A 1MUOA 4GG7A 5B2KA 1ZMVA 3DKFA 4KS8A 2ROZB 3ZVRA 4A7CA 4XV1A 3I7CA 4HW7A 5HCZA 5J1VA 2DFKA 3HW2B 4JQ8A 5IQGA 4I0TA 4DLJA 2KULA 3FM8C 4ZSGA 3D5VA 1OL2A 1ZYCA 5CZIA 5D3WA 4CV9A 2IZUA 3MVHA 5IQDA 1ZXEA 2D4QA 5AJQA 4IBMA 4IM0A 4BBEA 3QUPA 2WEIA 3LMHA 4KA3A 2Z0OA 4ZJVA 2IYBA 3MN3A 3PDTA 3PRFA 4I21A 3UIBA 4BHNA 4C3PA 2ACXA 1WJ1A 2BRNA 5IQIA 4TY1A 2IZTA 3P08A 3CTQA 4O38A 1ERKA 3CQWA 3EIDA 1NVRA 4AT5A 2XIYA 2YCRA 4RG0A 2UZOA 4ZSJA 5JGBA 5FGKA 4IM2A 5C27A 5KX8A 3QWJA 3P79A 4F9YA 4IZ7A 2ETRA 5LVOA 4NKSA 2HENA 2W9FB 2WOTA 2YM6A 3P5KA 3P78A 5CS6A 2GNFA 2UW6A 3VUHA 3ZLYA 4I5MA 3PJ1A 3RKBA 1HOWA 4F0IA 3CJFA 1X8BA 5FXQA 4A07A 1SGHA 4DINA 3D94A 5AP5A 4C4IA 4XOZA 3H0YA 4ZLYA 2VTSA 5ANGA 3IKAA 4HGSA 1ZYDA 5J5TA 1KUTA 2A27A 4OR5A 3NDMA 1ZC3B 3V8SA 3ZRKA 2RFEA 4PUZA 5H8BA 1JKLA 3HVCA 1GZNA 4DT9A 4HGTA 1Q8WA 5HVKA 3DFCB 2VN9A 1MIZB 3FC2A 2YM7A 4Z7GA 4E4XA 2F9GA 4FA2A 3M42A 5FUTA 1GC7A 4PWNA 3AXWA 3OTVA 4ZRKA 2X8IA 4IX3A 1KZGA 2XBAA 2UZLA 3E8NA 2IJMA 5DRBA 4FZDB 4GFMA 2OFUA 2R5TA 4WA9A 4JL9A 5IH6A 3R63A 2BRGA 5A4QA 2GQSA 3ZBXA 1BI7A 3BQRA 3FYKX 2OF2A 3ANQA 5HLWA 4O0SA 3SXRA 4G5JA 4K8AA 4V05A 5C4LA 1SYKA 2PZPA 3EJ1A 1H1SA 2PZRA 2VTTA 5K9IA 4EOOA 4CKRA 3BV3A 3X23A 4MD8E 2JKMA 3MFRA 2OBJA 2MWNB 4ZSAA 2ITWA 2Z0QA 3MH2A 4IX5A 4IAKA 4BKJA 5JRSA 3GCQA 2E9VA 3EQGA 3PJCA 1E9HA 4PF4A 5CVGA 4FC0A 4C35A 2GNLA 2V22A 3BHYA 1ZYLA 1OGUA 5F20A 2BHHA 1UWHA 4J98A 1FPUA 3IK3A 2XM9A 2FO0A 3QTUA 5LOHA 2YS5A 4ZZNA 2PHKA 4CFNA 4YPSA 5C8MA 4HVHA 2ITXA 2HXQA 4BCQA 4C58A 3TW1A 5HICA 3ZH8A 3DAJA 3ZYAA 4A9SA 3KU2A 2PVKA 4QQ5A 5GNKA 5FG8A 4EZ5A 3MDBC 2HYYA 2R3RA 2YEXA 3GXLA 3EQBA 1M2QA 2JC6A 5L6WL 4BCJA 3HZTA 3HV5A 4HGLA 2QO7A 4R7IA 4RBLA 3ZC5A 4R7BA 4D4YA 3A4PA 3DB6A 4D58A 2C6KA 4ANMA 3E62A 5AADA 3WF6A 2D9XA 4H3PA 4QMVA 3KCFA 1KWPA 4FT5A 1M7RA 4FTJA 3UC4A 4HVSA 1MAIA 1OIRA 3DZOA 3GYPA 2H7EA 3R7GA 1A9UA 1VYZA 5AV0A 3RWPA 3OFMA 3A8PA 3FKNA 1YQJA 3FMEA 2RGNB 3E93A 2QR7A 3HA6A 4CMUA 4ACGA 1ZY4A 2WMXA 4G6NA 4BCMA 3B2WA 4LGGA 4C02A 3NW6A 3Q4UA 5DHJA 4QTEA 4QNYA 3LHJA 2NZ8B 3PIXA 4NL0A 1UNHA 4WNPA 5AP0A 4UYAA 2ERZE 3BIZA 3F6XA 3ORXA 3V5QA 1EAZA 3F5UA 4XMOA 3NUXA 5EYKA 3R1NA 5FQDC 2C6OA 4LOOA 3E5AA 2ITVA 4KABA 5HX6A 5J7HA 2W1CA 4HCUA 5TF9A 4FIJA 5ANJA 3AOXA 4BDIA 4KHBB 3R1QA 2QKLA 3ZONA 2XUUA 3HP2A 4U8ZA 2DX5A 4ASDA 1BL6A 1PMNA 3N4VA 3PSCA 4NH1A 4O1PA 3NPCA 3FL5A 3CGOA 1X86A 1H08A 4JNWA 4YLKA 2ESMA 2SRCA 1OI9A 2ITOA 3D4QA 2PK9A 3LCTA 4L6QA 4YL8A 5AR4A 1QPCA 2RF9A 3KF4A 4MEDA 5CU6A 2OJFE 2C69A 3EQFA 4O0VA 5LJJA 1W1HA 2Y7BA 5FRIA 4X6QC 4F6UA 1E1XA 3NW7A 3RVGA 2DHIA 5HG7A 2X6DA 1QPDA 3MA6A 1JPAA 3C0HA 1XR1A 3AG9A 2PUPA 3VS7A 5J95A 4APPA 5EQYA 4Y8DA 5HVJA 4UMRA 2XKFA 3G0FA 3SRVB 1NTYA 3O8PA 2WMRA 2XB7A 2WTDA 4JDHA 2BDWA 3VWAA 3AD5A 4HJOA 4BCIA 4TYZA 3QF9A 2IZRA 1IEPA 1XH8A 1QPEA 3AC8A 3KXGA 5T6KA 2PVRA 3VHEA 4BZNA 4EK8A 3RTPA 2LGCA 3D8DA 3H9RA 4P4CA 5CI6A 3W2QA 1Y8YA 2PL0A 3C4EA 4MBLA 3UZPA 4E7WA 5KKRB 4YZ9A 4DBXA 1QL6A 4IAZA 3KULB 4I93A 4TWNA 5HQ0A 4DE4A 1FOEA 4QOXA 1U5RA 1FHOA 5DT4A 5IQAA 1YVJA 2C30A 1PRYA 4ANOA 3I0OA 1H01A 3R01A 5C79A 3HDNA 4C37A 2J2IB 2YWPA 4AS0A 3UODA 4WVFB 4HYIA 4BWXA 3LMGA 3UIUA 4DEDA 2G01A 1TQMA 3Q04A 3VQHA 3ZO3A 2WHBA 4PL5A 3BHTA 4YJOA 2UW5A 2ZB0A 2UZBA 3KXHA 4HOKA 3Q4ZA 5FI1A 2E9OA 3EZRA 4CMTA 2PZ5A 3KA0A 4E73A 4ZS0A 4FTIA 3OWLA 5GZAA 1CKPA 4ENXA 5CT0A 4BFMA 4KKHA 3SV0A 4MXOA 2QOCA 1H4LA 5IKWA 1SZMA 3QTRA 1P3RA 1FQ1B 2XIKA 3QCYA 3FZSA 4JRVA 4FSZA 1O6LA 2DKPA 2OTXA 1PJKA 4XG4A 3UQCA 4BR3A 2BHEA 4EOMA 4U42A 2PVHA 2ITPA 4QP9A 1U2BA 4FVQA 4A4OA 5KO1A 3LMIA 1U5EA 2L1CA 4QYYA 3R9DA 4ANLA 1UNLA 5GJDA 4QT1A 4G1WA 2BILB 4IQ6A 4NUSA 4P7EA 3CTHA 5BVOA 1DDWA 3PEGA 5HHWA 4CYJA 3F9NA 3ETAA 3F7WA 2BCJA 3GCUA 1ZSQA 4QMMA 1X11A 4DEBA 3R7EA 2VTNA 4I22A 5I9UA 2Y8FA 4I6QA 3OWPA 4EH5A 4IANA 4FMQA 4OGRA 5HEZA 1IA8A 3N9XA 3POOA 3PE1A 3A7HA 4YLJA 4HVDA 3O2MA 3OHTA 4GS6A 5DE2A 4BB4A 4Z3VA 1AWEA 2J9MA 3MWUA 5CX9A 3RM7A 3UOKA 1XODA 5HORA 3AMAA 4H36A 3SRVA 4E4MA 2FVDA 4RA5A 3SO6A 2UZTA 3T06A 2BRMA 3ZRMA 2OJGA 2BZHB 1VJYA 3SYXA 3PE2A 4TWPA 5BUEA 4DXAB 4CGAA 1OUYA 2EXCX 2ELAA 1DBHA 4BTJA 3B8QA 2NP8A 3O8UA 4YBKA 4EBWA 3R22A 4J8NA 4X2GA 5KE0A 3WYXA 2KCJA 1U59A 3DKCA 4Z7HA 4EZ7A 2C0TA 3HMOA 2QNJA 2JFMA 4G31A 1CKJA 1FGYA 2ETMA 3ORIA 1CM8A 2BFYA 3IGOA 5CXZA 2B53A 2QVSE 5FM2A 3D9VA 5IQFA 3NYOA 4PDPA 4QP3A 4DF3A 3MFUA 2PZYA 4FGRA 3PP2A 3DZQA 5BVEA 3PVLA 4FKUA 4PMMA 3PRIA 4C4HA 4CZTA 4DFYA 1GG3A 3FSKA 1Q99A 4X3JA 3KQ7A 1UWJA 2OICA 3TTIA 4C57A 2EB2A 3SLSA 1GNGA 3ZS5A 4BIBA 3IW7A 4EHVA 4OLIA 5DRDA 2WELA 3C4ZA 4WBOA 4IDVA 5LMAA 1XWSA 3LJ1A 3BGQA 3NUUA 3GFWA 4E93A 5HD4A 2LKOA 2VNWA 1DROA 3L8XA 3MVJA 4NZWB 1JSUA 1W84A 4AWIA 3OD6X 2I6LA 5C16A 3PXKA 4DAWA 4BYJA 3JVRA 5LMBA 4O84A 5KMNA 3G9NA 3TUCA 4A4XA 2ZAZA 2C6MA 2XVDA 1J91A 4WSQA 2XIXA 4DH1A 3W55A 2Z60A 4O0UA 3VUMA 2CY5A 2IW6A 5AWMA 5JKGA 1BTKA 1P5TA 3U6IA 2WFYA 1GIHA 4F7SA 4EKLA 3WF8A 2JFLA 4AN2A 3D8EA 5H3QA 5H9BA 3AU4A 2IVUA 3L9NA 5IDPA 4HAXB 3Q9YA 2YVCA 4IAIA 4HYHA 4TWOA 3FXXA 1XBBA 4JS8A 3EQRA 4AF3A 4EBVA 4EOLA 5BVFA 2VTOA 4DTKA 2I5CA 3NNWA 2WMSA 2OSCA 3CD8A 3F3ZA 4L46A 3TKIA 4EK5A 5DEYA 1EVHA 2VV9A 3HQCA 3FI3A 2RFDA 3OCBA 4IWQA 5K4IA 4ARKA 4IFGA 4GH2A 2J0LA 3VBTA 2C6LA 4AA4A 5IEVA 4AN9A 2VTRA 4DN5A 2YT1A 4O7WA 5L4QA 4G3FA 3R04A 4JXFA 4I92A 3RPRA 2HAKA 3QRTA 3BU3A 3WOWA 2BKZA 4XCUA 3IOPA 4RIWA 3LXNA 3NNVA 1I44A 3HUBA 3QTIA 2QKWB 2FUMA 4GL9A 4MQ1A 4DFUA 1W83A 3LIJA 3S95A 3TT0A 5ETCA 2C5VA 4GG5A 2V76A 3DY7A 3OROA 4XV9A 4GUEA 4YBJA 3G9WA 2UVZA 4WUNA 1Y8GA 3EZVA 4IOYX 3G9LX 3P9JA 4CTBA 4UWYA 3TO1A 4ZTLA 4ZJJA 1ZYSA 3L9MA 3ZO2A 3S00A 4IWPA 3F7ZA 3GVUA 4FX3A 4M13A 5KHWA 2GQRA 1ZAOA 2QKRA 1EF1A 3F69A 4YNEA 3C4FA 4O96A 4UBAA 4M0YA 4O0WA 4KBKA 1IRSA 4JAJA 2WZJA 3BJIA 1PMEA 2CDZA 2ZVAA 3GU4A 3GT8A 3I5ZA 4UZHA 2ZB1A 3V5TA 1Y5OA 4P5QA 5M51A 3IVFA 1TJ6A 4FUYA 1UU9A 2OW3A 3OCSA 5EW8A 5IZFA 4BY9E 4RJ7A 2XBJA 4JG8A 2KTYA 5LWMA 5DNRA 2X8EA 4YJNA 3WE8A 3ZBFA 5BYYA 2Y4IC 2CNQA 3WIKA 2V7AA 2YFXA 4FUXA 4E6AA 4E4NA 5EYDA 3R9NA 3KCKA 3ZXTA 4RX5A 2CCIA 3CPBA 2P33A 1STCE 2AUHA 3K3IA 4LYNA 1J19A 4ZY4A 2ETKA 2WQMA 5CSWA 5AIKA 3MGYA 4S31A 3E92A 4G6OA 5FDPA 3F3WA 3OXTA 4CFFA 1M7NA 3E7OA 3HLLA 3QU0A 4U81A 4KKEA 5JQ8A 5KMKA 1NT2A 2WQBA 4GEOA 3RPYA 5HIDA 4GK3A 2PMIA 2UZEA 4M69B 4DX90 2JDOA 3GENA 1FVRA 2O64A 2YRYA 4ZMEA 4Q5EA 2CKPA 4YHFA 3FXZA 2F49A 3OCGA 3SX9A 2B54A 3FI4A 2RG6A 5I3OA 4U97A 4O7VA 3IECA 5HBHA 3CIKA 4LMUA 3ZOSA 4APCA 2Y8OA 3RP9A 3ZUUA 1E5WA 2VD5A 5AV2A 3NIEA 2R09A 4J8MA 4S34A 5GOWB 4A6FA 4EC9A 3AD4A 5AUWA 3NGAA 5DYJA 4M66A 3QQLA 3AC1A 3U51A 1JOWB 4XBRA 3UG1A 2E2BA 3WBLA 5CAPA 2HZIA 1TQPA 3CQEA 5J9ZA 4GU9A 2XRWA 4RJ4A 1OM1A 5D7VA 4AZEA 4BDJA 4DFNA 4TN6A 3AQVA 1Y19B 2VAGA 4QQTA 2V55A 3WI6A 4W4XA 4EK6A 3GCPA 3P7ZA 5LCJA 2UVXA 4D0XA 2PYWA 3PG3A 3PXQA 3N7CA 4KIKA 3HEGA 4AGDA 2H34A 4II5A 2HE7A 2WQOA 1A48A 4EJNA 2UZVA 4LUEA 4E5AX 5JHHA 2WGJA 4U40A 1UNRA 2K2JA 3G2FA 4NM0A 2PMOX 3HV4A 2J7TA 3R1YA 5HCXA 1PYXA 2QC6A 4AZFA 1OL7A 5B2LA 4BTMA 4HAWB 2JITA 2QKMA 4CHJA 2CKEA 3EHAA 4RC3A 3NYNA 4G5PA 3FZTA 3DLZA 4F1MA 5IDNA 2E9UA 3U8ZA 2YA9A 2R3HA 1WBTA 4NCTA 3ET7A 4WUAA 4YONA 3FMJA 4G3DA 3JVSA 3BBTB 1XQZA 2I5FA 5FEEA 1PMSA 2ONLA 1BAKA 4IAFA 3R00A 1ND4A 2XNBA 4RWKA 2HOGA 4LQMA 3R8ZA 4C0TA 2M14A 1V5PA 2VWZA 3BWJA 3BHUA 3OZ6A 5FWKK 3VUKA 3R0TA 3AGLA 2PZ1A 2W1IA 4L3PA 5CQWA 5ACKA 1RJ2A 4HDOA 5D11A 4LI5A 5DT3A 4FSWA 1OPLA 3P86A 5FM3A 1SHCA 3FKLA 2UW0A 3ANRA 1QQGA 5HE3A 3TUDA 3GUBA 3A98B 2B52A 5LWNA 4U9AA 5HESA 2QOKA 3OWJA 5AP4A 2QQ7A 3ODXA 4NU1A 1M52A 3QTXA 2Q13A 5A46A 3PXFA 4D9UA 3UMXA 4JT3A 3VBXA 4PP7A 3EN7A 3A7GA 4Y83A 1W0XC 3CD3A 4LRMA 4XOYA 3D5UA 4BYIA 3ULCA 4MWIA 4FE2A 5DGZA 4IH8A 5J3YA 4CMOA 5M09A 3QHWA 4XS2A 1KE6A 4XG9A 1WFCA 1V89A 4I3ZA 4GMYA 1UU7A 2XZSA 4XG7A 2P0DA 1RW8A 3BHHA 2EXMA 3MBLA 4FNYA 3ZUVA 4ZZOA 1KOBA 2G2HA 4ZZMA 1JKTA 2QODA 3HP5A 2C0OA 4IDTA 4KS7A 3NW5A 4QTCA 4FTMA 5HO7A 5CSVA 2H96A 5EI8A 3R7YA 1APME 4KIOA 1ZZ2A 1W82A 3R83A 3NUYA 2WU6A 1K2PA 3QXOA 4TPTA 4W4WA 5H8GA 3EQCA 4GT3A 4RZVA 4AZTA 2IZSA 3PSBA 5DR9A 5G6VA 3UYTA 5AA8A 5EDRA 4PDYA 5HNIX 3LFSA 4ZRJA 3QL8A 1WVHA 2WTKC 4JX7A 4M67A 3B8RA 2R3OA 4OAVB 4E5BA 1FINA 5JMSA 4FKGA 2W99B 4ZAUA 3TNQB 4IJPA 2IN6A 4EH6A 5FEQA 5EYMA 4G34A 4CQEA 5HBJA 3U7DA 3QD3A 2R3KA 4KB8A 4B0GA 3KREA 3AT4A 3BQCA 4WG3A 4DG3E 5C5BA 3LFNA 1U27A 1XH4A 3QLGA 3DJ5A 5E8XA 5E8YA 5L2QA 2ROVA 4HB2B 3OWKA 4I20A 4EOIA 3LE6A 4P2KA 5D3YA 4ZOGA 4D4RA 4HGEA 5EQPA 4DHFA 3ALNA 1ZLTA 3O50A 2R3FA 5AAFA 4OTQA 3KB7A 4WHZA 4C36A 4K81A 5HTBA 4WNKA 4ZY6A 4EOJA 4B8MA 2RFSA 4CT2A 2YAKA 2Z7QA 5HLNA 1FAOA 3II5A 3NWWA 4AFJA 5CEOA 2QLQA 1WBNA 4AGUA 3PPZA 4W9WA 2ZDUA 3UO4A 3IG7A 3EN4A 3EQPA 3F5GA 4O27B 5CENA 4D2WA 2Y8GA 3SNHA 4DH3A 2VTPA 2ZV9A 2B0QA 4IZ5A 3SG8A 2ZMCA 3QAME 4CFWA 1MP8A 2WD1A 3LPBA 2YJSA 2Z7SA 2YCSA 3LQ8A 4KSQA 3FBVA 3I60A 3QKMA 4R78A 4XP2A 1H4RA 3ODYX 1WI1A 3A4OX 4NIFB 4B6HA 4FEWA 3UZRA 3VUDA 4FKQA 4XP3A 1MRUA 2G2IA 1ZWSA 2GPHA 2R4BA 4YC3A 4E8AA 3OXZA 1KV2A 3Q4CA 4BGHA 3EFLA 2X9EA 4U44A 4FKWA 2VNYA 2W06A 3D5XA 3FL4A 5CF4A 5DHFB 5EM7A 5FP6A 4C4EA 2W9ZB 5HE0A 2C6EA 4WG4A 4FL2A 1L3RE 5K3YA 3QRIA 3VO3A 3RINA 3VRZA 3A61A 3LKMA 2F4JA 5C01A 1TQIA 2JDVA 3DQWA 4B7TA 1R39A 4O6LA 3TNHA 3GOKA 3WF5A 4ZXTA 2W1DA 1H07A 4A4LA 5JP4A 2R3IA 5I9XA 2OZAB 5A4LA 2AC3A 1R0PA 4EZ3A 3E63A 3WARA 4QP6A 2H6DA 2EWAA 2VTHA 3F3TA 2C3JA 2Y0AA 5CNOA 4L68A 1JVPP 4C8BA 2GTMA 5JK3A 3D7TB 4IE9A 3U87A 1G8AA 1WGQA 4MQ2A 3DAKA 4BI2A 3V6RA 3DA6A 1YHWA 1Q3DA 1SVEA 4D4VA 1GIJA 4DG0E 4EYJA 4ZLZA 5TR6A 5IA0A 2E2XA 1XHAA 1PKGA 4JI9A 2B4SB 3FLYA 1LEZA 4D1ZA 3FQHA 3PVBA 2JBOA 4X2KA 3R8VA 2G35A 3FMHA 2XEYA 3LFBA 3HRBA 5K4JA 2NPQA 3LZBA 2BVAA 3F3VA 5HIBA 2P55A 4XLIA 3TG1A 4PRJA 3A8WA 3C0GA 4MNEB 5K5NA 4GN1A 4GFOA 4QYEA 3FHIA 3D0EA 4N4SA 2CAYA 4J71A 4I0SA 5E91A 1W1DA 2GCLA 3W2PA 2ZPYA 2GNHA 2X4FA 2WU7A 1GJOA 4FSYA 4FVPA 3R7IA 4ACMA 2X8DA 5KHXA 1YHSA 2A19B 2BZIB 3KXMA 4I5CA 5HX8A 3D8FA 2RGPA 1WBOA 3QRUA 4G16A 4X3FA 5AR2A 4NIFA 3V3VA 4GIHA 4J1RA 5L6OA 3QQFA 4L43A 5CYIA 4WO5A 1FMKA 2R2PA 4KBAA 5EH0A 3I1AA 3PVUA 3NSZA 3TUBA 1W7HA 2R0IA 2K2UA 2VGOA 5HNBA 3W2OA 5B7VA 5K5XA 4OTGA 3BELA 2IPXA 4F7JA 3LM5A 2XKDA 4F08A 2X1NA 4ALVA 3ACJA 4ID7A 2CRFA 2UV2A 1M7EA 3GI3A 3EWHA 5CF6A 2PUNA 5A3XA 4EONA 4DC2A 4ALUA 4ERWA 3QTZA 4BTKA 2OJIA 4MYGA 5AP7A 4DLIA 4E20A 4E4LA 3HAMA 5GINE 4GMVA 3ZHPC 2OZAA 2WTJA 5LMKC 3HK0A 4FV2A 5DWRA 1OL1A 3EN6A 4RC4A 2XM8A 4U3YA 3TV4A 3AD6A 4XYFA 2BROA 2QOBA 4FK6A 4PL4A 2F7EE 4O7SA 4EI4A 3D7TA 2R3NA 1KOAA 5EOLA 3VS3A 3TM0A 4DEEA 2FGIA 4TTHB 3K3JA 3P1AA 3QC4A 5KZ0A 3AC3A 4QPSA 1J7UA 3HRCA 5FTQA 5AFVA 3QX2A 4RQVA 4TYHB 2GHMA 3Q9XA 4C2WA 4D9TA 4Q9ZA 2NMBA 3ATSA 4TRLA 5IMEA 3LVPA 2QI8A 3E3BX 4FL1A 4OT5A 4KIPA 4BDKA 4Y5QA 4CV8A 2GS0A 3DV3A 2J51A 4M0ZA 2LULA 5JLJB 2PUIA 4FYNA 3IGGA 2EU9A 2JIIA 4IVAA 3NCZA 4BCPA 3KRXA 4Y85A 4CEGA 1G3NA 2P0HA 3R8PA 2UW9A 4F9BA 4WJ7A 4GKHA 2YN8A 3E8EA 4HNIA 4IFCA 3TV7A 5EI6A 4AW1A 4QYGA 1PF8A 3PY0A 2PVFA 3ZSGA 2XNPA 1OL6A 2F7XE 4CCUA 4KVGB 4G3CA 5L8LA 1ZRZA 4ENYA 3GCVA 3S1HA 1MRVA 3OY3A 4XH6A 3CXWA 4FT3A 4H39A 2I1KA 2DYLA 2VU3A 2WTIA 3CKWA 3C4XA 4L52A 4QMNA 4DFLA 4USFA 4DGNA 1JBPE 5AP3A 1XD4A 1DDMA 3VNTA 4RLKA 1BL7A 3DFAA 4GUBA 4O7ZA 2J0MB 4C4GA 2FSLX 1XO2B 2Q0NA 5EOBA 3DJ6A 3CR0A 3R8LA 4I6FA 3C1XA 3RNYA 4CCBA 3UP7A 1V5MA 2VO7A 4Y72A 2OLCA 4GJ2A 4DEAA 1NU2A 4ZTSA 3U9NA 5E8UA 3ZSHA 4YTHA 4Y73A 3KK9A 3QQGA 1OQNA 4USDA 3UPXA 1OUKA 1S9JA 3KN5A 5DVRA 5ANEA 3O8TA 2XP2A 2PVYA 1YXVA 5KMIA 4S33A 2GTNA 2OWBA 3GQLA 4LGDA 4W4VA 4YLLA 4CFMA 4Z2NA 5AV1A 4IAAA 5DR2A 1JSVA 4OW8A 2ITYA 3F61A 3UOLA 2DX1A 2GCJA 2J0JA 2VWUA 2OIQA 1ZOGA 2QOHA 3FI2A 3W2CA 1QC6A 5KNJA 5M08A 1M17A 2FA2A 2Q0BA 1PY5A 2VKIA 1L8TA 4QRCA 4PMSA 4TNBA 4FTNA 2W5BA 5AM6A 4IB5A 4RJ3A 3QCXA 4U45A 3LFAA 4EUUA 3U6HA 5IA2A 3FHRA 3TKUA 5IPJA 2OQBA 2XNMA 4EKUA 3FZPA 3RCJA 2EXEA 1YWNA 3IPHA 2ZV2A 4JX3A 1OBDA 2YDKA 4QO9A 4WSYA 2R9SA 4K1BA 1H00A 2XRUA 2ZM4A 3COIA 4GJ3A 4DEGA 5M53A 3ATTA 3RZFA 4ZTHA 1DM2A 2HXLA 2IO6A 2FSOX 2J5FA 3A60A 1OIYA 4FV6A 4IC7A 2C5XA 3PA5A 1G8SA 1M14A 2ZJWA 3PXYA 4K18A 1MK7B 2XKEA 3OT3A 3ZM9A 2R3QA 4NJDA 4F63A 2WQNA 3G33A 4FIHA 3OT8A 1OL5A 2XF0A 3F66A 4UMTA 3ROCA 3ZZEA 2RVBB 2VWVA 3CTJA 4JQEA 4PTEA 4TYJA 5E8WA 4JVGA 1U54B 2WAJA 1OVEA 4TYIA 4FG8A 2F2UA 3RJCA 2JLDA 1P5EA 1H25A 1GC6A 1YI3A 5AP1A 5GIPE 4MXXA 3FMMA 4GIIA 4YGAA 3UO6A 3DXEA 2J0MA 4EH9A 2UZUE 3QD4A 2I40A 3OVVA 5HVYA 3QGYA 1JAMA 3PP0A 4IZAA 4PPAA 1YDSE 2YIYA 3PYYA 3ULIA 4N6ZA 3VUGA 1XH7A 2JDTA 5DOSA 3POZA 5E8SA 3ENHA 4Z16A 3AJ4A 2XK3A 3DBFA 4HATB 4C0AA 3KXXA 2YM4A 3FMDA 3I6WA 4DGOA 3UC3A 4RLLA 5BMSA 5E8TA 1GOLA 2F7ZE 3F82A 1K9AA 4HAVB 4MVFA 3GP0A 3UNJA 5CU4A 3TIZA 2OK1A 3LFQA 3MYGA 4BDEA 5I0BA 2B9JA 3P7BA 4C4FA 3IDPA 4TT7A 4YZCA 1KSWA 2R3GA 1JQHA 5IUGA 2R0DA 4CVAA 4EHZA 5ANIA 4I0RA 4LM5A 4C4JA 4UV0A 3VS1A 3ZLXA 2ADZA 5ETAA 4PX6A 2YT0A 5BX0A 4FICA 4KNBA 1PFJA 1MQBA 2DS1A 2Z02A 3EL7A 5LCKA 3A8QA 2X7FA 4EH4A 2I0EA 4I4FA 3V8WA 4G9CA 3MPXA 3VIAA 2E9NA 4LV8A 1YXSA 2LAVA 4A06A 4IVBA 5J8IA 3G5DA 4FOBA 4CG9A 5EM5A 2ERKA 4BVUA 5I5ZA 3QD0A 3P0MA 4RA4A 2JKQA 2W1ZA 5J3TA 5LARA 2QLUA 1MRYA 4AQCA 4U43A 2P8VA 4IX4A 4IXPA 2PUUA 4IX6A 3VF9A 3HMNA 1H26A 4BBFA 1IAHA 1WVWA 2JP2A 4XNEA 5C4KA 3FQSA 4I4EA 4N6YA 4DGGA 1SM2A 4KWPA 3AGMA 3IQ7A 3OEZA 3ULBA 3QRKA 4MBJA 4O22A 4AZWA 1K5GB 2R3MA 3TDWA 4K2RA 4I5PA 4U7ZA 2H7DA 4FZFB 1U54A 3DJ7A 5C9CA 1CMKE 2OI4X 3F3UA 4PPBA 4G3GA 3ORZA 4ZK5A 1Q8UA 2YIWA 3WE4A 1ZM0A 4QTAA 4TYEA 5M44A 1ZVRA 4ITHA 1QMZA 3ALOA 3P7AA 4O7RA 2HIWA 5JRQA 3DT1A 4JRNA 4FKRA 4BZOA 3EYGA 3RCPA 3RALA 4O91A 3DLSA 2C47A 4YSMA 4JAIA 2XA4A 4K6ZA 4D1SA 3HMPA 3OW4A 4W9XA 5EM6A 4CFUA 2UW7A 4GCJA 4C59A 1J3HA 2B9FA 3N4UA 3OEFX 5D27A 2IW8A 3BLQA 2MFQA 2HW6A 4GK4A 5A54A 3M1IB 2QO2A 3GB2A 5DIAA 2JKKA 4R6VA 3MJ2A 4EK3A 2W1EA 3VBVA 3KULA 3V5JA 5D3VA 4HYSA 3JY0A 3RWQA 2YIXA 5GJFA 3QCQA 1M2RA 3CS9A 3DCVA 3NLBA 2VWWA 1PXJA 3G6HA 3JUHA 1FGKA 3PIYA 2GFSA 4YC8A 3PA4A 4U80A 2IVSA 5HNGA 5BYZA 3FMLA 4GPTB 3FPMA 4UWCA 4AGWA 5BVWA 3EFWA 1I7AA 1H27A 2YISA 3ZC6A 4AP7A 4B8LA 4HZRA 4PQ0A 4IMYA 1ZMUA 2PVMA 2UZDA 2CKQA 4UX9A 4O2PA 5M07A 2P4IA 4KKGA 4I41A 4K77A 2LYDA 3L8PA 3IONA 4CZUA 1Y6AA 1ZY5A 4C38A 5IISA 4BI0A 3ZDTA 4MK0A 3TNWA 2CNVA 2X2LA 2BRBA 4O7NA 2BAKA 1B39A 4IB3A 3V6SA 3UQGA 5DA3A 3KMUA 4I1ZA 4IWOA 5EW9A 4YUQA 3CXBB 3UNKA 3GU5A 3NEWA 4O0RA 3KC3A 3BYMA 5CAUA 2UW3A 3SXSA 1UKIA 2ZV7A 2GU8A 4U79A 4AOIA 3M1SA 1V5UA 4V0GB 5G1XA 5A4TA 5HBEA 3I6UA 1H28A 3GCSA 5IA1A 2OIBA 3Q5IA 3DBDA 2PTKA 3W2RA 3IW5A 3H4JA 4OAUC 3DU8A 2UZSA 3ZDIA 2WMAA 2VTMA 4JDIA 4OTIA 2GNGA 3LJ2A 3R7OA 3TCAA 4EWHA 1H0WA 3UDBA 2W1GA 3FEGA 4DTAA 5D41A 4F70A 4D5KA 3DS6A 1BWNA 2ITZA 3PZHA 3EQHA 3MJ1A 4QNAA 3AC4A 2CLQA 4K0YA 5AP6A 3RPVA 4E6CA 2D9ZA 5BMMA 4L3JA 4EQCA 1GIIA 4GT4A 4QMUA 2QURA 4MF0A 5CLLB 2OIDA 2WTWA 5J7BA 3ODOA 2ZM1A 3QZFA 5CVFA 2K00A 3PVWA 4AAAA 2RUKB 3Q2JA 4CZYB 5EYCA 3NCGA 4KSPA 4R8QA 3ZCLA 4FG9A 3DTCA 4DBNA 2JIUA 1S9IA 4IACA 3W1FA 2W17A 2LG1A 4YJSA 3P23A 3ID6C 1LR4A 1PYEA 4YU2A 5L2WA 4GZUA 3VJNA 5E9EA 2ITTA 2WTVA 3FLSA 3PLAE 3QBNA 2X7GA 4WG5A 3FSFA 4QMOA 4F09A 1Q67A 4AUAA 1VEBA 2BIYA 5M4CA 5GIOE 5CY3A 2D2QA 1KE8A 4NTSA 1NTVA 4DT8A 3ORMA 4BRXA 4K11A 3MH1A 4ZSEA 2D9VA 2NNWB 2HY81 1RDQE 2BALA 5DH9B 4J52A 4FIGA 4AZSA 5CQUA 3ZSIA 3IW4A 5CEKA 5JH6A 2F57A 3Q6UA 3QZIA 4FV7A 4R7HA 4J96A 1LEWA 5E4HA 4A5KA 3I79A 3I0QA 2GMXA 1YDRE 2G15A 3QTWA 3BWFA 4K9YA 2XK7A 2VZ6A 3NYXA 3SDJA 2YZAA 4YR8A 3MVLA 5D1JA 5DI1A 4FTAA 1JKKA 2QOLA 4V0GA 4OTDA 5IU2A 2PMNX 2BDJA 3EN9A 4PP9A 2A4LA 2I1JA 1H1RA 5CNNA 4HVIA 3QLFA 4D2PA 3N51A 1PXNA 3MPTA 4H1JA 2RSGA 1B6CB 5DPVA 4F65A 4J99A 2QU6A 4EQMA 3UZTA 3C13A 3ZDUA 2WNTA 1JNKA 3VW8A 3QA8A 4EWQA 4D0WA 3I7BA 4ACDA 4Y94A 3QQKA 1YKRA 4MTAA 2DKQA 5HCYA 1WBWA 1BMKA 4WRGA 3R73A 4H58A 5DLSA 3KMMA 2OU7A 5A4CA 4PL3A 5JN2A 1R0EA 2PVNA 4LMNA 4O0YA 3TJDA 4FSNA 5CF5A 1W98A 3EKNA 4HDQA 4RFZA 2YSZA 3QX4A 1B55A 2QG7A 3R9OA 3GNIB 3FSSA 2BR1A 4A9UA 4RVKA 3PP1A 4JBPA 2GSFA 4YJVA 2C6TA 3V01A 4GXBA 2REIA 4N57A 2OXYA 1JWHA 1ZC4B 1B38A 2W2XC 4FV0A 5IH5A 4RJ5A 4XUFA 3QQJA 4F9CA 3R2YA 1I09A 2PWLA 4KRDA 1CTPE 4A9RA 4PNIA 5B2MA 2HTHB 3BCEA 1QCFA 1H1WA 2QOFA 4RPVA 4QTDA 5HG8A 1G5SA 5KMJA 3FQEA 4NM5A 2BRHA 3SW7A 5FD2A 3MFTA 2AL6A 3AT2A 3GGFA 5HE2A 1H0VA 5EDPA 3ROYA 2M38A 3EKKA 5CSPA 4A6KA 3NNUA 2PU8A 2Z2WA 1Q97A 3PPKA 4HVGA 2YWVA 2GHLA 4M8TA 2J4ZA 4IADA 5HGIA 5ANOA 4HZSA 3OG7A 5CAQA 2YHVA 2GNIA 2VX3A 3DNEA 4O0TA 3LOKA 5E92A 3DAEA 4XV2A 4JBVA 3CP9A 5M4UA 2D11A 3QBVB 4PPCA 1HCLA 4RX9A 3KK8A 3UJGA 4HB3B 3NNXA 3TNIA 1NVSA 4QP2A 4ZTMA 4XG3A 3MIAA 3ORNA 4DA5A 3WF9A 3BX5A 5EKNA 4MAOA 4H3QA 3LCDA 2RKUA 2N0YA 2OXDA 5A6OA 4B6LA 5HG9A 3HUCA 4IVCA 4YHJA 3LFCA 4L3LA 4ZIMA 1LP4A 5D10A 3S3IA 3F2NA 3PY1A 3I81A 4G17A 4KHAA 5CT7A 1IASA 1PXOA 4J95A 3DQXA 4H3BA 4M69A 3A7FA 4L9IA 4RWJA 4UEUA 4HHVA 2A2AA 4IAYA 4YP8A 2L2IA 4NTTA 4FKLA 4FTTA 4BI1A 1SVGA 2CGWA 4DEIA 5J9YA 5L81A 1KV1A 5FI0A 3COHA 2C0IA 2YIQA 3DNDA 3D7ZA 2JEDA 5KBQA 3QC9A 3BEGA 2I0YA 5DH3A 3O96A 5ANDA 2V7OA 3PFQA 4ZTNA 5BNJA 2WPAA 3O71A 2QHMA 3GEQA 4FNWA 1BKXA 5DMZA 4DBBA 3NR9A 1Q3WA 2CSNA 4LUDA 1IRKA 3FKOA 4TNDA 3BHVA 3ORTA 3DK6A 3ZM4A 1U4DA 3WZKA 3MESA 4KUJA 1ISNA 3MH0A 2XJ0A 4PDOA 4IC8A 4X2FA 4HPUE 3TZ7A 3BBWA 5FP5A 3QHRA 3VAPA 5IQCA 4RIXB 5CU0A 4CLJA 5J1WA 2XKCA 3BPRA 2C1AA 2CHLA 3DK7A 2C5NA 4RVMA 3KN6A 3OANA 5GZ8A 2YZLA 4EQUA 3LM0A 3W32A 2WXVA 5J5SA 4PDSA 3TKHA 5M4FA 5M55A 4F1TA 1YW2A 4EH3A 4XX9A 2COCA 5LVNA 4CG8A 4Y95A 4NEUA 5J87A 4DFXE 3KXNA 4DTBA 2ZV8A 3SC1A 3FMKA 1Z87A 3TDVA 4MKCA 5FEDA 3R2BA 4D2VA 3KY9A 5ITAA 2XNEA 1XJDA 3K5VA 2O63A 2JAMA 4FV9A 5JGAA 4FSMA 3GC8A 4CQGA 5HO8A 3PG1A 4NCTC 4WBBB 1FB8A 4OBPA 2HELA 2CMWA 3H30A 3RK5A 3TL8A 4RQKA 4KHOA 3W8QA 5KMMA 3LXLA 2XJ1A 2D9WA 4NK9A 2Y6OA 3BYSA 4GK2A 3WZUA 4MT7A 2ONLC 3EH9A 3C5UA 2JAVA 1H1PA 3CC6A 3QXPA 3QYZA 3U4WA 3AT3A 5CXHA 3DXPA 3KRRA 4U6RA 3ZO4A 3T9IA 5JFSA 3F5RA 2BTRA 4LFIA 5F95A 3KEXA 5AV4A 3SAYA 3RBWA 2VO3A 3HMMA 4W8DA 5HZNA 1XCGA 4ITJA 1WJMA 3ORKA 2UVMA 3FDNA 4EC8A 4MF1A 2JD5A 1H8FA 4XP0A 3PJ2A 4DCAA 5FLFA 2OH4A 3A8XA 1ATPE 3FZ1A 3MPAA 5HE1A 3MA3A 5JFWA 5BVDA 4MXAA 3NVKI 3FV8A 1BX6A 2QD9A 3H3CA 4XLVA 4ZTRA 3JR1A 3PXRA 3PWYA 5T68A 2O3PA 1X1GA 4B4LA 5IQEA 4YNOA 1CSNA 1SNXA 2WO6A 4FKJA 3OMVA 3V51A 1TXDA 3ORLA 3AMYA 3TEIA 4QTBA 4RIYB 1VR2A 3RZBA 1ZARA 2CLXA 4FL3A 4ASXA 2OO8X 4GYIA 3LQ3A 4S2ZA 2IVVA 4QMZA 4FEXA 2DA0A 3QTQA 1O6KA 3A2CA 2O8YA 4WSFA 3QTSA 2HWPA 3E7VA 4MXYA 5BUJA 5M4IA 1WMKA 2QOQA 3FUPA 4ERKA 2YDJA 1OB3A 4RIXA 4C2VA 1YXTA 4LV5A 2COAA 4W8EA 3R8MA 3QD2B 4FV4A 5CLQB 4XRJA 4C61A 4FKTA 4I94A 3Q9WA 4RVLA 2UZRA 4R3CA 5IUIA 2VWYA 3FPQA 3VUTA 3GC9A 1Q4LA 3SD0A 4LGHA 5IQHA 2OFVA 4FEQA 4QYHA 1GY3A 5A14A 2GHGA 3FI8A 3UG2A 2UW4A 2WKMA 4LRKA 4M3QA 1X05A 5LVPA 3EB0A 2YCFA 4XWXA 4GVAA 3WZDA 4HYUA 4QMYA 2R7BA 5EHLA 4O86A 1PKDA 3P7CA 4FKVA 2GFCA 2VX1A 3ELJA 2JDRA 4E6QA 4D0NB 3E64A 3RI1A 3F0WA 4EOQA 3VIDA 3ZXZA 3SQQA 3TACA 4WRSA 2YIRA 1XBCA 3G15A 1UEFA 2YABA 5HTCA 1BYGA 2YACA 4K33A 4L45A 2CN8A 4OTPA 4QQJA 3VRYA 4M68A 4KRCA 4CRLA 5D12A 5EI2A 2FYSA 4F6SA 3UO5A 3Q60A 4EKKA 3OBJA 4BTFA 4FKPA 2OZOA
chains in the Genus database with same CATH superfamily
1Q24A 4JOAA 2HW7A 5EG3A 2Y7JA 5BUIA 2VTIA 1BI8A 4I5HA 3KGAA 5TE0A 2IWIA 2OXXA 3WF7A 4ACHA 4YC6A 3T3VA 3Q32A 2XIRA 4PMPA 4DH8A 2YJRA 4PTGA 3TTJA 5AUTA 3N4TA 2QCSA 3DDQA 4GYGA 5AUVA 4ASZA 5HTIA 4ZRIA 3DXCA 4FIFA 4E1ZA 3LJ0A 2Z8CA 3OTUA 4RIOA 4RIYA 2KGXB 4PQNA 4CHMA 2XCKA 4FT9A 3BE9A 3WZJA 4DFBA 3CY2A 4YTFA 4FV5A 1W2DA 4QP8A 3KSYA 4EOPA 1YOLA 3JYAA 3R8UA 1OKWA 3OOMA 2AC5A 4FSTA 2RLOA 5JHGA 1WG7A 5L2SA 5AR8A 5KMLA 2H8HA 4JBQA 4XG8A 5HG5A 2ZKMX 5M06A 2XK6A 3IDBA 4R1VA 3HGKA 3Q3BA 4FGBA 4BCHA 1DI8A 4AACA 3ZFYA 3VOQA 3VVHA 3QGWA 4UB7A 3RMFA 3NZ0A 1RQQA 4AW0A 3EN5A 3VHKA 3MVMA 4MH7A 5H8EA 5HLPA 3P6AA 1ZYJA 3IW8A 4M12A 3V8TA 4LL0A 5I4NA 2O0UA 4FI1A 4AQKA 5IA5A 5C8NA 2YDIA 4RWLA 3W0SA 3LLAA 2DYQA 5ETIA 4Z2MB 4F9AA 3PLSA 4QMPA 4FEUA 4A9TA 1U46A 1IA9A 3SKCA 2XK8A 1TKIA 4Q9SA 5EQEA 3LAUA 5AAGA 4L8MA 3MB7A 3THBA 4CFXA 2ITUA 2C4GA 5AM7A 1N3HA 4FTRA 3W8LA 3QQHA 2OG8A 2W4KA 2X0OA 2FH9A 1VZOA 4NFNA 4R5YA 4U3ZA 4EH8A 2IVTA 3Q5ZA 1VYWA 2P3GX 4PY1A 4XHKB 2FB8A 4ZP5A 3BEAA 1Z57A 3AC2A 3ERKA 3FLWA 3RAIA 3F2AA 5I2MA 3QYWA 3SGCA 4I23A 1OPJA 2C5OA 3R30A 4IAPA 3W0MA 4GSBA 5EDQA 1PXKA 2XNNA 2ZM3A 1Y91A 4X0MA 3BLHA 3WIGA 1WBVA 3ZU7A 4ZLOA 1O6YA 1WBPA 2B1PA 3H9OA 4FG7A 4D1XA 4DH5A 4AXAA 1OMWA 2WEVA 1GZOA 4B9DA 2G1TA 2HK5A 4WT6A 3ZRLA 2NBVA 3E8DA 2J90A 4MNEA 4AE9A 1YOMA 5AV3A 3FYJX 2DQ7X 2NRYA 3R9HA 2VX0A 3VBWA 1NI2A 3MV5A 4NSWA 1P2AA 4WNMA 3QQUA 4X3FC 4I6HA 5CANA 2OGVA 3KMWA 3FLZA 5JT2A 3UBDA 5JFXA 2VUWA 4F7HA 2VTAA 3GFEA 5CLPA 3C9WA 5LVLA 5J79A 3TZ8A 4LDTA 2EUFB 4EUTA 5KQ4A 1XR0B 2ZDTA 2BTSA 3UOJA 4BBKA 4CYIA 5AA9A 4D6WA 3HL7A 4TXCA 1WZYA 5HKMA 5ACBC 3TNPC 2Z7RA 2DUVA 1OBGA 3DBCA 4JG6A 4QMQA 4FTCA 2EB3A 2J0KA 5F1ZA 4DYMA 3HV3A 4CT1A 3C50A 3CGFA 4RWIA 3ZEPA 4F7NA 4F99A 5BV3A 2YAAA 2JDSA 4Q2AA 2J59M 3FY2A 2BIKB 2D10A 5CF8A 2EC1A 3WYYA 4O1OA 5E8ZA 4UZDA 3ORPA 4UMPA 5FXRA 2VRWB 5F94A 5KMOA 2H9VA 3HSAA 3NW8A 1FHWA 2Z13A 1XKEA 5EHOA 3W33A 4L6EA 5DHAB 2XK9A 1R1WA 4F0GA 3MDYA 3MSSA 3ZEWA 2PVJA 3VJOA 1U5GA 2W4JA 1W8CA 2OF4A 5E1SA 3TI1A 5GHVA 2N23A 3VBQA 5LOPB 3GU8A 4NY0A 4DH7A 4ZTQA 2IG7A 4L7FA 2DWBA 1YDTE 3MIYA 5DEWA 4YTCA 3UVRA 5CAVA 5KCVA 3HRFA 3A62A 3G90X 1Q5KA 4D5HA 4P5ZA 1Z5MA 3SA0A 4K2OA 4UXLA 3HIEA 3PVGA 1XBAA 3QALE 3IO7A 3R28A 4GFGA 4TYHA 5FDXA 4JDKA 4PV0A 4RX7A 3O5AA 4A9YA 3KVWA 3NYVA 4MD9E 5TKDA 5BVNA 2ZOQA 4G2FA 3FZRA 1MIXA 2PE0A 4DHJA 2W7XA 3SXFA 3NSUA 4NT4A 3GQIA 3JS2A 5BPYA 1FMOE 1UPRA 4AA5A 3GOPA 3NAXA 3QFVA 4BIDA 1OZ1A 1Q41A 4MNFA 1J1BA 2WMBA 1DAWA 2XCHA 3SUZA 3LXPA 3K5UA 1T46A 4UYNA 5TOZA 2ELBA 3TN8A 4K17A 4JR7A 4DCEA 4WOVA 3DKOA 1FVVA 3LFDA 5A4EA 2QG5A 3NMUF 4RSSA 3VF8A 3KY2A 4CKIA 3KKVA 2O5KA 4AG8A 2RL5A 1ZYIA 3UNZA 4ORKA 4LL5A 1FHXA 2E9PA 5KUPA 1LPUA 4YZNA 3F5PA 4UMQA 4QJ5B 5I9VA 1XKKA 5A9UA 4BCFA 3DKGA 4NW5A 4RMZA 4MXZA 2Y4PA 2WMUA 4AX8A 1OECA 4F9WA 1OY2A 4O7LA 3TJCA 4AT3A 4FR4A 4CYEA 3C5IA 3ODWA 3COMA 3D83A 3HV7A 2WIHA 3MS9A 5E7RA 4DG2E 2YLFA 3BYUA 1ZOHA 1P4OA 3H9FA 3UVQA 4D28A 3NX8A 3KRLA 3BV2A 4FKIA 4X2JA 4EH7A 4FIIA 4DX8A 4ANNA 4IM3A 2QHNA 3FLQA 2OKRA 5AX3A 1AGWA 3UE4A 5GJGA 4C3FA 2DLWA 3VC4A 4HAUB 4QP4A 3LXKA 1SMHA 3LCOA 5B0XA 3TV6A 1LB1A 5D9HA 1YRPA 4BKZA 3RPOA 4OTWA 4XV3A 3EYHA 5HI2A 3FJQE 5DT0A 3KL8A 2VSZA 2CNUA 4XJ0A 5EHYA 3FC1X 1KE9A 1UU3A 3UPZA 2RG5A 4DEHA 2XK4A 3FE3A 2DYNA 2PPQA 2HZNA 2W96B 4HCVA 2X2KA 4FV1A 2Y9QA 1PLSA 3DXNA 3A99A 4FZ6A 4L67A 5FTOA 3SOCA 4EL9A 5L6PA 4GVJA 1OITA 4JQ7A 5AUYA 2EJ8A 1XH6A 5CEMA 1UU8A 4N0SA 3M2WA 3MPMA 1U5DA 3H0ZA 5CSHA 3DK3A 4O7TA 4BF2A 2Q83A 4O81A 1PMUA 4FVRA 1V0BA 5LXMA 2X9FA 4V04A 3RAKA 3NUNA 3U4UA 3DOGA 2GNJA 2G2FA 4YTIA 4MD7E 5AR7A 3BI6A 3BYOA 2WQEA 3G0EA 4FOCA 4FNZA 4JIAA 4R5SA 4AN3A 3LLTA 2YF0A 4TWCA 2EVAA 3PWDA 3VUIA 1PXPA 3BZ3A 2VO6A 3C4CA 1DS5A 1O9UA 3REPA 4AA0A 2Z0PA 1J7LA 1WGUA 3CSVA 1HCKA 1V61A 4W4YA 2YS3A 1Y6BA 5JGDA 1YOJA 2C3IB 3NAYA 4FV8A 2CN5A 1OPKA 2Z7LA 3PPJA 4O4DA 4BWPA 3BYVA 4FYOA 4M14A 4BBMA 4L42A 5CSXA 3T3UA 1BTNA 3FXWA 2DHKA 1EGXA 3W0PA 4DITA 5KZIA 2GS7A 1WVYA 4MWHA 4Y46A 5AEPA 1Q8YA 3JPVA 3JXWA 4IWDA 1U5FA 3NRMA 4HAYB 2PE2A 4KIQA 1FOTA 2QOIA 4PTCA 3CCNA 1NVQA 2X2MA 2OJJA 3ZO1A 1J1CA 4XG6A 4FTUA 5LQFA 3BGZA 3FAAA 4FV3A 3QZHA 2W2WA 5AUXA 2O2UA 1KE5A 3KRWA 2Y4IB 3E87A 3ZLSA 5JQ5A 5C8KA 4NSTA 4IIRA 3KF7A 4A6HA 5TT7A 1Q62A 2R3JA 5CWZA 3PJ8A 2HY0A 3MTLA 4D2TA 1XH9A 4HPTE 3SV1A 4BDDA 4ZY5A 5L2IA 3QUDA 5CVHA 1QPJA 4I24A 3E88A 3SHEA 2ZYBA 4P90A 5AMNA 2JBPA 4NM3A 2RNRB 3UOHA 3BU5A 3CJGA 4BCGA 4O4CA 2ITQA 2X39A 3BKBA 3C4WA 5AIRA 2LOXA 3WA0A 3R1SA 3V5PA 1NXKA 3AU5A 1OKZA 3L9LA 3MI9A 1DI9A 4M7IA 3V5LA 4C7TA 4P7IA 1H1QA 4AE6A 2CCHA 2NYAA 2OH0E 2QOOA 4FF8A 3VS0A 2MKRA 4RIWB 3TZMA 1YI4A 3MTFA 4YZBA 1SNUA 2XIZA 4NWMA 4N70A 3PG7A 3HA8A 2PY3A 3RAHA 1H10A 2W4OA 3ZLWA 2QU5A 4D2SA 4AOJA 3MY0A 1MQ4A 2UVYA 3LFFA 4C34A 4XG2A 4HCTA 3DB8A 3OC1A 3DXDA 3DGKA 3PIZA 3R7VA 2PE1A 3VN9A 4RFYA 3ZMMA 3LCSA 5L2TA 4M97A 1PXIA 4KAOA 3E3PA 3UVPA 3L8SA 3V04A 4H05A 4BGGA 1OKYA 4F7GA 4F4PA 1J7IA 4C33A 4ANBA 5CI7A 3OW3A 1X1FA 3I5NA 4L00A 5IH4A 5F9EA 3U54A 2LOZA 5HO6A 4BL1A 3HKOA 5I9WA 2YT2A 4G9RA 4Q5HA 4BGQA 1FVTA 5CU2A 5L8JA 1OGYA 4L53A 3IOKA 3ACKA 1P6SA 1JSTA 3EQIA 3EQDA 3O51A 3OOGA 4FSUA 3D2IA 3NUPA 5GZ9A 4AT4A 4EH2A 1MPHA 2CY4A 4B99A 2FSMX 3ZZWA 4BDAA 3O7LB 2D9YA 3ZFMA 3COKA 3QKLA 4QMXA 1URWA 1XMLA 4DDIA 3MH3A 3SVVA 5JFVA 2BAJA 3D15A 4O21A 4R1YA 4UY9A 2RIOA 4RT7A 5AUUA 3R6XA 3EOCA 3VS2A 4YZMA 2A1AB 5JEBA 5KKRC 2BKKA 4YO6A 3HX4A 3ZFXA 3LQ5A 3NVMB 2C6IA 5FBOA 3DXQA 3DDPA 4GNKB 2HZ0A 2NO3A 4YHTA 4QDEA 3MB6A 4CXAA 4H8SA 5IG1A 2WMWA 3WZEA 3OXIA 2JIVA 2BZKB 3OS3A 4BZDA 4DHZA 4BN1A 1E1VA 3PTGA 4CTCA 1YWVA 3FVCA 3V5WA 1PHKA 4GV1A 5CZHA 1P4FA 5K0KA 3RGFA 3ML4A 4TZRA 5BQ0A 2R3LA 1YHVA 4YJRA 4EOSA 2PULA 2QO9A 2YM5A 4Z9LA 2P2HA 3BINA 4YZDA 3AC5A 5IA4A 4TKNA 3KFAA 4JR3A 4CKJA 4HB4B 4A6FB 2XJ2A 1Q8ZA 2C3LA 3UIMA 2COFA 3ENMA 4K2PA 4X21A 1OIQA 3QIJA 5DG5A 3KRJA 4WKQA 4BCNA 4LRJA 3CLYA 2B55A 1UA2A 3P4KA 3EFJA 4G6LA 2AEHA 3W0NA 4ANQA 4NW6A 1RRPB 5IMXA 2VTJA 2X6EA 4JJRA 4KD1A 2W1HA 2BUJA 5C26A 5I9YA 2R7IA 2XH5A 3L9PA 5H2UA 3MW1A 2WIPA 5CEPA 5JSMA 2YCQA 4CLIA 2G9XA 4USEA 2QR8A 4YJTA 4FBXA 4L1RA 2W5AA 4KIKB 1FGIA 3GC0A 3Q4TA 5EFXA 1GZKA 4XRLA 3HDMA 4NYEA 1H24A 4UALA 4QPMA 3QWMA 3BLRA 5J3QA 3E8CA 2A98A 4RJ8A 2C3KA 3IDCA 2PVLA 1AQCA 4TW9A 4QQCA 5M57A 4OBOA 3MFSA 3WYFB 3O0GA 1IG1A 4FT7A 1UVRA 3UYSA 4C62A 5C1QB 3SW4A 4DGMA 3FEHA 1F3MC 5AR5A 4TYGA 2WTKB 4YJUA 3NS9A 2X0QA 2WMTA 2I0HA 4MXCA 2W0JA 1Z9XA 1ZOEA 4AFEA 2P0FA 3EMGA 4F1OA 3TCPA 2EMTA 4ZS4A 1AQ1A 5IUHA 2UZWE 3OF0A 1WBSA 3UMWA 5C6RA 1PXLA 2IW9A 3ODZX 4DFZE 5L3AA 3G51A 2BAQA 3RM6A 3W10A 4EORA 3DTWA 4E6DA 1I2HA 2I7QA 3Q2MA 4BWKA 4J97A 3F88A 2IFSA 2C6DA 4ZSLA 2K49A 2PSQA 3FLNC 1LUFA 3HV6A 5AP2A 3CBLA 5K0XA 1YI6A 4RFMA 3OUNB 2UZNA 5JZNA 2P2IA 4R3PA 1EH4A 3LJUX 1YXXA 3B2TA 1YXUA 2W5HA 5BYLA 4EYMA 4D4SA 3U6JA 3W18A 3ULZA 2XEZA 2XNGA 4CNHA 2CGVA 1FBNA 2HZ4A 5IQBA 2CODA 2ZMDA 3BU6A 2GJYA 2GS2A 5F4NA 1CDKA 4I6BA 2I1MA 4L44A 5ETFA 2YM8A 4QMLA 2CGUA 3UP2A 3VS4A 2XS0A 3DBEA 3SG9A 2XYNA 1REJA 4ZEGA 3A7JA 1ZMWA 2WMQA 4MHAA 1WAKA 5ICPA 2WMVA 4PNKA 4FTOA 2EMSA 1KZ7A 5EKOA 4AGCA 4FT0A 5L8KA 4EJ7A 5CU3A 3SOAA 3T9TA 2JKOA 2PMLX 4BICA 4F6WA 3L1SA 3PSDA 3RK9A 1OKVA 4D2RA 5CALA 1MKEA 3F5XA 3L8VA 4LOQA 2RSVA 4Y5HA 3U8WA 4CSQA 1Y57A 5DN3A 3BL7A 4ANSA 3TWJA 4GU6A 4FKSA 5AUZA 2BPMA 4BC6A 2W05A 1YWRA 4QMWA 1WVXA 4NJ3A 3K54A 3S4QA 3VBYA 2O65A 1LW3A 5DFPA 4YPDA 5BVKA 5CASA 4TL0A 5T3QA 4ZMFA 3S2PA 1T45A 3QA0A 2GS6A 4NM7A 5DBXA 2XNOA 5E90A 3CE3A 2IEWA 4U0IA 2X7OA 3HAVA 3QWKA 5HU9A 3PA3A 3CQUA 3TIYA 4J53A 1SVHA 5E8VA 1TVOA 5CEIA 4F7UP 1PW2A 3DBQA 3G6GA 1GAGA 4AXCA 4ASEA 4AU8A 1PXMA 1UV5A 4RZWA 3RAWA 4YURA 4E26A 5LG4B 4JBOA 4DGLC 2DN6A 2VGPA 3TZ9A 4MBIA 1URCA 3GC7A 2R64A 2J6MA 4OT6A 5FBNC 5C5BB 2V62A 4HNFA 3RK7A 5AX9A 2DHJA 3D5WA 4NKAA 3UQFA 4BDGA 3RHKA 3KZ1A 3VS6A 3K2LA 3O17A 4FNXA 5FXSA 4AOTA 4X6RA 5DR6A 3U12A 4YO4A 3T8OA 4CRSA 2B7AA 5IF1A 3UGCA 2W1FA 1R78A 3RNIA 3LCKA 4FTKA 4GMXB 3M11A 3AMBA 4FZ7A 1J0WA 3MY5A 3QCSA 5DI9B 2XMYA 3UDTA 4YJPA 5HU3A 4UN0C 5I3RA 3W16A 2YM3A 5DIFB 3NUAA 3VQUA 3RPSA 4FTQA 3TXOA 4EOKA 3C7QA 3GU6A 3H10A 4EEVA 5AAEA 5CEQA 3Q52A 5D3XA 4OTRA 2R0UA 1W1GA 4U41A 2HCKA 3PXZA 4RJ6A 1Q8TA 3U9CA 4QDVA 5HOAA 4R77A 2W2XD 1IAJA 2VO0A 3O23A 3TMOA 4JDJA 3BE2A 4OUCA 5C03A 4UMUA 1NY3A 4CSVA 2Y6MA 4ITIA 3PUPA 4MY6A 4BDFA 2I0VA 3UTOA 4O4FA 4QPAA 4PMTA 4M84A 3RHXA 3TFMA 4BCOA 3TVVA 3PZDA 3LW0A 3D14A 3KVXA 5I9ZA 4S30A 4MCVA 4YMJA 5M56A 4RX8A 2RFNA 3F2RA 4QD6A 1JKSA 4E3CA 4JG7A 4YJQA 4AZVA 1R3CA 2QONA 4J7BA 1P14A 4FEVA 3U55A 2X18A 3Q53A 4BDHA 1IR3A 4GW8A 4QYFA 3PJ3A 4ACCA 2KUPA 3QZGA 5LVMA 2VWBA 3O7LD 3QUEA 2X4ZA 4FSQA 4RGJA 4F0FA 4F7LA 4S32A 5TO8A 3R9RA 1AD5A 2J5EA 4FZAB 5D7AA 4HAZB 1K5DB 3S0OA 5IA3A 2MDXA 3I4BA 3LFEA 2GQGA 3UIXA 3WILA 1UNGA 1REKA 4QP7A 4FIEA 4IW0A 5IEYA 4O82A 2OJ9A 1NA7A 2F2CB 3DPKA 4IHPA 2J50A 3OBGA 1U29A 2X81A 4TKSA 5A6NA 3EL8A 3QRJA 1G8KA 4D55A 4F64A 1NW1A 3PZEA 1Q61A 3FY0A 2J0IA 1XH5A 2GDOA 4LG4A 3VS5A 3Q6WA 1OIUA 4C3RA 4BDCA 1KI1B 1F5QA 3VULA 2CPKE 3VW6A 4QMTA 2DTCA 2BDFA 4UXQA 3HMIA 2FSTX 2AQXA 2XYUA 5IEXA 3GU7A 3W2SA 4WIHA 2VWXA 4L01A 3C0IA 4BHZA 2B9HA 2ITNA 5HIEA 2UUEA 1RJBA 2YERA 1GZ8A 4R3RA 1MK9B 5EK7A 3C51A 3ITZA 2BMCA 4OBQA 5CAOA 3CY3A 4KINA 4BDBA 1PMVA 2A0CX 3W0RA 3OY1A 3ZTXA 4QXAB 2C5YA 4YSJA 1TZDA 2JGZA 3Q96A 1UKHA 4OTFA 4BCKA 5JZJA 1XX0A 4IFSA 4IEBA 4FKOA 3RCDA 2R3PA 2NRUA 5FTGA 5HD7A 5E1EA 4GKIA 3Q9ZA 1TQZA 4FODA 4O83A 1DAYA 1UNQA 4FTLA 1M2PA 4O0XA 1V88A 5EW3A 4X3FB 5EM8A 2V5QA 4H1MA 1A06A 3OUKA 4AW2A 2X0GA 2CGXA 2P0CA 3D2KA 1BUHA 4WD5A 5KQ1A 2XQNM 2V0DA 1JLUE 3ZUTA 1KE7A 4ALWA 1V0OA 2CJMA 2WB8A 3W0QA 2VRXA 4RRVA 1WCCA 3DCXA 3KXZA 3BRBA 3OCTA 1M7QA 2UW8A 2WOUA 2GCDA 1V0PA 4IVDA 4IB1A 1BLXA 4IZYA 1DDVA 3GYOA 4X2NA 4EHEA 4UWBA 3OHMB 3QKKA 4RVTA 4QP1A 4U5JA 4CD0A 4E5WA 3A7IA 3MY1A 2FJLA 1ZZLA 1U5QA 2VTQA 1F0QA 4BKYA 3FWQA 5EFQA 4XEYA 4Z55A 3AKLA 4JIKA 2VTLA 3OP5A 4NFMA 4FSRA 1K3AA 5CTPA 4EMOA 4IJ9A 3FMNA 2BZJA 2YLEA 5LONB 3R21A 4O7YA 4X7QA 4GT5A 4GRBA 3EFKA 4L7SA 4HB0B 1UPQA 2VWIA 1T77A 2PZIA 3CKXA 4JLCA 3NUSA 3JY9A 1DYNA 4MX9A 5LMKA 3NIZA 4G3EA 1RE8A 4XBUA 3R71A 4ONAA 3CPCA 3PY3A 4WNOA 2WTCA 2YITA 5AR3A 2KR0A 4O2ZA 5KBRA 3HECA 3GBZA 5ANKA 2C68A 2C1BA 2XALA 2AYPA 4QMSA 1CKIA 1UNPA 2CKOA 4ZJIA 3HNGA 4CFVA 4OTHA 4AW5A 4KAXB 4FK3A 4KBCA 3R02A 5J9LA 2B9IA 2BFXA 4LOPA 4RC2A 2YS1A 3AKKA 3HYHA 3IW6A 4EHGA 3R7UA 3IS5A 4BIEA 3FZOA 1V1KA 4O6EA 3BGPA 4IB0A 4V01A 4EK4A 1FGZA 2HWOA 3CEKA 4M15A 1MUOA 4GG7A 5B2KA 1ZMVA 3DKFA 4KS8A 2ROZB 3ZVRA 4A7CA 4XV1A 3I7CA 4HW7A 5HCZA 5J1VA 2DFKA 3HW2B 4JQ8A 5IQGA 4I0TA 4DLJA 2KULA 3FM8C 4ZSGA 3D5VA 1OL2A 1ZYCA 5CZIA 5D3WA 4CV9A 2IZUA 3MVHA 5IQDA 1ZXEA 2D4QA 5AJQA 4IBMA 4IM0A 4BBEA 3QUPA 2WEIA 3LMHA 4KA3A 2Z0OA 4ZJVA 2IYBA 3MN3A 3PDTA 3PRFA 4I21A 3UIBA 4BHNA 4C3PA 2ACXA 1WJ1A 2BRNA 5IQIA 4TY1A 2IZTA 3P08A 3CTQA 4O38A