4EJUA

Staphylococcus epidermidis tcar full length
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
149
Chain Sequence
RRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLEKPDSNTDQRLKIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the antibiotic recognition mechanism of MarR family proteins
rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription regulator
molecule keywords Transcriptional regulator TcaR
total genus 47
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ejuA00
2GXBA 4KICA 4YFNF 3V8LA 4MQ9F 1TBXA 3MZYA 4EM0B 4ZZDA 5FO5A 5E18F 4KYWA 3BJAA 4G7OF 2MLKA 2EFQA 1LEBA 2XAFA 4G7ZF 1B4AA 1SMTA 2P7VB 3DXJF 2BGCA 2NNYA 3HRMA 2HOEA 3RYRA 4I0AA 2PJPA 4EGYA 2CQKA 5LBQA 4U88A 2GQQA 1FLIA 5CJ9A 4ZYGA 2RKHA 2G9WA 1ZG3A 2A07F 5TJJA 4BYYA 3CTAA 5HLGA 3D5LA 4HX8A 2VC0A 4KIBA 3CO7C 1TQMA 1IZ1A 2LNBA 5LLQA 1MKMA 3V8KA 3LA2A 2HS5A 2A6EF 4LMYA 2VBWA 2IA2A 2GAUA 2L54A 1J2XA 2RNJA 4LLGF 2WV0A 1WQ2A 3LAJA 1J5YA 2ZJ2A 1ZH5A 1LNWA 5BS6A 4U7DA 4A2UA 2VE9A 3BJOA 2RQPA 1IAWA 3Q9SA 2XASA 4F7ZA 3GWZA 3QPHA 4Q47A 1U6GA 4BHBA 4N0BA 3RKWA 1G6NA 1V3FA 2LF8A 1DPRA 3O3KA 2RDPA 3VOEA 4WF2A 3DFGA 3REOA 1XCBA 2NRAC 4O3MA 1NHAA 3I71A 4HDUA 1XCVA 3VFZA 2VBZA 3L9FA 3WODF 2XKOA 1J0RA 3W6KB 1WI9A 2K02A 2P5VA 1EH7A 2VN2A 3MQ0A 4E70A 2GZWA 4MTDA 3I53A 1I1SA 1KU2A 1FBSA 2EWNA 3LQRA 3J80K 2UWMA 2VE8A 2FBHA 1R23A 2QBYB 2VXZA 2YR2A 5J8CA 4HA8A 3HRSA 4AVPA 2RGVA 4RAYA 1IN7A 3K1MA 1UB9A 2P4WA 2DW4A 4JQFA 2V9VA 3VEPA 1QGPA 4OOIA 3JTGA 2V1DA 3M9AA 1LVAA 2AS5F 1SD7A 2B0LA 3MAJA 2HDCA 4L0YB 2KIMA 1GXQA 3K2ZA 2CSOA 5D6FA 3WTWC 5IT9Z 4ENNA 5JFRA 1RUOA 2WTEA 4A0ZA 4L0ZB 3RKXA 1YW9A 2WWYA 3EQLF 2VBYA 4ESBA 5AIPA 1YO5C 3TDZC 4YFKF 1XGMA 1G4DA 2IRFG 3RKYA 3Q5FA 4FX4A 3MCZA 3I58A 4CICA 1XMKA 3T0YA 1ZREA 2HKXA 1DDNA 2VODA 4JBAA 3I54A 4XSZF 5J8FA 1KU7A 1BOAA 3BWGA 3FX3A 4GXOA 1CF7A 4YIIA 2MC3A 1DP7P 1U8RA 5J6XA 2E1CA 1LDDA 2OZ6A 1STZA 2QQ9A 1FSEA 3LWFA 1USSA 4BXUA 4HX7A 4CHUA 1BN5A 4RB3C 4P5OA 3F21A 4ZYDA 3OV8A 2M30A 4HX4A 3FHZA 3CLOA 2FOKA 3WTTC 4KFCA 2PEXA 2E7WA 5KVRA 2EB7A 4IPAA 1Z9CA 5FGMA 1R58A 1BM9A 2OAZA 3O6BB 5FFZA 2K7LA 4OMZA 3F8CA 5BQTA 2RN7A 1MZBA 2PFBA 3EETA 5H20A 1ZHFA 3IWFA 4YIFA 5ERIA 3PFIA 1QPMA 4P9FA 3E5UA 4MTEA 1FYKA 2CGPA 2RV8A 5CVUA 5D8KB 1FYMA 3F6VA 4UUVA 1F4KA 2H6CA 1KQ0A 2OQGA 5DDGA 3ZMUA 1ONVA 4ENKA 3HSFA 3CUQB 5DCMB 3K0LA 1KA8A 2VC1A 4IF4A 5D4SA 3JSOA 3L7WA 4G8XA 2DU9A 2DTRA 1XDUA 2KJBA 2PMUA 3F3XA 3C1DA 5KK1A 3NQOA 3K1PA 5D4RA 3F23A 2FQ3A 4IRHA 4QWQA 2PBIA 3HOSA 2Z5UA 1HBXG 3WTUC 1BI0A 2K86A 4Y15A 3HIFA 2A5YB 2ELHA 2HTSA 4EM1A 4IRIA 4KT5C 4EMSA 3SZPA 2ZKZA 4XSXF 3E97A 3HSEA 4LG0A 3WU0A 1I27A 2L3DA 4U0WA 4EM2A 1W5SA 3E3VA 5LHIA 4Q4ZF 3Q9VA 4BHPA 3ML6A 2NNNA 5H6RA 4M71A 3TO7A 3CO6C 2XHKA 4HF1A 3G3ZA 4M9SA 5E17F 2CO5A 5FLXZ 1OPCA 1YLFA 1S3JA 3DPLC 1FSHA 2D2WA 5ICFA 2Y48A 3E5XA 2PG4A 4Q5SF 3ULQB 3QPTA 4EJOA 2HQNA 3P9IA 4U0YA 4KA4A 2MBFA 4TV7A 3RJPA 5LGUA 1DUXC 1K78A 1T0FA 4M6XA 3GXOA 1JXSA 3HHGA 4Y17A 2EK5A 2UXNA 4A0YA 2R3SA 4CZZA 1KGSA 1ZLKA 1CGPA 4ESJA 1HKSA 3L2CA 3AAFA 3KP3A 1XSDA 4A5NA 2W24A 2F5CA 2J5PA 4B8XA 1RZ4A 3KP4A 4G6QA 2L02A 1G3TA 1G3YA 4XLPF 3TKYA 3RPQA 2NYXA 1XGOA 2DO7A 4NHJA 1FYLA 3I59A 4L5JA 3BDDA 3I64A 1L0OC 2ESNA 2XAHA 3ERED 3QAHA 5HS9A 2Q8KA 2FU4A 1IN5A 1V4RA 2IPQX 4KMUX 3CUQA 1J9IA 2DK8A 3BJ6A 1TNSA 4IXAA 1I6XA 1ON1A 2W84A 4AIJA 3V4GA 4G6DA 4HYEA 4B09A 3P7NA 1I5ZA 4M72A 2WC2A 3DV8A 4L9NA 1O7FA 4UVAA 2JPBA 1R22A 1QZZA 3IL2A 4MEYF 3E6BA 5CLSA 4GYGA 2HKOA 4WXCA 1T98A 3ZN1A 5D5UB 4Q48A 3R4KA 2UZKA 2W25A 2Q2EA 2VBXA 3I59B 4YG2F 4K2EA 2FSWA 1FP1D 3WTVC 3HSRA 1KQ8A 1U5TB 2XAGA 3QP6A 3GW2A 1ZG1A 1YS7A 2RC4A 3LA3A 1XGNA 2V6CA 3KEQA 1ZRDA 2QBYA 2KRFA 1K6OA 4M74A 2MA3A 3EUHA 2ISYA 1ZGJA 2PN6A 3KZZA 3K69A 3VB2A 4D0PA 2PI0A 1FNNA 2MLGA 3WTSC 2A68F 3JW4A 2XGXA 4RB2C 4M73A 1FBUA 3WU1B 2VOOA 3HOTA 5HLHA 2H27A 5DYMA 3GO5A 3HUGA 2DPUA 5E1ZB 2DK5A 3CJNA 3V7CA 3FMSA 5DUIA 1TNTA 2O61A 1JE8A 5D8LB 3ECOA 2QVOA 4ZYHA 5E8GA 2F5FA 2XKPA 4RGUA 3WTXC 2QQBA 1P4XA 1KQ9A 3WGIA 1F1ZA 4KIGA 1WSUA 2EFPA 1CF7B 1KU9A 1U3EM 2DBBA 3RI4A 3ABTA 2Y0MA 1B9NA 4RB1A 2ACJA 2BEOA 4IHSA 2OU2A 1R1UA 4GYIA 1P2FA 5ICEA 5K5QA 3QP5A 1BJAA 2H94A 1WKMA 3GYHX 1GXPA 4YFXF 1F9NA 1HKQA 2J5OA 1R36A 3BP8A 4MNUA 1Y0UA 4O6JA 4EGZA 1BC7C 4A0XA 3TDUC 5ILUA 4ENJA 2FF4A 3F22A 4FHTA 2HGCA 1IXCA 4XRFA 2CWEA 4I02A 2XAJA 2BE5F 1MD0A 3QU3A 3FM5A 4IHTA 2ZBKA 2FNAA 1I1GA 4KUMA 2IT0A 4H0EA 4ETSA 2EJRA 2HTJA 2M45A 1LDKB 2Q0OA 4HQEA 1OMIA 2IA0A 4LGWA 3GEZA 2EV6A 5CVIA 3RPUA 2R7FA 1MJBA 1JHFA 3EYYA 4WX9A 2EA2A 5LEJA 3KP5A 3GF2A 2QLZA 2EV5A 5L3GA 2IA1A 2ZFWA 4MEXF 1HW1A 1YTYA 3PQJA 2M5WA 2M1BA 3C7JA 2IJLA 5LRRA 2HYFA 3V7SA 2MH9A 1EH8A 3ABUA 1IF1A 3TGNA 4A12A 1SD5A 5DCMA 4OIPF 3F8BA 1UFMA 3RIRA 4UHTA 2XVCA 2FRHA 2HQRA 3IRQA 5K5OA 3ZPLA 4AIKA 2HFHA 2F5EA 4KNYA 4P9UA 4HF2A 3GUDA 3FWEA 3KP7A 3I4PA 1H0MA 4L9VA 1P92A 4A6DA 3TO6A 3IC7A 2DT5A 1S29A 3P9KA 1YW8A 2ETHA 2XV4S 2XAQA 2FBKA 5HVQC 1YW7A 1TW2A 1ON2A 1SMYF 3L00A 1Z05A 3J81K 1OYYA 3GZ6A 2VOPA 3KP2A 1YYVA 5FFXA 2O8XA 5F6FA 5E1WA 5LEKA 1IN6A 4I01A 3QOPA 2FEZA 4LFUA 3ROUA 1BIBA 3N97A 1IXSB 4L5IA 3QRFF 5DUKA 2GA2A 1HSJA 3G73A 3BY6A 2GWRA 3FMQA 4ON0A 3B73A 2JT1A 1O7LA 5L3DA 5AONA 3M8EA 2ZCWA 1X3UA 1IRFA 1T39A 3F72A 4I0BA 1TQPA 3BOQA 1W7PA 4PGGA 4KMFA 1TQIA 4HF0A 3TQNA 4HW0A 5DD4A 4OINF 1XDSA 1R1VA 1BIAA 2FNPA 4HQMA 3J7AO 1REPC 4L18B 1DPUA 1H9GA 1Z7UA 3ZMVA 3V8JA 2O0YA 2DLLA 3WGGA 4I09A 3GFIA 2OD5A 3NRVA 2HZTA 2EFWA 5D5XB 1UCRA 4NB5A 5FB2A 4WWCA 3LFKA 2H09A 3DP7A 3TOBA 4QLCU 2OA4A 3ELKA 4AWXB 1ZGAA 3BPVA 2OZUA 1FP2A 4LK1F 1OKRA 3MZHA 4MHGA 2ZMEB 5CVVA 4WCGA 3IWZA 4CXFA 2JZYA 1MJAA 5D5VB 5HDGA 1D8JA 4HV5A 3BZ6A 4I98B 1K79A 3SQNA 4EVIA 4EQQA 2YU3A 3ZQ7A 4EJVA 3H92A 3KE2A 2VT3A 3RYPA 1EH6A 4L9JA 2OBPA 2YPRA 1R00A 1MDMA 2FMLA 3FXQA 5ILSA 4M9ZA 1ZRFA 1QQIA 5BOXA 3WTYC 2YX4A 1OYWA 4DQ2A 1OR7A 1WRJA 4ASNA 1R5GA 2GA1A 1RI7A 1S6LA 1D8KA 5HDKA 2W57A 1K78B 1R5HA 2Z9OA 3ZMZA 1D5VA 5A2QZ 3HHHA 4HAMA 2P7CB 4RS8A 2LSOA 5JI6A 4GCVA 1U5TC 4KN4X 1YS6A 3BROA 2FA5A 1BI3A 4ZH4F 2F2EA 4R8HA 1B6AA 4KN7X 1VTNC 3J80Z 2YSRA 5EEHA 4UNOA 3F8FA 5JHUA 1J59A 1T38A 1E2XA 3M8FA 1USTA 1O3SA 3DQVC 5CVJA 1WWXA 1QO0D 4N9HA 1ODDA 2JSCA 3H3ZA 1J7KA 3E6CC 2QZ8A 5HS7A 2TDXA 5HOOA 4GO1A 5IT9K 2P6SA 3N4MA 1IN8A 2LF7A 4OIQF 5BPIA 1L3LA 3F8NA 2V1UA 4MGRA 4R1HA 3EDPA 2ZO4A 1W5TA 3DPTA 4LB6B 3MFKA 3DEUA 2P6TA 2DAOA 3R0JA 3H3UA 1IRGA 5FD5A 3V7RA 4I2OA 1KYZA 5L3BA 3T8TA 1W7PB 2P8TA 2YX7A 2STTA 3VODA 4PGHA 4AIHA 3JAMZ 1ZRCA 2Z99A 2LDUA 3CDHA 1K7AA 4Y13A 3DKWA 2HWVA 1P4AA 3JTHA 1JGSA 1P4WA 5HS8A 2CFXA 3I5UA 1SAXA 2X0LA 2FMYA 3M7GA 1XMAA 4OIOF 4FX0A 5IT3A 2V1XA 4LD5A 4BHCA 3HRUA 3KZYA 4L9TA 2ZMEA 1T2KA 2E7XA 2O3FA 2VONA 4HLYA 1JHHA 2Z3YA 1MDMB 4HV6A 3IRRA 2D45A 1RNLA 3KP6A 2IP2A 1Z6TA 1W4MA 3IKTA 3ZP5A 3IHUA 1HQCA 4P55A 5D5WB 5BMZA 3LSTA 4IRGA 2STWA 3O2PE 4RGSA 2LKPA 4UV9A 5JR3A 3HYIA 1FC3A 4O5VA 5E20A 3SZTA 1H9TA 1O57A 4CGZA 2IVMA 3WTZA 5CYVA 3TOAA 1ZLJA 4DNCA 2FE3A 1R7JA 3TO9A 3C18A 2EV0A 2G7UA 3GVAA 1O3TA 5HLIA 1S7AA 2UXXA 3R61A 1O3QA 1B1BA 1LJ9A 5AIQA 2HEOA 2NS0A 3K1NA 3GFJA 1TW3A 3ZMSA 2PMHA 1SFEA 5DV5A 1PUEE 3LA7A 4RGRA 3J81Z 1XSVA 3KETA 3GZ5A 1D3YA 5DEQA 3S2WA 5ICCA 2P5LC 2CW0F 2PQ8A 5ILVA 2OQRA 1YFHA 4RB0A 3ZN0A 4PZJA 2ZNYA 3ECHA 2A61A 1OYIA 2HR3A 4BH9A 4PDKA 1KU3A 2GIVA 4CYDA 4G94A 1Z1DA 4LJZF 1IW7F 1F5TA 5DD8A 1HSTA 1B9MA 2L4AA 3T1BA 2XIGA 3LAPA 5H6QA 4R79A 1IN4A 2W85A 2ADUA 3GFLA 3R0AA 2Y75A 5FLXK 2DQRA 2R7DA 2EA4A 2GXGA 2KJCA 3R6SA 1ZAOA 3ZMDA 4U0VA 1FWZA 3WE2A 2JPCA 1ZYRF 1UHMA 4M6YA 4UVCA 3DF8A 1Q1HA 2DPDA 3E6DA 3OOPA 4WXDA 3SFZA 1Z91A 4Z2YA 4LG0B 2DFIA 2ISZA 2K4BA 2K27A 4OU0A 3KFWX 1ZN2A 1LDJA 2A6HF 3GLXA 4UV8A 5ICGA 4OMYA 3E6MA 3E5QA 2FBIA 1Z6RA 4XLNF 3U1DA 3WE3A 1BI1A 2A69F 1O3RA 2KIUA 2CYYA 4RGXA 4CDGA 3RTRA 5L3FA 1J75A 3KLOA 1FY7A 5E8IA 1IXRC 1TTYA 2QYOA 2CG4A 2FXAA 5K1YA 2D1VA 1SFUA 2O6GE 3HTUA 4KIFA 4I7HA 3SXYA 3D0SA 3BPXA 5EEGA 4NQWA 5LRSA 3M1EA 1SD6A 3CUOA 4HLXA 3FXRA 1BI2A 2NAZA 2XROA 4G9YA 1ZARA 1LEAA 5F1RA 4WK8F 4IVNA 3HTSB 2MD5A 4HOBA 2KIFA 2QM3A 1LQ1A 3LQQA 5TRDA 5A2QK 4G7HF 1YG2A 4ZYEA 1FOKA 1XSXA 1HW5A 4BQAA 4LK0F 5DCFA 3K9TA 4FT8A 4RAZA 3F6OA 1GHCA 1QZYA 1PDNC 4A6EA 2M8EA 3F8MA 1QNTA 2PLYA 1SD4A 1MGTA 1RUNA 1FBQA 5JVTA 3FM3A 2JTVA 1QBJA 1FX7A 1AWCA 2ESHA 3U9GA 3KCCA 3RDIA 4LLNA 1E17A 2V79A 3EYIA 4HZFA 1FPQA 1XN7A 4IJAA 4XBFA 2O03A 2C6YA 4OIRF 2RVCA 3COAC 5LGTA 1A04A 2EFOA 4ZZLA 4AD9A 5L3EA 1HW2A 2IW5A 3KLNA 3QU6A 1GVJA 4EJWA 4S05A 3SHFA 4HBLA 3FXUA 3MEXA 1EV7A 4ESFA 3IKVA 2H6BA 1PP7U 1BBYA 2DI3A 1IUYA 2COMA 2M87A 4MQVA 2Z33A 3I0TA 4A5MA 5ED4A 2K4JA 3WG9A 1RIOH 1YIOA 3JAMK 3KEOA 4EJUA 3T5XA 3W6JB 4M9XA 3ISPA 5L3CA 3WGHA 3NEUA 1XB4A 4WXHA 3GX4X 1W7PD 2L4MA 4JK1X 4LLLA 1G3WA 1G3SA 1FT9A 3MWMA 4U7BA 1U78A 4EJTA 4LB5A 2XRNA 5E1XA 2JRTA 2KKOA 3FF5A 1LB2A 1ULYA 2QWWA 2G7HA 2D1HA 5LHHA 1XGSA 4ENMA 1SFXA 1P6RA 4KDPA 3PQKA 5HDNA 2QQAA 1KYWA 3FZVA 3B02A 4UXNA 3CUQC 2P5KA 1U2WA 4HDVA 3HRTA 2L01A 1MJ9A 2ZNZA 4GGGA 1UHWA 2XUBA 4UVBA 4P96A 1BC8C 1XD7A 2MH2A 3GFMA 2BV6A 5FD6A 3JSPA 2ZXJA 4S04A 3ZMTA 2X4HA 5K5RA 4PCQA 5CVRA 2BBYA 2QUFA 2VT2A 1TLHB 2A3SA 4N9IA 5BPDA 2HYGD 2E1NA 1HXDA 5LGNA 3L09A 2AXLA 3P9CA 4BNCA 1R1TA 3U2RA 1HKTA 3T8RA 2DQLA 1B59A 2QENA 1AOYA 1FZPB 1YQAA 4BAYA 2BYVE 1ZG5A 2F5DA 3R60A 5D6EA 4CO8A 5F64A 3FMRA 1S8NA 6PAXA 2EFNA 1U5TA 1T6SA 1S7OA 5LHGA 1C0WA 1PP8F 3C3WA 4EV0A
chains in the Genus database with same CATH superfamily
1D0YA 4B47A 1JKOC 3VYTB 1OCCH 2GXBA 4KICA 4YFNF 3UKGA 3V8LA 2H8RA 1XTAA 1TC3C 4MQ9F 1POGA 4CCMA 2EZLA 2PMZN 5B3SH 1TBXA 3MZYA 4EM0B 2EIJH 4QSHA 4ZZDA 2KMUA 1U0JA 5FO5A 3A01B 2M2EA 2K40A 2LG4A 2IGKA 5E18F 5B1BH 1AKHB 2NVTJ 4KYWA 3BJAA 1Z21A 3ZGKA 5M5YJ 4G7OF 1A36A 2MLKA 5K7HA 2EFQA 3ZOBA 2XAFA 1LEBA 1OFCX 4G7ZF 3ABMH 2IGNA 1B4AA 1SMTA 3K4JA 2P7VB 3DXJF 2BGCA 2NNYA 1K6YA 4IZZA 2DJNA 3HRMA 1HCRA 2HOEA 1LFPA 1ETKA 3RYRA 3OS2A 4I0AA 1ETVA 2PJPA 1R4MB 4EGYA 2CQKA 5LBQA 1Y6IA 1IG7A 5KHDA 3HG9A 2VJJA 4BE1A 1W0TA 4U88A 2NVQJ 2GQQA 2YUSA 1FLIA 1QPIA 4CCJA 5CPRB 3HOUJ 2F48A 5CJ9A 4ZYGA 2RKHA 2G9WA 2WAQA 1ZG3A 1IUFA 5H2FC 2A07F 5TJJA 4BYYA 3CTAA 3OYLA 5C4JJ 2BY0A 5HLGA 3Q0WA 1BR2A 3D5LA 1VQ9I 4HX8A 1UAAA 3S2HJ 2VC0A 4KIBA 5K7FA 1TQMA 3CO7C 2B63J 1IZ1A 2GOXB 2LNBA 5LLQA 2K9MA 2ZXIA 4PSXA 4I99C 3HOWJ 4BY7J 3L2QA 1MKMA 4FETA 3LA2A 2HS5A 2A6EF 4LMYA 3V8KA 1R9TJ 1MMAA 1ZELA 2LLKA 3JRIA 2VBWA 2IA2A 4A69C 2GAUA 3GTPJ 4JP0A 2X6OA 1WJEA 2L54A 5IY5H 1FJLA 1J2XA 2M7AA 3OYKA 2LBFB 1U9NA 1X2NA 4LOCA 2EILH 2RNJA 4LLGF 2M7BA 2WV0A 3K4KA 1WQ2A 3LAJA 1J5YA 2ZJ2A 3DLLF 4RA2A 1ZH5A 5EGOB 1LNWA 2B9SA 2EH3A 5BS6A 1BR1A 2CUEA 4U7DA 4A2UA 2VE9A 2I8DA 3BJOA 3EUKL 2RQPA 1IAWA 3L2WA 3I4MJ 2O8KA 1W5CC 4ABZA 3Q9SA 2XASA 4F7ZA 3H35A 3GWZA 3H5NA 3QPHA 4Q47A 1U6GA 4BHBA 4N0BA 3RKWA 1DU0A 1VQ7I 1G6NA 3DU6A 1V3FA 5GADJ 2LF8A 1DPRA 3HOYJ 3CC4I 3O3KA 2IS4A 2E2HJ 2RDPA 3ZR8X 3VOEA 4ZC3A 2PX9A 2XB0X 2W1OA 3CCJI 4BEHA 3ZCOA 1PYVA 4WF2A 1UJ8A 3DFGA 4RDUA 2M0MA 3GTJJ 3REOA 1XCBA 3Q0UA 1MW7A 5IYBJ 2NRAC 4O3MA 1NHAA 3I71A 4HDUA 2DCEA 1XCVA 3DCFA 3VFZA 4C3HJ 2VBZA 3L9FA 3WODF 2XKOA 1J0RA 3W6KB 3JRGA 4RM2A 1WI9A 4OAYA 3G1OA 3LFUA 2K02A 2P5VA 4CSWA 3JRAA 1WH7A 1EH7A 2VN2A 4N4NB 3MQ0A 4E70A 2GZWA 4MTDA 1FEXA 3I53A 1I1SA 2QCOA 2R7ZJ 1KU2A 1FBSA 2EWNA 3KYCB 3LQRA 3ASOH 4CZCA 1PUFA 2G0EA 3J80K 2UWMA 1N77A 2VE8A 2ME0A 2RAEA 2FBHA 2XF6A 2R7WA 1VQMI 1UMQA 1R23A 2DMTA 2QBYB 2LVSA 2VXZA 2YR2A 2Q1ZB 2WBMA 4HA8A 3VYSB 5J8CA 2PMZA 3HRSA 1RR8C 3IAS2 2KZVA 4AVPA 2RGVA 4RAYA 1IN7A 2IXSA 5DM7F 3K1MA 2XF5A 3PIOF 1UB9A 5F0CA 1WJ5A 2P4WA 3HGYA 3HGGA 4KISA 2DW4A 4F52A 4JQFA 2V9VA 3VEPA 1TWGJ 3PJRA 3MMYB 1QGPA 4OOIA 3JTGA 2V1DA 3M9AA 4CH7A 1D1CA 1P9QC 3LNQA 3AG3H 4S0HB 3OMYA 2HDDA 1LVAA 5TISC 1SD7A 2B0LA 2AS5F 2HI3A 3AG2H 3MAJA 2HDCA 4L0YB 2KIMA 4XONA 3AFHA 4AVZA 3OOUA 2R5ZA 1V5FA 1GXQA 4UB8C 2JVHA 5J4VA 3K2ZA 2CSOA 1VF9A 2M4KA 5D6FA 3WTWC 1VQ8I 5IT9Z 4BEHB 4ENNA 3P5JA 2FQ4A 5JFRA 4DBRA 1JGGA 1RUOA 1Z67A 2WTEA 1LFBA 3OY9A 5E3LA 4A0ZA 3RKXA 4L0ZB 1YW9A 2VQLA 2WWYA 3EQLF 2BW3B 2VBYA 4ESBA 1MBEA 5AIPA 1YO5C 3IUOA 3TDZC 3K70D 1GUUA 3CCUI 4YFKF 1XGMA 1G4DA 2IRFG 3RKYA 4QPQA 3SDBA 2GIZA 3GZNB 1MNMC 3Q5FA 4FX4A 5EG0B 3SDGA 3MCZA 1T95A 4JYKA 3UNGC 3I58A 5J40A 4CICA 2RQQA 2OUMA 1XMKA 2Y69H 1S5LC 2L9SA 3T0YA 1ZREA 2HKXA 1DDNA 1OISA 2VODA 4JBAA 2CV0A 3I54A 3S14J 2V4JC 1X1CA 3S1RJ 4XSZF 3LSGA 2E2IJ 5J8FA 1KU7A 1CQTA 1BOAA 1TT0A 3BWGA 3FX3A 3CCQI 3RZOJ 4GXOA 5JHFA 1CF7A 4YIIA 3IH3A 2KFDA 1XPXA 2MC3A 2DT7B 1DP7P 1B72A 1U8RA 1X19A 4A3KJ 5J6XA 2E1CA 2K9NA 4BBSJ 5E3OA 1LDDA 2WY7Q 2OZ6A 1STZA 2QQ9A 1FSEA 3LWFA 1USSA 5FKOA 4BXUA 1QU3A 4HX7A 2ZXHA 4CHUA 1BN5A 4RLQA 4RB3C 2AQEA 3MKYB 3TL4X 4P5OA 3F21A 1P7JA 3S2DJ 1OCZH 1E3HA 4XLAA 4ZYDA 3OV8A 4E7ZA 1QHGA 2QKMB 4FE4A 2M30A 4NDLA 1T08B 1D0ZA 2IBDA 5BNGA 3U21A 2M9HA 4HX4A 3FHZA 3CLOA 2FOKA 3WTTC 4KFCA 2PEXA 2E7WA 1ETXA 5KVRA 2EB7A 4IPAA 4AYBA 3ZQHA 3MKWB 1Z9CA 2NS8A 4PJ0C 5FGMA 1R58A 1BM9A 2OAZA 3O6BB 5FFZA 2K7LA 4OMZA 5IYCJ 3F8CA 3FIWA 5F04A 5BQTA 2RN7A 1MZBA 4NBQA 2PFBA 3EETA 5H20A 1ZHFA 2E36A 3IWFA 4B3XA 4YIFA 1SVLA 5ERIA 4BXXJ 3PFIA 1QPMA 4P9FA 5IP7J 5K7ZA 3GTGJ 3E5UA 4MTEA 3BR2A 4EATA 1FYKA 2CGPA 2RV8A 5CVUA 5E79C 1FTTA 4DOZA 5D8KB 1FYMA 2KHMA 3F6VA 3L2UA 2ZJQF 3B6CA 4UUVA 1GVDA 4M6VA 1F4KA 2H6CA 1JT6A 4C2MJ 1KQ0A 2OQGA 1ERDA 5DDGA 3ZMUA 1ONVA 4ENKA 3HSFA 3F0CA 3I9V2 3CUQB 1ZQ3P 5DCMB 3K0LA 1KA8A 2LRDA 2B7EA 2VC1A 1M1EB 1Y8RB 4IF4A 5D4SA 3JSOA 1I6HJ 3L7WA 4KT6A 4X0GA 1G2HA 2L7FP 4G8XA 2DU9A 1ETWA 1X2MA 2DTRA 2HQAA 4E7JA 2HPMA 1XDUA 2KJBA 1WVRA 2PMUA 4DJAA 2XPWA 3F3XA 3C1DA 5KK1A 3NQOA 3K1PA 2LC2A 1MMDA 5D4RA 3F23A 4D5CA 2HOSA 2L9RA 1FMVA 2ZXWH 3BG6A 4ZYAA 2FQ3A 4IRHA 3S3NA 4QWQA 2PBIA 3HOSA 2Z5UA 1ZTRA 1HBXG 3WTUC 1BI0A 2W48A 5JVGF 2K85A 2K86A 4Y15A 3HIFA 1Z7LA 1BW5A 2A5YB 3TEDA 2ELHA 2HTSA 5F0FA 3H5RA 4EM1A 2QGUA 4IRIA 4KT5C 4EMSA 3N05A 4E7IA 3ESWB 3SZPA 2ZKZA 4D5FA 4XSXF 1MNDA 1EF4A 5GAGJ 4AM3A 4MLOA 2NOJB 3E97A 3HSEA 2LY1A 4LG0A 5FKMA 2X1DA 4M3FA 3WU0A 1I27A 2L3DA 4BBRJ 4U0WA 3TBIA 2M8GX 4EM2A 2DA2A 3GLLA 1W5SA 2LKXA 2QQ8A 3E3VA 2JA2A 2ELKA 1JTXA 3K4MA 5LHIA 5C4XJ 4Q4ZF 1KZHA 3Q9VA 4BHPA 3WG7H 2A5WA 3ML6A 3SJMA 4DYCA 2NNNA 1VFCA 5H6RA 4M71A 3TO7A 3CO6C 4HEA2 2XHKA 4HF1A 1X4OA 3G3ZA 4XMYA 3OYMA 1LUJB 2BY3A 2DFFA 4I76A 4BDYA 2Y30A 1QRYA 4M9SA 5E17F 3SFIA 3VSKA 2CO5A 4DYRA 2DA3A 3EUAA 1OPCA 5FLXZ 1YLFA 2OCEA 3BG3A 3FXMA 3H9JA 4AIDA 5F1JA 1S3JA 2P81A 3DPLC 4XORA 1JJ8C 4GRIA 1FSHA 1JKQC 5IPAA 1W36C 2D2WA 4AU7A 3HKZA 5ICFA 2Y48A 3E5XA 2PG4A 3MN2A 2XGEA 3ZQQA 4UUTA 4Q5SF 3KYDB 4E4HA 3ULQB 3QPTA 4EJOA 2HQNA 3P9IA 2UUZA 4U0YA 5E3MA 2E60A 3HJEA 3JCUC 5F0HA 4KA4A 2MBFA 4TV7A 5J1UA 3RJPA 5LGUA 1DUXC 5FRMA 4II2A 3DBRB 1K78A 3K4NA 3QOEA 2XC7A 1VQ6I 1T0FA 2V7FA 3A01A 1AKHA 3DTEA 3CLQA 4XRSG 1BL0A 2Y31A 1OR7C 4M6XA 3GXOA 5EZGA 1JXSA 4MFEA 2ID6A 3HHGA 3OSFA 1XMXA 1R71A 4Y17A 2DYRH 2EK5A 2UXNA 4A93J 4A0YA 2BVMA 4XLHA 2R3SA 1Z3YA 1KGSA 4LIVA 4CZZA 1ZLKA 3CP2A 1ZR4A 1CGPA 4ESJA 3C2GA 2DODA 5HNFA 3QPSA 3BTCA 1HKSA 1K4SA 3K4LA 3L2CA 3AAFA 3KP3A 1XSDA 1YJWI 4A5NA 2W24A 2F5CA 2J5PA 4B8XA 1MBKA 1LKXA 1RZ4A 1RKTA 3KP4A 4G6QA 3H36A 2L02A 1VI0A 1G3TA 1G3YA 4XLPF 3KX2A 3TKYA 1D0XA 3VYUB 4C9YA 1I50J 2JSPA 3RPQA 2NYXA 3ZQLA 1A31A 3NAUA 2GOMA 3CDLA 1XGOA 1SVOA 2DO7A 4DGWB 4NHJA 2JMWA 1FYLA 3I59A 4L5JA 3SYTA 1EJ9A 2WADA 3BDDA 4X6AJ 3I4NJ 4XLEA 3JRCA 4E7HA 3I64A 1L0OC 4RLFA 2MD0A 2DTZA 4IOAF 3KZIC 2CV1A 4QTRA 4ZTJA 3JRFA 2ESNA 4IOCF 2E1OA 2XAHA 3TP0A 5GPCA 3HBLA 3ERED 1IC8A 5CQGA 3RKQA 3QAHA 5HS9A 2Q8KA 5EEAA 3IV5A 2VKVA 2OTJI 2FU4A 1IN5A 3QQAA 3BG9A 3H0DA 1V4RA 2ICWG 4G12A 2IPQX 1BJZA 4KMUX 3CUQA 3FKIJ 2ELJA 1J9IA 3EUHC 1S72I 2DK8A 3BJ6A 1TNSA 5GP9A 3HEFA 1I6XA 4IXAA 2FOWA 2XB5A 1ON1A 2BVLA 4F92B 2W84A 4AIJA 2K9LA 2E1MB 3V4GA 1Y39A 4G6DA 1JT0A 4HYEA 5J4YA 4HNUA 3S3MA 3AL0B 4F3QA 4B09A 1PVEA 2CUZA 1WGXA 3P7NA 3K10A 1I5ZA 3LMMA 5CQEA 4M72A 2VL8A 2WC2A 3DV8A 4L9NA 1O7FA 4UVAA 5E3NA 3IH2A 3ABKH 3GTLJ 2JPBA 1R22A 1QZZA 3HUGB 3IL2A 1H8AC 1X4PA 4MEYF 3E6BA 5CLSA 3LSRA 4GYGA 4XR6A 2HKOA 1LFUP 3AG4H 4WXCA 2O5RA 1T98A 3ZN1A 5D5UB 3UR3C 3RPUD 2LH9A 9ANTA 1N25A 2KLOA 4Q48A 3R4KA 2I10A 2CMPA 2UZKA 2R5YA 2W25A 1DP3A 2Q2EA 2VBXA 3I59B 4YG2F 4K2EA 1O4XA 2FSWA 3ZRGA 1FP1D 3OS1A 3WTVC 3HSRA 3TW7A 5HNHA 1JKRC 1U5TB 4B1RA 1KQ8A 2XAGA 2L2OA 3QP6A 4E7SA 1LE8A 3GW2A 1ZG1A 1YS7A 2RC4A 4ZTFA 4E7LA 3LA3A 4CYCA 2R93J 4XOTA 1XGNA 2KDZA 2V6CA 3TP3A 2VKEA 4J19A 2DMPA 3PFYA 5KCMA 1Z0XA 3K6GA 3KEQA 2VKHA 1ZRDA 2QBYA 3PNVA 4BQQA 2E1MC 2KRFA 1ORKA 2CQQA 2MW8A 2ZC2A 4M74A 1K6OA 1JTYA 3CD6I 2MA3A 3BTLA 3E1SA 3EUHA 2WA0A 4BACA 1K4TA 2H8WA 2ISYA 1ZGJA 2PN6A 1DGWY 3KZZA 1I3AA 1OQYA 3K69A 3VB2A 4A3MJ 3OYNA 2WB1A 4V2GA 3CCLI 3GTMJ 5F27A 4D0PA 2PI0A 5FRNA 4RMNA 1FNNA 2MLGA 3WTSC 2BY2A 2A68F 3JW4A 2XGXA 4RB2C 4M73A 1FBUA 3WU1B 2R5YB 4A3EJ 2VOOA 2DFEA 3LSKA 3HOTA 3G1LA 1FIPA 5HLHA 2H27A 3W6VA 5DYMA 3GO5A 3HUGA 3FKJA 5JLXA 2LY2A 2R7RA 2DPUA 1ETOA 2Y9ZA 5E1ZB 1X1AA 1D1AA 2DK5A 3CJNA 4XN3A 2HNHA 3V7CA 2LBFA 3JRBA 3DTIA 1H88C 4U87A 3TW6A 4A3GJ 3FMSA 5DUIA 1RRJA 2OCCH 1TNTA 2O61A 1JE8A 5D8LB 1IGNA 2R0QC 3WHCA 3ECOA 4DZPA 2QVOA 4YEJA 3FXLA 4ZYHA 3ONQA 2IAIA 4FISA 5E8GA 1BW6A 2F5FA 3MKLA 2VI6A 2XKPA 4RGUA 3WTXC 5FLVA 3CCMI 2QQBA 3OYBA 3DWLE 1P4XA 1HA8A 1KQ9A 3VPRA 3WGIA 4PJMA 1F1ZA 4KIGA 3W2WA 4M3BA 1WSUA 4NQWB 1AA7A 2EFPA 5J1YA 1CF7B 1DGRM 1KU9A 2L5QA 1U8BA 2ZFUA 1U3EM 2PJRB 2DBBA 3RI4A 3ABTA 3MKZA 2Y0MA 2DDBA 5GAEJ 3CJQB 4X1EA 1B9NA 2WV1A 4RB1A 2BEOA 2ACJA 4IHSA 3PO2J 4BGDA 2OU2A 2R92J 2CRGA 2E71A 2W4SA 1R1UA 3G71I 2R7OA 3CJRB 1QHHD 2WAFA 4GYIA 1P2FA 5C44J 1HLVA 3BCBA 4YRVA 2A05A 1VQLI 2VB6A 5ICEA 5K5QA 3QP5A 2NVXJ 1Z77A 3BQZA 1BJAA 1FTZA 2H94A 1WKMA 3GYHX 3WU2C 4N4OB 1JI8A 3Q3SA 5FROA 1GXPA 1VQNI 4BJTA 4YFXF 1F9NA 1HKQA 1TP4A 2J5OA 2X1EA 1R36A 3BP8A 3LSJA 2IS1A 5GPAA 4MNUA 1Y0UA 4O6JA 3LSMA 4H4KC 4BY1J 4EGZA 1R6RA 1IV6A 1BC7C 4A0XA 3TDUC 5ILUA 2HVSA 4B44A 3VDXA 4ENJA 2FF4A 3F22A 1GLNA 1WJAA 2OPTA 1SAUA 4FHTA 2HGCA 3CQZJ 1IXCA 4Y7NJ 4HNTA 2DA1A 4PJJA 3MVPA 4XRFA 2CWEA 4I02A 3A03A 2XAJA 4C3JJ 2X51A 2BE5F 1MD0A 3QU3A 3FM5A 1JJ6C 4IHTA 2ZBKA 2FNAA 3NARA 1I1GA 2VUMJ 2Z16A 1T0FC 3S1QJ 4KUMA 2IT0A 4H0EA 3OL3A 4ETSA 1V5EA 2EJRA 2HTJA 2E19A 2M45A 1OCTC 3K4BA 1LDKB 2Q0OA 1IDYA 2HOAA 5FKKA 4HQEA 1JUMA 2R7UA 3J7AY 3CDIA 1OMIA 5HODA 2CQ7A 2JN6A 2IA0A 4LGWA 2EQRA 3GEZA 2IS2A 2EV6A 5CVIA 3RPUA 2BW3A 1Y1VJ 2LREA 1YHQI 2Y0SN 2R7FA 1MJBA 1JHFA 3EYYA 4WX9A 4UUSB 2EA2A 2F4OB 5LEJA 3KP5A 2O9LA 3SZGA 3BR3A 3GF2A 2CU7A 1RC9A 2QLZA 2NOGA 2EV5A 5M5XJ 5L3GA 2E34A 1Y0NA 5CKTA 2IA1A 2ZFWA 2MFZA 4MEXF 3QYBA 1WJDA 3OR1C 1R49A 1HW1A 1TWAJ 1YTYA 3PQJA 3VSLA 2M5WA 4ZDPA 2M1BA 3A2KA 3C7JA 1XS9A 2IJLA 2KPMA 5LRRA 5FLMJ 2HYFA 4IKFA 3V7SA 2MH9A 1EH8A 3ABUA 1IF1A 3TGNA 2V9PA 4UUSA 1SD5A 4A12A 5DCMA 4OIPF 3CC2I 3M1CA 5M3FJ 3F8BA 1UFMA 3HZJA 3RIRA 4UHTA 4XKCA 2XVCA 2FRHA 2HQRA 3NWTA 3IRQA 4HSRA 3H9GA 5K5OA 3ZPLA 3QYEA 4AIKA 4F55A 1G8XA 1R4NB 2F5EA 2HFHA 4EEFG 4P9UA 4J00A 4HF2A 4KNYA 1N78A 3BTJA 2JRMA 3GCMA 3GUDA 1IRZA 2E5ZA 3FWEA 2L7MP 3KP7A 3I4PA 4BU2A 1H0MA 4L9VA 1P92A 4A6DA 4IO9F 3H3VK 3TO6A 3IC7A 2DT5A 1IJWC 1S29A 3P9KA 3PIPF 1YW8A 5FJ8J 2ETHA 2XV4S 2XAQA 3BG7A 2CQNA 2IEKA 2JA5J 2FBKA 4D7MA 2JA6J 1NTCA 5HVQC 1YW7A 1TW2A 2M4GA 2W7NA 1ON2A 4XKVA 1SMYF 2DN0A 3L00A 3WHBA 2DYSH 1Z05A 3J81K 2QKLB 1OYYA 2M34A 4XLCA 3GZ6A 2VOPA 3KP2A 1YYVA 1X1DA 5FFXA 2O8XA 5F6FA 2GXAA 2VQCA 5E1WA 2JWTA 1RESA 1IN6A 5LEKA 2EPFA 4I01A 1NK2P 3S15J 3QOPA 2FEZA 1PUFB 3GBGA 2ZMEC 4LFUA 3ROUA 1BIBA 3N97A 4M3GA 1IXSB 1EKEA 4L5IA 3OYHA 3QRFF 5DUKA 2GA2A 1HSJA 3G73A 3BY6A 3FISA 2GWRA 3FMQA 4KITB 4ON0A 3B73A 5DTDA 3BLYA 2JT1A 1O7LA 4PK4A 5L3DA 2MC4A 2LTPA 5AONA 2DA7A 1IDZA 3M8EA 2XF7A 2OV7A 2ZCWA 1X3UA 2BOLA 1MSEC 2OTLI 1IRFA 4XICA 1T39A 3F72A 4I0BA 1TQPA 3BOQA 4NC6A 1W7PA 2V26A 4PGGA 2KDOA 2XPVA 3C2HA 4XK4A 4XOPA 4KMFA 1TQIA 4HF0A 3TQNA 4HW0A 4L5EA 5DD4A 4OINF 2Y9YA 1XDSA 2VIXA 2CJJA 2HXOA 1R1VA 2ID3A 1B8IB 3ZXSA 3BC8A 3HPGA 1BIAA 2FNPA 3SEQA 4HQMA 3J7AO 2JK3A 1REPC 4L18B 1HF0A 4FTHA 2OC6A 1DPUA 1H9GA 2QSGX 1Z7UA 3ZMVA 3FXJA 3CCEI 3V8JA 2O0YA 3HKZN 3S17J 3JR9A 2DLLA 3WGGA 2R7XA 4M3EA 1KONA 4I09A 3GFIA 2OD5A 3FXKA 3NRVA 2HZTA 2FJ1A 2EFWA 5D5XB 3CMYA 2NVUB 3PNTA 1UCRA 4NB5A 5FB2A 4WWCA 2R7TA 4BQOA 1FMWA 1ZGWA 5EYRA 4QIWN 1X1PA 2H09A 1VQOI 2VXDA 1D5YA 3DP7A 1VZ0A 3TOBA 2ECBA 4QLCU 2OA4A 1MMGA 3ELKA 4AWXB 2KISA 5J47A 2LD5A 1ZGAA 2XDVA 3O8HA 3BPVA 2OZUA 4LITA 1FP2A 4LK1F 1OKRA 3FBNB 4IHVA 3E7LA 1HC8A 3MZHA 3VYRB 4MHGA 3S16J 1VQPI 5KNLA 3RZDJ 2Z1DA 2ZMEB 1K83J 5CVVA 4WCGA 1MH3A 3S93A 3IWZA 4CXFA 2X1CA 3H1CA 2JZYA 1MJAA 5D5VB 3GTOJ 3OIOA 5HDGA 3IP4B 4CCLA 2H1KA 1D8JA 2L9NA 4HPQA 4HV5A 4MO7A 3BZ6A 4I98B 1K79A 4J01A 3SQNA 4EVIA 4EQQA 2YU3A 3V42A 3ZQ7A 4II3A 4EJVA 4B48A 3H92A 3KE2A 2VT3A 3RYPA 1EH6A 2Y0SA 3OYGA 4L9JA 3AKZA 2OBPA 2YPRA 2LP0A 1R00A 1MDMA 2FMLA 3FXQA 5ILSA 3A4CA 1SFKA 4M9ZA 5EDNA 1ZRFA 3K4CA 4XKBA 1J09A 1QQIA 3K7AJ 5BOXA 3WTYC 2YX4A 1OYWA 4DQ2A 2F6CA 1OR7A 3VWBA 1F36A 4AYBN 3TMOA 4XQFA 1WRJA 1TWCJ 3PSFA 4ASNA 3G4SI 1R5GA 2GA1A 3OYIA 2DFHA 1RI7A 4XN0A 1S6LA 1D8KA 5HDKA 2W57A 1K78B 1R5HA 1BA5A 2QEXI 2AO9A 2Z9OA 1WJBA 3ZMZA 4BDZA 5A2QZ 1X3WB 4MIMA 4MFDA 1D5VA 3CCVI 1QA6A 3HHHA 3DPUA 4HAMA 2AHQA 4RS8A 5M3MJ 2LSOA 2P7CB 4IEJA 1ZKGA 4GCVA 5GTIC 2LYCA 1U5TC 3DEEA 4KN4X 5JI6A 1YS6A 4XIDA 3BROA 4HRIA 2FA5A 1BI3A 1YJ9I 4Y52J 4ZH4F 2F2EA 4R8HA 1B6AA 1MIJA 4KN7X 1VTNC 3J80Z 2XPUA 4RM3A 1RETA 3OL4A 1UG0A 2YSRA 3PUFA 4XM3A 5IP6A 5EEHA 2Z2SB 2K3FA 4UNOA 4PFPA 3G1MA 1VNDA 3BCAA 2ZJPF 1GDTA 2ZB9A 5IYDJ 1NH3A 2EIKH 3F8FA 5JHUA 3A0BC 4BJ5C 5EG0A 1Y56A 1OJLA 1T38A 1J59A 1E2XA 2XRLA 3M8FA 1USTA 2NS7A 2F4MB 1O3SA 3DQVC 5CVJA 4CYCB 4XKWA 2IS6A 1WWXA 2FD5A 2HXIA 1QO0D 2VQGA 4HG2A 4LG3A 2W82A 1ODDA 4N9HA 1ZR2A 3QODA 3ZQIA 2JSCA 3H3ZA 3H0GJ 1J7KA 3PO3J 3E6CC 2QZ8A 4A3LJ 5HS7A 2H1LA 2TDXA 5HOOA 2X6WA 1MMSA 3PL8A 4GO1A 3W2VA 5IT9K 2P6SA 3N4MA 2V1NA 2BXYA 2CFOA 1IN8A 2LF7A 4IL6C 4OIQF 5IOYA 5BPIA 1L3LA 3F8NA 4DIQA 2V1UA 4MGRA 4R1HA 3CMEI 3EDPA 3CC7I 2MYSA 2ZO4A 2AQFA 2CUFA 2JUCA 4ZDOA 1W5TA 3DPTA 2M3AA 4LB6B 3MFKA 3JREA 3LSHA 4BE0A 3ZQGA 2HDWA 2P6TA 2DAOA 3DEUA 3R0JA 3H3UA 2KIQA 2EINH 2KL4A 5FD5A 3V7RA 1PJRA 1IRGA 3PM1A 4I2OA 1KYZA 5L3BA 3HDDA 2E2JJ 3T8TA 1W7PB 2P8TA 4W97A 2YX7A 3OIQA 2STTA 2R7SA 3VODA 4PGHA 2E5NA 4AIHA 3JAMZ 4FASD 3CESA 1ZRCA 2Z99A 1E3PA 3L2VA 1ITYA 2LDUA 3CDHA 1SEUA 1ACIA 1K7AA 2XSJC 4YIRX 2JQ7A 2RNGA 4XRSA 4Y13A 3DKWA 3PSIA 4RAGA 2HWVA 1X1BA 3PNYA 5FKNA 1P4AA 1T8IA 3JTHA 2DDAA 1JGSA 3AG1H 1P7IA 2DOEA 3A0HC 4M3DA 1P4WA 5HS8A 1TWHJ 1Z3XA 2CFXA 3I5UA 2LK2A 4JOMA 2ZSHB 3HB9A 3M07A 3CCYA 2QF7A 3PUBA 1SAXA 3QWLA 2X0LA 2CV2A 1RR7A 2VJIA 4JX6A 2VPLA 1HDDC 2FMYA 3M7GA 2VQHA 1XMAA 2PJRA 2JA8J 3OYCA 4OIOF 5TGTA 4FX0A 4RBOA 5IT3A 2V1XA 1S9HA 1UZCA 4LD5A 4BHCA 3ZQCA 3HRUA 4Y33A 1GT0C 3KEYA 5EGOA 3KZYA 4L9TA 3MD2A 1WJFA 4ITVA 2ZMEA 1T2KA 2E7XA 2O3FA 2R7QA 2VONA 5KAIC 2X6XA 4HLYA 3D5RC 1JHHA 2Z3YA 1MBJA 1MDMB 3FXOA 2HPIA 4HV6A 4IHXA 3JRHA 3IRRA 2NXNB 5LD2C 2D45A 1V54H 1RNLA 2BHYA 3KP6A 2ZJRF 2IP2A 2V6EA 3OIPA 4DYQA 2HVQA 3FBIB 2I5UA 3QPLA 1Z6TA 1W4MA 3IKTA 3ZP5A 5M5WJ 4F91B 3IHUA 1HQCA 2O7OA 3MZ8A 4P55A 5D5WB 5BMZA 3LSTA 2K5CA 4IRGA 4DBQA 2STWA 2R7VA 3O2PE 2GM4A 1RKWA 4RGSA 1WHUA 2LKPA 3BR0A 4UV9A 3CZ6A 5JR3A 1LVKA 4QPOA 2KRCA 1IRXA 2XGDA 2VKDA 1VQ5I 5HLTA 3HYIA 1FC3A 4O5VA 5E20A 3SZTA 1H9TA 1UG2A 2WY8Q 1O57A 4CGZA 4DZJA 2CS3A 2IVMA 3WTZA 5CYVA 1NG6A 3TOAA 1Y8QB 1ZLJA 4NUBA 4XL9A 2TCTA 4DNCA 1B8IA 1X3ZB 2FE3A 1R7JA 3TO9A 1I3QJ 3C18A 2EV0A 2HYJA 2G7UA 2VLAA 1F43A 1YX3A 3GVAA 1Y1WJ 1O3TA 3S1NJ 1WFXA 3L2RA 5HLIA 1S7AA 2TRTA 2UXXA 3R61A 1O3QA 3Q0VA 1B1BA 2HVRA 1LJ9A 2BXZA 3HC7A 5AIQA 2NS0A 2HEOA 3E0JB 3K1NA 3DKYA 3A1YA 1DU6A 3GFJA 1TW3A 4GDFA 3ZMSA 2V9KA 3NWSA 1YJNI 2PMHA 1SFEA 5DV5A 1PUEE 3LA7A 4A3IJ 4RGRA 3J81Z 1LE8B 3CCRI 1XSVA 3KETA 1GV2A 1D3YA 3GZ5A 3DLAA 5DEQA 3S2WA 3F9KA 5ICCA 2P5LC 3RSNA 2CW0F 2N8GA 2PQ8A 5ILVA 2OQRA 5EF6A 2YS9A 1YFHA 1N75A 4RB0A 3ZN0A 4PZJA 2ZNYA 4IHYA 3ECHA 3KIOA 2A61A 1UELB 1MBGA 1OYIA 2CW8A 2P0WA 3DEWA 3OYDA 2HR3A 1A35A 3BR1A 2KRHA 4BH9A 2BHZA 4PDKA 4ANJA 2DMQA 1KU3A 2GIVA 5B5EC 4JX5A 4CYDA 3CCSI 2HOTA 4Y3OA 2JVGA 4G94A 1Z1DA 3DBLB 4LJZF 1IW7F 1F5TA 5DD8A 1HSTA 4V2FA 2IGMA 1W36D 1B9MA 2L4AA 3T1BA 1FOWA 3BQYA 2XIGA 2L9VA 5EJCA 3LAPA 3RQ4A 3S8PA 5H6QA 4R79A 2W00A 1IN4A 2W85A 2ADUA 3GFLA 3R0AA 2Y75A 2VPRA 2LMDA 3ZQFA 2CH0A 4YELA 5FLXK 2DQRA 2R7DA 1LPQA 3OS0A 4NC7A 1QVUA 2EA4A 2GXGA 2KJCA 3R6SA 2X6YA 4ZDLA 3G6EI 1ZAOA 3ZMDA 2R5ZB 4U0VA 2JA7J 3ERMA 2RREA 1FWZA 3WE2A 1QZEA 2JPCA 1ZYRF 3BZKA 2OJED 2WB1N 3S32A 3DTKA 1UHMA 4M6YA 1MNEA 3DF8A 1Q1HA 3EPZA 4UVCA 3W2AA 4JX4A 2DPDA 3CJTB 4AUXA 3E6DA 3OOPA 4WXDA 1X58A 3SFZA 1Z91A 4Z2YA 5F08A 4LG0B 2DFIA 2ISZA 2K4BA 2K27A 2EIMH 4OU0A 2LFBA 3KFWX 4XLFA 4B43A 1ZN2A 2DMUA 1LDJA 1WCMJ 2A6HF 3GLXA 2KQRA 4UV8A 1SANA 5ICGA 4OMYA 2CUJA 4NC8A 3E6MA 3E5QA 1YI2I 2MG4A 2VJ4A 1NG7A 1E0EA 1XG1A 1VQKI 3O8GA 2XGCA 2FBIA 1Z6RA 2XSDC 5LFAA 2YU9J 3D5SC 4XLNF 3LL7A 3I56I 3U1DA 3WE3A 1BI1A 2A69F 5B66C 3D1NI 2L0KA 4BXFA 1W0UA 1O3RA 4AC0A 2L7ZA 2KIUA 1AU7A 1WPKA 2CYYA 4RGXA 2LY9A 4PFOA 4CDGA 3RTRA 1B72B 2FX0A 2DJIA 5L3FA 2E35A 1J75A 3AL0C 3KLOA 1DQUA 2K9SA 3HL2A 1FY7A 1MSFC 5E8IA 1OLTA 2LR8A 2JUGA 1IXRC 4PSWA 1TTYA 1WJCA 2QYOA 4C3IJ 5GTHC 2CG4A 2FXAA 1A5JA 5K1YA 2D1VA 3DBHB 4PJNA 1SFUA 5DM6F 2O6GE 3HTUA 3KPHA 4KIFA 4I7HA 2X48A 3SXYA 3D0SA 3BPXA 4P1WA 1BR4A 1MBHA 5EEGA 4NQWA 5LRSA 4F93B 1G59A 1FOYA 1MMNA 1T56A 2EZHA 1SD6A 3CMMA 3M1EA 3CUOA 3OYEA 2D5VA 2QSHX 3H9QA 4HLXA 3FXRA 1BI2A 2NAZA 1Q1VA 4C2UA 2XROA 1YIJI 4G9YA 2EZIA 3CMAI 2WAEA 2EBIA 1ZARA 4FE7A 1LEAA 5F1RA 1V55H 4WK8F 2DA4A 4IVNA 3HTSB 1SVMA 4CA0A 4FCYA 3M3YJ 2MD5A 4HOBA 1WZ2A 2KIFA 2QM3A 1LQ1A 4XRMA 1WI3A 3HPHA 3LQQA 5TRDA 4HNVA 1TZLA 5A2QK 2CQXA 4PJLA 4XNFA 2BY1A 5B1AH 4G7HF 1YG2A 1YOVB 4BE2A 4ZYEA 1FOKA 5GAHJ 1TL8A 1XSXA 4D7NA 2LKSA 2VASA 3I55I 4B3AA 1HW5A 4BKXA 4BQAA 4LK0F 5IP9J 5J1RA 4C30A 5EZHA 1IO2A 5IOZA 5DCFA 5JLWA 1FIAA 3K9TA 4FT8A 4RAZA 3F6OA 2DA5A 3FHNA 1YX5A 1GHCA 1QZYA 1PDNC 4A6EA 2M8EA 3F8MA 4BJ6C 1QNTA 1V5GA 1H89C 2PLYA 1SD4A 1MGTA 2GBYA 1RUNA 1FBQA 5JVTA 4C2TA 4NNJA 3FM3A 4CCKA 1W1WE 2JTVA 1JKPC 1QBJA 5J3LA 1FX7A 1AWCA 2ESHA 2ME6A 1I39A 3U9GA 3KCCA 2MABA 3RDIA 3J7ZI 4LLNA 1E17A 2V79A 3EYIA 4HZFA 1FPQA 1A6IA 1XN7A 1JUSA 4BL0B 4IJAA 3HOZJ 4XBFA 2O03A 3JRDA 4OIRF 1ETQA 2C6YA 2RVCA 3COAC 2DOFA 5LGTA 3K70C 3GTKJ 1IV8A 1A04A 2EFOA 4ZZLA 4AD9A 5L3EA 1HW2A 2IW5A 3KLNA 3QU6A 2IGOA 4LIUA 3GTQJ 2DA6A 1GVJA 4EJWA 4GFBA 2DT6A 4S05A 3HM5A 1EA3A 2VJ5A 4HBLA 3SHFA 2CW7A 3DKXA 3FXUA 1HOMA 3MEXA 1EV7A 1YITI 1YE9A 1D1BA 3OYFA 1APLC 5FKLA 4RAFA 4ESFA 4A3JJ 3IKVA 2H6BA 2BZTA 2KP6A 1PP7U 1BBYA 2DXIA 3RQIA 1XC5A 2DI3A 2X85A 4G6TB 3HOVJ 1OCPA 4BUPA 1IUYA 2COMA 2M87A 4MQVA 2Z33A 3I0TA 4A5MA 3J7YJ 1GV5A 5ED4A 4IQ4A 2K4JA 3WG9A 3LSPA 1ETYA 4OAZA 1RIOH 1U9OA 1YIOA 2K3PA 2FUG2 1R5ID 3JAMK 3KEOA 1FOXA 3FK7A 4EJUA 3M8JA 1TT5B 3OR2C 3T5XA 3W6JB 4DW6A 4M9XA 3X2QH 3FDYA 2QSFX 3ISPA 5L3CA 4E7KA 3B6AA 1QVTA 3BZCA 3IH4A 3WGHA 2K9QA 3NEUA 1XB4A 4WXHA 3GX4X 4V19K 1W7PD 4IX7A 2L4MA 5KAFC 4JK1X 3LSIA 4LLLA 1VQ4I 1RPWA 3ABLH 3M4OJ 1G3WA 3FK6A 1G3SA 2HU9A 1FT9A 2MSYA 1ZK8A 1S7EA 3MWMA 2X9DA 4U7BA 1U78A 2OF7A 4EJTA 3GMEA 5C3EJ 3U1KA 4LB5A 3L1PA 2XRNA 5E1XA 2JRTA 2KKOA 1E3OC 3FF5A 4A3BJ 1LB2A 1HDPA 2Y2ZA 1ULYA 2JJ7A 2Q2EB 2GLOA 2QWWA 2G7HA 4Z6YA 2D1HA 5LHHA 3G2BA 1XGSA 4ENMA 1SFXA 4E6KG 1P6RA 2ECCA 4KDPA 3PQKA 4CCNA 4I6ZA 4D9JA 5HDNA 3BG5A 3RCOA 1MBFA 2QQAA 1JUPA 2R4GA 1KYWA 2QA4I 4HSTA 3W3CA 3SEZA 3CF5F 2WAQN 3FZVA 3B02A 4UXNA 3CUQC 2P5KA 2ZSIB 2F4IA 1U2WA 3BT9A 4HDVA 3HRTA 3BR6A 4OWRB 4BQNA 1OCOH 2UV1A 2L01A 3CP8A 3QYFA 2L7KA 2DOAA 1MJ9A 3KYLA 2ZNZA 4GGGA 4CUGA 2KZGA 3IAM2 1UHWA 2XUBA 3LOCA 4UVBA 4P96A 2HQ5A 2MGQA 1BC8C 1XD7A 4B4CA 3GFMA 1A6QA 2MH2A 2BV6A 2NVYJ 4W1UA 1YRNA 5FD6A 3JSPA 2ZXJA 4S04A 1T33A 3ZMTA 4IQJA 2AXTC 4A3FJ 2X4HA 3C2BA 5K5RA 1ENHA 4PCQA 5CVRA 2BBYA 2QUFA 3ASNH 4Y4RA 2HZDA 3OYJA 3S3OA 4CCOA 2DMNA 1TLHB 2A3SA 2VT2A 4FQGA 4D1QA 4N9IA 5BPDA 2HYGD 2E1NA 3OWTA 3OSGA 1AHDP 1SC7A 1NK3P 3S1MJ 1BOBA 1HXDA 2A6TA 1WH5A 3CF2A 5LGNA 4A3CJ 3L09A 2AXLA 3P9CA 4BNCA 1SFOJ 1R1TA 4BS9A 2COBA 3A02A 3U2RA 1HKTA 3HOXJ 1K61A 3T8RA 1YRNB 3DU5A 2DQLA 1B59A 2QENA 1AOYA 4ZJZA 1FZPB 3I3LA 1YQAA 3K2AA 4PUSA 4BAYA 2XAUA 2BYVE 4UB6C 1TWFJ 4IHWA 1ZG5A 3BTIA 2F5DA 3R60A 1XX5A 2EZKA 2KT0A 5D6EA 1OCRH 4CO8A 2F5VA 3H5AA 5F64A 2LOOA 3FMRA 1S8NA 4A3DJ 6PAXA 2M0CA 4UY8I 2EFNA 1MH4A 1U5TA 3HXLA 5DS9A 1T6SA 1S7OA 5LHGA 1C0WA 1UHSA 4KJZA 3OYAA 3BR5A 4EV0A 1PP8F 3C3WA 3LFKA
chains in the Genus database with same CATH topology
2GXBA 4KICA 4YFNF 3V8LA 4MQ9F 1TBXA 3MZYA 4EM0B 4ZZDA 5FO5A 5E18F 4KYWA 3BJAA 4G7OF 2MLKA 2EFQA 1LEBA 2XAFA 4G7ZF 1B4AA 1SMTA 2P7VB 3DXJF 2BGCA 2NNYA 3HRMA 2HOEA 3RYRA 4I0AA 2PJPA 4EGYA 2CQKA 5LBQA 4U88A 2GQQA 1FLIA 5CJ9A 4ZYGA 2RKHA 2G9WA 1ZG3A 2A07F 5TJJA 4BYYA 3CTAA 5HLGA 3D5LA 4HX8A 2VC0A 4KIBA 3CO7C 1TQMA 1IZ1A 2LNBA 5LLQA 1MKMA 3V8KA 3LA2A 2HS5A 2A6EF 4LMYA 2VBWA 2IA2A 2GAUA 2L54A 1J2XA 2RNJA 4LLGF 2WV0A 1WQ2A 3LAJA 1J5YA 2ZJ2A 1ZH5A 1LNWA 5BS6A 4U7DA 4A2UA 2VE9A 3BJOA 2RQPA 1IAWA 3Q9SA 2XASA 4F7ZA 3GWZA 3QPHA 4Q47A 1U6GA 4BHBA 4N0BA 3RKWA 1G6NA 1V3FA 2LF8A 1DPRA 3O3KA 2RDPA 3VOEA 4WF2A 3DFGA 3REOA 1XCBA 2NRAC 4O3MA 1NHAA 3I71A 4HDUA 1XCVA 3VFZA 2VBZA 3L9FA 3WODF 2XKOA 1J0RA 3W6KB 1WI9A 2K02A 2P5VA 1EH7A 2VN2A 3MQ0A 4E70A 2GZWA 4MTDA 3I53A 1I1SA 1KU2A 1FBSA 2EWNA 3LQRA 3J80K 2UWMA 2VE8A 2FBHA 1R23A 2QBYB 2VXZA 2YR2A 5J8CA 4HA8A 3HRSA 4AVPA 2RGVA 4RAYA 1IN7A 3K1MA 1UB9A 2P4WA 2DW4A 4JQFA 2V9VA 3VEPA 1QGPA 4OOIA 3JTGA 2V1DA 3M9AA 1LVAA 2AS5F 1SD7A 2B0LA 3MAJA 2HDCA 4L0YB 2KIMA 1GXQA 3K2ZA 2CSOA 5D6FA 3WTWC 5IT9Z 4ENNA 5JFRA 1RUOA 2WTEA 4A0ZA 4L0ZB 3RKXA 1YW9A 2WWYA 3EQLF 2VBYA 4ESBA 5AIPA 1YO5C 3TDZC 4YFKF 1XGMA 1G4DA 2IRFG 3RKYA 3Q5FA 4FX4A 3MCZA 3I58A 4CICA 1XMKA 3T0YA 1ZREA 2HKXA 1DDNA 2VODA 4JBAA 3I54A 4XSZF 5J8FA 1KU7A 1BOAA 3BWGA 3FX3A 4GXOA 1CF7A 4YIIA 2MC3A 1DP7P 1U8RA 5J6XA 2E1CA 1LDDA 2OZ6A 1STZA 2QQ9A 1FSEA 3LWFA 1USSA 4BXUA 4HX7A 4CHUA 1BN5A 4RB3C 4P5OA 3F21A 4ZYDA 3OV8A 2M30A 4HX4A 3FHZA 3CLOA 2FOKA 3WTTC 4KFCA 2PEXA 2E7WA 5KVRA 2EB7A 4IPAA 1Z9CA 5FGMA 1R58A 1BM9A 2OAZA 3O6BB 5FFZA 2K7LA 4OMZA 3F8CA 5BQTA 2RN7A 1MZBA 2PFBA 3EETA 5H20A 1ZHFA 3IWFA 4YIFA 5ERIA 3PFIA 1QPMA 4P9FA 3E5UA 4MTEA 1FYKA 2CGPA 2RV8A 5CVUA 5D8KB 1FYMA 3F6VA 4UUVA 1F4KA 2H6CA 1KQ0A 2OQGA 5DDGA 3ZMUA 1ONVA 4ENKA 3HSFA 3CUQB 5DCMB 3K0LA 1KA8A 2VC1A 4IF4A 5D4SA 3JSOA 3L7WA 4G8XA 2DU9A 2DTRA 1XDUA 2KJBA 2PMUA 3F3XA 3C1DA 5KK1A 3NQOA 3K1PA 5D4RA 3F23A 2FQ3A 4IRHA 4QWQA 2PBIA 3HOSA 2Z5UA 1HBXG 3WTUC 1BI0A 2K86A 4Y15A 3HIFA 2A5YB 2ELHA 2HTSA 4EM1A 4IRIA 4KT5C 4EMSA 3SZPA 2ZKZA 4XSXF 3E97A 3HSEA 4LG0A 3WU0A 1I27A 2L3DA 4U0WA 4EM2A 1W5SA 3E3VA 5LHIA 4Q4ZF 3Q9VA 4BHPA 3ML6A 2NNNA 5H6RA 4M71A 3TO7A 3CO6C 2XHKA 4HF1A 3G3ZA 4M9SA 5E17F 2CO5A 5FLXZ 1OPCA 1YLFA 1S3JA 3DPLC 1FSHA 2D2WA 5ICFA 2Y48A 3E5XA 2PG4A 4Q5SF 3ULQB 3QPTA 4EJOA 2HQNA 3P9IA 4U0YA 4KA4A 2MBFA 4TV7A 3RJPA 5LGUA 1DUXC 1K78A 1T0FA 4M6XA 3GXOA 1JXSA 3HHGA 4Y17A 2EK5A 2UXNA 4A0YA 2R3SA 4CZZA 1KGSA 1ZLKA 1CGPA 4ESJA 1HKSA 3L2CA 3AAFA 3KP3A 1XSDA 4A5NA 2W24A 2F5CA 2J5PA 4B8XA 1RZ4A 3KP4A 4G6QA 2L02A 1G3TA 1G3YA 4XLPF 3TKYA 3RPQA 2NYXA 1XGOA 2DO7A 4NHJA 1FYLA 3I59A 4L5JA 3BDDA 3I64A 1L0OC 2ESNA 2XAHA 3ERED 3QAHA 5HS9A 2Q8KA 2FU4A 1IN5A 1V4RA 2IPQX 4KMUX 3CUQA 1J9IA 2DK8A 3BJ6A 1TNSA 4IXAA 1I6XA 1ON1A 2W84A 4AIJA 3V4GA 4G6DA 4HYEA 4B09A 3P7NA 1I5ZA 4M72A 2WC2A 3DV8A 4L9NA 1O7FA 4UVAA 2JPBA 1R22A 1QZZA 3IL2A 4MEYF 3E6BA 5CLSA 4GYGA 2HKOA 4WXCA 1T98A 3ZN1A 5D5UB 4Q48A 3R4KA 2UZKA 2W25A 2Q2EA 2VBXA 3I59B 4YG2F 4K2EA 2FSWA 1FP1D 3WTVC 3HSRA 1KQ8A 1U5TB 2XAGA 3QP6A 3GW2A 1ZG1A 1YS7A 2RC4A 3LA3A 1XGNA 2V6CA 3KEQA 1ZRDA 2QBYA 2KRFA 1K6OA 4M74A 2MA3A 3EUHA 2ISYA 1ZGJA 2PN6A 3KZZA 3K69A 3VB2A 4D0PA 2PI0A 1FNNA 2MLGA 3WTSC 2A68F 3JW4A 2XGXA 4RB2C 4M73A 1FBUA 3WU1B 2VOOA 3HOTA 5HLHA 2H27A 5DYMA 3GO5A 3HUGA 2DPUA 5E1ZB 2DK5A 3CJNA 3V7CA 3FMSA 5DUIA 1TNTA 2O61A 1JE8A 5D8LB 3ECOA 2QVOA 4ZYHA 5E8GA 2F5FA 2XKPA 4RGUA 3WTXC 2QQBA 1P4XA 1KQ9A 3WGIA 1F1ZA 4KIGA 1WSUA 2EFPA 1CF7B 1KU9A 1U3EM 2DBBA 3RI4A 3ABTA 2Y0MA 1B9NA 4RB1A 2ACJA 2BEOA 4IHSA 2OU2A 1R1UA 4GYIA 1P2FA 5ICEA 5K5QA 3QP5A 1BJAA 2H94A 1WKMA 3GYHX 1GXPA 4YFXF 1F9NA 1HKQA 2J5OA 1R36A 3BP8A 4MNUA 1Y0UA 4O6JA 4EGZA 1BC7C 4A0XA 3TDUC 5ILUA 4ENJA 2FF4A 3F22A 4FHTA 2HGCA 1IXCA 4XRFA 2CWEA 4I02A 2XAJA 2BE5F 1MD0A 3QU3A 3FM5A 4IHTA 2ZBKA 2FNAA 1I1GA 4KUMA 2IT0A 4H0EA 4ETSA 2EJRA 2HTJA 2M45A 1LDKB 2Q0OA 4HQEA 1OMIA 2IA0A 4LGWA 3GEZA 2EV6A 5CVIA 3RPUA 2R7FA 1MJBA 1JHFA 3EYYA 4WX9A 2EA2A 5LEJA 3KP5A 3GF2A 2QLZA 2EV5A 5L3GA 2IA1A 2ZFWA 4MEXF 1HW1A 1YTYA 3PQJA 2M5WA 2M1BA 3C7JA 2IJLA 5LRRA 2HYFA 3V7SA 2MH9A 1EH8A 3ABUA 1IF1A 3TGNA 4A12A 1SD5A 5DCMA 4OIPF 3F8BA 1UFMA 3RIRA 4UHTA 2XVCA 2FRHA 2HQRA 3IRQA 5K5OA 3ZPLA 4AIKA 2HFHA 2F5EA 4KNYA 4P9UA 4HF2A 3GUDA 3FWEA 3KP7A 3I4PA 1H0MA 4L9VA 1P92A 4A6DA 3TO6A 3IC7A 2DT5A 1S29A 3P9KA 1YW8A 2ETHA 2XV4S 2XAQA 2FBKA 5HVQC 1YW7A 1TW2A 1ON2A 1SMYF 3L00A 1Z05A 3J81K 1OYYA 3GZ6A 2VOPA 3KP2A 1YYVA 5FFXA 2O8XA 5F6FA 5E1WA 5LEKA 1IN6A 4I01A 3QOPA 2FEZA 4LFUA 3ROUA 1BIBA 3N97A 1IXSB 4L5IA 3QRFF 5DUKA 2GA2A 1HSJA 3G73A 3BY6A 2GWRA 3FMQA 4ON0A 3B73A 2JT1A 1O7LA 5L3DA 5AONA 3M8EA 2ZCWA 1X3UA 1IRFA 1T39A 3F72A 4I0BA 1TQPA 3BOQA 1W7PA 4PGGA 4KMFA 1TQIA 4HF0A 3TQNA 4HW0A 5DD4A 4OINF 1XDSA 1R1VA 1BIAA 2FNPA 4HQMA 3J7AO 1REPC 4L18B 1DPUA 1H9GA 1Z7UA 3ZMVA 3V8JA 2O0YA 2DLLA 3WGGA 4I09A 3GFIA 2OD5A 3NRVA 2HZTA 2EFWA 5D5XB 1UCRA 4NB5A 5FB2A 4WWCA 3LFKA 2H09A 3DP7A 3TOBA 4QLCU 2OA4A 3ELKA 4AWXB 1ZGAA 3BPVA 2OZUA 1FP2A 4LK1F 1OKRA 3MZHA 4MHGA 2ZMEB 5CVVA 4WCGA 3IWZA 4CXFA 2JZYA 1MJAA 5D5VB 5HDGA 1D8JA 4HV5A 3BZ6A 4I98B 1K79A 3SQNA 4EVIA 4EQQA 2YU3A 3ZQ7A 4EJVA 3H92A 3KE2A 2VT3A 3RYPA 1EH6A 4L9JA 2OBPA 2YPRA 1R00A 1MDMA 2FMLA 3FXQA 5ILSA 4M9ZA 1ZRFA 1QQIA 5BOXA 3WTYC 2YX4A 1OYWA 4DQ2A 1OR7A 1WRJA 4ASNA 1R5GA 2GA1A 1RI7A 1S6LA 1D8KA 5HDKA 2W57A 1K78B 1R5HA 2Z9OA 3ZMZA 1D5VA 5A2QZ 3HHHA 4HAMA 2P7CB 4RS8A 2LSOA 5JI6A 4GCVA 1U5TC 4KN4X 1YS6A 3BROA 2FA5A 1BI3A 4ZH4F 2F2EA 4R8HA 1B6AA 4KN7X 1VTNC 3J80Z 2YSRA 5EEHA 4UNOA 3F8FA 5JHUA 1J59A 1T38A 1E2XA 3M8FA 1USTA 1O3SA 3DQVC 5CVJA 1WWXA 1QO0D 4N9HA 1ODDA 2JSCA 3H3ZA 1J7KA 3E6CC 2QZ8A 5HS7A 2TDXA 5HOOA 4GO1A 5IT9K 2P6SA 3N4MA 1IN8A 2LF7A 4OIQF 5BPIA 1L3LA 3F8NA 2V1UA 4MGRA 4R1HA 3EDPA 2ZO4A 1W5TA 3DPTA 4LB6B 3MFKA 3DEUA 2P6TA 2DAOA 3R0JA 3H3UA 1IRGA 5FD5A 3V7RA 4I2OA 1KYZA 5L3BA 3T8TA 1W7PB 2P8TA 2YX7A 2STTA 3VODA 4PGHA 4AIHA 3JAMZ 1ZRCA 2Z99A 2LDUA 3CDHA 1K7AA 4Y13A 3DKWA 2HWVA 1P4AA 3JTHA 1JGSA 1P4WA 5HS8A 2CFXA 3I5UA 1SAXA 2X0LA 2FMYA 3M7GA 1XMAA 4OIOF 4FX0A 5IT3A 2V1XA 4LD5A 4BHCA 3HRUA 3KZYA 4L9TA 2ZMEA 1T2KA 2E7XA 2O3FA 2VONA 4HLYA 1JHHA 2Z3YA 1MDMB 4HV6A 3IRRA 2D45A 1RNLA 3KP6A 2IP2A 1Z6TA 1W4MA 3IKTA 3ZP5A 3IHUA 1HQCA 4P55A 5D5WB 5BMZA 3LSTA 4IRGA 2STWA 3O2PE 4RGSA 2LKPA 4UV9A 5JR3A 3HYIA 1FC3A 4O5VA 5E20A 3SZTA 1H9TA 1O57A 4CGZA 2IVMA 3WTZA 5CYVA 3TOAA 1ZLJA 4DNCA 2FE3A 1R7JA 3TO9A 3C18A 2EV0A 2G7UA 3GVAA 1O3TA 5HLIA 1S7AA 2UXXA 3R61A 1O3QA 1B1BA 1LJ9A 5AIQA 2HEOA 2NS0A 3K1NA 3GFJA 1TW3A 3ZMSA 2PMHA 1SFEA 5DV5A 1PUEE 3LA7A 4RGRA 3J81Z 1XSVA 3KETA 3GZ5A 1D3YA 5DEQA 3S2WA 5ICCA 2P5LC 2CW0F 2PQ8A 5ILVA 2OQRA 1YFHA 4RB0A 3ZN0A 4PZJA 2ZNYA 3ECHA 2A61A 1OYIA 2HR3A 4BH9A 4PDKA 1KU3A 2GIVA 4CYDA 4G94A 1Z1DA 4LJZF 1IW7F 1F5TA 5DD8A 1HSTA 1B9MA 2L4AA 3T1BA 2XIGA 3LAPA 5H6QA 4R79A 1IN4A 2W85A 2ADUA 3GFLA 3R0AA 2Y75A 5FLXK 2DQRA 2R7DA 2EA4A 2GXGA 2KJCA 3R6SA 1ZAOA 3ZMDA 4U0VA 1FWZA 3WE2A 2JPCA 1ZYRF 1UHMA 4M6YA 4UVCA 3DF8A 1Q1HA 2DPDA 3E6DA 3OOPA 4WXDA 3SFZA 1Z91A 4Z2YA 4LG0B 2DFIA 2ISZA 2K4BA 2K27A 4OU0A 3KFWX 1ZN2A 1LDJA 2A6HF 3GLXA 4UV8A 5ICGA 4OMYA 3E6MA 3E5QA 2FBIA 1Z6RA 4XLNF 3U1DA 3WE3A 1BI1A 2A69F 1O3RA 2KIUA 2CYYA 4RGXA 4CDGA 3RTRA 5L3FA 1J75A 3KLOA 1FY7A 5E8IA 1IXRC 1TTYA 2QYOA 2CG4A 2FXAA 5K1YA 2D1VA 1SFUA 2O6GE 3HTUA 4KIFA 4I7HA 3SXYA 3D0SA 3BPXA 5EEGA 4NQWA 5LRSA 3M1EA 1SD6A 3CUOA 4HLXA 3FXRA 1BI2A 2NAZA 2XROA 4G9YA 1ZARA 1LEAA 5F1RA 4WK8F 4IVNA 3HTSB 2MD5A 4HOBA 2KIFA 2QM3A 1LQ1A 3LQQA 5TRDA 5A2QK 4G7HF 1YG2A 4ZYEA 1FOKA 1XSXA 1HW5A 4BQAA 4LK0F 5DCFA 3K9TA 4FT8A 4RAZA 3F6OA 1GHCA 1QZYA 1PDNC 4A6EA 2M8EA 3F8MA 1QNTA 2PLYA 1SD4A 1MGTA 1RUNA 1FBQA 5JVTA 3FM3A 2JTVA 1QBJA 1FX7A 1AWCA 2ESHA 3U9GA 3KCCA 3RDIA 4LLNA 1E17A 2V79A 3EYIA 4HZFA 1FPQA 1XN7A 4IJAA 4XBFA 2O03A 2C6YA 4OIRF 2RVCA 3COAC 5LGTA 1A04A 2EFOA 4ZZLA 4AD9A 5L3EA 1HW2A 2IW5A 3KLNA 3QU6A 1GVJA 4EJWA 4S05A 3SHFA 4HBLA 3FXUA 3MEXA 1EV7A 4ESFA 3IKVA 2H6BA 1PP7U 1BBYA 2DI3A 1IUYA 2COMA 2M87A 4MQVA 2Z33A 3I0TA 4A5MA 5ED4A 2K4JA 3WG9A 1RIOH 1YIOA 3JAMK 3KEOA 4EJUA 3T5XA 3W6JB 4M9XA 3ISPA 5L3CA 3WGHA 3NEUA 1XB4A 4WXHA 3GX4X 1W7PD 2L4MA 4JK1X 4LLLA 1G3WA 1G3SA 1FT9A 3MWMA 4U7BA 1U78A 4EJTA 4LB5A 2XRNA 5E1XA 2JRTA 2KKOA 3FF5A 1LB2A 1ULYA 2QWWA 2G7HA 2D1HA 5LHHA 1XGSA 4ENMA 1SFXA 1P6RA 4KDPA 3PQKA 5HDNA 2QQAA 1KYWA 3FZVA 3B02A 4UXNA 3CUQC 2P5KA 1U2WA 4HDVA 3HRTA 2L01A 1MJ9A 2ZNZA 4GGGA 1UHWA 2XUBA 4UVBA 4P96A 1BC8C 1XD7A 2MH2A 3GFMA 2BV6A 5FD6A 3JSPA 2ZXJA 4S04A 3ZMTA 2X4HA 5K5RA 4PCQA 5CVRA 2BBYA 2QUFA 2VT2A 1TLHB 2A3SA 4N9IA 5BPDA 2HYGD 2E1NA 1HXDA 5LGNA 3L09A 2AXLA 3P9CA 4BNCA 1R1TA 3U2RA 1HKTA 3T8RA 2DQLA 1B59A 2QENA 1AOYA 1FZPB 1YQAA 4BAYA 2BYVE 1ZG5A 2F5DA 3R60A 5D6EA 4CO8A 5F64A 3FMRA 1S8NA 6PAXA 2EFNA 1U5TA 1T6SA 1S7OA 5LHGA 1C0WA 1PP8F 3C3WA 4EV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GXB A;  4KIC A;  4YFN F;  3V8L A;  4MQ9 F;  1TBX A;  3MZY A;  4EM0 B;  4ZZD A;  5FO5 A;  5E18 F;  4KYW A;  3BJA A;  4G7O F;  2MLK A;  2EFQ A;  1LEB A;  2XAF A;  4G7Z F;  1B4A A;  1SMT A;  2P7V B;  3DXJ F;  2BGC A;  2NNY A;  3HRM A;  2HOE A;  3RYR A;  4I0A A;  2PJP A;  4EGY A;  2CQK A;  5LBQ A;  4U88 A;  2GQQ A;  1FLI A;  5CJ9 A;  4ZYG A;  2RKH A;  2G9W A;  1ZG3 A;  2A07 F;  5TJJ A;  4BYY A;  3CTA A;  5HLG A;  3D5L A;  4HX8 A;  2VC0 A;  4KIB A;  3CO7 C;  1TQM A;  1IZ1 A;  2LNB A;  5LLQ A;  1MKM A;  3V8K A;  3LA2 A;  2HS5 A;  2A6E F;  4LMY A;  2VBW A;  2IA2 A;  2GAU A;  2L54 A;  1J2X A;  2RNJ A;  4LLG F;  2WV0 A;  1WQ2 A;  3LAJ A;  1J5Y A;  2ZJ2 A;  1ZH5 A;  1LNW A;  5BS6 A;  4U7D A;  4A2U A;  2VE9 A;  3BJO A;  2RQP A;  1IAW A;  3Q9S A;  2XAS A;  4F7Z A;  3GWZ A;  3QPH A;  4Q47 A;  1U6G A;  4BHB A;  4N0B A;  3RKW A;  1G6N A;  1V3F A;  2LF8 A;  1DPR A;  3O3K A;  2RDP A;  3VOE A;  4WF2 A;  3DFG A;  3REO A;  1XCB A;  2NRA C;  4O3M A;  1NHA A;  3I71 A;  4HDU A;  1XCV A;  3VFZ A;  2VBZ A;  3L9F A;  3WOD F;  2XKO A;  1J0R A;  3W6K B;  1WI9 A;  2K02 A;  2P5V A;  1EH7 A;  2VN2 A;  3MQ0 A;  4E70 A;  2GZW A;  4MTD A;  3I53 A;  1I1S A;  1KU2 A;  1FBS A;  2EWN A;  3LQR A;  3J80 K;  2UWM A;  2VE8 A;  2FBH A;  1R23 A;  2QBY B;  2VXZ A;  2YR2 A;  5J8C A;  4HA8 A;  3HRS A;  4AVP A;  2RGV A;  4RAY A;  1IN7 A;  3K1M A;  1UB9 A;  2P4W A;  2DW4 A;  4JQF A;  2V9V A;  3VEP A;  1QGP A;  4OOI A;  3JTG A;  2V1D A;  3M9A A;  1LVA A;  2AS5 F;  1SD7 A;  2B0L A;  3MAJ A;  2HDC A;  4L0Y B;  2KIM A;  1GXQ A;  3K2Z A;  2CSO A;  5D6F A;  3WTW C;  5IT9 Z;  4ENN A;  5JFR A;  1RUO A;  2WTE A;  4A0Z A;  4L0Z B;  3RKX A;  1YW9 A;  2WWY A;  3EQL F;  2VBY A;  4ESB A;  5AIP A;  1YO5 C;  3TDZ C;  4YFK F;  1XGM A;  1G4D A;  2IRF G;  3RKY A;  3Q5F A;  4FX4 A;  3MCZ A;  3I58 A;  4CIC A;  1XMK A;  3T0Y A;  1ZRE A;  2HKX A;  1DDN A;  2VOD A;  4JBA A;  3I54 A;  4XSZ F;  5J8F A;  1KU7 A;  1BOA A;  3BWG A;  3FX3 A;  4GXO A;  1CF7 A;  4YII A;  2MC3 A;  1DP7 P;  1U8R A;  5J6X A;  2E1C A;  1LDD A;  2OZ6 A;  1STZ A;  2QQ9 A;  1FSE A;  3LWF A;  1USS A;  4BXU A;  4HX7 A;  4CHU A;  1BN5 A;  4RB3 C;  4P5O A;  3F21 A;  4ZYD A;  3OV8 A;  2M30 A;  4HX4 A;  3FHZ A;  3CLO A;  2FOK A;  3WTT C;  4KFC A;  2PEX A;  2E7W A;  5KVR A;  2EB7 A;  4IPA A;  1Z9C A;  5FGM A;  1R58 A;  1BM9 A;  2OAZ A;  3O6B B;  5FFZ A;  2K7L A;  4OMZ A;  3F8C A;  5BQT A;  2RN7 A;  1MZB A;  2PFB A;  3EET A;  5H20 A;  1ZHF A;  3IWF A;  4YIF A;  5ERI A;  3PFI A;  1QPM A;  4P9F A;  3E5U A;  4MTE A;  1FYK A;  2CGP A;  2RV8 A;  5CVU A;  5D8K B;  1FYM A;  3F6V A;  4UUV A;  1F4K A;  2H6C A;  1KQ0 A;  2OQG A;  5DDG A;  3ZMU A;  1ONV A;  4ENK A;  3HSF A;  3CUQ B;  5DCM B;  3K0L A;  1KA8 A;  2VC1 A;  4IF4 A;  5D4S A;  3JSO A;  3L7W A;  4G8X A;  2DU9 A;  2DTR A;  1XDU A;  2KJB A;  2PMU A;  3F3X A;  3C1D A;  5KK1 A;  3NQO A;  3K1P A;  5D4R A;  3F23 A;  2FQ3 A;  4IRH A;  4QWQ A;  2PBI A;  3HOS A;  2Z5U A;  1HBX G;  3WTU C;  1BI0 A;  2K86 A;  4Y15 A;  3HIF A;  2A5Y B;  2ELH A;  2HTS A;  4EM1 A;  4IRI A;  4KT5 C;  4EMS A;  3SZP A;  2ZKZ A;  4XSX F;  3E97 A;  3HSE A;  4LG0 A;  3WU0 A;  1I27 A;  2L3D A;  4U0W A;  4EM2 A;  1W5S A;  3E3V A;  5LHI A;  4Q4Z F;  3Q9V A;  4BHP A;  3ML6 A;  2NNN A;  5H6R A;  4M71 A;  3TO7 A;  3CO6 C;  2XHK A;  4HF1 A;  3G3Z A;  4M9S A;  5E17 F;  2CO5 A;  5FLX Z;  1OPC A;  1YLF A;  1S3J A;  3DPL C;  1FSH A;  2D2W A;  5ICF A;  2Y48 A;  3E5X A;  2PG4 A;  4Q5S F;  3ULQ B;  3QPT A;  4EJO A;  2HQN A;  3P9I A;  4U0Y A;  4KA4 A;  2MBF A;  4TV7 A;  3RJP A;  5LGU A;  1DUX C;  1K78 A;  1T0F A;  4M6X A;  3GXO A;  1JXS A;  3HHG A;  4Y17 A;  2EK5 A;  2UXN A;  4A0Y A;  2R3S A;  4CZZ A;  1KGS A;  1ZLK A;  1CGP A;  4ESJ A;  1HKS A;  3L2C A;  3AAF A;  3KP3 A;  1XSD A;  4A5N A;  2W24 A;  2F5C A;  2J5P A;  4B8X A;  1RZ4 A;  3KP4 A;  4G6Q A;  2L02 A;  1G3T A;  1G3Y A;  4XLP F;  3TKY A;  3RPQ A;  2NYX A;  1XGO A;  2DO7 A;  4NHJ A;  1FYL A;  3I59 A;  4L5J A;  3BDD A;  3I64 A;  1L0O C;  2ESN A;  2XAH A;  3ERE D;  3QAH A;  5HS9 A;  2Q8K A;  2FU4 A;  1IN5 A;  1V4R A;  2IPQ X;  4KMU X;  3CUQ A;  1J9I A;  2DK8 A;  3BJ6 A;  1TNS A;  4IXA A;  1I6X A;  1ON1 A;  2W84 A;  4AIJ A;  3V4G A;  4G6D A;  4HYE A;  4B09 A;  3P7N A;  1I5Z A;  4M72 A;  2WC2 A;  3DV8 A;  4L9N A;  1O7F A;  4UVA A;  2JPB A;  1R22 A;  1QZZ A;  3IL2 A;  4MEY F;  3E6B A;  5CLS A;  4GYG A;  2HKO A;  4WXC A;  1T98 A;  3ZN1 A;  5D5U B;  4Q48 A;  3R4K A;  2UZK A;  2W25 A;  2Q2E A;  2VBX A;  3I59 B;  4YG2 F;  4K2E A;  2FSW A;  1FP1 D;  3WTV C;  3HSR A;  1KQ8 A;  1U5T B;  2XAG A;  3QP6 A;  3GW2 A;  1ZG1 A;  1YS7 A;  2RC4 A;  3LA3 A;  1XGN A;  2V6C A;  3KEQ A;  1ZRD A;  2QBY A;  2KRF A;  1K6O A;  4M74 A;  2MA3 A;  3EUH A;  2ISY A;  1ZGJ A;  2PN6 A;  3KZZ A;  3K69 A;  3VB2 A;  4D0P A;  2PI0 A;  1FNN A;  2MLG A;  3WTS C;  2A68 F;  3JW4 A;  2XGX A;  4RB2 C;  4M73 A;  1FBU A;  3WU1 B;  2VOO A;  3HOT A;  5HLH A;  2H27 A;  5DYM A;  3GO5 A;  3HUG A;  2DPU A;  5E1Z B;  2DK5 A;  3CJN A;  3V7C A;  3FMS A;  5DUI A;  1TNT A;  2O61 A;  1JE8 A;  5D8L B;  3ECO A;  2QVO A;  4ZYH A;  5E8G A;  2F5F A;  2XKP A;  4RGU A;  3WTX C;  2QQB A;  1P4X A;  1KQ9 A;  3WGI A;  1F1Z A;  4KIG A;  1WSU A;  2EFP A;  1CF7 B;  1KU9 A;  1U3E M;  2DBB A;  3RI4 A;  3ABT A;  2Y0M A;  1B9N A;  4RB1 A;  2ACJ A;  2BEO A;  4IHS A;  2OU2 A;  1R1U A;  4GYI A;  1P2F A;  5ICE A;  5K5Q A;  3QP5 A;  1BJA A;  2H94 A;  1WKM A;  3GYH X;  1GXP A;  4YFX F;  1F9N A;  1HKQ A;  2J5O A;  1R36 A;  3BP8 A;  4MNU A;  1Y0U A;  4O6J A;  4EGZ A;  1BC7 C;  4A0X A;  3TDU C;  5ILU A;  4ENJ A;  2FF4 A;  3F22 A;  4FHT A;  2HGC A;  1IXC A;  4XRF A;  2CWE A;  4I02 A;  2XAJ A;  2BE5 F;  1MD0 A;  3QU3 A;  3FM5 A;  4IHT A;  2ZBK A;  2FNA A;  1I1G A;  4KUM A;  2IT0 A;  4H0E A;  4ETS A;  2EJR A;  2HTJ A;  2M45 A;  1LDK B;  2Q0O A;  4HQE A;  1OMI A;  2IA0 A;  4LGW A;  3GEZ A;  2EV6 A;  5CVI A;  3RPU A;  2R7F A;  1MJB A;  1JHF A;  3EYY A;  4WX9 A;  2EA2 A;  5LEJ A;  3KP5 A;  3GF2 A;  2QLZ A;  2EV5 A;  5L3G A;  2IA1 A;  2ZFW A;  4MEX F;  1HW1 A;  1YTY A;  3PQJ A;  2M5W A;  2M1B A;  3C7J A;  2IJL A;  5LRR A;  2HYF A;  3V7S A;  2MH9 A;  1EH8 A;  3ABU A;  1IF1 A;  3TGN A;  4A12 A;  1SD5 A;  5DCM A;  4OIP F;  3F8B A;  1UFM A;  3RIR A;  4UHT A;  2XVC A;  2FRH A;  2HQR A;  3IRQ A;  5K5O A;  3ZPL A;  4AIK A;  2HFH A;  2F5E A;  4KNY A;  4P9U A;  4HF2 A;  3GUD A;  3FWE A;  3KP7 A;  3I4P A;  1H0M A;  4L9V A;  1P92 A;  4A6D A;  3TO6 A;  3IC7 A;  2DT5 A;  1S29 A;  3P9K A;  1YW8 A;  2ETH A;  2XV4 S;  2XAQ A;  2FBK A;  5HVQ C;  1YW7 A;  1TW2 A;  1ON2 A;  1SMY F;  3L00 A;  1Z05 A;  3J81 K;  1OYY A;  3GZ6 A;  2VOP A;  3KP2 A;  1YYV A;  5FFX A;  2O8X A;  5F6F A;  5E1W A;  5LEK A;  1IN6 A;  4I01 A;  3QOP A;  2FEZ A;  4LFU A;  3ROU A;  1BIB A;  3N97 A;  1IXS B;  4L5I A;  3QRF F;  5DUK A;  2GA2 A;  1HSJ A;  3G73 A;  3BY6 A;  2GWR A;  3FMQ A;  4ON0 A;  3B73 A;  2JT1 A;  1O7L A;  5L3D A;  5AON A;  3M8E A;  2ZCW A;  1X3U A;  1IRF A;  1T39 A;  3F72 A;  4I0B A;  1TQP A;  3BOQ A;  1W7P A;  4PGG A;  4KMF A;  1TQI A;  4HF0 A;  3TQN A;  4HW0 A;  5DD4 A;  4OIN F;  1XDS A;  1R1V A;  1BIA A;  2FNP A;  4HQM A;  3J7A O;  1REP C;  4L18 B;  1DPU A;  1H9G A;  1Z7U A;  3ZMV A;  3V8J A;  2O0Y A;  2DLL A;  3WGG A;  4I09 A;  3GFI A;  2OD5 A;  3NRV A;  2HZT A;  2EFW A;  5D5X B;  1UCR A;  4NB5 A;  5FB2 A;  4WWC A;  3LFK A;  2H09 A;  3DP7 A;  3TOB A;  4QLC U;  2OA4 A;  3ELK A;  4AWX B;  1ZGA A;  3BPV A;  2OZU A;  1FP2 A;  4LK1 F;  1OKR A;  3MZH A;  4MHG A;  2ZME B;  5CVV A;  4WCG A;  3IWZ A;  4CXF A;  2JZY A;  1MJA A;  5D5V B;  5HDG A;  1D8J A;  4HV5 A;  3BZ6 A;  4I98 B;  1K79 A;  3SQN A;  4EVI A;  4EQQ A;  2YU3 A;  3ZQ7 A;  4EJV A;  3H92 A;  3KE2 A;  2VT3 A;  3RYP A;  1EH6 A;  4L9J A;  2OBP A;  2YPR A;  1R00 A;  1MDM A;  2FML A;  3FXQ A;  5ILS A;  4M9Z A;  1ZRF A;  1QQI A;  5BOX A;  3WTY C;  2YX4 A;  1OYW A;  4DQ2 A;  1OR7 A;  1WRJ A;  4ASN A;  1R5G A;  2GA1 A;  1RI7 A;  1S6L A;  1D8K A;  5HDK A;  2W57 A;  1K78 B;  1R5H A;  2Z9O A;  3ZMZ A;  1D5V A;  5A2Q Z;  3HHH A;  4HAM A;  2P7C B;  4RS8 A;  2LSO A;  5JI6 A;  4GCV A;  1U5T C;  4KN4 X;  1YS6 A;  3BRO A;  2FA5 A;  1BI3 A;  4ZH4 F;  2F2E A;  4R8H A;  1B6A A;  4KN7 X;  1VTN C;  3J80 Z;  2YSR A;  5EEH A;  4UNO A;  3F8F A;  5JHU A;  1J59 A;  1T38 A;  1E2X A;  3M8F A;  1UST A;  1O3S A;  3DQV C;  5CVJ A;  1WWX A;  1QO0 D;  4N9H A;  1ODD A;  2JSC A;  3H3Z A;  1J7K A;  3E6C C;  2QZ8 A;  5HS7 A;  2TDX A;  5HOO A;  4GO1 A;  5IT9 K;  2P6S A;  3N4M A;  1IN8 A;  2LF7 A;  4OIQ F;  5BPI A;  1L3L A;  3F8N A;  2V1U A;  4MGR A;  4R1H A;  3EDP A;  2ZO4 A;  1W5T A;  3DPT A;  4LB6 B;  3MFK A;  3DEU A;  2P6T A;  2DAO A;  3R0J A;  3H3U A;  1IRG A;  5FD5 A;  3V7R A;  4I2O A;  1KYZ A;  5L3B A;  3T8T A;  1W7P B;  2P8T A;  2YX7 A;  2STT A;  3VOD A;  4PGH A;  4AIH A;  3JAM Z;  1ZRC A;  2Z99 A;  2LDU A;  3CDH A;  1K7A A;  4Y13 A;  3DKW A;  2HWV A;  1P4A A;  3JTH A;  1JGS A;  1P4W A;  5HS8 A;  2CFX A;  3I5U A;  1SAX A;  2X0L A;  2FMY A;  3M7G A;  1XMA A;  4OIO F;  4FX0 A;  5IT3 A;  2V1X A;  4LD5 A;  4BHC A;  3HRU A;  3KZY A;  4L9T A;  2ZME A;  1T2K A;  2E7X A;  2O3F A;  2VON A;  4HLY A;  1JHH A;  2Z3Y A;  1MDM B;  4HV6 A;  3IRR A;  2D45 A;  1RNL A;  3KP6 A;  2IP2 A;  1Z6T A;  1W4M A;  3IKT A;  3ZP5 A;  3IHU A;  1HQC A;  4P55 A;  5D5W B;  5BMZ A;  3LST A;  4IRG A;  2STW A;  3O2P E;  4RGS A;  2LKP A;  4UV9 A;  5JR3 A;  3HYI A;  1FC3 A;  4O5V A;  5E20 A;  3SZT A;  1H9T A;  1O57 A;  4CGZ A;  2IVM A;  3WTZ A;  5CYV A;  3TOA A;  1ZLJ A;  4DNC A;  2FE3 A;  1R7J A;  3TO9 A;  3C18 A;  2EV0 A;  2G7U A;  3GVA A;  1O3T A;  5HLI A;  1S7A A;  2UXX A;  3R61 A;  1O3Q A;  1B1B A;  1LJ9 A;  5AIQ A;  2HEO A;  2NS0 A;  3K1N A;  3GFJ A;  1TW3 A;  3ZMS A;  2PMH A;  1SFE A;  5DV5 A;  1PUE E;  3LA7 A;  4RGR A;  3J81 Z;  1XSV A;  3KET A;  3GZ5 A;  1D3Y A;  5DEQ A;  3S2W A;  5ICC A;  2P5L C;  2CW0 F;  2PQ8 A;  5ILV A;  2OQR A;  1YFH A;  4RB0 A;  3ZN0 A;  4PZJ A;  2ZNY A;  3ECH A;  2A61 A;  1OYI A;  2HR3 A;  4BH9 A;  4PDK A;  1KU3 A;  2GIV A;  4CYD A;  4G94 A;  1Z1D A;  4LJZ F;  1IW7 F;  1F5T A;  5DD8 A;  1HST A;  1B9M A;  2L4A A;  3T1B A;  2XIG A;  3LAP A;  5H6Q A;  4R79 A;  1IN4 A;  2W85 A;  2ADU A;  3GFL A;  3R0A A;  2Y75 A;  5FLX K;  2DQR A;  2R7D A;  2EA4 A;  2GXG A;  2KJC A;  3R6S A;  1ZAO A;  3ZMD A;  4U0V A;  1FWZ A;  3WE2 A;  2JPC A;  1ZYR F;  1UHM A;  4M6Y A;  4UVC A;  3DF8 A;  1Q1H A;  2DPD A;  3E6D A;  3OOP A;  4WXD A;  3SFZ A;  1Z91 A;  4Z2Y A;  4LG0 B;  2DFI A;  2ISZ A;  2K4B A;  2K27 A;  4OU0 A;  3KFW X;  1ZN2 A;  1LDJ A;  2A6H F;  3GLX A;  4UV8 A;  5ICG A;  4OMY A;  3E6M A;  3E5Q A;  2FBI A;  1Z6R A;  4XLN F;  3U1D A;  3WE3 A;  1BI1 A;  2A69 F;  1O3R A;  2KIU A;  2CYY A;  4RGX A;  4CDG A;  3RTR A;  5L3F A;  1J75 A;  3KLO A;  1FY7 A;  5E8I A;  1IXR C;  1TTY A;  2QYO A;  2CG4 A;  2FXA A;  5K1Y A;  2D1V A;  1SFU A;  2O6G E;  3HTU A;  4KIF A;  4I7H A;  3SXY A;  3D0S A;  3BPX A;  5EEG A;  4NQW A;  5LRS A;  3M1E A;  1SD6 A;  3CUO A;  4HLX A;  3FXR A;  1BI2 A;  2NAZ A;  2XRO A;  4G9Y A;  1ZAR A;  1LEA A;  5F1R A;  4WK8 F;  4IVN A;  3HTS B;  2MD5 A;  4HOB A;  2KIF A;  2QM3 A;  1LQ1 A;  3LQQ A;  5TRD A;  5A2Q K;  4G7H F;  1YG2 A;  4ZYE A;  1FOK A;  1XSX A;  1HW5 A;  4BQA A;  4LK0 F;  5DCF A;  3K9T A;  4FT8 A;  4RAZ A;  3F6O A;  1GHC A;  1QZY A;  1PDN C;  4A6E A;  2M8E A;  3F8M A;  1QNT A;  2PLY A;  1SD4 A;  1MGT A;  1RUN A;  1FBQ A;  5JVT A;  3FM3 A;  2JTV A;  1QBJ A;  1FX7 A;  1AWC A;  2ESH A;  3U9G A;  3KCC A;  3RDI A;  4LLN A;  1E17 A;  2V79 A;  3EYI A;  4HZF A;  1FPQ A;  1XN7 A;  4IJA A;  4XBF A;  2O03 A;  2C6Y A;  4OIR F;  2RVC A;  3COA C;  5LGT A;  1A04 A;  2EFO A;  4ZZL A;  4AD9 A;  5L3E A;  1HW2 A;  2IW5 A;  3KLN A;  3QU6 A;  1GVJ A;  4EJW A;  4S05 A;  3SHF A;  4HBL A;  3FXU A;  3MEX A;  1EV7 A;  4ESF A;  3IKV A;  2H6B A;  1PP7 U;  1BBY A;  2DI3 A;  1IUY A;  2COM A;  2M87 A;  4MQV A;  2Z33 A;  3I0T A;  4A5M A;  5ED4 A;  2K4J A;  3WG9 A;  1RIO H;  1YIO A;  3JAM K;  3KEO A;  4EJU A;  3T5X A;  3W6J B;  4M9X A;  3ISP A;  5L3C A;  3WGH A;  3NEU A;  1XB4 A;  4WXH A;  3GX4 X;  1W7P D;  2L4M A;  4JK1 X;  4LLL A;  1G3W A;  1G3S A;  1FT9 A;  3MWM A;  4U7B A;  1U78 A;  4EJT A;  4LB5 A;  2XRN A;  5E1X A;  2JRT A;  2KKO A;  3FF5 A;  1LB2 A;  1ULY A;  2QWW A;  2G7H A;  2D1H A;  5LHH A;  1XGS A;  4ENM A;  1SFX A;  1P6R A;  4KDP A;  3PQK A;  5HDN A;  2QQA A;  1KYW A;  3FZV A;  3B02 A;  4UXN A;  3CUQ C;  2P5K A;  1U2W A;  4HDV A;  3HRT A;  2L01 A;  1MJ9 A;  2ZNZ A;  4GGG A;  1UHW A;  2XUB A;  4UVB A;  4P96 A;  1BC8 C;  1XD7 A;  2MH2 A;  3GFM A;  2BV6 A;  5FD6 A;  3JSP A;  2ZXJ A;  4S04 A;  3ZMT A;  2X4H A;  5K5R A;  4PCQ A;  5CVR A;  2BBY A;  2QUF A;  2VT2 A;  1TLH B;  2A3S A;  4N9I A;  5BPD A;  2HYG D;  2E1N A;  1HXD A;  5LGN A;  3L09 A;  2AXL A;  3P9C A;  4BNC A;  1R1T A;  3U2R A;  1HKT A;  3T8R A;  2DQL A;  1B59 A;  2QEN A;  1AOY A;  1FZP B;  1YQA A;  4BAY A;  2BYV E;  1ZG5 A;  2F5D A;  3R60 A;  5D6E A;  4CO8 A;  5F64 A;  3FMR A;  1S8N A;  6PAX A;  2EFN A;  1U5T A;  1T6S A;  1S7O A;  5LHG A;  1C0W A;  1PP8 F;  3C3W A;  4EV0 A; 
#chains in the Genus database with same CATH topology
 1D0Y A;  4B47 A;  1JKO C;  3VYT B;  1OCC H;  2GXB A;  4KIC A;  4YFN F;  3UKG A;  3V8L A;  2H8R A;  1XTA A;  1TC3 C;  4MQ9 F;  1POG A;  4CCM A;  2EZL A;  2PMZ N;  5B3S H;  1TBX A;  3MZY A;  4EM0 B;  2EIJ H;  4QSH A;  4ZZD A;  2KMU A;  1U0J A;  5FO5 A;  3A01 B;  2M2E A;  2K40 A;  2LG4 A;  2IGK A;  5E18 F;  5B1B H;  1AKH B;  2NVT J;  4KYW A;  3BJA A;  1Z21 A;  3ZGK A;  5M5Y J;  4G7O F;  1A36 A;  2MLK A;  5K7H A;  2EFQ A;  3ZOB A;  2XAF A;  1LEB A;  1OFC X;  4G7Z F;  3ABM H;  2IGN A;  1B4A A;  1SMT A;  3K4J A;  2P7V B;  3DXJ F;  2BGC A;  2NNY A;  1K6Y A;  4IZZ A;  2DJN A;  3HRM A;  1HCR A;  2HOE A;  1LFP A;  1ETK A;  3RYR A;  3OS2 A;  4I0A A;  1ETV A;  2PJP A;  1R4M B;  4EGY A;  2CQK A;  5LBQ A;  1Y6I A;  1IG7 A;  5KHD A;  3HG9 A;  2VJJ A;  4BE1 A;  1W0T A;  4U88 A;  2NVQ J;  2GQQ A;  2YUS A;  1FLI A;  1QPI A;  4CCJ A;  5CPR B;  3HOU J;  2F48 A;  5CJ9 A;  4ZYG A;  2RKH A;  2G9W A;  2WAQ A;  1ZG3 A;  1IUF A;  5H2F C;  2A07 F;  5TJJ A;  4BYY A;  3CTA A;  3OYL A;  5C4J J;  2BY0 A;  5HLG A;  3Q0W A;  1BR2 A;  3D5L A;  1VQ9 I;  4HX8 A;  1UAA A;  3S2H J;  2VC0 A;  4KIB A;  5K7F A;  1TQM A;  3CO7 C;  2B63 J;  1IZ1 A;  2GOX B;  2LNB A;  5LLQ A;  2K9M A;  2ZXI A;  4PSX A;  4I99 C;  3HOW J;  4BY7 J;  3L2Q A;  1MKM A;  4FET A;  3LA2 A;  2HS5 A;  2A6E F;  4LMY A;  3V8K A;  1R9T J;  1MMA A;  1ZEL A;  2LLK A;  3JRI A;  2VBW A;  2IA2 A;  4A69 C;  2GAU A;  3GTP J;  4JP0 A;  2X6O A;  1WJE A;  2L54 A;  5IY5 H;  1FJL A;  1J2X A;  2M7A A;  3OYK A;  2LBF B;  1U9N A;  1X2N A;  4LOC A;  2EIL H;  2RNJ A;  4LLG F;  2M7B A;  2WV0 A;  3K4K A;  1WQ2 A;  3LAJ A;  1J5Y A;  2ZJ2 A;  3DLL F;  4RA2 A;  1ZH5 A;  5EGO B;  1LNW A;  2B9S A;  2EH3 A;  5BS6 A;  1BR1 A;  2CUE A;  4U7D A;  4A2U A;  2VE9 A;  2I8D A;  3BJO A;  3EUK L;  2RQP A;  1IAW A;  3L2W A;  3I4M J;  2O8K A;  1W5C C;  4ABZ A;  3Q9S A;  2XAS A;  4F7Z A;  3H35 A;  3GWZ A;  3H5N A;  3QPH A;  4Q47 A;  1U6G A;  4BHB A;  4N0B A;  3RKW A;  1DU0 A;  1VQ7 I;  1G6N A;  3DU6 A;  1V3F A;  5GAD J;  2LF8 A;  1DPR A;  3HOY J;  3CC4 I;  3O3K A;  2IS4 A;  2E2H J;  2RDP A;  3ZR8 X;  3VOE A;  4ZC3 A;  2PX9 A;  2XB0 X;  2W1O A;  3CCJ I;  4BEH A;  3ZCO A;  1PYV A;  4WF2 A;  1UJ8 A;  3DFG A;  4RDU A;  2M0M A;  3GTJ J;  3REO A;  1XCB A;  3Q0U A;  1MW7 A;  5IYB J;  2NRA C;  4O3M A;  1NHA A;  3I71 A;  4HDU A;  2DCE A;  1XCV A;  3DCF A;  3VFZ A;  4C3H J;  2VBZ A;  3L9F A;  3WOD F;  2XKO A;  1J0R A;  3W6K B;  3JRG A;  4RM2 A;  1WI9 A;  4OAY A;  3G1O A;  3LFU A;  2K02 A;  2P5V A;  4CSW A;  3JRA A;  1WH7 A;  1EH7 A;  2VN2 A;  4N4N B;  3MQ0 A;  4E70 A;  2GZW A;  4MTD A;  1FEX A;  3I53 A;  1I1S A;  2QCO A;  2R7Z J;  1KU2 A;  1FBS A;  2EWN A;  3KYC B;  3LQR A;  3ASO H;  4CZC A;  1PUF A;  2G0E A;  3J80 K;  2UWM A;  1N77 A;  2VE8 A;  2ME0 A;  2RAE A;  2FBH A;  2XF6 A;  2R7W A;  1VQM I;  1UMQ A;  1R23 A;  2DMT A;  2QBY B;  2LVS A;  2VXZ A;  2YR2 A;  2Q1Z B;  2WBM A;  4HA8 A;  3VYS B;  5J8C A;  2PMZ A;  3HRS A;  1RR8 C;  3IAS 2;  2KZV A;  4AVP A;  2RGV A;  4RAY A;  1IN7 A;  2IXS A;  5DM7 F;  3K1M A;  2XF5 A;  3PIO F;  1UB9 A;  5F0C A;  1WJ5 A;  2P4W A;  3HGY A;  3HGG A;  4KIS A;  2DW4 A;  4F52 A;  4JQF A;  2V9V A;  3VEP A;  1TWG J;  3PJR A;  3MMY B;  1QGP A;  4OOI A;  3JTG A;  2V1D A;  3M9A A;  4CH7 A;  1D1C A;  1P9Q C;  3LNQ A;  3AG3 H;  4S0H B;  3OMY A;  2HDD A;  1LVA A;  5TIS C;  1SD7 A;  2B0L A;  2AS5 F;  2HI3 A;  3AG2 H;  3MAJ A;  2HDC A;  4L0Y B;  2KIM A;  4XON A;  3AFH A;  4AVZ A;  3OOU A;  2R5Z A;  1V5F A;  1GXQ A;  4UB8 C;  2JVH A;  5J4V A;  3K2Z A;  2CSO A;  1VF9 A;  2M4K A;  5D6F A;  3WTW C;  1VQ8 I;  5IT9 Z;  4BEH B;  4ENN A;  3P5J A;  2FQ4 A;  5JFR A;  4DBR A;  1JGG A;  1RUO A;  1Z67 A;  2WTE A;  1LFB A;  3OY9 A;  5E3L A;  4A0Z A;  3RKX A;  4L0Z B;  1YW9 A;  2VQL A;  2WWY A;  3EQL F;  2BW3 B;  2VBY A;  4ESB A;  1MBE A;  5AIP A;  1YO5 C;  3IUO A;  3TDZ C;  3K70 D;  1GUU A;  3CCU I;  4YFK F;  1XGM A;  1G4D A;  2IRF G;  3RKY A;  4QPQ A;  3SDB A;  2GIZ A;  3GZN B;  1MNM C;  3Q5F A;  4FX4 A;  5EG0 B;  3SDG A;  3MCZ A;  1T95 A;  4JYK A;  3UNG C;  3I58 A;  5J40 A;  4CIC A;  2RQQ A;  2OUM A;  1XMK A;  2Y69 H;  1S5L C;  2L9S A;  3T0Y A;  1ZRE A;  2HKX A;  1DDN A;  1OIS A;  2VOD A;  4JBA A;  2CV0 A;  3I54 A;  3S14 J;  2V4J C;  1X1C A;  3S1R J;  4XSZ F;  3LSG A;  2E2I J;  5J8F A;  1KU7 A;  1CQT A;  1BOA A;  1TT0 A;  3BWG A;  3FX3 A;  3CCQ I;  3RZO J;  4GXO A;  5JHF A;  1CF7 A;  4YII A;  3IH3 A;  2KFD A;  1XPX A;  2MC3 A;  2DT7 B;  1DP7 P;  1B72 A;  1U8R A;  1X19 A;  4A3K J;  5J6X A;  2E1C A;  2K9N A;  4BBS J;  5E3O A;  1LDD A;  2WY7 Q;  2OZ6 A;  1STZ A;  2QQ9 A;  1FSE A;  3LWF A;  1USS A;  5FKO A;  4BXU A;  1QU3 A;  4HX7 A;  2ZXH A;  4CHU A;  1BN5 A;  4RLQ A;  4RB3 C;  2AQE A;  3MKY B;  3TL4 X;  4P5O A;  3F21 A;  1P7J A;  3S2D J;  1OCZ H;  1E3H A;  4XLA A;  4ZYD A;  3OV8 A;  4E7Z A;  1QHG A;  2QKM B;  4FE4 A;  2M30 A;  4NDL A;  1T08 B;  1D0Z A;  2IBD A;  5BNG A;  3U21 A;  2M9H A;  4HX4 A;  3FHZ A;  3CLO A;  2FOK A;  3WTT C;  4KFC A;  2PEX A;  2E7W A;  1ETX A;  5KVR A;  2EB7 A;  4IPA A;  4AYB A;  3ZQH A;  3MKW B;  1Z9C A;  2NS8 A;  4PJ0 C;  5FGM A;  1R58 A;  1BM9 A;  2OAZ A;  3O6B B;  5FFZ A;  2K7L A;  4OMZ A;  5IYC J;  3F8C A;  3FIW A;  5F04 A;  5BQT A;  2RN7 A;  1MZB A;  4NBQ A;  2PFB A;  3EET A;  5H20 A;  1ZHF A;  2E36 A;  3IWF A;  4B3X A;  4YIF A;  1SVL A;  5ERI A;  4BXX J;  3PFI A;  1QPM A;  4P9F A;  5IP7 J;  5K7Z A;  3GTG J;  3E5U A;  4MTE A;  3BR2 A;  4EAT A;  1FYK A;  2CGP A;  2RV8 A;  5CVU A;  5E79 C;  1FTT A;  4DOZ A;  5D8K B;  1FYM A;  2KHM A;  3F6V A;  3L2U A;  2ZJQ F;  3B6C A;  4UUV A;  1GVD A;  4M6V A;  1F4K A;  2H6C A;  1JT6 A;  4C2M J;  1KQ0 A;  2OQG A;  1ERD A;  5DDG A;  3ZMU A;  1ONV A;  4ENK A;  3HSF A;  3F0C A;  3I9V 2;  3CUQ B;  1ZQ3 P;  5DCM B;  3K0L A;  1KA8 A;  2LRD A;  2B7E A;  2VC1 A;  1M1E B;  1Y8R B;  4IF4 A;  5D4S A;  3JSO A;  1I6H J;  3L7W A;  4KT6 A;  4X0G A;  1G2H A;  2L7F P;  4G8X A;  2DU9 A;  1ETW A;  1X2M A;  2DTR A;  2HQA A;  4E7J A;  2HPM A;  1XDU A;  2KJB A;  1WVR A;  2PMU A;  4DJA A;  2XPW A;  3F3X A;  3C1D A;  5KK1 A;  3NQO A;  3K1P A;  2LC2 A;  1MMD A;  5D4R A;  3F23 A;  4D5C A;  2HOS A;  2L9R A;  1FMV A;  2ZXW H;  3BG6 A;  4ZYA A;  2FQ3 A;  4IRH A;  3S3N A;  4QWQ A;  2PBI A;  3HOS A;  2Z5U A;  1ZTR A;  1HBX G;  3WTU C;  1BI0 A;  2W48 A;  5JVG F;  2K85 A;  2K86 A;  4Y15 A;  3HIF A;  1Z7L A;  1BW5 A;  2A5Y B;  3TED A;  2ELH A;  2HTS A;  5F0F A;  3H5R A;  4EM1 A;  2QGU A;  4IRI A;  4KT5 C;  4EMS A;  3N05 A;  4E7I A;  3ESW B;  3SZP A;  2ZKZ A;  4D5F A;  4XSX F;  1MND A;  1EF4 A;  5GAG J;  4AM3 A;  4MLO A;  2NOJ B;  3E97 A;  3HSE A;  2LY1 A;  4LG0 A;  5FKM A;  2X1D A;  4M3F A;  3WU0 A;  1I27 A;  2L3D A;  4BBR J;  4U0W A;  3TBI A;  2M8G X;  4EM2 A;  2DA2 A;  3GLL A;  1W5S A;  2LKX A;  2QQ8 A;  3E3V A;  2JA2 A;  2ELK A;  1JTX A;  3K4M A;  5LHI A;  5C4X J;  4Q4Z F;  1KZH A;  3Q9V A;  4BHP A;  3WG7 H;  2A5W A;  3ML6 A;  3SJM A;  4DYC A;  2NNN A;  1VFC A;  5H6R A;  4M71 A;  3TO7 A;  3CO6 C;  4HEA 2;  2XHK A;  4HF1 A;  1X4O A;  3G3Z A;  4XMY A;  3OYM A;  1LUJ B;  2BY3 A;  2DFF A;  4I76 A;  4BDY A;  2Y30 A;  1QRY A;  4M9S A;  5E17 F;  3SFI A;  3VSK A;  2CO5 A;  4DYR A;  2DA3 A;  3EUA A;  1OPC A;  5FLX Z;  1YLF A;  2OCE A;  3BG3 A;  3FXM A;  3H9J A;  4AID A;  5F1J A;  1S3J A;  2P81 A;  3DPL C;  4XOR A;  1JJ8 C;  4GRI A;  1FSH A;  1JKQ C;  5IPA A;  1W36 C;  2D2W A;  4AU7 A;  3HKZ A;  5ICF A;  2Y48 A;  3E5X A;  2PG4 A;  3MN2 A;  2XGE A;  3ZQQ A;  4UUT A;  4Q5S F;  3KYD B;  4E4H A;  3ULQ B;  3QPT A;  4EJO A;  2HQN A;  3P9I A;  2UUZ A;  4U0Y A;  5E3M A;  2E60 A;  3HJE A;  3JCU C;  5F0H A;  4KA4 A;  2MBF A;  4TV7 A;  5J1U A;  3RJP A;  5LGU A;  1DUX C;  5FRM A;  4II2 A;  3DBR B;  1K78 A;  3K4N A;  3QOE A;  2XC7 A;  1VQ6 I;  1T0F A;  2V7F A;  3A01 A;  1AKH A;  3DTE A;  3CLQ A;  4XRS G;  1BL0 A;  2Y31 A;  1OR7 C;  4M6X A;  3GXO A;  5EZG A;  1JXS A;  4MFE A;  2ID6 A;  3HHG A;  3OSF A;  1XMX A;  1R71 A;  4Y17 A;  2DYR H;  2EK5 A;  2UXN A;  4A93 J;  4A0Y A;  2BVM A;  4XLH A;  2R3S A;  1Z3Y A;  1KGS A;  4LIV A;  4CZZ A;  1ZLK A;  3CP2 A;  1ZR4 A;  1CGP A;  4ESJ A;  3C2G A;  2DOD A;  5HNF A;  3QPS A;  3BTC A;  1HKS A;  1K4S A;  3K4L A;  3L2C A;  3AAF A;  3KP3 A;  1XSD A;  1YJW I;  4A5N A;  2W24 A;  2F5C A;  2J5P A;  4B8X A;  1MBK A;  1LKX A;  1RZ4 A;  1RKT A;  3KP4 A;  4G6Q A;  3H36 A;  2L02 A;  1VI0 A;  1G3T A;  1G3Y A;  4XLP F;  3KX2 A;  3TKY A;  1D0X A;  3VYU B;  4C9Y A;  1I50 J;  2JSP A;  3RPQ A;  2NYX A;  3ZQL A;  1A31 A;  3NAU A;  2GOM A;  3CDL A;  1XGO A;  1SVO A;  2DO7 A;  4DGW B;  4NHJ A;  2JMW A;  1FYL A;  3I59 A;  4L5J A;  3SYT A;  1EJ9 A;  2WAD A;  3BDD A;  4X6A J;  3I4N J;  4XLE A;  3JRC A;  4E7H A;  3I64 A;  1L0O C;  4RLF A;  2MD0 A;  2DTZ A;  4IOA F;  3KZI C;  2CV1 A;  4QTR A;  4ZTJ A;  3JRF A;  2ESN A;  4IOC F;  2E1O A;  2XAH A;  3TP0 A;  5GPC A;  3HBL A;  3ERE D;  1IC8 A;  5CQG A;  3RKQ A;  3QAH A;  5HS9 A;  2Q8K A;  5EEA A;  3IV5 A;  2VKV A;  2OTJ I;  2FU4 A;  1IN5 A;  3QQA A;  3BG9 A;  3H0D A;  1V4R A;  2ICW G;  4G12 A;  2IPQ X;  1BJZ A;  4KMU X;  3CUQ A;  3FKI J;  2ELJ A;  1J9I A;  3EUH C;  1S72 I;  2DK8 A;  3BJ6 A;  1TNS A;  5GP9 A;  3HEF A;  1I6X A;  4IXA A;  2FOW A;  2XB5 A;  1ON1 A;  2BVL A;  4F92 B;  2W84 A;  4AIJ A;  2K9L A;  2E1M B;  3V4G A;  1Y39 A;  4G6D A;  1JT0 A;  4HYE A;  5J4Y A;  4HNU A;  3S3M A;  3AL0 B;  4F3Q A;  4B09 A;  1PVE A;  2CUZ A;  1WGX A;  3P7N A;  3K10 A;  1I5Z A;  3LMM A;  5CQE A;  4M72 A;  2VL8 A;  2WC2 A;  3DV8 A;  4L9N A;  1O7F A;  4UVA A;  5E3N A;  3IH2 A;  3ABK H;  3GTL J;  2JPB A;  1R22 A;  1QZZ A;  3HUG B;  3IL2 A;  1H8A C;  1X4P A;  4MEY F;  3E6B A;  5CLS A;  3LSR A;  4GYG A;  4XR6 A;  2HKO A;  1LFU P;  3AG4 H;  4WXC A;  2O5R A;  1T98 A;  3ZN1 A;  5D5U B;  3UR3 C;  3RPU D;  2LH9 A;  9ANT A;  1N25 A;  2KLO A;  4Q48 A;  3R4K A;  2I10 A;  2CMP A;  2UZK A;  2R5Y A;  2W25 A;  1DP3 A;  2Q2E A;  2VBX A;  3I59 B;  4YG2 F;  4K2E A;  1O4X A;  2FSW A;  3ZRG A;  1FP1 D;  3OS1 A;  3WTV C;  3HSR A;  3TW7 A;  5HNH A;  1JKR C;  1U5T B;  4B1R A;  1KQ8 A;  2XAG A;  2L2O A;  3QP6 A;  4E7S A;  1LE8 A;  3GW2 A;  1ZG1 A;  1YS7 A;  2RC4 A;  4ZTF A;  4E7L A;  3LA3 A;  4CYC A;  2R93 J;  4XOT A;  1XGN A;  2KDZ A;  2V6C A;  3TP3 A;  2VKE A;  4J19 A;  2DMP A;  3PFY A;  5KCM A;  1Z0X A;  3K6G A;  3KEQ A;  2VKH A;  1ZRD A;  2QBY A;  3PNV A;  4BQQ A;  2E1M C;  2KRF A;  1ORK A;  2CQQ A;  2MW8 A;  2ZC2 A;  4M74 A;  1K6O A;  1JTY A;  3CD6 I;  2MA3 A;  3BTL A;  3E1S A;  3EUH A;  2WA0 A;  4BAC A;  1K4T A;  2H8W A;  2ISY A;  1ZGJ A;  2PN6 A;  1DGW Y;  3KZZ A;  1I3A A;  1OQY A;  3K69 A;  3VB2 A;  4A3M J;  3OYN A;  2WB1 A;  4V2G A;  3CCL I;  3GTM J;  5F27 A;  4D0P A;  2PI0 A;  5FRN A;  4RMN A;  1FNN A;  2MLG A;  3WTS C;  2BY2 A;  2A68 F;  3JW4 A;  2XGX A;  4RB2 C;  4M73 A;  1FBU A;  3WU1 B;  2R5Y B;  4A3E J;  2VOO A;  2DFE A;  3LSK A;  3HOT A;  3G1L A;  1FIP A;  5HLH A;  2H27 A;  3W6V A;  5DYM A;  3GO5 A;  3HUG A;  3FKJ A;  5JLX A;  2LY2 A;  2R7R A;  2DPU A;  1ETO A;  2Y9Z A;  5E1Z B;  1X1A A;  1D1A A;  2DK5 A;  3CJN A;  4XN3 A;  2HNH A;  3V7C A;  2LBF A;  3JRB A;  3DTI A;  1H88 C;  4U87 A;  3TW6 A;  4A3G J;  3FMS A;  5DUI A;  1RRJ A;  2OCC H;  1TNT A;  2O61 A;  1JE8 A;  5D8L B;  1IGN A;  2R0Q C;  3WHC A;  3ECO A;  4DZP A;  2QVO A;  4YEJ A;  3FXL A;  4ZYH A;  3ONQ A;  2IAI A;  4FIS A;  5E8G A;  1BW6 A;  2F5F A;  3MKL A;  2VI6 A;  2XKP A;  4RGU A;  3WTX C;  5FLV A;  3CCM I;  2QQB A;  3OYB A;  3DWL E;  1P4X A;  1HA8 A;  1KQ9 A;  3VPR A;  3WGI A;  4PJM A;  1F1Z A;  4KIG A;  3W2W A;  4M3B A;  1WSU A;  4NQW B;  1AA7 A;  2EFP A;  5J1Y A;  1CF7 B;  1DGR M;  1KU9 A;  2L5Q A;  1U8B A;  2ZFU A;  1U3E M;  2PJR B;  2DBB A;  3RI4 A;  3ABT A;  3MKZ A;  2Y0M A;  2DDB A;  5GAE J;  3CJQ B;  4X1E A;  1B9N A;  2WV1 A;  4RB1 A;  2BEO A;  2ACJ A;  4IHS A;  3PO2 J;  4BGD A;  2OU2 A;  2R92 J;  2CRG A;  2E71 A;  2W4S A;  1R1U A;  3G71 I;  2R7O A;  3CJR B;  1QHH D;  2WAF A;  4GYI A;  1P2F A;  5C44 J;  1HLV A;  3BCB A;  4YRV A;  2A05 A;  1VQL I;  2VB6 A;  5ICE A;  5K5Q A;  3QP5 A;  2NVX J;  1Z77 A;  3BQZ A;  1BJA A;  1FTZ A;  2H94 A;  1WKM A;  3GYH X;  3WU2 C;  4N4O B;  1JI8 A;  3Q3S A;  5FRO A;  1GXP A;  1VQN I;  4BJT A;  4YFX F;  1F9N A;  1HKQ A;  1TP4 A;  2J5O A;  2X1E A;  1R36 A;  3BP8 A;  3LSJ A;  2IS1 A;  5GPA A;  4MNU A;  1Y0U A;  4O6J A;  3LSM A;  4H4K C;  4BY1 J;  4EGZ A;  1R6R A;  1IV6 A;  1BC7 C;  4A0X A;  3TDU C;  5ILU A;  2HVS A;  4B44 A;  3VDX A;  4ENJ A;  2FF4 A;  3F22 A;  1GLN A;  1WJA A;  2OPT A;  1SAU A;  4FHT A;  2HGC A;  3CQZ J;  1IXC A;  4Y7N J;  4HNT A;  2DA1 A;  4PJJ A;  3MVP A;  4XRF A;  2CWE A;  4I02 A;  3A03 A;  2XAJ A;  4C3J J;  2X51 A;  2BE5 F;  1MD0 A;  3QU3 A;  3FM5 A;  1JJ6 C;  4IHT A;  2ZBK A;  2FNA A;  3NAR A;  1I1G A;  2VUM J;  2Z16 A;  1T0F C;  3S1Q J;  4KUM A;  2IT0 A;  4H0E A;  3OL3 A;  4ETS A;  1V5E A;  2EJR A;  2HTJ A;  2E19 A;  2M45 A;  1OCT C;  3K4B A;  1LDK B;  2Q0O A;  1IDY A;  2HOA A;  5FKK A;  4HQE A;  1JUM A;  2R7U A;  3J7A Y;  3CDI A;  1OMI A;  5HOD A;  2CQ7 A;  2JN6 A;  2IA0 A;  4LGW A;  2EQR A;  3GEZ A;  2IS2 A;  2EV6 A;  5CVI A;  3RPU A;  2BW3 A;  1Y1V J;  2LRE A;  1YHQ I;  2Y0S N;  2R7F A;  1MJB A;  1JHF A;  3EYY A;  4WX9 A;  4UUS B;  2EA2 A;  2F4O B;  5LEJ A;  3KP5 A;  2O9L A;  3SZG A;  3BR3 A;  3GF2 A;  2CU7 A;  1RC9 A;  2QLZ A;  2NOG A;  2EV5 A;  5M5X J;  5L3G A;  2E34 A;  1Y0N A;  5CKT A;  2IA1 A;  2ZFW A;  2MFZ A;  4MEX F;  3QYB A;  1WJD A;  3OR1 C;  1R49 A;  1HW1 A;  1TWA J;  1YTY A;  3PQJ A;  3VSL A;  2M5W A;  4ZDP A;  2M1B A;  3A2K A;  3C7J A;  1XS9 A;  2IJL A;  2KPM A;  5LRR A;  5FLM J;  2HYF A;  4IKF A;  3V7S A;  2MH9 A;  1EH8 A;  3ABU A;  1IF1 A;  3TGN A;  2V9P A;  4UUS A;  1SD5 A;  4A12 A;  5DCM A;  4OIP F;  3CC2 I;  3M1C A;  5M3F J;  3F8B A;  1UFM A;  3HZJ A;  3RIR A;  4UHT A;  4XKC A;  2XVC A;  2FRH A;  2HQR A;  3NWT A;  3IRQ A;  4HSR A;  3H9G A;  5K5O A;  3ZPL A;  3QYE A;  4AIK A;  4F55 A;  1G8X A;  1R4N B;  2F5E A;  2HFH A;  4EEF G;  4P9U A;  4J00 A;  4HF2 A;  4KNY A;  1N78 A;  3BTJ A;  2JRM A;  3GCM A;  3GUD A;  1IRZ A;  2E5Z A;  3FWE A;  2L7M P;  3KP7 A;  3I4P A;  4BU2 A;  1H0M A;  4L9V A;  1P92 A;  4A6D A;  4IO9 F;  3H3V K;  3TO6 A;  3IC7 A;  2DT5 A;  1IJW C;  1S29 A;  3P9K A;  3PIP F;  1YW8 A;  5FJ8 J;  2ETH A;  2XV4 S;  2XAQ A;  3BG7 A;  2CQN A;  2IEK A;  2JA5 J;  2FBK A;  4D7M A;  2JA6 J;  1NTC A;  5HVQ C;  1YW7 A;  1TW2 A;  2M4G A;  2W7N A;  1ON2 A;  4XKV A;  1SMY F;  2DN0 A;  3L00 A;  3WHB A;  2DYS H;  1Z05 A;  3J81 K;  2QKL B;  1OYY A;  2M34 A;  4XLC A;  3GZ6 A;  2VOP A;  3KP2 A;  1YYV A;  1X1D A;  5FFX A;  2O8X A;  5F6F A;  2GXA A;  2VQC A;  5E1W A;  2JWT A;  1RES A;  1IN6 A;  5LEK A;  2EPF A;  4I01 A;  1NK2 P;  3S15 J;  3QOP A;  2FEZ A;  1PUF B;  3GBG A;  2ZME C;  4LFU A;  3ROU A;  1BIB A;  3N97 A;  4M3G A;  1IXS B;  1EKE A;  4L5I A;  3OYH A;  3QRF F;  5DUK A;  2GA2 A;  1HSJ A;  3G73 A;  3BY6 A;  3FIS A;  2GWR A;  3FMQ A;  4KIT B;  4ON0 A;  3B73 A;  5DTD A;  3BLY A;  2JT1 A;  1O7L A;  4PK4 A;  5L3D A;  2MC4 A;  2LTP A;  5AON A;  2DA7 A;  1IDZ A;  3M8E A;  2XF7 A;  2OV7 A;  2ZCW A;  1X3U A;  2BOL A;  1MSE C;  2OTL I;  1IRF A;  4XIC A;  1T39 A;  3F72 A;  4I0B A;  1TQP A;  3BOQ A;  4NC6 A;  1W7P A;  2V26 A;  4PGG A;  2KDO A;  2XPV A;  3C2H A;  4XK4 A;  4XOP A;  4KMF A;  1TQI A;  4HF0 A;  3TQN A;  4HW0 A;  4L5E A;  5DD4 A;  4OIN F;  2Y9Y A;  1XDS A;  2VIX A;  2CJJ A;  2HXO A;  1R1V A;  2ID3 A;  1B8I B;  3ZXS A;  3BC8 A;  3HPG A;  1BIA A;  2FNP A;  3SEQ A;  4HQM A;  3J7A O;  2JK3 A;  1REP C;  4L18 B;  1HF0 A;  4FTH A;  2OC6 A;  1DPU A;  1H9G A;  2QSG X;  1Z7U A;  3ZMV A;  3FXJ A;  3CCE I;  3V8J A;  2O0Y A;  3HKZ N;  3S17 J;  3JR9 A;  2DLL A;  3WGG A;  2R7X A;  4M3E A;  1KON A;  4I09 A;  3GFI A;  2OD5 A;  3FXK A;  3NRV A;  2HZT A;  2FJ1 A;  2EFW A;  5D5X B;  3CMY A;  2NVU B;  3PNT A;  1UCR A;  4NB5 A;  5FB2 A;  4WWC A;  2R7T A;  4BQO A;  1FMW A;  1ZGW A;  5EYR A;  4QIW N;  1X1P A;  2H09 A;  1VQO I;  2VXD A;  1D5Y A;  3DP7 A;  1VZ0 A;  3TOB A;  2ECB A;  4QLC U;  2OA4 A;  1MMG A;  3ELK A;  4AWX B;  2KIS A;  5J47 A;  2LD5 A;  1ZGA A;  2XDV A;  3O8H A;  3BPV A;  2OZU A;  4LIT A;  1FP2 A;  4LK1 F;  1OKR A;  3FBN B;  4IHV A;  3E7L A;  1HC8 A;  3MZH A;  3VYR B;  4MHG A;  3S16 J;  1VQP I;  5KNL A;  3RZD J;  2Z1D A;  2ZME B;  1K83 J;  5CVV A;  4WCG A;  1MH3 A;  3S93 A;  3IWZ A;  4CXF A;  2X1C A;  3H1C A;  2JZY A;  1MJA A;  5D5V B;  3GTO J;  3OIO A;  5HDG A;  3IP4 B;  4CCL A;  2H1K A;  1D8J A;  2L9N A;  4HPQ A;  4HV5 A;  4MO7 A;  3BZ6 A;  4I98 B;  1K79 A;  4J01 A;  3SQN A;  4EVI A;  4EQQ A;  2YU3 A;  3V42 A;  3ZQ7 A;  4II3 A;  4EJV A;  4B48 A;  3H92 A;  3KE2 A;  2VT3 A;  3RYP A;  1EH6 A;  2Y0S A;  3OYG A;  4L9J A;  3AKZ A;  2OBP A;  2YPR A;  2LP0 A;  1R00 A;  1MDM A;  2FML A;  3FXQ A;  5ILS A;  3A4C A;  1SFK A;  4M9Z A;  5EDN A;  1ZRF A;  3K4C A;  4XKB A;  1J09 A;  1QQI A;  3K7A J;  5BOX A;  3WTY C;  2YX4 A;  1OYW A;  4DQ2 A;  2F6C A;  1OR7 A;  3VWB A;  1F36 A;  4AYB N;  3TMO A;  4XQF A;  1WRJ A;  1TWC J;  3PSF A;  4ASN A;  3G4S I;  1R5G A;  2GA1 A;  3OYI A;  2DFH A;  1RI7 A;  4XN0 A;  1S6L A;  1D8K A;  5HDK A;  2W57 A;  1K78 B;  1R5H A;  1BA5 A;  2QEX I;  2AO9 A;  2Z9O A;  1WJB A;  3ZMZ A;  4BDZ A;  5A2Q Z;  1X3W B;  4MIM A;  4MFD A;  1D5V A;  3CCV I;  1QA6 A;  3HHH A;  3DPU A;  4HAM A;  2AHQ A;  4RS8 A;  5M3M J;  2LSO A;  2P7C B;  4IEJ A;  1ZKG A;  4GCV A;  5GTI C;  2LYC A;  1U5T C;  3DEE A;  4KN4 X;  5JI6 A;  1YS6 A;  4XID A;  3BRO A;  4HRI A;  2FA5 A;  1BI3 A;  1YJ9 I;  4Y52 J;  4ZH4 F;  2F2E A;  4R8H A;  1B6A A;  1MIJ A;  4KN7 X;  1VTN C;  3J80 Z;  2XPU A;  4RM3 A;  1RET A;  3OL4 A;  1UG0 A;  2YSR A;  3PUF A;  4XM3 A;  5IP6 A;  5EEH A;  2Z2S B;  2K3F A;  4UNO A;  4PFP A;  3G1M A;  1VND A;  3BCA A;  2ZJP F;  1GDT A;  2ZB9 A;  5IYD J;  1NH3 A;  2EIK H;  3F8F A;  5JHU A;  3A0B C;  4BJ5 C;  5EG0 A;  1Y56 A;  1OJL A;  1T38 A;  1J59 A;  1E2X A;  2XRL A;  3M8F A;  1UST A;  2NS7 A;  2F4M B;  1O3S A;  3DQV C;  5CVJ A;  4CYC B;  4XKW A;  2IS6 A;  1WWX A;  2FD5 A;  2HXI A;  1QO0 D;  2VQG A;  4HG2 A;  4LG3 A;  2W82 A;  1ODD A;  4N9H A;  1ZR2 A;  3QOD A;  3ZQI A;  2JSC A;  3H3Z A;  3H0G J;  1J7K A;  3PO3 J;  3E6C C;  2QZ8 A;  4A3L J;  5HS7 A;  2H1L A;  2TDX A;  5HOO A;  2X6W A;  1MMS A;  3PL8 A;  4GO1 A;  3W2V A;  5IT9 K;  2P6S A;  3N4M A;  2V1N A;  2BXY A;  2CFO A;  1IN8 A;  2LF7 A;  4IL6 C;  4OIQ F;  5IOY A;  5BPI A;  1L3L A;  3F8N A;  4DIQ A;  2V1U A;  4MGR A;  4R1H A;  3CME I;  3EDP A;  3CC7 I;  2MYS A;  2ZO4 A;  2AQF A;  2CUF A;  2JUC A;  4ZDO A;  1W5T A;  3DPT A;  2M3A A;  4LB6 B;  3MFK A;  3JRE A;  3LSH A;  4BE0 A;  3ZQG A;  2HDW A;  2P6T A;  2DAO A;  3DEU A;  3R0J A;  3H3U A;  2KIQ A;  2EIN H;  2KL4 A;  5FD5 A;  3V7R A;  1PJR A;  1IRG A;  3PM1 A;  4I2O A;  1KYZ A;  5L3B A;  3HDD A;  2E2J J;  3T8T A;  1W7P B;  2P8T A;  4W97 A;  2YX7 A;  3OIQ A;  2STT A;  2R7S A;  3VOD A;  4PGH A;  2E5N A;  4AIH A;  3JAM Z;  4FAS D;  3CES A;  1ZRC A;  2Z99 A;  1E3P A;  3L2V A;  1ITY A;  2LDU A;  3CDH A;  1SEU A;  1ACI A;  1K7A A;  2XSJ C;  4YIR X;  2JQ7 A;  2RNG A;  4XRS A;  4Y13 A;  3DKW A;  3PSI A;  4RAG A;  2HWV A;  1X1B A;  3PNY A;  5FKN A;  1P4A A;  1T8I A;  3JTH A;  2DDA A;  1JGS A;  3AG1 H;  1P7I A;  2DOE A;  3A0H C;  4M3D A;  1P4W A;  5HS8 A;  1TWH J;  1Z3X A;  2CFX A;  3I5U A;  2LK2 A;  4JOM A;  2ZSH B;  3HB9 A;  3M07 A;  3CCY A;  2QF7 A;  3PUB A;  1SAX A;  3QWL A;  2X0L A;  2CV2 A;  1RR7 A;  2VJI A;  4JX6 A;  2VPL A;  1HDD C;  2FMY A;  3M7G A;  2VQH A;  1XMA A;  2PJR A;  2JA8 J;  3OYC A;  4OIO F;  5TGT A;  4FX0 A;  4RBO A;  5IT3 A;  2V1X A;  1S9H A;  1UZC A;  4LD5 A;  4BHC A;  3ZQC A;  3HRU A;  4Y33 A;  1GT0 C;  3KEY A;  5EGO A;  3KZY A;  4L9T A;  3MD2 A;  1WJF A;  4ITV A;  2ZME A;  1T2K A;  2E7X A;  2O3F A;  2R7Q A;  2VON A;  5KAI C;  2X6X A;  4HLY A;  3D5R C;  1JHH A;  2Z3Y A;  1MBJ A;  1MDM B;  3FXO A;  2HPI A;  4HV6 A;  4IHX A;  3JRH A;  3IRR A;  2NXN B;  5LD2 C;  2D45 A;  1V54 H;  1RNL A;  2BHY A;  3KP6 A;  2ZJR F;  2IP2 A;  2V6E A;  3OIP A;  4DYQ A;  2HVQ A;  3FBI B;  2I5U A;  3QPL A;  1Z6T A;  1W4M A;  3IKT A;  3ZP5 A;  5M5W J;  4F91 B;  3IHU A;  1HQC A;  2O7O A;  3MZ8 A;  4P55 A;  5D5W B;  5BMZ A;  3LST A;  2K5C A;  4IRG A;  4DBQ A;  2STW A;  2R7V A;  3O2P E;  2GM4 A;  1RKW A;  4RGS A;  1WHU A;  2LKP A;  3BR0 A;  4UV9 A;  3CZ6 A;  5JR3 A;  1LVK A;  4QPO A;  2KRC A;  1IRX A;  2XGD A;  2VKD A;  1VQ5 I;  5HLT A;  3HYI A;  1FC3 A;  4O5V A;  5E20 A;  3SZT A;  1H9T A;  1UG2 A;  2WY8 Q;  1O57 A;  4CGZ A;  4DZJ A;  2CS3 A;  2IVM A;  3WTZ A;  5CYV A;  1NG6 A;  3TOA A;  1Y8Q B;  1ZLJ A;  4NUB A;  4XL9 A;  2TCT A;  4DNC A;  1B8I A;  1X3Z B;  2FE3 A;  1R7J A;  3TO9 A;  1I3Q J;  3C18 A;  2EV0 A;  2HYJ A;  2G7U A;  2VLA A;  1F43 A;  1YX3 A;  3GVA A;  1Y1W J;  1O3T A;  3S1N J;  1WFX A;  3L2R A;  5HLI A;  1S7A A;  2TRT A;  2UXX A;  3R61 A;  1O3Q A;  3Q0V A;  1B1B A;  2HVR A;  1LJ9 A;  2BXZ A;  3HC7 A;  5AIQ A;  2NS0 A;  2HEO A;  3E0J B;  3K1N A;  3DKY A;  3A1Y A;  1DU6 A;  3GFJ A;  1TW3 A;  4GDF A;  3ZMS A;  2V9K A;  3NWS A;  1YJN I;  2PMH A;  1SFE A;  5DV5 A;  1PUE E;  3LA7 A;  4A3I J;  4RGR A;  3J81 Z;  1LE8 B;  3CCR I;  1XSV A;  3KET A;  1GV2 A;  1D3Y A;  3GZ5 A;  3DLA A;  5DEQ A;  3S2W A;  3F9K A;  5ICC A;  2P5L C;  3RSN A;  2CW0 F;  2N8G A;  2PQ8 A;  5ILV A;  2OQR A;  5EF6 A;  2YS9 A;  1YFH A;  1N75 A;  4RB0 A;  3ZN0 A;  4PZJ A;  2ZNY A;  4IHY A;  3ECH A;  3KIO A;  2A61 A;  1UEL B;  1MBG A;  1OYI A;  2CW8 A;  2P0W A;  3DEW A;  3OYD A;  2HR3 A;  1A35 A;  3BR1 A;  2KRH A;  4BH9 A;  2BHZ A;  4PDK A;  4ANJ A;  2DMQ A;  1KU3 A;  2GIV A;  5B5E C;  4JX5 A;  4CYD A;  3CCS I;  2HOT A;  4Y3O A;  2JVG A;  4G94 A;  1Z1D A;  3DBL B;  4LJZ F;  1IW7 F;  1F5T A;  5DD8 A;  1HST A;  4V2F A;  2IGM A;  1W36 D;  1B9M A;  2L4A A;  3T1B A;  1FOW A;  3BQY A;  2XIG A;  2L9V A;  5EJC A;  3LAP A;  3RQ4 A;  3S8P A;  5H6Q A;  4R79 A;  2W00 A;  1IN4 A;  2W85 A;  2ADU A;  3GFL A;  3R0A A;  2Y75 A;  2VPR A;  2LMD A;  3ZQF A;  2CH0 A;  4YEL A;  5FLX K;  2DQR A;  2R7D A;  1LPQ A;  3OS0 A;  4NC7 A;  1QVU A;  2EA4 A;  2GXG A;  2KJC A;  3R6S A;  2X6Y A;  4ZDL A;  3G6E I;  1ZAO A;  3ZMD A;  2R5Z B;  4U0V A;  2JA7 J;  3ERM A;  2RRE A;  1FWZ A;  3WE2 A;  1QZE A;  2JPC A;  1ZYR F;  3BZK A;  2OJE D;  2WB1 N;  3S32 A;  3DTK A;  1UHM A;  4M6Y A;  1MNE A;  3DF8 A;  1Q1H A;  3EPZ A;  4UVC A;  3W2A A;  4JX4 A;  2DPD A;  3CJT B;  4AUX A;  3E6D A;  3OOP A;  4WXD A;  1X58 A;  3SFZ A;  1Z91 A;  4Z2Y A;  5F08 A;  4LG0 B;  2DFI A;  2ISZ A;  2K4B A;  2K27 A;  2EIM H;  4OU0 A;  2LFB A;  3KFW X;  4XLF A;  4B43 A;  1ZN2 A;  2DMU A;  1LDJ A;  1WCM J;  2A6H F;  3GLX A;  2KQR A;  4UV8 A;  1SAN A;  5ICG A;  4OMY A;  2CUJ A;  4NC8 A;  3E6M A;  3E5Q A;  1YI2 I;  2MG4 A;  2VJ4 A;  1NG7 A;  1E0E A;  1XG1 A;  1VQK I;  3O8G A;  2XGC A;  2FBI A;  1Z6R A;  2XSD C;  5LFA A;  2YU9 J;  3D5S C;  4XLN F;  3LL7 A;  3I56 I;  3U1D A;  3WE3 A;  1BI1 A;  2A69 F;  5B66 C;  3D1N I;  2L0K A;  4BXF A;  1W0U A;  1O3R A;  4AC0 A;  2L7Z A;  2KIU A;  1AU7 A;  1WPK A;  2CYY A;  4RGX A;  2LY9 A;  4PFO A;  4CDG A;  3RTR A;  1B72 B;  2FX0 A;  2DJI A;  5L3F A;  2E35 A;  1J75 A;  3AL0 C;  3KLO A;  1DQU A;  2K9S A;  3HL2 A;  1FY7 A;  1MSF C;  5E8I A;  1OLT A;  2LR8 A;  2JUG A;  1IXR C;  4PSW A;  1TTY A;  1WJC A;  2QYO A;  4C3I J;  5GTH C;  2CG4 A;  2FXA A;  1A5J A;  5K1Y A;  2D1V A;  3DBH B;  4PJN A;  1SFU A;  5DM6 F;  2O6G E;  3HTU A;  3KPH A;  4KIF A;  4I7H A;  2X48 A;  3SXY A;  3D0S A;  3BPX A;  4P1W A;  1BR4 A;  1MBH A;  5EEG A;  4NQW A;  5LRS A;  4F93 B;  1G59 A;  1FOY A;  1MMN A;  1T56 A;  2EZH A;  1SD6 A;  3CMM A;  3M1E A;  3CUO A;  3OYE A;  2D5V A;  2QSH X;  3H9Q A;  4HLX A;  3FXR A;  1BI2 A;  2NAZ A;  1Q1V A;  4C2U A;  2XRO A;  1YIJ I;  4G9Y A;  2EZI A;  3CMA I;  2WAE A;  2EBI A;  1ZAR A;  4FE7 A;  1LEA A;  5F1R A;  1V55 H;  4WK8 F;  2DA4 A;  4IVN A;  3HTS B;  1SVM A;  4CA0 A;  4FCY A;  3M3Y J;  2MD5 A;  4HOB A;  1WZ2 A;  2KIF A;  2QM3 A;  1LQ1 A;  4XRM A;  1WI3 A;  3HPH A;  3LQQ A;  5TRD A;  4HNV A;  1TZL A;  5A2Q K;  2CQX A;  4PJL A;  4XNF A;  2BY1 A;  5B1A H;  4G7H F;  1YG2 A;  1YOV B;  4BE2 A;  4ZYE A;  1FOK A;  5GAH J;  1TL8 A;  1XSX A;  4D7N A;  2LKS A;  2VAS A;  3I55 I;  4B3A A;  1HW5 A;  4BKX A;  4BQA A;  4LK0 F;  5IP9 J;  5J1R A;  4C30 A;  5EZH A;  1IO2 A;  5IOZ A;  5DCF A;  5JLW A;  1FIA A;  3K9T A;  4FT8 A;  4RAZ A;  3F6O A;  2DA5 A;  3FHN A;  1YX5 A;  1GHC A;  1QZY A;  1PDN C;  4A6E A;  2M8E A;  3F8M A;  4BJ6 C;  1QNT A;  1V5G A;  1H89 C;  2PLY A;  1SD4 A;  1MGT A;  2GBY A;  1RUN A;  1FBQ A;  5JVT A;  4C2T A;  4NNJ A;  3FM3 A;  4CCK A;  1W1W E;  2JTV A;  1JKP C;  1QBJ A;  5J3L A;  1FX7 A;  1AWC A;  2ESH A;  2ME6 A;  1I39 A;  3U9G A;  3KCC A;  2MAB A;  3RDI A;  3J7Z I;  4LLN A;  1E17 A;  2V79 A;  3EYI A;  4HZF A;  1FPQ A;  1A6I A;  1XN7 A;  1JUS A;  4BL0 B;  4IJA A;  3HOZ J;  4XBF A;  2O03 A;  3JRD A;  4OIR F;  1ETQ A;  2C6Y A;  2RVC A;  3COA C;  2DOF A;  5LGT A;  3K70 C;  3GTK J;  1IV8 A;  1A04 A;  2EFO A;  4ZZL A;  4AD9 A;  5L3E A;  1HW2 A;  2IW5 A;  3KLN A;  3QU6 A;  2IGO A;  4LIU A;  3GTQ J;  2DA6 A;  1GVJ A;  4EJW A;  4GFB A;  2DT6 A;  4S05 A;  3HM5 A;  1EA3 A;  2VJ5 A;  4HBL A;  3SHF A;  2CW7 A;  3DKX A;  3FXU A;  1HOM A;  3MEX A;  1EV7 A;  1YIT I;  1YE9 A;  1D1B A;  3OYF A;  1APL C;  5FKL A;  4RAF A;  4ESF A;  4A3J J;  3IKV A;  2H6B A;  2BZT A;  2KP6 A;  1PP7 U;  1BBY A;  2DXI A;  3RQI A;  1XC5 A;  2DI3 A;  2X85 A;  4G6T B;  3HOV J;  1OCP A;  4BUP A;  1IUY A;  2COM A;  2M87 A;  4MQV A;  2Z33 A;  3I0T A;  4A5M A;  3J7Y J;  1GV5 A;  5ED4 A;  4IQ4 A;  2K4J A;  3WG9 A;  3LSP A;  1ETY A;  4OAZ A;  1RIO H;  1U9O A;  1YIO A;  2K3P A;  2FUG 2;  1R5I D;  3JAM K;  3KEO A;  1FOX A;  3FK7 A;  4EJU A;  3M8J A;  1TT5 B;  3OR2 C;  3T5X A;  3W6J B;  4DW6 A;  4M9X A;  3X2Q H;  3FDY A;  2QSF X;  3ISP A;  5L3C A;  4E7K A;  3B6A A;  1QVT A;  3BZC A;  3IH4 A;  3WGH A;  2K9Q A;  3NEU A;  1XB4 A;  4WXH A;  3GX4 X;  4V19 K;  1W7P D;  4IX7 A;  2L4M A;  5KAF C;  4JK1 X;  3LSI A;  4LLL A;  1VQ4 I;  1RPW A;  3ABL H;  3M4O J;  1G3W A;  3FK6 A;  1G3S A;  2HU9 A;  1FT9 A;  2MSY A;  1ZK8 A;  1S7E A;  3MWM A;  2X9D A;  4U7B A;  1U78 A;  2OF7 A;  4EJT A;  3GME A;  5C3E J;  3U1K A;  4LB5 A;  3L1P A;  2XRN A;  5E1X A;  2JRT A;  2KKO A;  1E3O C;  3FF5 A;  4A3B J;  1LB2 A;  1HDP A;  2Y2Z A;  1ULY A;  2JJ7 A;  2Q2E B;  2GLO A;  2QWW A;  2G7H A;  4Z6Y A;  2D1H A;  5LHH A;  3G2B A;  1XGS A;  4ENM A;  1SFX A;  4E6K G;  1P6R A;  2ECC A;  4KDP A;  3PQK A;  4CCN A;  4I6Z A;  4D9J A;  5HDN A;  3BG5 A;  3RCO A;  1MBF A;  2QQA A;  1JUP A;  2R4G A;  1KYW A;  2QA4 I;  4HST A;  3W3C A;  3SEZ A;  3CF5 F;  2WAQ N;  3FZV A;  3B02 A;  4UXN A;  3CUQ C;  2P5K A;  2ZSI B;  2F4I A;  1U2W A;  3BT9 A;  4HDV A;  3HRT A;  3BR6 A;  4OWR B;  4BQN A;  1OCO H;  2UV1 A;  2L01 A;  3CP8 A;  3QYF A;  2L7K A;  2DOA A;  1MJ9 A;  3KYL A;  2ZNZ A;  4GGG A;  4CUG A;  2KZG A;  3IAM 2;  1UHW A;  2XUB A;  3LOC A;  4UVB A;  4P96 A;  2HQ5 A;  2MGQ A;  1BC8 C;  1XD7 A;  4B4C A;  3GFM A;  1A6Q A;  2MH2 A;  2BV6 A;  2NVY J;  4W1U A;  1YRN A;  5FD6 A;  3JSP A;  2ZXJ A;  4S04 A;  1T33 A;  3ZMT A;  4IQJ A;  2AXT C;  4A3F J;  2X4H A;  3C2B A;  5K5R A;  1ENH A;  4PCQ A;  5CVR A;  2BBY A;  2QUF A;  3ASN H;  4Y4R A;  2HZD A;  3OYJ A;  3S3O A;  4CCO A;  2DMN A;  1TLH B;  2A3S A;  2VT2 A;  4FQG A;  4D1Q A;  4N9I A;  5BPD A;  2HYG D;  2E1N A;  3OWT A;  3OSG A;  1AHD P;  1SC7 A;  1NK3 P;  3S1M J;  1BOB A;  1HXD A;  2A6T A;  1WH5 A;  3CF2 A;  5LGN A;  4A3C J;  3L09 A;  2AXL A;  3P9C A;  4BNC A;  1SFO J;  1R1T A;  4BS9 A;  2COB A;  3A02 A;  3U2R A;  1HKT A;  3HOX J;  1K61 A;  3T8R A;  1YRN B;  3DU5 A;  2DQL A;  1B59 A;  2QEN A;  1AOY A;  4ZJZ A;  1FZP B;  3I3L A;  1YQA A;  3K2A A;  4PUS A;  4BAY A;  2XAU A;  2BYV E;  4UB6 C;  1TWF J;  4IHW A;  1ZG5 A;  3BTI A;  2F5D A;  3R60 A;  1XX5 A;  2EZK A;  2KT0 A;  5D6E A;  1OCR H;  4CO8 A;  2F5V A;  3H5A A;  5F64 A;  2LOO A;  3FMR A;  1S8N A;  4A3D J;  6PAX A;  2M0C A;  4UY8 I;  2EFN A;  1MH4 A;  1U5T A;  3HXL A;  5DS9 A;  1T6S A;  1S7O A;  5LHG A;  1C0W A;  1UHS A;  4KJZ A;  3OYA A;  3BR5 A;  4EV0 A;  1PP8 F;  3C3W A;  3LFK A; 
#chains in the Genus database with same CATH homology
 2GXB A;  4KIC A;  4YFN F;  3V8L A;  4MQ9 F;  1TBX A;  3MZY A;  4EM0 B;  4ZZD A;  5FO5 A;  5E18 F;  4KYW A;  3BJA A;  4G7O F;  2MLK A;  2EFQ A;  1LEB A;  2XAF A;  4G7Z F;  1B4A A;  1SMT A;  2P7V B;  3DXJ F;  2BGC A;  2NNY A;  3HRM A;  2HOE A;  3RYR A;  4I0A A;  2PJP A;  4EGY A;  2CQK A;  5LBQ A;  4U88 A;  2GQQ A;  1FLI A;  5CJ9 A;  4ZYG A;  2RKH A;  2G9W A;  1ZG3 A;  2A07 F;  5TJJ A;  4BYY A;  3CTA A;  5HLG A;  3D5L A;  4HX8 A;  2VC0 A;  4KIB A;  3CO7 C;  1TQM A;  1IZ1 A;  2LNB A;  5LLQ A;  1MKM A;  3V8K A;  3LA2 A;  2HS5 A;  2A6E F;  4LMY A;  2VBW A;  2IA2 A;  2GAU A;  2L54 A;  1J2X A;  2RNJ A;  4LLG F;  2WV0 A;  1WQ2 A;  3LAJ A;  1J5Y A;  2ZJ2 A;  1ZH5 A;  1LNW A;  5BS6 A;  4U7D A;  4A2U A;  2VE9 A;  3BJO A;  2RQP A;  1IAW A;  3Q9S A;  2XAS A;  4F7Z A;  3GWZ A;  3QPH A;  4Q47 A;  1U6G A;  4BHB A;  4N0B A;  3RKW A;  1G6N A;  1V3F A;  2LF8 A;  1DPR A;  3O3K A;  2RDP A;  3VOE A;  4WF2 A;  3DFG A;  3REO A;  1XCB A;  2NRA C;  4O3M A;  1NHA A;  3I71 A;  4HDU A;  1XCV A;  3VFZ A;  2VBZ A;  3L9F A;  3WOD F;  2XKO A;  1J0R A;  3W6K B;  1WI9 A;  2K02 A;  2P5V A;  1EH7 A;  2VN2 A;  3MQ0 A;  4E70 A;  2GZW A;  4MTD A;  3I53 A;  1I1S A;  1KU2 A;  1FBS A;  2EWN A;  3LQR A;  3J80 K;  2UWM A;  2VE8 A;  2FBH A;  1R23 A;  2QBY B;  2VXZ A;  2YR2 A;  5J8C A;  4HA8 A;  3HRS A;  4AVP A;  2RGV A;  4RAY A;  1IN7 A;  3K1M A;  1UB9 A;  2P4W A;  2DW4 A;  4JQF A;  2V9V A;  3VEP A;  1QGP A;  4OOI A;  3JTG A;  2V1D A;  3M9A A;  1LVA A;  2AS5 F;  1SD7 A;  2B0L A;  3MAJ A;  2HDC A;  4L0Y B;  2KIM A;  1GXQ A;  3K2Z A;  2CSO A;  5D6F A;  3WTW C;  5IT9 Z;  4ENN A;  5JFR A;  1RUO A;  2WTE A;  4A0Z A;  4L0Z B;  3RKX A;  1YW9 A;  2WWY A;  3EQL F;  2VBY A;  4ESB A;  5AIP A;  1YO5 C;  3TDZ C;  4YFK F;  1XGM A;  1G4D A;  2IRF G;  3RKY A;  3Q5F A;  4FX4 A;  3MCZ A;  3I58 A;  4CIC A;  1XMK A;  3T0Y A;  1ZRE A;  2HKX A;  1DDN A;  2VOD A;  4JBA A;  3I54 A;  4XSZ F;  5J8F A;  1KU7 A;  1BOA A;  3BWG A;  3FX3 A;  4GXO A;  1CF7 A;  4YII A;  2MC3 A;  1DP7 P;  1U8R A;  5J6X A;  2E1C A;  1LDD A;  2OZ6 A;  1STZ A;  2QQ9 A;  1FSE A;  3LWF A;  1USS A;  4BXU A;  4HX7 A;  4CHU A;  1BN5 A;  4RB3 C;  4P5O A;  3F21 A;  4ZYD A;  3OV8 A;  2M30 A;  4HX4 A;  3FHZ A;  3CLO A;  2FOK A;  3WTT C;  4KFC A;  2PEX A;  2E7W A;  5KVR A;  2EB7 A;  4IPA A;  1Z9C A;  5FGM A;  1R58 A;  1BM9 A;  2OAZ A;  3O6B B;  5FFZ A;  2K7L A;  4OMZ A;  3F8C A;  5BQT A;  2RN7 A;  1MZB A;  2PFB A;  3EET A;  5H20 A;  1ZHF A;  3IWF A;  4YIF A;  5ERI A;  3PFI A;  1QPM A;  4P9F A;  3E5U A;  4MTE A;  1FYK A;  2CGP A;  2RV8 A;  5CVU A;  5D8K B;  1FYM A;  3F6V A;  4UUV A;  1F4K A;  2H6C A;  1KQ0 A;  2OQG A;  5DDG A;  3ZMU A;  1ONV A;  4ENK A;  3HSF A;  3CUQ B;  5DCM B;  3K0L A;  1KA8 A;  2VC1 A;  4IF4 A;  5D4S A;  3JSO A;  3L7W A;  4G8X A;  2DU9 A;  2DTR A;  1XDU A;  2KJB A;  2PMU A;  3F3X A;  3C1D A;  5KK1 A;  3NQO A;  3K1P A;  5D4R A;  3F23 A;  2FQ3 A;  4IRH A;  4QWQ A;  2PBI A;  3HOS A;  2Z5U A;  1HBX G;  3WTU C;  1BI0 A;  2K86 A;  4Y15 A;  3HIF A;  2A5Y B;  2ELH A;  2HTS A;  4EM1 A;  4IRI A;  4KT5 C;  4EMS A;  3SZP A;  2ZKZ A;  4XSX F;  3E97 A;  3HSE A;  4LG0 A;  3WU0 A;  1I27 A;  2L3D A;  4U0W A;  4EM2 A;  1W5S A;  3E3V A;  5LHI A;  4Q4Z F;  3Q9V A;  4BHP A;  3ML6 A;  2NNN A;  5H6R A;  4M71 A;  3TO7 A;  3CO6 C;  2XHK A;  4HF1 A;  3G3Z A;  4M9S A;  5E17 F;  2CO5 A;  5FLX Z;  1OPC A;  1YLF A;  1S3J A;  3DPL C;  1FSH A;  2D2W A;  5ICF A;  2Y48 A;  3E5X A;  2PG4 A;  4Q5S F;  3ULQ B;  3QPT A;  4EJO A;  2HQN A;  3P9I A;  4U0Y A;  4KA4 A;  2MBF A;  4TV7 A;  3RJP A;  5LGU A;  1DUX C;  1K78 A;  1T0F A;  4M6X A;  3GXO A;  1JXS A;  3HHG A;  4Y17 A;  2EK5 A;  2UXN A;  4A0Y A;  2R3S A;  4CZZ A;  1KGS A;  1ZLK A;  1CGP A;  4ESJ A;  1HKS A;  3L2C A;  3AAF A;  3KP3 A;  1XSD A;  4A5N A;  2W24 A;  2F5C A;  2J5P A;  4B8X A;  1RZ4 A;  3KP4 A;  4G6Q A;  2L02 A;  1G3T A;  1G3Y A;  4XLP F;  3TKY A;  3RPQ A;  2NYX A;  1XGO A;  2DO7 A;  4NHJ A;  1FYL A;  3I59 A;  4L5J A;  3BDD A;  3I64 A;  1L0O C;  2ESN A;  2XAH A;  3ERE D;  3QAH A;  5HS9 A;  2Q8K A;  2FU4 A;  1IN5 A;  1V4R A;  2IPQ X;  4KMU X;  3CUQ A;  1J9I A;  2DK8 A;  3BJ6 A;  1TNS A;  4IXA A;  1I6X A;  1ON1 A;  2W84 A;  4AIJ A;  3V4G A;  4G6D A;  4HYE A;  4B09 A;  3P7N A;  1I5Z A;  4M72 A;  2WC2 A;  3DV8 A;  4L9N A;  1O7F A;  4UVA A;  2JPB A;  1R22 A;  1QZZ A;  3IL2 A;  4MEY F;  3E6B A;  5CLS A;  4GYG A;  2HKO A;  4WXC A;  1T98 A;  3ZN1 A;  5D5U B;  4Q48 A;  3R4K A;  2UZK A;  2W25 A;  2Q2E A;  2VBX A;  3I59 B;  4YG2 F;  4K2E A;  2FSW A;  1FP1 D;  3WTV C;  3HSR A;  1KQ8 A;  1U5T B;  2XAG A;  3QP6 A;  3GW2 A;  1ZG1 A;  1YS7 A;  2RC4 A;  3LA3 A;  1XGN A;  2V6C A;  3KEQ A;  1ZRD A;  2QBY A;  2KRF A;  1K6O A;  4M74 A;  2MA3 A;  3EUH A;  2ISY A;  1ZGJ A;  2PN6 A;  3KZZ A;  3K69 A;  3VB2 A;  4D0P A;  2PI0 A;  1FNN A;  2MLG A;  3WTS C;  2A68 F;  3JW4 A;  2XGX A;  4RB2 C;  4M73 A;  1FBU A;  3WU1 B;  2VOO A;  3HOT A;  5HLH A;  2H27 A;  5DYM A;  3GO5 A;  3HUG A;  2DPU A;  5E1Z B;  2DK5 A;  3CJN A;  3V7C A;  3FMS A;  5DUI A;  1TNT A;  2O61 A;  1JE8 A;  5D8L B;  3ECO A;  2QVO A;  4ZYH A;  5E8G A;  2F5F A;  2XKP A;  4RGU A;  3WTX C;  2QQB A;  1P4X A;  1KQ9 A;  3WGI A;  1F1Z A;  4KIG A;  1WSU A;  2EFP A;  1CF7 B;  1KU9 A;  1U3E M;  2DBB A;  3RI4 A;  3ABT A;  2Y0M A;  1B9N A;  4RB1 A;  2ACJ A;  2BEO A;  4IHS A;  2OU2 A;  1R1U A;  4GYI A;  1P2F A;  5ICE A;  5K5Q A;  3QP5 A;  1BJA A;  2H94 A;  1WKM A;  3GYH X;  1GXP A;  4YFX F;  1F9N A;  1HKQ A;  2J5O A;  1R36 A;  3BP8 A;  4MNU A;  1Y0U A;  4O6J A;  4EGZ A;  1BC7 C;  4A0X A;  3TDU C;  5ILU A;  4ENJ A;  2FF4 A;  3F22 A;  4FHT A;  2HGC A;  1IXC A;  4XRF A;  2CWE A;  4I02 A;  2XAJ A;  2BE5 F;  1MD0 A;  3QU3 A;  3FM5 A;  4IHT A;  2ZBK A;  2FNA A;  1I1G A;  4KUM A;  2IT0 A;  4H0E A;  4ETS A;  2EJR A;  2HTJ A;  2M45 A;  1LDK B;  2Q0O A;  4HQE A;  1OMI A;  2IA0 A;  4LGW A;  3GEZ A;  2EV6 A;  5CVI A;  3RPU A;  2R7F A;  1MJB A;  1JHF A;  3EYY A;  4WX9 A;  2EA2 A;  5LEJ A;  3KP5 A;  3GF2 A;  2QLZ A;  2EV5 A;  5L3G A;  2IA1 A;  2ZFW A;  4MEX F;  1HW1 A;  1YTY A;  3PQJ A;  2M5W A;  2M1B A;  3C7J A;  2IJL A;  5LRR A;  2HYF A;  3V7S A;  2MH9 A;  1EH8 A;  3ABU A;  1IF1 A;  3TGN A;  4A12 A;  1SD5 A;  5DCM A;  4OIP F;  3F8B A;  1UFM A;  3RIR A;  4UHT A;  2XVC A;  2FRH A;  2HQR A;  3IRQ A;  5K5O A;  3ZPL A;  4AIK A;  2HFH A;  2F5E A;  4KNY A;  4P9U A;  4HF2 A;  3GUD A;  3FWE A;  3KP7 A;  3I4P A;  1H0M A;  4L9V A;  1P92 A;  4A6D A;  3TO6 A;  3IC7 A;  2DT5 A;  1S29 A;  3P9K A;  1YW8 A;  2ETH A;  2XV4 S;  2XAQ A;  2FBK A;  5HVQ C;  1YW7 A;  1TW2 A;  1ON2 A;  1SMY F;  3L00 A;  1Z05 A;  3J81 K;  1OYY A;  3GZ6 A;  2VOP A;  3KP2 A;  1YYV A;  5FFX A;  2O8X A;  5F6F A;  5E1W A;  5LEK A;  1IN6 A;  4I01 A;  3QOP A;  2FEZ A;  4LFU A;  3ROU A;  1BIB A;  3N97 A;  1IXS B;  4L5I A;  3QRF F;  5DUK A;  2GA2 A;  1HSJ A;  3G73 A;  3BY6 A;  2GWR A;  3FMQ A;  4ON0 A;  3B73 A;  2JT1 A;  1O7L A;  5L3D A;  5AON A;  3M8E A;  2ZCW A;  1X3U A;  1IRF A;  1T39 A;  3F72 A;  4I0B A;  1TQP A;  3BOQ A;  1W7P A;  4PGG A;  4KMF A;  1TQI A;  4HF0 A;  3TQN A;  4HW0 A;  5DD4 A;  4OIN F;  1XDS A;  1R1V A;  1BIA A;  2FNP A;  4HQM A;  3J7A O;  1REP C;  4L18 B;  1DPU A;  1H9G A;  1Z7U A;  3ZMV A;  3V8J A;  2O0Y A;  2DLL A;  3WGG A;  4I09 A;  3GFI A;  2OD5 A;  3NRV A;  2HZT A;  2EFW A;  5D5X B;  1UCR A;  4NB5 A;  5FB2 A;  4WWC A;  3LFK A;  2H09 A;  3DP7 A;  3TOB A;  4QLC U;  2OA4 A;  3ELK A;  4AWX B;  1ZGA A;  3BPV A;  2OZU A;  1FP2 A;  4LK1 F;  1OKR A;  3MZH A;  4MHG A;  2ZME B;  5CVV A;  4WCG A;  3IWZ A;  4CXF A;  2JZY A;  1MJA A;  5D5V B;  5HDG A;  1D8J A;  4HV5 A;  3BZ6 A;  4I98 B;  1K79 A;  3SQN A;  4EVI A;  4EQQ A;  2YU3 A;  3ZQ7 A;  4EJV A;  3H92 A;  3KE2 A;  2VT3 A;  3RYP A;  1EH6 A;  4L9J A;  2OBP A;  2YPR A;  1R00 A;  1MDM A;  2FML A;  3FXQ A;  5ILS A;  4M9Z A;  1ZRF A;  1QQI A;  5BOX A;  3WTY C;  2YX4 A;  1OYW A;  4DQ2 A;  1OR7 A;  1WRJ A;  4ASN A;  1R5G A;  2GA1 A;  1RI7 A;  1S6L A;  1D8K A;  5HDK A;  2W57 A;  1K78 B;  1R5H A;  2Z9O A;  3ZMZ A;  1D5V A;  5A2Q Z;  3HHH A;  4HAM A;  2P7C B;  4RS8 A;  2LSO A;  5JI6 A;  4GCV A;  1U5T C;  4KN4 X;  1YS6 A;  3BRO A;  2FA5 A;  1BI3 A;  4ZH4 F;  2F2E A;  4R8H A;  1B6A A;  4KN7 X;  1VTN C;  3J80 Z;  2YSR A;  5EEH A;  4UNO A;  3F8F A;  5JHU A;  1J59 A;  1T38 A;  1E2X A;  3M8F A;  1UST A;  1O3S A;  3DQV C;  5CVJ A;  1WWX A;  1QO0 D;  4N9H A;  1ODD A;  2JSC A;  3H3Z A;  1J7K A;  3E6C C;  2QZ8 A;  5HS7 A;  2TDX A;  5HOO A;  4GO1 A;  5IT9 K;  2P6S A;  3N4M A;  1IN8 A;  2LF7 A;  4OIQ F;  5BPI A;  1L3L A;  3F8N A;  2V1U A;  4MGR A;  4R1H A;  3EDP A;  2ZO4 A;  1W5T A;  3DPT A;  4LB6 B;  3MFK A;  3DEU A;  2P6T A;  2DAO A;  3R0J A;  3H3U A;  1IRG A;  5FD5 A;  3V7R A;  4I2O A;  1KYZ A;  5L3B A;  3T8T A;  1W7P B;  2P8T A;  2YX7 A;  2STT A;  3VOD A;  4PGH A;  4AIH A;  3JAM Z;  1ZRC A;  2Z99 A;  2LDU A;  3CDH A;  1K7A A;  4Y13 A;  3DKW A;  2HWV A;  1P4A A;  3JTH A;  1JGS A;  1P4W A;  5HS8 A;  2CFX A;  3I5U A;  1SAX A;  2X0L A;  2FMY A;  3M7G A;  1XMA A;  4OIO F;  4FX0 A;  5IT3 A;  2V1X A;  4LD5 A;  4BHC A;  3HRU A;  3KZY A;  4L9T A;  2ZME A;  1T2K A;  2E7X A;  2O3F A;  2VON A;  4HLY A;  1JHH A;  2Z3Y A;  1MDM B;  4HV6 A;  3IRR A;  2D45 A;  1RNL A;  3KP6 A;  2IP2 A;  1Z6T A;  1W4M A;  3IKT A;  3ZP5 A;  3IHU A;  1HQC A;  4P55 A;  5D5W B;  5BMZ A;  3LST A;  4IRG A;  2STW A;  3O2P E;  4RGS A;  2LKP A;  4UV9 A;  5JR3 A;  3HYI A;  1FC3 A;  4O5V A;  5E20 A;  3SZT A;  1H9T A;  1O57 A;  4CGZ A;  2IVM A;  3WTZ A;  5CYV A;  3TOA A;  1ZLJ A;  4DNC A;  2FE3 A;  1R7J A;  3TO9 A;  3C18 A;  2EV0 A;  2G7U A;  3GVA A;  1O3T A;  5HLI A;  1S7A A;  2UXX A;  3R61 A;  1O3Q A;  1B1B A;  1LJ9 A;  5AIQ A;  2HEO A;  2NS0 A;  3K1N A;  3GFJ A;  1TW3 A;  3ZMS A;  2PMH A;  1SFE A;  5DV5 A;  1PUE E;  3LA7 A;  4RGR A;  3J81 Z;  1XSV A;  3KET A;  3GZ5 A;  1D3Y A;  5DEQ A;  3S2W A;  5ICC A;  2P5L C;  2CW0 F;  2PQ8 A;  5ILV A;  2OQR A;  1YFH A;  4RB0 A;  3ZN0 A;  4PZJ A;  2ZNY A;  3ECH A;  2A61 A;  1OYI A;  2HR3 A;  4BH9 A;  4PDK A;  1KU3 A;  2GIV A;  4CYD A;  4G94 A;  1Z1D A;  4LJZ F;  1IW7 F;  1F5T A;  5DD8 A;  1HST A;  1B9M A;  2L4A A;  3T1B A;  2XIG A;  3LAP A;  5H6Q A;  4R79 A;  1IN4 A;  2W85 A;  2ADU A;  3GFL A;  3R0A A;  2Y75 A;  5FLX K;  2DQR A;  2R7D A;  2EA4 A;  2GXG A;  2KJC A;  3R6S A;  1ZAO A;  3ZMD A;  4U0V A;  1FWZ A;  3WE2 A;  2JPC A;  1ZYR F;  1UHM A;  4M6Y A;  4UVC A;  3DF8 A;  1Q1H A;  2DPD A;  3E6D A;  3OOP A;  4WXD A;  3SFZ A;  1Z91 A;  4Z2Y A;  4LG0 B;  2DFI A;  2ISZ A;  2K4B A;  2K27 A;  4OU0 A;  3KFW X;  1ZN2 A;  1LDJ A;  2A6H F;  3GLX A;  4UV8 A;  5ICG A;  4OMY A;  3E6M A;  3E5Q A;  2FBI A;  1Z6R A;  4XLN F;  3U1D A;  3WE3 A;  1BI1 A;  2A69 F;  1O3R A;  2KIU A;  2CYY A;  4RGX A;  4CDG A;  3RTR A;  5L3F A;  1J75 A;  3KLO A;  1FY7 A;  5E8I A;  1IXR C;  1TTY A;  2QYO A;  2CG4 A;  2FXA A;  5K1Y A;  2D1V A;  1SFU A;  2O6G E;  3HTU A;  4KIF A;  4I7H A;  3SXY A;  3D0S A;  3BPX A;  5EEG A;  4NQW A;  5LRS A;  3M1E A;  1SD6 A;  3CUO A;  4HLX A;  3FXR A;  1BI2 A;  2NAZ A;  2XRO A;  4G9Y A;  1ZAR A;  1LEA A;  5F1R A;  4WK8 F;  4IVN A;  3HTS B;  2MD5 A;  4HOB A;  2KIF A;  2QM3 A;  1LQ1 A;  3LQQ A;  5TRD A;  5A2Q K;  4G7H F;  1YG2 A;  4ZYE A;  1FOK A;  1XSX A;  1HW5 A;  4BQA A;  4LK0 F;  5DCF A;  3K9T A;  4FT8 A;  4RAZ A;  3F6O A;  1GHC A;  1QZY A;  1PDN C;  4A6E A;  2M8E A;  3F8M A;  1QNT A;  2PLY A;  1SD4 A;  1MGT A;  1RUN A;  1FBQ A;  5JVT A;  3FM3 A;  2JTV A;  1QBJ A;  1FX7 A;  1AWC A;  2ESH A;  3U9G A;  3KCC A;  3RDI A;  4LLN A;  1E17 A;  2V79 A;  3EYI A;  4HZF A;  1FPQ A;  1XN7 A;  4IJA A;  4XBF A;  2O03 A;  2C6Y A;  4OIR F;  2RVC A;  3COA C;  5LGT A;  1A04 A;  2EFO A;  4ZZL A;  4AD9 A;  5L3E A;  1HW2 A;  2IW5 A;  3KLN A;  3QU6 A;  1GVJ A;  4EJW A;  4S05 A;  3SHF A;  4HBL A;  3FXU A;  3MEX A;  1EV7 A;  4ESF A;  3IKV A;  2H6B A;  1PP7 U;  1BBY A;  2DI3 A;  1IUY A;  2COM A;  2M87 A;  4MQV A;  2Z33 A;  3I0T A;  4A5M A;  5ED4 A;  2K4J A;  3WG9 A;  1RIO H;  1YIO A;  3JAM K;  3KEO A;  4EJU A;  3T5X A;  3W6J B;  4M9X A;  3ISP A;  5L3C A;  3WGH A;  3NEU A;  1XB4 A;  4WXH A;  3GX4 X;  1W7P D;  2L4M A;  4JK1 X;  4LLL A;  1G3W A;  1G3S A;  1FT9 A;  3MWM A;  4U7B A;  1U78 A;  4EJT A;  4LB5 A;  2XRN A;  5E1X A;  2JRT A;  2KKO A;  3FF5 A;  1LB2 A;  1ULY A;  2QWW A;  2G7H A;  2D1H A;  5LHH A;  1XGS A;  4ENM A;  1SFX A;  1P6R A;  4KDP A;  3PQK A;  5HDN A;  2QQA A;  1KYW A;  3FZV A;  3B02 A;  4UXN A;  3CUQ C;  2P5K A;  1U2W A;  4HDV A;  3HRT A;  2L01 A;  1MJ9 A;  2ZNZ A;  4GGG A;  1UHW A;  2XUB A;  4UVB A;  4P96 A;  1BC8 C;  1XD7 A;  2MH2 A;  3GFM A;  2BV6 A;  5FD6 A;  3JSP A;  2ZXJ A;  4S04 A;  3ZMT A;  2X4H A;  5K5R A;  4PCQ A;  5CVR A;  2BBY A;  2QUF A;  2VT2 A;  1TLH B;  2A3S A;  4N9I A;  5BPD A;  2HYG D;  2E1N A;  1HXD A;  5LGN A;  3L09 A;  2AXL A;  3P9C A;  4BNC A;  1R1T A;  3U2R A;  1HKT A;  3T8R A;  2DQL A;  1B59 A;  2QEN A;  1AOY A;  1FZP B;  1YQA A;  4BAY A;  2BYV E;  1ZG5 A;  2F5D A;  3R60 A;  5D6E A;  4CO8 A;  5F64 A;  3FMR A;  1S8N A;  6PAX A;  2EFN A;  1U5T A;  1T6S A;  1S7O A;  5LHG A;  1C0W A;  1PP8 F;  3C3W A;  4EV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...