4EJUA

Staphylococcus epidermidis tcar full length
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
149
Chain Sequence
RRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLEKPDSNTDQRLKIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator TcaR
publication title Structural analysis of the antibiotic recognition mechanism of MarR family proteins
rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription regulator
total genus 47
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ejuA00
5L3DA 5LEJA 3P9CA 2Z3YA 2P5KA 1ZH5A 1QBJA 5HDNA 3F8NA 2LF7A 5HS9A 3DQVC 1TQIA 2BV6A 2FU4A 1TNSA 1K7AA 5CVIA 2L54A 3WTYC 4KDPA 2CG4A 3E97A 3HRUA 2PFBA 2RQPA 3QAHA 4O6JA 1IF1A 1Z7UA 2VBYA 1EH7A 4IPAA 1MKMA 3FHZA 2XASA 3T8RA 4LGWA 4P5OA 4IRIA 2ZFWA 1IAWA 2CW0F 3C18A 1H9GA 3FF5A 2A3SA 3FXQA 3GF2A 3JTHA 3WU0A 4EJTA 1S29A 2KIMA 3ZN0A 2UZKA 2RVCA 5BOXA 1BI2A 3F6OA 1BI0A 1O3QA 3BDDA 3KEQA 1REPC 2ESNA 4UUVA 3E3VA 2E1NA 2MH2A 4PCQA 2EV6A 4L18B 1LDJA 1U5TC 3H3UA 5KK1A 2HEOA 4A0YA 1ZGAA 4KA4A 1ON2A 4UHTA 2UXXA 1BBYA 5D4RA 5CVVA 4I0BA 3FXUA 3RIRA 4EV0A 4EJUA 1HW2A 1F1ZA 4IXAA 4WWCA 1XN7A 1FYKA 4U0WA 1P92A 3CTAA 1MDMA 3T1BA 2HQNA 1UHWA 2FOKA 1RIOH 1JXSA 2ACJA 4S04A 4AIJA 2K27A 5L3CA 4Y13A 3VODA 2IVMA 2Q0OA 1QGPA 3LQRA 2XVCA 1HKTA 4RB1A 4HLYA 1ZG1A 1BI3A 1OPCA 2J5PA 4KMUX 1T2KA 3I0TA 4HDVA 1HKSA 2QLZA 1B59A 1O57A 1KU3A 2XAGA 1FC3A 4TV7A 3TO9A 5TRDA 3GFLA 4I02A 2Z9OA 3KCCA 2RN7A 1DDNA 1AOYA 4CICA 3CUOA 3KP4A 1VTNC 4FX0A 3K2ZA 2QWWA 2EA2A 2PEXA 2DW4A 5ICCA 4PDKA 5ERIA 4BHCA 4GXOA 1B9MA 4D0PA 4UNOA 2EFPA 3F72A 1U5TB 3IKVA 2RC4A 3F8FA 1HBXG 2F5DA 1S7OA 5LRRA 2EB7A 3WTVC 5H6RA 3O2PE 1SFEA 5F64A 1CF7A 1FBUA 4KIGA 2Z99A 3E6DA 2H27A 4BNCA 2DO7A 5ILVA 5K5QA 3ZMTA 3L09A 3W6KB 3V7RA 5LBQA 2LKPA 1IZ1A 5IT3A 4HV5A 5HLIA 1MJ9A 1XGMA 4G8XA 1YO5C 5DV5A 1Z05A 4LB6B 4ZZLA 2E7XA 3HSRA 3TOAA 3ZMVA 3GZ5A 3MFKA 3HYIA 4Q5SF 1R7JA 2NRAC 2J5OA 1IN7A 4B09A 5H6QA 3DFGA 2JSCA 4WX9A 1R36A 4CGZA 2VBZA 4R8HA 4AVPA 4YFNF 1GXPA 4M9XA 5ICGA 1SD7A 2KIFA 2KIUA 5TJJA 1J75A 4OINF 3QU3A 3HIFA 3VEPA 1FOKA 4A2UA 3TO7A 3E5UA 5FD5A 3PQJA 3SFZA 4HQMA 3R6SA 4EJVA 2XV4S 5JI6A 5L3EA 4LJZF 2K4BA 5DCMB 5LEKA 1ZRCA 4PGHA 1P6RA 3LA2A 1G6NA 3ULQB 3ZMSA 1BOAA 1USTA 1B6AA 4KIFA 2RGVA 3ERED 3P9KA 1I1SA 1TNTA 2XIGA 2PI0A 1SD6A 3M9AA 3ZMDA 2BEOA 1T6SA 2JPCA 1MD0A 3ELKA 4U0VA 2VC1A 3DXJF 2OQGA 2A6EF 3ABTA 2L4MA 4JQFA 1JGSA 1G3SA 1PP7U 5D5UB 3QOPA 3BWGA 2VBWA 1IRGA 2VXZA 3H3ZA 1ZN2A 2K7LA 5D6EA 4BQAA 3DF8A 2M1BA 4HX7A 3FMRA 3WTTC 2IA1A 2F5CA 4YG2F 3EYYA 3N97A 2EV5A 1WQ2A 2LDUA 1U3EM 1GXQA 3F3XA 1U78A 2PBIA 1SMTA 2OQRA 1LVAA 4HW0A 2XROA 1ZRFA 2O8XA 3G3ZA 3M8EA 2GA2A 3ISPA 3GEZA 1FX7A 2IPQX 1KQ9A 1F9NA 2NAZA 1CGPA 5D8KB 1QO0D 4ESJA 4OMZA 2GQQA 3EYIA 2CWEA 2GWRA 4XSXF 3KFWX 2CYYA 3M1EA 3L2CA 5EEHA 3GFMA 3HHHA 4MTEA 4UVAA 5L3FA 2V79A 1K6OA 3IRQA 3HTSB 3VB2A 5E17F 2UWMA 1EV7A 1S6LA 5CVJA 3MZYA 2VT3A 2H6BA 2XAFA 5L3BA 5D4SA 4M9SA 4O5VA 1LNWA 4RS8A 2YR2A 3MQ0A 3ZN1A 5HS7A 1UFMA 2FEZA 3WGHA 2CFXA 2VBXA 1WWXA 1IXCA 5E8GA 1U6GA 2K02A 1G3YA 1GHCA 2RKHA 3WTSC 1IXSB 3HUGA 2DK5A 5HDKA 4HV6A 2A61A 2K4JA 2KJCA 2MLKA 1AWCA 2ETHA 1RZ4A 1U8RA 1F5TA 2M87A 4IVNA 5CLSA 3L00A 4ETSA 4EGYA 2PMHA 2FBKA 2KRFA 2PMUA 2L4AA 3P9IA 4KN7X 4I0AA 3IRRA 1ZG5A 4YIFA 3K69A 2R7FA 3FXRA 2A68F 2CQKA 1R1VA 1IN5A 4A12A 3U2RA 2F5EA 3RYRA 3HTUA 1O3RA 2EWNA 4CDGA 1K78A 3GZ6A 2ZO4A 5E1WA 3SZTA 1EH6A 2RDPA 3J81Z 5A2QZ 3R61A 3HOSA 4ESFA 2Q8KA 4BXUA 5BPIA 4R1HA 3J81K 2DPUA 4LG0A 4IRHA 5A2QK 2XRNA 2O6GE 5FFZA 5DCFA 3ECOA 1L0OC 4OIPF 2GXGA 1X3UA 2EFNA 1RUOA 1JE8A 2C6YA 1I1GA 2FMLA 2QQBA 5HVQC 2Z5UA 3HRTA 4MEXF 2Z33A 3J7AO 1I5ZA 3LAJA 3W6JB 3C3WA 2HDCA 1TQMA 2HYGD 2RNJA 4P96A 3TGNA 1B4AA 1XDSA 2QZ8A 4ENJA 2GZWA 1R23A 5CVRA 5JVTA 1LB2A 4MQVA 1ON1A 1P2FA 1H9TA 2HKXA 4KUMA 2HWVA 3KP3A 2V9VA 3CJNA 4G9YA 1FP1D 3WGIA 4YFXF 2UXNA 4HA8A 2LF8A 1CF7B 5CJ9A 3KP6A 1FY7A 3F8CA 4GO1A 3PQKA 1J9IA 4UVBA 4K2EA 1TLHB 3FWEA 5E1XA 1F4KA 4CO8A 3BOQA 3F22A 1C0WA 3TOBA 3FMSA 2NYXA 2IA2A 2L02A 2F5FA 4JK1X 3QPTA 2VOOA 1J5YA 1J2XA 5LGUA 3ECHA 3F8MA 2VN2A 4LK0F 4U88A 1LEBA 4A6EA 1YYVA 1ZLKA 5LGNA 2PG4A 3JW4A 2IA0A 2OZ6A 3QP6A 1V3FA 2KKOA 1PUEE 1FP2A 1W7PA 4G7HF 3WG9A 5AONA 4I98B 3WTWC 4HDUA 2HYFA 1PP8F 2P5LC 5DDGA 4UV9A 4Y17A 4IHSA 4YFKF 1E17A 2HTJA 3E6MA 4G94A 3CO6C 4A0ZA 5DD8A 4WF2A 4OIRF 2DT5A 3GXOA 1S3JA 2LNBA 2O3FA 2EJRA 4EMSA 2M5WA 1OR7A 3KP7A 1DP7P 1S8NA 4BHBA 1KQ0A 1J59A 3SHFA 1FBSA 2YPRA 4EJWA 4RGRA 3TO6A 3R0AA 2XAHA 1ONVA 5JR3A 1O7LA 5DUKA 3IHUA 4L5JA 2FA5A 4M6XA 3KP5A 3BJAA 4EJOA 3DEUA 2CO5A 2B0LA 1XMAA 3GFIA 4MGRA 3BZ6A 3IWZA 3JAMK 3SQNA 5HLGA 4M74A 3RKWA 3T5XA 1ZG3A 2KJBA 6PAXA 4O3MA 4HBLA 1YG2A 1L3LA 2P7VB 3PFIA 3MZHA 2ZNYA 3MWMA 1YS7A 2W57A 2ZBKA 4I01A 1QZYA 4GCVA 3J80K 4EQQA 2HQRA 5D8LB 1R58A 2FNAA 3DP7A 3HRMA 1QNTA 4RGUA 2VC0A 4EM1A 1HW1A 1QQIA 4RGXA 1SMYF 3QP5A 1G3TA 3COAC 1ZREA 4AIHA 3O3KA 4M73A 4RB2C 2QYOA 5K5OA 3N4MA 5FGMA 1XSDA 3D5LA 1XCBA 2DPDA 2P4WA 3V8LA 3I4PA 3NEUA 2FSWA 1YLFA 4KYWA 5D5XB 5BMZA 2JRTA 3GLXA 1OKRA 4HAMA 4Q48A 2MBFA 3U1DA 2YSRA 2JPBA 2H6CA 2HR3A 4FT8A 3DKWA 4I09A 4BYYA 1LJ9A 3C7JA 2YX7A 2D45A 1YW7A 4MHGA 2XAQA 3GWZA 2ZCWA 2MLGA 4GYGA 5J8FA 2FQ3A 3E5QA 1R00A 1BIAA 5KVRA 4MEYF 4I7HA 1W5TA 3Q5FA 4XRFA 5K5RA 3C1DA 3K1MA 3WTZA 2WC2A 1RUNA 3GYHX 3BPXA 1HSTA 5FD6A 2PQ8A 1FZPB 1R5HA 3RDIA 3BP8A 3EUHA 3P7NA 1I27A 1FSEA 2OAZA 3MAJA 2VT2A 4U0YA 5LRSA 3TQNA 2CSOA 5ILUA 3F21A 5LHIA 2P7CB 1R22A 2G9WA 4G6DA 4WXCA 3H92A 2V1XA 1OYWA 1SFUA 2ZMEB 1OYIA 4YIIA 1B1BA 1OYYA 5LHHA 3DV8A 2E7WA 4OIQF 3U9GA 4OMYA 3RPQA 4IF4A 2BYVE 3GX4X 3JSOA 4MQ9F 4KIBA 3GO5A 2FF4A 3I59A 5E20A 1A04A 4Z2YA 1BIBA 2XKOA 1TW3A 2XUBA 3KEOA 1BN5A 2HKOA 1YW9A 2NNYA 2DLLA 2OZUA 3KE2A 1P4AA 1WKMA 3BPVA 1K78B 4PZJA 3E6CC 3KP2A 4ZYHA 2OA4A 2QBYA 2DFIA 2W84A 1WRJA 5JFRA 1D8JA 3EDPA 2IP2A 3K0LA 4LG0B 1YS6A 5D6FA 2EA4A 2OU2A 3I53A 4Y15A 5E1ZB 3ABUA 2Q2EA 4EM2A 3BJ6A 5DCMA 3DPLC 3BROA 1Z91A 2JTVA 3KZZA 2K86A 1ZLJA 2BGCA 2QQAA 4XSZF 3RKYA 4KMFA 3HSEA 1HW5A 1ZARA 4B8XA 4N9HA 2H94A 2MC3A 5E18F 1KU2A 3WTXC 1YQAA 4M71A 1W7PD 4QWQA 2YX4A 1ZHFA 4Q4ZF 4BAYA 1UHMA 3CLOA 1IXRC 1XDUA 3Q9VA 1JHFA 5HS8A 4WK8F 2VODA 2XGXA 4M9ZA 2M30A 4ENNA 3LWFA 3RI4A 4CHUA 4KFCA 5L3GA 1ZGJA 4ZYEA 1YW8A 2EFQA 2NS0A 3LFKA 1XGNA 4LLNA 4LD5A 4HF2A 2MA3A 2WV0A 4LB5A 1Z6TA 4HYEA 2PLYA 4NHJA 4IJAA 2FBIA 1T98A 4XLNF 1XSVA 2EV0A 4AIKA 1U2WA 3K1PA 2G7UA 3ZQ7A 4S05A 3AAFA 4ENKA 3WE2A 2GXBA 3FM5A 2ADUA 2IJLA 2QQ9A 4HF1A 3GUDA 4XBFA 3V8JA 2DAOA 1LDDA 4RAZA 3K9TA 1XGSA 2HGCA 2HOEA 5D5WB 4ON0A 1ZYRF 4A5NA 3FMQA 5JHUA 5DUIA 1MDMB 4ASNA 5CVUA 1KYZA 4P9FA 4P9UA 2D1HA 2O03A 1UCRA 2F2EA 1KYWA 2D1VA 3L9FA 3R60A 5ICFA 4KNYA 4CXFA 3IKTA 3V8KA 2W85A 4NB5A 1LDKB 1XD7A 5IT9Z 1TQPA 3GW2A 4WCGA 4IHTA 4M6YA 3LA3A 1IW7F 5LGTA 3LA7A 4L5IA 1W7PB 5HDGA 1TBXA 5IT9K 4H0EA 4RB3C 4IRGA 1J0RA 1BJAA 4L0YB 3LQQA 2JZYA 1Z1DA 2MD5A 4ZYDA 1ODDA 5F6FA 4KN4X 2QENA 3ZMZA 3KLNA 3L7WA 2BBYA 3EQLF 3CUQA 1R1UA 4QLCU 1KQ8A 5DYMA 3ZP5A 4KT5C 1FWZA 2FRHA 5HOOA 2A69F 4EM0B 4ENMA 2AXLA 3MCZA 2P6SA 2L01A 4RGSA 1Z9CA 2ISZA 1FT9A 2Y75A 3I5UA 3T0YA 2GIVA 2M45A 2H09A 4U7DA 5J8CA 3WODF 4HX8A 2V1DA 3T8TA 1I6XA 2Y0MA 3K1NA 2QM3A 2V6CA 4MTDA 3RKXA 5ILSA 1BC8C 4RB0A 1SD5A 1QPMA 3NQOA 3WU1B 1T38A 5ED4A 3EETA 2X0LA 2STTA 2ZXJA 5FFXA 2OBPA 5DEQA 3BJOA 1EH8A 1T39A 2EFWA 2P8TA 2FXAA 2DI3A 1FPQA 3M7GA 2IT0A 4ZYGA 3WTUC 3I64A 1RI7A 4I2OA 2A5YB 2PJPA 2HZTA 2NNNA 2ISYA 4HX4A 3FM3A 3KLOA 2XKPA 4ZZDA 4XLPF 3CDHA 2HFHA 1NHAA 4EGZA 1IN6A 5BPDA 3RTRA 2STWA 2YU3A 2G7HA 4LMYA 1HXDA 1XSXA 2O61A 2ELHA 4A5MA 5EEGA 1Y0UA 1HQCA 4UVCA 4FHTA 3GFJA 4L9JA 3QPHA 4L9NA 1HKQA 1QZZA 5J6XA 3RYPA 4GYIA 4WXHA 3OOPA 2DTRA 2R7DA 3M8FA 4G6QA 2AS5F 1G4DA 4WXDA 3JAMZ 1TW2A 2O0YA 1W4MA 4OU0A 1H0MA 1IUYA 1Z6RA 2LSOA 2BE5F 5FO5A 2HTSA 1W5SA 2ZNZA 1E2XA 3TDZC 4A0XA 2L3DA 4EVIA 3J80Z 3FX3A 5K1YA 1UB9A 2EK5A 1BM9A 1TTYA 1MZBA 1B9NA 1YIOA 3FZVA 3HOTA 3D0SA 4HF0A 3IC7A 3KETA 3VOEA 2COMA 4KICA 4UV8A 1FYMA 3VFZA 2JT1A 2DBBA 2WTEA 3F23A 2A07F 2IW5A 4R79A 3ZPLA 2QUFA 1P4XA 3V4GA 2XHKA 2EFOA 4RAYA 2VE8A 1KU9A 1MGTA 3JSPA 1K79A 3I59B 5H20A 1ZRDA 2QVOA 3DPTA 3LSTA 2A6HF 2WWYA 4BHPA 1SFXA 4GGGA 4LLLA 4OOIA 1YFHA 3QU6A 1HSJA 5E8IA 4M72A 4L9VA 2XAJA 2W24A 2OD5A 2QBYB 3IWFA 4LK1F 1R5GA 4CYDA 1U5TA 4PGGA 2VE9A 1DPRA 2FBHA 1RNLA 3WE3A 3LAPA 1XB4A 3ML6A 4E70A 4F7ZA 1MJAA 4HQEA 2R3SA 3B73A 1FLIA 4OIOF 3F6VA 4CZZA 3E6BA 4Q47A 3V7SA 5FB2A 1J7KA 4LFUA 2TDXA 1SAXA 1ULYA 3REOA 5LHGA 2V1UA 2P6TA 2FNPA 3OV8A 5DD4A 1FSHA 1OMIA 3HSFA 4LLGF 4A6DA 1XCVA 3IL2A 1XGOA 3QRFF 5BQTA 3ROUA 3RJPA 2GAUA 4HZFA 3R0JA 4AD9A 3TDUC 1ZAOA 3E5XA 1O3TA 1MJBA 1S7AA 4ESBA 3CUQC 1IN8A 3BY6A 4UXNA 2DU9A 1R1TA 3SZPA 4ZH4F 3O6BB 2D2WA 1FNNA 1LEAA 2GA1A 3HHGA 4JBAA 3JTGA 3MEXA 1GVJA 1XMKA 5AIQA 3CO7C 1PDNC 3F8BA 4DNCA 1IRFA 1FBQA 1LQ1A 1JHHA 3I71A 2HS5A 3SXYA 5F1RA 4FX4A 3I54A 1WI9A 1IN4A 3HRSA 3ZMUA 3GVAA 4N9IA 4L0ZB 2ESHA 3NRVA 2DK8A 2FE3A 4L9TA 4MNUA 3KZYA 5LLQA 5HLHA 1DPUA 1WSUA 4NQWA 3B02A 1SD4A 2PN6A 3TKYA 5AIPA 1FYLA 4AWXB 4HLXA 1V4RA 4P55A 1Q1HA 2P5VA 3G73A 1O7FA 1KA8A 3WGGA 2E1CA 2DQRA 2VOPA 1G3WA 2W25A 2M8EA 3CUQB 4G7OF 1O3SA 1YTYA 1USSA 1KGSA 2IRFG 1DUXC 3RPUA 1BI1A 2CGPA 4HOBA 1D8KA 2RV8A 3Q9SA 2ZMEA 4U7BA 2ZJ2A 5ICEA 2X4HA 1D5VA 3I58A 5BS6A 1BC7C 3R4KA 3V7CA 2FMYA 2ZKZA 4BH9A 5FLXZ 4G7ZF 4N0BA 5D5VB 1STZA 2DQLA 2Y48A 1KU7A 5CYVA 2VONA 3S2WA 2MH9A 1P4WA 1D3YA 5FLXK 4DQ2A 1T0FA
chains in the Genus database with same CATH superfamily
5L3DA 3GCMA 5LEJA 4XLEA 2CQQA 3P9CA 4A3LJ 2Z3YA 2P5KA 2CUEA 1ZH5A 2GM4A 1QBJA 5HDNA 3PNVA 3F8NA 2LF7A 2LR8A 4BL0B 5HS9A 2YUSA 3DQVC 1TQIA 3UNGC 4Z6YA 2BV6A 2FU4A 1ETVA 1TNSA 3CF5F 2GXAA 4JX6A 1K7AA 1W1WE 3G6EI 1AA7A 1E0EA 5CVIA 2H8WA 1AHDP 2L54A 3WTYC 4KDPA 2CG4A 3E97A 1SVLA 3HRUA 2PFBA 2F4OB 2RQPA 2LD5A 2M2EA 1HDDC 1Z3XA 3QAHA 4O6JA 3W2VA 1IF1A 1Z7UA 2VBYA 2X1DA 1LFUP 1MMNA 5K7ZA 4NUBA 1EH7A 1MNDA 2P81A 4IPAA 1MKMA 4JX4A 4BEHA 2DA1A 2XASA 3FHZA 5FKLA 2CJJA 4KT6A 4IHYA 4BQNA 3T8RA 2XSJC 4LGWA 1F43A 1WGXA 1X1DA 3CP2A 3H5NA 4P5OA 4NC6A 4IRIA 2XPWA 2ZFWA 4XKBA 5B1AH 3A01B 3DEEA 1IAWA 2CW0F 3C18A 3K2AA 1H9GA 3NAUA 3H0DA 3FF5A 2A3SA 3FXQA 1RR8C 3GF2A 3JTHA 4RLQA 2PX9A 3U21A 4FCYA 2DMQA 3WU0A 4EJTA 1S29A 2KIMA 2BHZA 3BTCA 1G8XA 2V9KA 3CP8A 3ZN0A 1GVDA 2UZKA 2RVCA 1LE8A 2DA4A 4RM2A 5BOXA 1BI2A 3F6OA 4Y7NJ 1BI0A 1O3QA 3G2BA 3H0GJ 3BDDA 3KEQA 1REPC 2ESNA 4UUVA 3E3VA 2E1NA 2F4IA 2MH2A 1Z67A 4PCQA 4LIVA 2V9PA 2EV6A 2BVLA 3KYDB 2B7EA 2B63J 1BR2A 4BS9A 2OPTA 1UELB 4L18B 3BG5A 2LYCA 1LDJA 1QRYA 1U5TC 2DMPA 2KP6A 4XL9A 2BOLA 3H3UA 5H2FC 2KQRA 5KK1A 2WB1A 2EZHA 1A6IA 1OFCX 3E1SA 4MLOA 4A0YA 2HEOA 3OYIA 1ZGAA 4KA4A 1ON2A 2IS2A 1UMQA 2DA2A 2E36A 2UXXA 4UHTA 5F0HA 1BBYA 5D4RA 2KISA 5CVVA 4I0BA 3A2KA 3FXUA 4IKFA 3RIRA 4EV0A 2ECBA 4EJUA 1HW2A 1F1ZA 4IXAA 4WWCA 1XN7A 1FYKA 3ZXSA 4U0WA 1P92A 3CTAA 1MDMA 3VSLA 3T1BA 2HQNA 1UHWA 2FOKA 1TWCJ 1RIOH 2ME0A 1YI2I 1JXSA 2ACJA 4S04A 4AIJA 2K27A 5L3CA 4Y13A 3VODA 2CUFA 2VJ5A 2IVMA 3ABKH 2Q0OA 1Z3YA 4B48A 1BW6A 1QGPA 2CQNA 2M7AA 2DXIA 3LQRA 2XVCA 1HKTA 4RB1A 2X48A 4HLYA 1ZG1A 1BI3A 1I3QJ 1OPCA 2HDWA 2J5PA 4KMUX 2HPMA 1T2KA 3I0TA 5IPAA 4X6AJ 2ZJPF 2L7KA 4HDVA 1TL8A 1HKSA 2QLZA 1B59A 1O57A 2R7WA 1KU3A 3TBIA 1QVUA 3GLLA 2VPLA 2X51A 4II2A 2VQCA 3CCUI 2XAGA 1FC3A 3TP0A 3LSIA 4TV7A 3TO9A 5TRDA 2ZB9A 3GFLA 4I02A 2Z9OA 3KCCA 2RN7A 4IX7A 1DDNA 4CICA 1AOYA 3CUOA 1B8IA 3KP4A 2LBFA 1VTNC 1SANA 4FX0A 4YEJA 3K2ZA 1OCPA 2QWWA 2EA2A 2PEXA 2DW4A 1MSEC 5J1YA 5ICCA 1CQTA 1B72A 4PDKA 5ERIA 4BHCA 4GXOA 1B9MA 2TRTA 4D0PA 4UNOA 2NXNB 2IGKA 5EDNA 2EPFA 2Y9YA 2VQGA 1UHSA 1P7JA 1MNMC 2EFPA 3FKIJ 1FIAA 5M3MJ 3F72A 3S17J 3DU5A 1U5TB 5GTHC 3IKVA 4XMYA 2RC4A 3K4NA 3F8FA 2R7RA 5M5XJ 3CCMI 1BOBA 3VYTB 1D5YA 1HBXG 4RLFA 4LOCA 2F5DA 1S7OA 5LRRA 3HOYJ 2EB7A 4AUXA 3A03A 5M3FJ 3K10A 2JA5J 3WTVC 4YELA 2IS1A 5H6RA 4XOTA 1JJ8C 3O2PE 1SFEA 1MW7A 3A1YA 5F64A 1CF7A 5E3MA 2L9SA 1FBUA 4KIGA 3BR2A 2Z99A 3E6DA 3CCYA 2IGNA 5FKNA 2H27A 4BNCA 1U9NA 2HZDA 1XTAA 1JKQC 2BY0A 2DO7A 5GAGJ 2VJIA 1N75A 5ILVA 5K5QA 1R49A 1ERDA 1YJ9I 3TMOA 3ZMTA 3L09A 3W6KB 3S93A 3V7RA 5LBQA 2LKPA 4UB8C 4XM3A 2CQ7A 1IZ1A 4IEJA 5IT3A 3L2WA 1BL0A 4HV5A 5HLIA 3CJQB 3OY9A 9ANTA 1MJ9A 2CV2A 1I3AA 1XGMA 3QYEA 1KONA 4G8XA 1YO5C 2E19A 3ESWB 5DV5A 1Z05A 3K4KA 4LB6B 2R93J 4ZZLA 2E7XA 3L2RA 3HSRA 3TOAA 5CQEA 2DMUA 3ZMVA 1W0TA 3X2QH 2E35A 3GZ5A 3MFKA 3HYIA 3DBRB 4D9JA 4Q5SF 1R7JA 2NRAC 2J5OA 1IN7A 4J01A 1ACIA 4B09A 1JKPC 5H6QA 2MGQA 3HEFA 2NVUB 4UUTA 4XN0A 5GAHJ 2OJED 4KITB 3VSKA 1HDPA 3DKXA 5DS9A 3DFGA 3LSRA 2JSCA 5FKKA 4WX9A 3QQAA 1EF4A 1R36A 4CGZA 2VBZA 4R8HA 4AVPA 3ZCOA 4YFNF 2HNHA 3SYTA 1GXPA 2JWTA 3RPUD 4DYRA 4M9XA 5ICGA 1SD7A 2KIFA 2KIUA 5TJJA 3PIOF 1J75A 4OINF 3QU3A 3HIFA 1JJ6C 3VEPA 1FOKA 2BXYA 3BTIA 4A2UA 4DZPA 3TO7A 1PUFB 3PO2J 3AG3H 2R5YB 1R5ID 3FK7A 3OYFA 4D7NA 1TWAJ 2JUCA 3E5UA 5FD5A 3OYNA 2P0WA 2ZMEC 3PQJA 3SFZA 3KEYA 1OISA 3ASNH 4HQMA 1POGA 2BW3A 3BC8A 3R6SA 4EJVA 2XV4S 5JI6A 1HOMA 5L3EA 4RAFA 4RDUA 4LJZF 3TW6A 2K4BA 5DCMB 5LEKA 1ZRCA 4PGHA 3CMMA 1P6RA 1E3HA 3LA2A 4KJZA 1G6NA 3ULQB 4CCKA 3ZMSA 2JVGA 2O5RA 1BOAA 1USTA 1S9HA 3Q3SA 5JLWA 1B6AA 5M5YJ 4C2TA 2PMZN 4KIFA 2RGVA 2VL8A 1T0FC 3SDBA 3PSFA 5HNFA 1MH3A 3ERED 3P9KA 1I1SA 1TNTA 2XIGA 5FKOA 1TWHJ 1MBFA 3W3CA 2PI0A 1SD6A 3M9AA 1Z0XA 2A5WA 4BY7J 3ZMDA 2BEOA 4IO9F 1S72I 1VZ0A 2ZXIA 4NQWB 1T6SA 2DJNA 2JPCA 1MD0A 3ASOH 4XR6A 4GFBA 3FBIB 3P5JA 3ELKA 2HXIA 1LUJB 4E7LA 4U0VA 2VC1A 3GTKJ 3I56I 3DXJF 2OQGA 2A6EF 2OCEA 2L4MA 3ABTA 2CV1A 4JQFA 1JGSA 1G3SA 4A3DJ 1PP7U 5D5UB 3QOPA 4HSTA 1SAUA 3BWGA 2VBWA 1IJWC 1IRGA 2VXZA 3H3ZA 1ZN2A 2Z1DA 2K7LA 3M07A 5D6EA 1QHGA 4BQAA 3DF8A 2M1BA 2W1OA 2VI6A 3BTJA 3FMRA 3KX2A 4HX7A 5FRNA 3WTTC 4XKCA 2IA1A 4G6TB 2F5CA 5IP9J 4BE1A 1FOXA 1VNDA 1MMAA 4YG2F 3FK6A 3EYYA 2F48A 3JREA 4DBQA 5F0CA 4C2MJ 5LD2C 4BGDA 3N97A 3GMEA 4XICA 5GPAA 2L7MP 1GLNA 2EV5A 4GDFA 4M6VA 2O7OA 3FDYA 1VQ6I 1WQ2A 1APLC 4RM3A 2LP0A 4OWRB 2LDUA 1U3EM 4CA0A 1GXQA 2GBYA 3F3XA 1U78A 2JA7J 2OF7A 2PBIA 1MMDA 1RR7A 1SMTA 2OQRA 5EG0B 1LVAA 2LY9A 4HW0A 4BJ6C 2XROA 1ZRFA 2WY8Q 3PNYA 1N78A 1QZEA 2EINH 3HOWJ 3I4MJ 2O8XA 3G3ZA 3M8EA 1YE9A 2K5CA 5FROA 2GA2A 3ISPA 3GEZA 5JHFA 5J1RA 1BJZA 1ETQA 1FX7A 1YJWI 2IPQX 4BBSJ 1QHHD 2COBA 1V5EA 5K7HA 2JUGA 1KQ9A 1IV8A 1F9NA 2UV1A 5J4VA 1FOWA 2NAZA 1H89C 1CGPA 2LK2A 3PL8A 5D8KB 1QO0D 2ZC2A 4ESJA 3M3YJ 4OMZA 2GQQA 2FD5A 3EYIA 1Y8RB 2CWEA 2NS8A 4HEA2 2GWRA 2EBIA 1W5CC 3HOXJ 4XSXF 3KFWX 2VJ4A 2CYYA 3M1EA 3L2CA 5EEHA 1HLVA 3GFMA 3HHHA 4MTEA 2EH3A 4UVAA 5L3FA 2KHMA 4CCMA 2V79A 5JVGF 1K6OA 2CV0A 1SVOA 2G0EA 3IRQA 3HTSB 2XF5A 3VB2A 1VQKI 5E17F 2UWMA 2Y0SN 1EV7A 1S6LA 3HJEA 4CCLA 5CVJA 3MZYA 2VT3A 2H6BA 2XAFA 5L3BA 5D4SA 5EEAA 2VLAA 4M9SA 4H4KC 5EGOA 3OYAA 4O5VA 2JVHA 1EA3A 1LNWA 4RS8A 2ZXWH 4IQJA 2YR2A 3MQ0A 4IZZA 3ZN1A 5HS7A 3BR1A 1UFMA 4HG2A 2JJ7A 5F04A 3UR3C 1AKHA 2FEZA 3FHNA 1X19A 3WGHA 2CFXA 2VBXA 1WWXA 1S7EA 2LMDA 1IXCA 5E8GA 1LVKA 1D0XA 1U6GA 3PNTA 4Y33A 1WJFA 1K6YA 1WJBA 2K02A 3TL4X 1G3YA 3MKWB 1U0JA 1GHCA 2Y31A 1ZR4A 1VQMI 3K6GA 2RKHA 3WTSC 2CS3A 3CZ6A 1IXSB 3HUGA 3NARA 2DK5A 4E4HA 5HDKA 4HV6A 2A61A 2K4JA 2KJCA 2MLKA 3MKYB 1LE8B 1AWCA 1WH7A 5F27A 2ETHA 1V5GA 1Y6IA 1RZ4A 1U8RA 3S1NJ 5F0FA 4CYCA 2JK3A 2M0CA 3LSPA 1F5TA 2M87A 4IVNA 5CLSA 3L00A 4XORA 4ETSA 3WHBA 1PJRA 4EGYA 2V4JC 4XN3A 2PMHA 5FJ8J 2JA6J 2FBKA 1VF9A 2KRFA 2PMUA 2NVXJ 2L4AA 4JYKA 3P9IA 4KN7X 4I0AA 3BCAA 4M3FA 3IRRA 1ZG5A 2H8RA 2XB5A 4D7MA 4YIFA 1I50J 3K69A 2DMTA 2R7FA 1RKWA 2A68F 3FXRA 4XLHA 2HDDA 2CQKA 1R1VA 3JRDA 1IN5A 4A12A 3L2QA 3U2RA 2F5EA 1ETXA 2NOGA 2I8DA 3RYRA 1FMVA 3DLAA 2DMNA 2BHYA 3CDIA 3HTUA 2HVSA 1W0UA 1O3RA 2EWNA 2KMUA 4CDGA 2ZJQF 2PMZA 1K78A 3DPUA 3GZ6A 3MMYB 3OSGA 2ZO4A 5E1WA 3SZTA 1ZR2A 4P1WA 2LVSA 1EH6A 2RDPA 3J81Z 1X1PA 5A2QZ 3CCEI 3R61A 3HOSA 3GTPJ 2TCTA 2ELJA 4ESFA 1RKTA 2Q8KA 4BXUA 5GADJ 3S1RJ 5BPIA 2CU7A 3BQYA 4HNUA 2OCCH 2OV7A 4R1HA 3J81K 2DPUA 3QODA 4LG0A 4IRHA 4MIMA 5A2QK 2KZVA 2XRNA 4ZYAA 2O6GE 3W6VA 1X2MA 5FFZA 5DCFA 1LPQA 3ECOA 1L0OC 4OIPF 2GXGA 3Q0VA 1X3UA 2EFNA 1SVMA 1RUOA 3D5SC 4B1RA 3CMEI 1JE8A 2C6YA 2M4GA 1I1GA 2FMLA 4PJ0C 4UB6C 2QQBA 5HVQC 5FRMA 3MKZA 2Z5UA 3HRTA 2MG4A 4B4CA 2W00A 1OCZH 2BY2A 4MEXF 2Z33A 3J7AO 1I5ZA 3LAJA 3W6JB 4XKWA 5DTDA 2XGCA 2CUJA 3C3WA 3HL2A 2HDCA 2L7ZA 3OOUA 1TQMA 1WCMJ 2HYGD 2RNJA 1B8IB 4P96A 3CD6I 2HYJA 2EIJH 5HODA 3TGNA 1G2HA 1B4AA 1XDSA 3CC7I 3QPSA 1ETYA 2M8GX 2QZ8A 4DYCA 2W7NA 4ENJA 2GZWA 1B72B 2HVRA 1R23A 1R4NB 4F55A 5GAEJ 2L0KA 2WAQN 2WAEA 4XRMA 5CVRA 2MD0A 5JVTA 3IH4A 3HOVJ 1LB2A 4MQVA 1ON1A 1P2FA 1XPXA 1H9TA 2MSYA 3SZGA 3OL4A 2HKXA 2I5UA 3JRGA 4X1EA 2VQLA 4KUMA 1ORKA 2DODA 3HZJA 4B47A 2HWVA 3QOEA 4HSRA 2CMPA 2VPRA 3KP3A 4BJ5C 3OYJA 2V9VA 1R4MB 4XONA 3CJNA 3QYFA 4G9YA 1FP1D 3WGIA 1NK3P 2PJRA 5CQGA 1K83J 4YFXF 5B5EC 2UXNA 3IAM2 1W36C 2QKLB 4HA8A 1VQ5I 2IEKA 2LF8A 1BR4A 2X1CA 4W1UA 1CF7B 5CJ9A 3KIOA 3KP6A 1FJLA 1FY7A 2JMWA 2K9NA 3F8CA 4RBOA 1MSFC 2QSGX 4GO1A 3PQKA 4E7JA 1J9IA 4PFOA 3BCBA 3MVPA 3OWTA 3RQ4A 4UVBA 1JTXA 2BZTA 1TLHB 4K2EA 3FWEA 5E1XA 4D1QA 1F4KA 4CO8A 3BOQA 5J47A 3F22A 1C0WA 1LKXA 3H1CA 1V55H 2XF6A 4OAYA 4F92B 3CCVI 3TOBA 3FMSA 2NYXA 2IA2A 5IOYA 2L02A 1ENHA 2F5FA 4JK1X 2V26A 3BZCA 1D0YA 3O8HA 4PJMA 3QPTA 2VOOA 2ZFUA 3OIOA 4BDZA 4KISA 1GT0C 1J5YA 1J2XA 3G4SI 5LGUA 3ZQLA 4II3A 3ECHA 2RNGA 3F8MA 2VN2A 2A05A 4LK0F 4U88A 1LEBA 3OYMA 3JRBA 4W97A 4A6EA 1YYVA 3M8JA 1ZLKA 3S3NA 2LRDA 1JUPA 2W48A 2M3AA 1Y56A 5LGNA 2PG4A 3JW4A 3H5RA 2IA0A 2M9HA 3ZOBA 4FASD 4F93B 5GPCA 2DDAA 2OZ6A 3QP6A 5F1JA 1V3FA 2X9DA 3IH3A 1MMSA 2KKOA 1PUEE 1FP2A 2IBDA 3BG9A 1VQPI 1W7PA 2XDVA 4G7HF 2N8GA 3SFIA 3OYDA 3WG9A 5AONA 4A3JJ 3Q0WA 1MBEA 3ABLH 4I98B 4ZDPA 1OCCH 3WTWC 1K4SA 1OQYA 3FXOA 4HDUA 2HYFA 1Z7LA 4B43A 4E6KG 1XS9A 5IYBJ 3S1MJ 3U1KA 2HQAA 2P5LC 2BY3A 5DDGA 1PP8F 3LOCA 4UV9A 1DGWY 4Y17A 4IHSA 4YFKF 2JSPA 1E17A 2HTJA 3E6MA 4G94A 3CO6C 3A01A 3DTIA 4A0ZA 2BW3B 5DD8A 4WF2A 1JTYA 4CCOA 4OIRF 1Z77A 2DT5A 1MBHA 1T08B 3GXOA 1GDTA 1S3JA 2HI3A 2LNBA 2V1NA 2VKHA 3LSMA 4AM3A 2OC6A 5TGTA 1IRZA 2O3FA 4DYQA 2EJRA 1BW5A 4EMSA 4XLCA 2M5WA 1OR7A 3PUBA 1RETA 4FISA 2XB0X 3KP7A 1DP7P 2M0MA 1NG6A 4IL6C 1S8NA 4BHBA 1KQ0A 2JA2A 1J59A 3SHFA 1FBSA 2XRLA 2E34A 2YPRA 4RGRA 4EJWA 2K85A 3TO6A 3R0AA 4PJLA 2XGEA 2V7FA 3CC2I 2XAHA 1ONVA 1NG7A 5JR3A 4UY8I 1O7LA 5DUKA 3IHUA 3JRIA 4L5JA 1HF0A 2FA5A 4M6XA 3KP5A 5KHDA 5IP6A 1YOVB 1OCTC 3BJAA 4EJOA 4BXFA 3DEUA 2CO5A 1D1AA 1XMAA 2B0LA 2R5ZA 3GFIA 3ZR8X 4MGRA 3VYUB 3BZ6A 2DCEA 3HDDA 3IWZA 3JAMK 3SQNA 5HLGA 3OR1C 3O8GA 4M74A 3RKWA 3T5XA 1D1BA 1ZG3A 2KJBA 6PAXA 4O3MA 2VUMJ 4HBLA 1ETWA 1YG2A 1MIJA 3OYBA 1L3LA 2P7VB 3PFIA 3D5RC 3MZHA 4DGWB 4BKXA 2WBMA 3F0CA 3C2BA 3S3OA 2ZNYA 4BDYA 1FTZA 2ID6A 2Q1ZB 1JKOC 3VWBA 3MWMA 4UUSA 1YS7A 2ZXHA 2W57A 2ZBKA 3GTMJ 4I01A 1QZYA 2EZIA 4GCVA 1D1CA 1SFOJ 1RC9A 3J80K 4EQQA 4PUSA 2R0QC 3N05A 2LY1A 1VQ7I 2HQRA 5D8LB 1R58A 2FNAA 2JN6A 3DP7A 3BT9A 3HRMA 4S0HB 1IGNA 1QNTA 4RGUA 1YX5A 2VC0A 4EM1A 1HW1A 1QQIA 2EIMH 4RGXA 1UG0A 1SMYF 3QP5A 2ME6A 1G3TA 3COAC 3WHCA 2DFFA 1ZREA 4AIHA 5E3LA 2VKEA 3O3KA 4BU2A 4LG3A 3FXKA 4M73A 4RB2C 3LSKA 4YRVA 5M5WJ 1VQOI 4XRSG 1WI3A 1MH4A 1AU7A 2QYOA 5K5OA 3N4MA 1OJLA 4IQ4A 5FGMA 1GV5A 1XSDA 3D5LA 4DZJA 2VKVA 3JRFA 2E60A 2DOAA 1RRJA 3HB9A 1XCBA 1ZGWA 4IHVA 2DPDA 2P4WA 3V8LA 1X4PA 3I4PA 2EZKA 3NEUA 4NBQA 1ZKGA 2FSWA 1YLFA 2NS7A 2DT7B 1VQ9I 3D1NI 4KYWA 4L5EA 2AHQA 3M4OJ 5D5XB 5BMZA 5J40A 2AQEA 3G1OA 3AG1H 3DU6A 3RZOJ 2JRTA 3QPLA 3GLXA 1OKRA 2QSFX 4HAMA 4Q48A 2MBFA 2X6XA 3U1DA 2DFHA 2YSRA 2JPBA 1YHQI 1UZCA 2W4SA 2H6CA 4FETA 2HR3A 1TT5B 2XF7A 3DKWA 4FT8A 4I09A 4QSHA 4BYYA 1LJ9A 2R7QA 4Y52J 3C7JA 4EEFG 2BY1A 2YX7A 1IO2A 2D45A 1YW7A 4MHGA 2XAQA 4BY1J 3GWZA 2ZCWA 2MLGA 4GYGA 5J8FA 2EZLA 2WAFA 4HNVA 4IHXA 1TWFJ 2FQ3A 3E5QA 1WZ2A 4M3GA 3DCFA 1DGRM 4F91B 1R00A 1HC8A 1BIAA 2HXOA 2KPMA 5KVRA 4MEYF 2K3PA 1JT0A 1X3ZB 4I7HA 4MFEA 2H1KA 2NVQJ 3HGGA 1W5TA 2XPUA 4PFPA 5GTIC 3Q5FA 2EQRA 4XRFA 2Y30A 5K5RA 2DDBA 3C1DA 5DM6F 3K1MA 3WTZA 2WC2A 2R7XA 3I55I 2BVMA 2L9VA 1RUNA 3CESA 3GYHX 3BPXA 1HSTA 2HPIA 1E3OC 5FD6A 5K7FA 2PQ8A 3IAS2 3I3LA 2L5QA 4C3HJ 1R5HA 3RDIA 1FZPB 3BP8A 3EUHA 3P7NA 1I27A 4XOPA 3HG9A 2E5NA 1FSEA 2OAZA 2CH0A 1FIPA 4IOAF 3MAJA 3DEWA 2VT2A 3DKYA 4U0YA 3J7YJ 3QYBA 5LRSA 2K3FA 3TQNA 5KAFC 2IGOA 2CSOA 2QEXI 1RPWA 1M1EB 5ILUA 3F21A 5LHIA 2P7CB 2WY7Q 2KRHA 1R22A 2G9WA 4G6DA 4WXCA 1XX5A 2R7ZJ 4I6ZA 3H92A 2V1XA 1OYWA 3K70C 2E2JJ 1SFUA 3NWSA 2ZMEB 1OYIA 4YIIA 4B3XA 1B1BA 1OYYA 4M3DA 5LHHA 3DV8A 2E7WA 4OIQF 3U9GA 4OMYA 5EZGA 2FUG2 3RPQA 1ZELA 4IF4A 4A3MJ 2BYVE 1J09A 3JSOA 3GX4X 3DTKA 2DOEA 2MC4A 1JT6A 4YIRX 4MQ9F 3S2HJ 4KIBA 4BBRJ 4CCNA 3GO5A 2FF4A 2F5VA 5KCMA 3OYKA 3I59A 4I76A 4M3BA 1A04A 5E20A 2HOTA 4Z2YA 1BIBA 2XKOA 1TW3A 2LC2A 3W2WA 2XUBA 3KEOA 1KZHA 1BN5A 2DJIA 3LSGA 3S3MA 2HKOA 2WADA 2DA5A 1YW9A 2NNYA 2DLLA 2E2HJ 2OZUA 3KE2A 1P4AA 1WKMA 3BPVA 2VQHA 3GTJJ 1K78B 3OYGA 2VXDA 2CW8A 4PZJA 3E6CC 3DTEA 2X6WA 3KP2A 1FMWA 2CRGA 1IRXA 5GP9A 4ZYHA 5IP7J 2OA4A 3PJRA 3AL0C 1RESA 1WJAA 2QBYA 2DFIA 4ZTFA 1YRNA 2W84A 2NVTJ 2L2OA 1WRJA 4GRIA 2KT0A 5JFRA 1D8JA 4PJNA 3HKZN 2FQ4A 3EDPA 2DA3A 2LOOA 2IP2A 2VASA 3K0LA 3KYCB 3JRHA 3RSNA 4LG0B 1YS6A 5D6FA 2EA4A 2OU2A 3I53A 4Y15A 3K4MA 5E1ZB 1T95A 1T33A 1IG7A 3ABUA 2Q2EA 3LFUA 4F52A 2WB1N 4EM2A 3BJ6A 5DCMA 3DPLC 3BROA 1Z91A 2JTVA 3KZZA 2K86A 1WPKA 1ZLJA 2VKDA 2BGCA 2QQAA 4XSZF 3H5AA 3RKYA 5C4XJ 1U8BA 5B1BH 5CKTA 4KMFA 5J1UA 3HSEA 1OCRH 1HW5A 1ZARA 4B8XA 2OTLI 3SEQA 4N9HA 2H94A 4BEHB 2ZSIB 2LKSA 4DBRA 3SJMA 2QQ8A 2MC3A 5E18F 2QF7A 1KU2A 3MN2A 1X3WB 3JR9A 2M34A 3WTXC 1YQAA 4M71A 4BUPA 1W7PD 2LREA 2K40A 2YS9A 3V42A 4QWQA 2YX4A 1ZHFA 4Q4ZF 2Y2ZA 4BAYA 1UHMA 3CLOA 2KZGA 1IXRC 1OCOH 2EIKH 4NNJA 1XDUA 3Q9VA 1JHFA 4QPQA 4C3IJ 2HOSA 1VFCA 5HS8A 4WK8F 2VODA 2CQXA 1A31A 3KZIC 5EYRA 3H36A 4FE7A 4DOZA 2XGXA 2L9NA 1MBJA 1K61A 1VQLI 3CCSI 4M9ZA 2M30A 4ENNA 3LWFA 3RI4A 4CHUA 4KFCA 4HPQA 5L3GA 1ZGJA 4ZYEA 4E7KA 1YW8A 3TP3A 1P9QC 2EFQA 2NS0A 3LFKA 2PJRB 1XGNA 3OS0A 4LLNA 3MD2A 4LD5A 3K4CA 3WG7H 2MA3A 5J4YA 4HF2A 2WV0A 3HOZJ 4LB5A 1Z6TA 2MW8A 4HYEA 4BQOA 1SEUA 2PLYA 4NHJA 4IJAA 2DN0A 1I39A 1T98A 2FBIA 4XLNF 1XSVA 1ETKA 2EV0A 4AIKA 1U2WA 3K1PA 1OR7C 2G7UA 3ZQ7A 4S05A 3AAFA 2KRCA 4ENKA 3WE2A 2GXBA 3AL0B 3FM5A 2ADUA 2X1EA 3FISA 5KNLA 2IJLA 2QQ9A 4M3EA 4ZC3A 5EG0A 4HF1A 3I4NJ 3GUDA 3CCRI 4XBFA 4Y3OA 3V8JA 3ZQQA 2DAOA 1LDDA 4RAZA 3K9TA 1XGSA 2DOFA 2ID3A 2UUZA 2HGCA 2HOEA 4A69C 5D5WB 4ON0A 1ZYRF 3CQZJ 3PM1A 4A5NA 3BR3A 3FMQA 5JHUA 3ZQGA 5DUIA 1MDMB 4XIDA 4Y4RA 4ASNA 5CVUA 1LFBA 3E0JB 4DIQA 5HNHA 3SEZA 5FLVA 3WU2C 2CW7A 5C44J 1KYZA 4P9FA 4P9UA 2D1HA 1X58A 2O03A 1UCRA 3PSIA 2F2EA 1KYWA 2D1VA 1TC3C 4G12A 3G71I 3L9FA 2HU9A 3R60A 1GUUA 4LIUA 5ICFA 4CXFA 4KNYA 3OIPA 3A4CA 2E1OA 3IKTA 2OTJI 3V8KA 2W85A 4JOMA 4NB5A 4DW6A 2R7SA 1LDKB 5EZHA 3EUKL 5E79C 1XD7A 4ZDLA 3CF2A 2JRMA 4XK4A 1VQNI 3JRAA 3F9KA 5IT9Z 1TQPA 3GW2A 4WCGA 4IHTA 4M6YA 3LA3A 4N4NB 3J7ZI 1IW7F 4E7SA 5LGTA 3UKGA 3LA7A 4L5IA 2R7TA 1W7PB 5HDGA 1MNEA 3G1LA 2LBFB 1TBXA 4CCJA 4V2FA 5IT9K 4H0EA 4RB3C 3CJRB 4IRGA 3S2DJ 1J0RA 1BJAA 4XQFA 2HVQA 3BR5A 3JCUC 2FJ1A 4L0YB 3LQQA 2JZYA 1Z1DA 3S16J 2MD5A 3K4LA 4ZYDA 1ODDA 5F6FA 5B66C 5JLXA 3DLLF 1JI8A 3S1QJ 4ABZA 2XAUA 4KN4X 2WV1A 2QENA 1W36D 3ZMZA 4PSXA 3KLNA 3L7WA 3OS1A 1PYVA 2BBYA 3EQLF 4IHWA 3CUQA 1R1UA 3ZQIA 3GBGA 4QLCU 2DTZA 1KQ8A 4NC8A 5J3LA 3OS2A 5DYMA 3LSHA 4KT5C 1FWZA 3ZP5A 1FEXA 2FRHA 5HOOA 2A69F 2GIZA 4EM0B 4C9YA 4ENMA 1XG1A 3H3VK 2AXLA 3MCZA 2P6SA 2L01A 4RGSA 1Z9CA 2ISZA 1FT9A 1YJNI 2Y75A 3I5UA 3T0YA 2GIVA 2IGMA 2A6TA 2M45A 1X1CA 2H09A 5IOZA 3HKZA 5IYCJ 4U7DA 3AG2H 4CUGA 2R5ZB 1XC5A 4N4OB 3IUOA 5J8CA 3WODF 4HX8A 2OUMA 1GV2A 2Y0SA 2V1DA 3T8TA 2ICWG 4A3IJ 4U87A 1I6XA 2Y0MA 1UG2A 3K1NA 1ZQ3P 2QM3A 2V6CA 4MTDA 4ZTJA 3RKXA 4A3CJ 5ILSA 4F3QA 4A3GJ 4AIDA 1BC8C 4RB0A 4B3AA 2F4MB 1V54H 3HC7A 3HGYA 2KLOA 1SD5A 1QPMA 2QA4I 3NQOA 3VDXA 3WU1B 1T38A 1F36A 2R7UA 4PSWA 5ED4A 3EETA 2X0LA 4BACA 2STTA 2AQFA 2ZXJA 4D5CA 1VQ8I 4UUSB 3HXLA 5LFAA 4E7IA 4C30A 5FFXA 3RKQA 1QPIA 2OBPA 3K7AJ 3VPRA 5DEQA 4PJJA 4CSWA 3BJOA 1EH8A 2XPVA 1T39A 2EFWA 1WFXA 2P8TA 2R7OA 2FXAA 2DI3A 2E2IJ 4LITA 1SC7A 1FPQA 3M7GA 2IT0A 1VI0A 4ZYGA 3ZQHA 5B3SH 3S32A 5EF6A 3WTUC 3EUHC 3I64A 3JRCA 1RI7A 4I2OA 1A36A 2A5YB 2PJPA 2HZTA 2NNNA 2ISYA 1XMXA 4HX4A 4AU7A 3FM3A 3KLOA 2XKPA 2VJJA 4ZZDA 4CH7A 1MBGA 1H8AC 4XLPF 2L7FP 3CDHA 2HFHA 3C2GA 4XKVA 3PIPF 1MMGA 2Y69H 3A02A 2EILH 2FOWA 1NHAA 2QSHX 5IY5H 4EGZA 1IN6A 5BPDA 3RTRA 3BG6A 5FKMA 3A0BC 2STWA 2YU3A 2G7HA 2R4GA 4LMYA 1HXDA 1XSXA 2O61A 2ELHA 3BLYA 4A5MA 2GOMA 5EEGA 1Y0UA 1HQCA 2IXSA 4UVCA 3BZKA 4FHTA 1JUSA 3GFJA 4L9JA 3QPHA 4L9NA 5C3EJ 2CUZA 1HKQA 1QZZA 5J6XA 3RYPA 4FE4A 4FTHA 2HOAA 1ZTRA 4QPOA 1QA6A 4HRIA 1Y1WJ 4GYIA 4WXHA 3OOPA 2DTRA 2MYSA 2R7DA 3M8FA 3OR2C 4G6QA 2AS5F 1G4DA 4WXDA 3JAMZ 1TW2A 1NTCA 2K9MA 2O0YA 3BG7A 1WHUA 1W4MA 3Q0UA 4AYBN 2LG4A 3FKJA 4OU0A 1Q1VA 2LFBA 1H0MA 3ABMH 2RREA 1N25A 1IUYA 4XLFA 1IC8A 3BR6A 1Z6RA 2LSOA 3BG3A 3CCQI 1TT0A 2BE5F 5FO5A 2O8KA 2HTSA 1W5SA 2ZNZA 1E2XA 2L9RA 3TDZC 1ZK8A 1R71A 3HPGA 2W82A 4A0XA 2L3DA 2RAEA 4EVIA 3J80Z 1BR1A 3K4JA 1NK2P 5CPRB 2KDOA 2E5ZA 2KFDA 3FXLA 1MBKA 2DT6A 3FX3A 5KAIC 5TISC 1WVRA 5K1YA 4QTRA 1UB9A 1ITYA 3OYEA 2H1LA 1WJ5A 2EK5A 2MABA 1BM9A 3AFHA 1TTYA 1MZBA 1B9NA 4A93J 1EJ9A 1YIOA 1YX3A 3DWLE 3FIWA 4QIWN 1WJDA 3FXJA 3KPHA 1YITI 4XNFA 3FZVA 2FX0A 3HOTA 2O9LA 3D0SA 4HF0A 3E7LA 2V6EA 2HQ5A 2DYSH 3IC7A 2E1MC 3KETA 2WAQA 5HLTA 3J7AY 1DP3A 3VOEA 3FBNB 2COMA 1IDYA 4KICA 1S5LC 1Z21A 1TWGJ 2Z16A 5C4JJ 1HA8A 4UV8A 2IAIA 1FYMA 4EATA 2E71A 4NC7A 1TZLA 2JT1A 3VFZA 2DBBA 2XGDA 2WTEA 3F23A 1R6RA 3OYLA 2A07F 2IW5A 4R79A 3ZPLA 4E7ZA 2QUFA 3EPZA 1P4XA 3B6CA 3V4GA 2XHKA 4A3KJ 2EFOA 3MZ8A 4RAYA 2NVYJ 2VE8A 1KU9A 1MGTA 1Y8QB 3JSPA 3L2UA 3GTLJ 1K79A 3I59B 5H20A 1ZRDA 2QVOA 2LKXA 3DPTA 3CJTB 3LSTA 1X4OA 4IOCF 2A6HF 2WWYA 4D5FA 4BHPA 4ZJZA 1SFXA 4BE2A 4V19K 4RAGA 4A3BJ 1LFPA 4GGGA 4LLLA 3BQZA 4OOIA 2ELKA 4JP0A 1YFHA 5FLMJ 3QU6A 1HSJA 5E8IA 4M72A 4L9VA 2XAJA 3ZQCA 1VQ4I 3LSJA 1UAAA 3EUAA 2W24A 1QU3A 2OD5A 4ITVA 2QBYB 3IWFA 4LK1F 3ZGKA 1R5GA 3K4BA 1YRNB 1EKEA 4CYDA 1U5TA 1IUFA 4PGGA 3VYSB 4BE0A 1ETOA 1WJEA 4I99C 2IS4A 2VE9A 1DPRA 1E3PA 2FBHA 3CMAI 1RNLA 4PK4A 2KDZA 2KL4A 3OIQA 3WE3A 2Q2EB 1JUMA 1DU0A 1IV6A 3IP4B 3LAPA 2VB6A 3CLQA 3NWTA 2JQ7A 5EGOB 1XB4A 4XLAA 3ML6A 4E70A 4F7ZA 4XRSA 1MJAA 4HNTA 4HQEA 1OLTA 2R3SA 3B73A 1FLIA 2I10A 4OIOF 1U9OA 2WA0A 1AKHB 1D0ZA 3F6VA 4CZZA 3C2HA 3E6BA 4Q47A 3V7SA 3CCJI 3RCOA 3IH2A 4JX5A 3ZQFA 5FB2A 1J7KA 4LFUA 3OSFA 1JKRC 2AO9A 2TDXA 3LL7A 1SAXA 2RQQA 1ULYA 3REOA 5LHGA 2V1UA 2K9SA 2K9LA 1BA5A 2E1MB 2FNPA 2P6TA 1X1BA 3OV8A 5DD4A 3SDGA 3HUGB 3AKZA 1FSHA 2AXTC 1OMIA 3ONQA 3HSFA 4LLGF 4A6DA 1XCVA 3K70D 2R7VA 1UJ8A 2DA7A 3B6AA 3H9JA 3IL2A 1XGOA 2ZJRF 3QRFF 3AG4H 4ANJA 3L2VA 5BQTA 3ROUA 4CYCB 3RJPA 1T8IA 4DJAA 4MO7A 3ZRGA 5E3OA 2GAUA 1Y0NA 4HZFA 3R0JA 2K9QA 3G1MA 4AD9A 5F08A 1Y39A 2LTPA 4AVZA 3OYHA 3W2AA 3TDUC 1ZAOA 2ZSHB 3E5XA 1O3TA 2XC7A 1MJBA 1FOYA 3MKLA 1S7AA 1X1AA 4ESBA 1G59A 3CUQC 3HPHA 2XSDC 2CFOA 1IN8A 3BR0A 3BY6A 1DU6A 3ERMA 4UXNA 2DU9A 3GTQJ 1FTTA 2X85A 3GZNB 3H9GA 1PUFA 4A3EJ 2LH9A 4J19A 1R1TA 2R5YA 3SZPA 2ECCA 3O6BB 4ZH4F 4E7HA 2D2WA 1FNNA 2QCOA 2B9SA 1LEAA 2R92J 4AYBA 2GA1A 3CDLA 3LMMA 3HHGA 4JBAA 3JTGA 3MEXA 3PUFA 1GVJA 3TW7A 1XMKA 1QVTA 5AIQA 3CO7C 1PDNC 5EJCA 4AC0A 2YU9J 1SFKA 3F8BA 4DNCA 1HCRA 1IRFA 1FBQA 1P7IA 1LQ1A 4C2UA 1JHHA 3I71A 2HS5A 4B44A 3SXYA 2QKMB 5F1RA 4FX4A 1JGGA 3I54A 4ZDOA 1WI9A 1IN4A 3HRSA 3S14J 3HM5A 3H9QA 1H88C 3ZMUA 4J00A 3GVAA 4N9IA 3A0HC 3CC4I 3GTGJ 1K4TA 4L0ZB 2NOJB 2ESHA 3NRVA 2LLKA 3CCLI 2DK8A 2FE3A 1X2NA 3CMYA 1A5JA 4L9TA 4MNUA 3KZYA 5LLQA 5HLHA 1DPUA 1WSUA 4NQWA 1YIJI 3RQIA 4BQQA 3B02A 1SD4A 2PN6A 3TKYA 5E3NA 2X6OA 3BTLA 5AIPA 3DBHB 1FYLA 3PFYA 2X6YA 4AWXB 3I9V2 3S8PA 2GLOA 4HLXA 1V4RA 4P55A 3VYRB 1T56A 2IS6A 1Q1HA 2DYRH 2P5VA 4C3JJ 3G73A 1O7FA 2BXZA 4RA2A 3M1CA 2M4KA 1KA8A 3WGGA 3PO3J 2DA6A 2E1CA 2DQRA 3OL3A 1G3WA 2W25A 3GTOJ 3HOUJ 1A6QA 2VOPA 2M8EA 3KYLA 4V2GA 3CUQB 1R9TJ 2Y9ZA 3H35A 4G7OF 1IDZA 3L1PA 3HBLA 1O3SA 3OYCA 1YTYA 1USSA 1KGSA 2IRFG 4A3FJ 1PVEA 3TEDA 1DUXC 1TP4A 2Z2SB 3OMYA 3RPUA 1BI1A 2CGPA 2MFZA 4HOBA 4CZCA 2JA8J 1D8KA 2RV8A 3Q9SA 4MFDA 2ZMEA 1Y1VJ 5BNGA 1WH5A 2F6CA 3S15J 4U7BA 2DFEA 2QGUA 2ZJ2A 2GOXB 5ICEA 2X4HA 4FQGA 1V5FA 1D5VA 4BXXJ 1O4XA 3I58A 1DQUA 5BS6A 3FXMA 1BC7C 3R4KA 3V7CA 2FMYA 4OAZA 2VIXA 2KIQA 3LNQA 2ZKZA 5IYDJ 4X0GA 4BH9A 1WJCA 3DBLB 1I6HJ 5FLXZ 4NDLA 3QWLA 4G7ZF 4N0BA 1N77A 5D5VB 1STZA 2DQLA 2Y48A 1KU7A 5CYVA 5DM7F 2VONA 3S2WA 1NH3A 2MH9A 4RMNA 1P4WA 3IV5A 2M7BA 2LY2A 4BJTA 1D3YA 2D5VA 5FLXK 3RZDJ 4DQ2A 1A35A 1T0FA
chains in the Genus database with same CATH topology
5L3DA 5LEJA 3P9CA 2Z3YA 2P5KA 1ZH5A 1QBJA 5HDNA 3F8NA 2LF7A 5HS9A 3DQVC 1TQIA 2BV6A 2FU4A 1TNSA 1K7AA 5CVIA 2L54A 3WTYC 4KDPA 2CG4A 3E97A 3HRUA 2PFBA 2RQPA 3QAHA 4O6JA 1IF1A 1Z7UA 2VBYA 1EH7A 4IPAA 1MKMA 3FHZA 2XASA 3T8RA 4LGWA 4P5OA 4IRIA 2ZFWA 1IAWA 2CW0F 3C18A 1H9GA 3FF5A 2A3SA 3FXQA 3GF2A 3JTHA 3WU0A 4EJTA 1S29A 2KIMA 3ZN0A 2UZKA 2RVCA 5BOXA 1BI2A 3F6OA 1BI0A 1O3QA 3BDDA 3KEQA 1REPC 2ESNA 4UUVA 3E3VA 2E1NA 2MH2A 4PCQA 2EV6A 4L18B 1LDJA 1U5TC 3H3UA 5KK1A 2HEOA 4A0YA 1ZGAA 4KA4A 1ON2A 4UHTA 2UXXA 1BBYA 5D4RA 5CVVA 4I0BA 3FXUA 3RIRA 4EV0A 4EJUA 1HW2A 1F1ZA 4IXAA 4WWCA 1XN7A 1FYKA 4U0WA 1P92A 3CTAA 1MDMA 3T1BA 2HQNA 1UHWA 2FOKA 1RIOH 1JXSA 2ACJA 4S04A 4AIJA 2K27A 5L3CA 4Y13A 3VODA 2IVMA 2Q0OA 1QGPA 3LQRA 2XVCA 1HKTA 4RB1A 4HLYA 1ZG1A 1BI3A 1OPCA 2J5PA 4KMUX 1T2KA 3I0TA 4HDVA 1HKSA 2QLZA 1B59A 1O57A 1KU3A 2XAGA 1FC3A 4TV7A 3TO9A 5TRDA 3GFLA 4I02A 2Z9OA 3KCCA 2RN7A 1DDNA 1AOYA 4CICA 3CUOA 3KP4A 1VTNC 4FX0A 3K2ZA 2QWWA 2EA2A 2PEXA 2DW4A 5ICCA 4PDKA 5ERIA 4BHCA 4GXOA 1B9MA 4D0PA 4UNOA 2EFPA 3F72A 1U5TB 3IKVA 2RC4A 3F8FA 1HBXG 2F5DA 1S7OA 5LRRA 2EB7A 3WTVC 5H6RA 3O2PE 1SFEA 5F64A 1CF7A 1FBUA 4KIGA 2Z99A 3E6DA 2H27A 4BNCA 2DO7A 5ILVA 5K5QA 3ZMTA 3L09A 3W6KB 3V7RA 5LBQA 2LKPA 1IZ1A 5IT3A 4HV5A 5HLIA 1MJ9A 1XGMA 4G8XA 1YO5C 5DV5A 1Z05A 4LB6B 4ZZLA 2E7XA 3HSRA 3TOAA 3ZMVA 3GZ5A 3MFKA 3HYIA 4Q5SF 1R7JA 2NRAC 2J5OA 1IN7A 4B09A 5H6QA 3DFGA 2JSCA 4WX9A 1R36A 4CGZA 2VBZA 4R8HA 4AVPA 4YFNF 1GXPA 4M9XA 5ICGA 1SD7A 2KIFA 2KIUA 5TJJA 1J75A 4OINF 3QU3A 3HIFA 3VEPA 1FOKA 4A2UA 3TO7A 3E5UA 5FD5A 3PQJA 3SFZA 4HQMA 3R6SA 4EJVA 2XV4S 5JI6A 5L3EA 4LJZF 2K4BA 5DCMB 5LEKA 1ZRCA 4PGHA 1P6RA 3LA2A 1G6NA 3ULQB 3ZMSA 1BOAA 1USTA 1B6AA 4KIFA 2RGVA 3ERED 3P9KA 1I1SA 1TNTA 2XIGA 2PI0A 1SD6A 3M9AA 3ZMDA 2BEOA 1T6SA 2JPCA 1MD0A 3ELKA 4U0VA 2VC1A 3DXJF 2OQGA 2A6EF 3ABTA 2L4MA 4JQFA 1JGSA 1G3SA 1PP7U 5D5UB 3QOPA 3BWGA 2VBWA 1IRGA 2VXZA 3H3ZA 1ZN2A 2K7LA 5D6EA 4BQAA 3DF8A 2M1BA 4HX7A 3FMRA 3WTTC 2IA1A 2F5CA 4YG2F 3EYYA 3N97A 2EV5A 1WQ2A 2LDUA 1U3EM 1GXQA 3F3XA 1U78A 2PBIA 1SMTA 2OQRA 1LVAA 4HW0A 2XROA 1ZRFA 2O8XA 3G3ZA 3M8EA 2GA2A 3ISPA 3GEZA 1FX7A 2IPQX 1KQ9A 1F9NA 2NAZA 1CGPA 5D8KB 1QO0D 4ESJA 4OMZA 2GQQA 3EYIA 2CWEA 2GWRA 4XSXF 3KFWX 2CYYA 3M1EA 3L2CA 5EEHA 3GFMA 3HHHA 4MTEA 4UVAA 5L3FA 2V79A 1K6OA 3IRQA 3HTSB 3VB2A 5E17F 2UWMA 1EV7A 1S6LA 5CVJA 3MZYA 2VT3A 2H6BA 2XAFA 5L3BA 5D4SA 4M9SA 4O5VA 1LNWA 4RS8A 2YR2A 3MQ0A 3ZN1A 5HS7A 1UFMA 2FEZA 3WGHA 2CFXA 2VBXA 1WWXA 1IXCA 5E8GA 1U6GA 2K02A 1G3YA 1GHCA 2RKHA 3WTSC 1IXSB 3HUGA 2DK5A 5HDKA 4HV6A 2A61A 2K4JA 2KJCA 2MLKA 1AWCA 2ETHA 1RZ4A 1U8RA 1F5TA 2M87A 4IVNA 5CLSA 3L00A 4ETSA 4EGYA 2PMHA 2FBKA 2KRFA 2PMUA 2L4AA 3P9IA 4KN7X 4I0AA 3IRRA 1ZG5A 4YIFA 3K69A 2R7FA 3FXRA 2A68F 2CQKA 1R1VA 1IN5A 4A12A 3U2RA 2F5EA 3RYRA 3HTUA 1O3RA 2EWNA 4CDGA 1K78A 3GZ6A 2ZO4A 5E1WA 3SZTA 1EH6A 2RDPA 3J81Z 5A2QZ 3R61A 3HOSA 4ESFA 2Q8KA 4BXUA 5BPIA 4R1HA 3J81K 2DPUA 4LG0A 4IRHA 5A2QK 2XRNA 2O6GE 5FFZA 5DCFA 3ECOA 1L0OC 4OIPF 2GXGA 1X3UA 2EFNA 1RUOA 1JE8A 2C6YA 1I1GA 2FMLA 2QQBA 5HVQC 2Z5UA 3HRTA 4MEXF 2Z33A 3J7AO 1I5ZA 3LAJA 3W6JB 3C3WA 2HDCA 1TQMA 2HYGD 2RNJA 4P96A 3TGNA 1B4AA 1XDSA 2QZ8A 4ENJA 2GZWA 1R23A 5CVRA 5JVTA 1LB2A 4MQVA 1ON1A 1P2FA 1H9TA 2HKXA 4KUMA 2HWVA 3KP3A 2V9VA 3CJNA 4G9YA 1FP1D 3WGIA 4YFXF 2UXNA 4HA8A 2LF8A 1CF7B 5CJ9A 3KP6A 1FY7A 3F8CA 4GO1A 3PQKA 1J9IA 4UVBA 4K2EA 1TLHB 3FWEA 5E1XA 1F4KA 4CO8A 3BOQA 3F22A 1C0WA 3TOBA 3FMSA 2NYXA 2IA2A 2L02A 2F5FA 4JK1X 3QPTA 2VOOA 1J5YA 1J2XA 5LGUA 3ECHA 3F8MA 2VN2A 4LK0F 4U88A 1LEBA 4A6EA 1YYVA 1ZLKA 5LGNA 2PG4A 3JW4A 2IA0A 2OZ6A 3QP6A 1V3FA 2KKOA 1PUEE 1FP2A 1W7PA 4G7HF 3WG9A 5AONA 4I98B 3WTWC 4HDUA 2HYFA 1PP8F 2P5LC 5DDGA 4UV9A 4Y17A 4IHSA 4YFKF 1E17A 2HTJA 3E6MA 4G94A 3CO6C 4A0ZA 5DD8A 4WF2A 4OIRF 2DT5A 3GXOA 1S3JA 2LNBA 2O3FA 2EJRA 4EMSA 2M5WA 1OR7A 3KP7A 1DP7P 1S8NA 4BHBA 1KQ0A 1J59A 3SHFA 1FBSA 2YPRA 4EJWA 4RGRA 3TO6A 3R0AA 2XAHA 1ONVA 5JR3A 1O7LA 5DUKA 3IHUA 4L5JA 2FA5A 4M6XA 3KP5A 3BJAA 4EJOA 3DEUA 2CO5A 2B0LA 1XMAA 3GFIA 4MGRA 3BZ6A 3IWZA 3JAMK 3SQNA 5HLGA 4M74A 3RKWA 3T5XA 1ZG3A 2KJBA 6PAXA 4O3MA 4HBLA 1YG2A 1L3LA 2P7VB 3PFIA 3MZHA 2ZNYA 3MWMA 1YS7A 2W57A 2ZBKA 4I01A 1QZYA 4GCVA 3J80K 4EQQA 2HQRA 5D8LB 1R58A 2FNAA 3DP7A 3HRMA 1QNTA 4RGUA 2VC0A 4EM1A 1HW1A 1QQIA 4RGXA 1SMYF 3QP5A 1G3TA 3COAC 1ZREA 4AIHA 3O3KA 4M73A 4RB2C 2QYOA 5K5OA 3N4MA 5FGMA 1XSDA 3D5LA 1XCBA 2DPDA 2P4WA 3V8LA 3I4PA 3NEUA 2FSWA 1YLFA 4KYWA 5D5XB 5BMZA 2JRTA 3GLXA 1OKRA 4HAMA 4Q48A 2MBFA 3U1DA 2YSRA 2JPBA 2H6CA 2HR3A 4FT8A 3DKWA 4I09A 4BYYA 1LJ9A 3C7JA 2YX7A 2D45A 1YW7A 4MHGA 2XAQA 3GWZA 2ZCWA 2MLGA 4GYGA 5J8FA 2FQ3A 3E5QA 1R00A 1BIAA 5KVRA 4MEYF 4I7HA 1W5TA 3Q5FA 4XRFA 5K5RA 3C1DA 3K1MA 3WTZA 2WC2A 1RUNA 3GYHX 3BPXA 1HSTA 5FD6A 2PQ8A 1FZPB 1R5HA 3RDIA 3BP8A 3EUHA 3P7NA 1I27A 1FSEA 2OAZA 3MAJA 2VT2A 4U0YA 5LRSA 3TQNA 2CSOA 5ILUA 3F21A 5LHIA 2P7CB 1R22A 2G9WA 4G6DA 4WXCA 3H92A 2V1XA 1OYWA 1SFUA 2ZMEB 1OYIA 4YIIA 1B1BA 1OYYA 5LHHA 3DV8A 2E7WA 4OIQF 3U9GA 4OMYA 3RPQA 4IF4A 2BYVE 3GX4X 3JSOA 4MQ9F 4KIBA 3GO5A 2FF4A 3I59A 5E20A 1A04A 4Z2YA 1BIBA 2XKOA 1TW3A 2XUBA 3KEOA 1BN5A 2HKOA 1YW9A 2NNYA 2DLLA 2OZUA 3KE2A 1P4AA 1WKMA 3BPVA 1K78B 4PZJA 3E6CC 3KP2A 4ZYHA 2OA4A 2QBYA 2DFIA 2W84A 1WRJA 5JFRA 1D8JA 3EDPA 2IP2A 3K0LA 4LG0B 1YS6A 5D6FA 2EA4A 2OU2A 3I53A 4Y15A 5E1ZB 3ABUA 2Q2EA 4EM2A 3BJ6A 5DCMA 3DPLC 3BROA 1Z91A 2JTVA 3KZZA 2K86A 1ZLJA 2BGCA 2QQAA 4XSZF 3RKYA 4KMFA 3HSEA 1HW5A 1ZARA 4B8XA 4N9HA 2H94A 2MC3A 5E18F 1KU2A 3WTXC 1YQAA 4M71A 1W7PD 4QWQA 2YX4A 1ZHFA 4Q4ZF 4BAYA 1UHMA 3CLOA 1IXRC 1XDUA 3Q9VA 1JHFA 5HS8A 4WK8F 2VODA 2XGXA 4M9ZA 2M30A 4ENNA 3LWFA 3RI4A 4CHUA 4KFCA 5L3GA 1ZGJA 4ZYEA 1YW8A 2EFQA 2NS0A 3LFKA 1XGNA 4LLNA 4LD5A 4HF2A 2MA3A 2WV0A 4LB5A 1Z6TA 4HYEA 2PLYA 4NHJA 4IJAA 2FBIA 1T98A 4XLNF 1XSVA 2EV0A 4AIKA 1U2WA 3K1PA 2G7UA 3ZQ7A 4S05A 3AAFA 4ENKA 3WE2A 2GXBA 3FM5A 2ADUA 2IJLA 2QQ9A 4HF1A 3GUDA 4XBFA 3V8JA 2DAOA 1LDDA 4RAZA 3K9TA 1XGSA 2HGCA 2HOEA 5D5WB 4ON0A 1ZYRF 4A5NA 3FMQA 5JHUA 5DUIA 1MDMB 4ASNA 5CVUA 1KYZA 4P9FA 4P9UA 2D1HA 2O03A 1UCRA 2F2EA 1KYWA 2D1VA 3L9FA 3R60A 5ICFA 4KNYA 4CXFA 3IKTA 3V8KA 2W85A 4NB5A 1LDKB 1XD7A 5IT9Z 1TQPA 3GW2A 4WCGA 4IHTA 4M6YA 3LA3A 1IW7F 5LGTA 3LA7A 4L5IA 1W7PB 5HDGA 1TBXA 5IT9K 4H0EA 4RB3C 4IRGA 1J0RA 1BJAA 4L0YB 3LQQA 2JZYA 1Z1DA 2MD5A 4ZYDA 1ODDA 5F6FA 4KN4X 2QENA 3ZMZA 3KLNA 3L7WA 2BBYA 3EQLF 3CUQA 1R1UA 4QLCU 1KQ8A 5DYMA 3ZP5A 4KT5C 1FWZA 2FRHA 5HOOA 2A69F 4EM0B 4ENMA 2AXLA 3MCZA 2P6SA 2L01A 4RGSA 1Z9CA 2ISZA 1FT9A 2Y75A 3I5UA 3T0YA 2GIVA 2M45A 2H09A 4U7DA 5J8CA 3WODF 4HX8A 2V1DA 3T8TA 1I6XA 2Y0MA 3K1NA 2QM3A 2V6CA 4MTDA 3RKXA 5ILSA 1BC8C 4RB0A 1SD5A 1QPMA 3NQOA 3WU1B 1T38A 5ED4A 3EETA 2X0LA 2STTA 2ZXJA 5FFXA 2OBPA 5DEQA 3BJOA 1EH8A 1T39A 2EFWA 2P8TA 2FXAA 2DI3A 1FPQA 3M7GA 2IT0A 4ZYGA 3WTUC 3I64A 1RI7A 4I2OA 2A5YB 2PJPA 2HZTA 2NNNA 2ISYA 4HX4A 3FM3A 3KLOA 2XKPA 4ZZDA 4XLPF 3CDHA 2HFHA 1NHAA 4EGZA 1IN6A 5BPDA 3RTRA 2STWA 2YU3A 2G7HA 4LMYA 1HXDA 1XSXA 2O61A 2ELHA 4A5MA 5EEGA 1Y0UA 1HQCA 4UVCA 4FHTA 3GFJA 4L9JA 3QPHA 4L9NA 1HKQA 1QZZA 5J6XA 3RYPA 4GYIA 4WXHA 3OOPA 2DTRA 2R7DA 3M8FA 4G6QA 2AS5F 1G4DA 4WXDA 3JAMZ 1TW2A 2O0YA 1W4MA 4OU0A 1H0MA 1IUYA 1Z6RA 2LSOA 2BE5F 5FO5A 2HTSA 1W5SA 2ZNZA 1E2XA 3TDZC 4A0XA 2L3DA 4EVIA 3J80Z 3FX3A 5K1YA 1UB9A 2EK5A 1BM9A 1TTYA 1MZBA 1B9NA 1YIOA 3FZVA 3HOTA 3D0SA 4HF0A 3IC7A 3KETA 3VOEA 2COMA 4KICA 4UV8A 1FYMA 3VFZA 2JT1A 2DBBA 2WTEA 3F23A 2A07F 2IW5A 4R79A 3ZPLA 2QUFA 1P4XA 3V4GA 2XHKA 2EFOA 4RAYA 2VE8A 1KU9A 1MGTA 3JSPA 1K79A 3I59B 5H20A 1ZRDA 2QVOA 3DPTA 3LSTA 2A6HF 2WWYA 4BHPA 1SFXA 4GGGA 4LLLA 4OOIA 1YFHA 3QU6A 1HSJA 5E8IA 4M72A 4L9VA 2XAJA 2W24A 2OD5A 2QBYB 3IWFA 4LK1F 1R5GA 4CYDA 1U5TA 4PGGA 2VE9A 1DPRA 2FBHA 1RNLA 3WE3A 3LAPA 1XB4A 3ML6A 4E70A 4F7ZA 1MJAA 4HQEA 2R3SA 3B73A 1FLIA 4OIOF 3F6VA 4CZZA 3E6BA 4Q47A 3V7SA 5FB2A 1J7KA 4LFUA 2TDXA 1SAXA 1ULYA 3REOA 5LHGA 2V1UA 2P6TA 2FNPA 3OV8A 5DD4A 1FSHA 1OMIA 3HSFA 4LLGF 4A6DA 1XCVA 3IL2A 1XGOA 3QRFF 5BQTA 3ROUA 3RJPA 2GAUA 4HZFA 3R0JA 4AD9A 3TDUC 1ZAOA 3E5XA 1O3TA 1MJBA 1S7AA 4ESBA 3CUQC 1IN8A 3BY6A 4UXNA 2DU9A 1R1TA 3SZPA 4ZH4F 3O6BB 2D2WA 1FNNA 1LEAA 2GA1A 3HHGA 4JBAA 3JTGA 3MEXA 1GVJA 1XMKA 5AIQA 3CO7C 1PDNC 3F8BA 4DNCA 1IRFA 1FBQA 1LQ1A 1JHHA 3I71A 2HS5A 3SXYA 5F1RA 4FX4A 3I54A 1WI9A 1IN4A 3HRSA 3ZMUA 3GVAA 4N9IA 4L0ZB 2ESHA 3NRVA 2DK8A 2FE3A 4L9TA 4MNUA 3KZYA 5LLQA 5HLHA 1DPUA 1WSUA 4NQWA 3B02A 1SD4A 2PN6A 3TKYA 5AIPA 1FYLA 4AWXB 4HLXA 1V4RA 4P55A 1Q1HA 2P5VA 3G73A 1O7FA 1KA8A 3WGGA 2E1CA 2DQRA 2VOPA 1G3WA 2W25A 2M8EA 3CUQB 4G7OF 1O3SA 1YTYA 1USSA 1KGSA 2IRFG 1DUXC 3RPUA 1BI1A 2CGPA 4HOBA 1D8KA 2RV8A 3Q9SA 2ZMEA 4U7BA 2ZJ2A 5ICEA 2X4HA 1D5VA 3I58A 5BS6A 1BC7C 3R4KA 3V7CA 2FMYA 2ZKZA 4BH9A 5FLXZ 4G7ZF 4N0BA 5D5VB 1STZA 2DQLA 2Y48A 1KU7A 5CYVA 2VONA 3S2WA 2MH9A 1P4WA 1D3YA 5FLXK 4DQ2A 1T0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L3D A;  5LEJ A;  3P9C A;  2Z3Y A;  2P5K A;  1ZH5 A;  1QBJ A;  5HDN A;  3F8N A;  2LF7 A;  5HS9 A;  3DQV C;  1TQI A;  2BV6 A;  2FU4 A;  1TNS A;  1K7A A;  5CVI A;  2L54 A;  3WTY C;  4KDP A;  2CG4 A;  3E97 A;  3HRU A;  2PFB A;  2RQP A;  3QAH A;  4O6J A;  1IF1 A;  1Z7U A;  2VBY A;  1EH7 A;  4IPA A;  1MKM A;  3FHZ A;  2XAS A;  3T8R A;  4LGW A;  4P5O A;  4IRI A;  2ZFW A;  1IAW A;  2CW0 F;  3C18 A;  1H9G A;  3FF5 A;  2A3S A;  3FXQ A;  3GF2 A;  3JTH A;  3WU0 A;  4EJT A;  1S29 A;  2KIM A;  3ZN0 A;  2UZK A;  2RVC A;  5BOX A;  1BI2 A;  3F6O A;  1BI0 A;  1O3Q A;  3BDD A;  3KEQ A;  1REP C;  2ESN A;  4UUV A;  3E3V A;  2E1N A;  2MH2 A;  4PCQ A;  2EV6 A;  4L18 B;  1LDJ A;  1U5T C;  3H3U A;  5KK1 A;  2HEO A;  4A0Y A;  1ZGA A;  4KA4 A;  1ON2 A;  4UHT A;  2UXX A;  1BBY A;  5D4R A;  5CVV A;  4I0B A;  3FXU A;  3RIR A;  4EV0 A;  4EJU A;  1HW2 A;  1F1Z A;  4IXA A;  4WWC A;  1XN7 A;  1FYK A;  4U0W A;  1P92 A;  3CTA A;  1MDM A;  3T1B A;  2HQN A;  1UHW A;  2FOK A;  1RIO H;  1JXS A;  2ACJ A;  4S04 A;  4AIJ A;  2K27 A;  5L3C A;  4Y13 A;  3VOD A;  2IVM A;  2Q0O A;  1QGP A;  3LQR A;  2XVC A;  1HKT A;  4RB1 A;  4HLY A;  1ZG1 A;  1BI3 A;  1OPC A;  2J5P A;  4KMU X;  1T2K A;  3I0T A;  4HDV A;  1HKS A;  2QLZ A;  1B59 A;  1O57 A;  1KU3 A;  2XAG A;  1FC3 A;  4TV7 A;  3TO9 A;  5TRD A;  3GFL A;  4I02 A;  2Z9O A;  3KCC A;  2RN7 A;  1DDN A;  1AOY A;  4CIC A;  3CUO A;  3KP4 A;  1VTN C;  4FX0 A;  3K2Z A;  2QWW A;  2EA2 A;  2PEX A;  2DW4 A;  5ICC A;  4PDK A;  5ERI A;  4BHC A;  4GXO A;  1B9M A;  4D0P A;  4UNO A;  2EFP A;  3F72 A;  1U5T B;  3IKV A;  2RC4 A;  3F8F A;  1HBX G;  2F5D A;  1S7O A;  5LRR A;  2EB7 A;  3WTV C;  5H6R A;  3O2P E;  1SFE A;  5F64 A;  1CF7 A;  1FBU A;  4KIG A;  2Z99 A;  3E6D A;  2H27 A;  4BNC A;  2DO7 A;  5ILV A;  5K5Q A;  3ZMT A;  3L09 A;  3W6K B;  3V7R A;  5LBQ A;  2LKP A;  1IZ1 A;  5IT3 A;  4HV5 A;  5HLI A;  1MJ9 A;  1XGM A;  4G8X A;  1YO5 C;  5DV5 A;  1Z05 A;  4LB6 B;  4ZZL A;  2E7X A;  3HSR A;  3TOA A;  3ZMV A;  3GZ5 A;  3MFK A;  3HYI A;  4Q5S F;  1R7J A;  2NRA C;  2J5O A;  1IN7 A;  4B09 A;  5H6Q A;  3DFG A;  2JSC A;  4WX9 A;  1R36 A;  4CGZ A;  2VBZ A;  4R8H A;  4AVP A;  4YFN F;  1GXP A;  4M9X A;  5ICG A;  1SD7 A;  2KIF A;  2KIU A;  5TJJ A;  1J75 A;  4OIN F;  3QU3 A;  3HIF A;  3VEP A;  1FOK A;  4A2U A;  3TO7 A;  3E5U A;  5FD5 A;  3PQJ A;  3SFZ A;  4HQM A;  3R6S A;  4EJV A;  2XV4 S;  5JI6 A;  5L3E A;  4LJZ F;  2K4B A;  5DCM B;  5LEK A;  1ZRC A;  4PGH A;  1P6R A;  3LA2 A;  1G6N A;  3ULQ B;  3ZMS A;  1BOA A;  1UST A;  1B6A A;  4KIF A;  2RGV A;  3ERE D;  3P9K A;  1I1S A;  1TNT A;  2XIG A;  2PI0 A;  1SD6 A;  3M9A A;  3ZMD A;  2BEO A;  1T6S A;  2JPC A;  1MD0 A;  3ELK A;  4U0V A;  2VC1 A;  3DXJ F;  2OQG A;  2A6E F;  3ABT A;  2L4M A;  4JQF A;  1JGS A;  1G3S A;  1PP7 U;  5D5U B;  3QOP A;  3BWG A;  2VBW A;  1IRG A;  2VXZ A;  3H3Z A;  1ZN2 A;  2K7L A;  5D6E A;  4BQA A;  3DF8 A;  2M1B A;  4HX7 A;  3FMR A;  3WTT C;  2IA1 A;  2F5C A;  4YG2 F;  3EYY A;  3N97 A;  2EV5 A;  1WQ2 A;  2LDU A;  1U3E M;  1GXQ A;  3F3X A;  1U78 A;  2PBI A;  1SMT A;  2OQR A;  1LVA A;  4HW0 A;  2XRO A;  1ZRF A;  2O8X A;  3G3Z A;  3M8E A;  2GA2 A;  3ISP A;  3GEZ A;  1FX7 A;  2IPQ X;  1KQ9 A;  1F9N A;  2NAZ A;  1CGP A;  5D8K B;  1QO0 D;  4ESJ A;  4OMZ A;  2GQQ A;  3EYI A;  2CWE A;  2GWR A;  4XSX F;  3KFW X;  2CYY A;  3M1E A;  3L2C A;  5EEH A;  3GFM A;  3HHH A;  4MTE A;  4UVA A;  5L3F A;  2V79 A;  1K6O A;  3IRQ A;  3HTS B;  3VB2 A;  5E17 F;  2UWM A;  1EV7 A;  1S6L A;  5CVJ A;  3MZY A;  2VT3 A;  2H6B A;  2XAF A;  5L3B A;  5D4S A;  4M9S A;  4O5V A;  1LNW A;  4RS8 A;  2YR2 A;  3MQ0 A;  3ZN1 A;  5HS7 A;  1UFM A;  2FEZ A;  3WGH A;  2CFX A;  2VBX A;  1WWX A;  1IXC A;  5E8G A;  1U6G A;  2K02 A;  1G3Y A;  1GHC A;  2RKH A;  3WTS C;  1IXS B;  3HUG A;  2DK5 A;  5HDK A;  4HV6 A;  2A61 A;  2K4J A;  2KJC A;  2MLK A;  1AWC A;  2ETH A;  1RZ4 A;  1U8R A;  1F5T A;  2M87 A;  4IVN A;  5CLS A;  3L00 A;  4ETS A;  4EGY A;  2PMH A;  2FBK A;  2KRF A;  2PMU A;  2L4A A;  3P9I A;  4KN7 X;  4I0A A;  3IRR A;  1ZG5 A;  4YIF A;  3K69 A;  2R7F A;  3FXR A;  2A68 F;  2CQK A;  1R1V A;  1IN5 A;  4A12 A;  3U2R A;  2F5E A;  3RYR A;  3HTU A;  1O3R A;  2EWN A;  4CDG A;  1K78 A;  3GZ6 A;  2ZO4 A;  5E1W A;  3SZT A;  1EH6 A;  2RDP A;  3J81 Z;  5A2Q Z;  3R61 A;  3HOS A;  4ESF A;  2Q8K A;  4BXU A;  5BPI A;  4R1H A;  3J81 K;  2DPU A;  4LG0 A;  4IRH A;  5A2Q K;  2XRN A;  2O6G E;  5FFZ A;  5DCF A;  3ECO A;  1L0O C;  4OIP F;  2GXG A;  1X3U A;  2EFN A;  1RUO A;  1JE8 A;  2C6Y A;  1I1G A;  2FML A;  2QQB A;  5HVQ C;  2Z5U A;  3HRT A;  4MEX F;  2Z33 A;  3J7A O;  1I5Z A;  3LAJ A;  3W6J B;  3C3W A;  2HDC A;  1TQM A;  2HYG D;  2RNJ A;  4P96 A;  3TGN A;  1B4A A;  1XDS A;  2QZ8 A;  4ENJ A;  2GZW A;  1R23 A;  5CVR A;  5JVT A;  1LB2 A;  4MQV A;  1ON1 A;  1P2F A;  1H9T A;  2HKX A;  4KUM A;  2HWV A;  3KP3 A;  2V9V A;  3CJN A;  4G9Y A;  1FP1 D;  3WGI A;  4YFX F;  2UXN A;  4HA8 A;  2LF8 A;  1CF7 B;  5CJ9 A;  3KP6 A;  1FY7 A;  3F8C A;  4GO1 A;  3PQK A;  1J9I A;  4UVB A;  4K2E A;  1TLH B;  3FWE A;  5E1X A;  1F4K A;  4CO8 A;  3BOQ A;  3F22 A;  1C0W A;  3TOB A;  3FMS A;  2NYX A;  2IA2 A;  2L02 A;  2F5F A;  4JK1 X;  3QPT A;  2VOO A;  1J5Y A;  1J2X A;  5LGU A;  3ECH A;  3F8M A;  2VN2 A;  4LK0 F;  4U88 A;  1LEB A;  4A6E A;  1YYV A;  1ZLK A;  5LGN A;  2PG4 A;  3JW4 A;  2IA0 A;  2OZ6 A;  3QP6 A;  1V3F A;  2KKO A;  1PUE E;  1FP2 A;  1W7P A;  4G7H F;  3WG9 A;  5AON A;  4I98 B;  3WTW C;  4HDU A;  2HYF A;  1PP8 F;  2P5L C;  5DDG A;  4UV9 A;  4Y17 A;  4IHS A;  4YFK F;  1E17 A;  2HTJ A;  3E6M A;  4G94 A;  3CO6 C;  4A0Z A;  5DD8 A;  4WF2 A;  4OIR F;  2DT5 A;  3GXO A;  1S3J A;  2LNB A;  2O3F A;  2EJR A;  4EMS A;  2M5W A;  1OR7 A;  3KP7 A;  1DP7 P;  1S8N A;  4BHB A;  1KQ0 A;  1J59 A;  3SHF A;  1FBS A;  2YPR A;  4EJW A;  4RGR A;  3TO6 A;  3R0A A;  2XAH A;  1ONV A;  5JR3 A;  1O7L A;  5DUK A;  3IHU A;  4L5J A;  2FA5 A;  4M6X A;  3KP5 A;  3BJA A;  4EJO A;  3DEU A;  2CO5 A;  2B0L A;  1XMA A;  3GFI A;  4MGR A;  3BZ6 A;  3IWZ A;  3JAM K;  3SQN A;  5HLG A;  4M74 A;  3RKW A;  3T5X A;  1ZG3 A;  2KJB A;  6PAX A;  4O3M A;  4HBL A;  1YG2 A;  1L3L A;  2P7V B;  3PFI A;  3MZH A;  2ZNY A;  3MWM A;  1YS7 A;  2W57 A;  2ZBK A;  4I01 A;  1QZY A;  4GCV A;  3J80 K;  4EQQ A;  2HQR A;  5D8L B;  1R58 A;  2FNA A;  3DP7 A;  3HRM A;  1QNT A;  4RGU A;  2VC0 A;  4EM1 A;  1HW1 A;  1QQI A;  4RGX A;  1SMY F;  3QP5 A;  1G3T A;  3COA C;  1ZRE A;  4AIH A;  3O3K A;  4M73 A;  4RB2 C;  2QYO A;  5K5O A;  3N4M A;  5FGM A;  1XSD A;  3D5L A;  1XCB A;  2DPD A;  2P4W A;  3V8L A;  3I4P A;  3NEU A;  2FSW A;  1YLF A;  4KYW A;  5D5X B;  5BMZ A;  2JRT A;  3GLX A;  1OKR A;  4HAM A;  4Q48 A;  2MBF A;  3U1D A;  2YSR A;  2JPB A;  2H6C A;  2HR3 A;  4FT8 A;  3DKW A;  4I09 A;  4BYY A;  1LJ9 A;  3C7J A;  2YX7 A;  2D45 A;  1YW7 A;  4MHG A;  2XAQ A;  3GWZ A;  2ZCW A;  2MLG A;  4GYG A;  5J8F A;  2FQ3 A;  3E5Q A;  1R00 A;  1BIA A;  5KVR A;  4MEY F;  4I7H A;  1W5T A;  3Q5F A;  4XRF A;  5K5R A;  3C1D A;  3K1M A;  3WTZ A;  2WC2 A;  1RUN A;  3GYH X;  3BPX A;  1HST A;  5FD6 A;  2PQ8 A;  1FZP B;  1R5H A;  3RDI A;  3BP8 A;  3EUH A;  3P7N A;  1I27 A;  1FSE A;  2OAZ A;  3MAJ A;  2VT2 A;  4U0Y A;  5LRS A;  3TQN A;  2CSO A;  5ILU A;  3F21 A;  5LHI A;  2P7C B;  1R22 A;  2G9W A;  4G6D A;  4WXC A;  3H92 A;  2V1X A;  1OYW A;  1SFU A;  2ZME B;  1OYI A;  4YII A;  1B1B A;  1OYY A;  5LHH A;  3DV8 A;  2E7W A;  4OIQ F;  3U9G A;  4OMY A;  3RPQ A;  4IF4 A;  2BYV E;  3GX4 X;  3JSO A;  4MQ9 F;  4KIB A;  3GO5 A;  2FF4 A;  3I59 A;  5E20 A;  1A04 A;  4Z2Y A;  1BIB A;  2XKO A;  1TW3 A;  2XUB A;  3KEO A;  1BN5 A;  2HKO A;  1YW9 A;  2NNY A;  2DLL A;  2OZU A;  3KE2 A;  1P4A A;  1WKM A;  3BPV A;  1K78 B;  4PZJ A;  3E6C C;  3KP2 A;  4ZYH A;  2OA4 A;  2QBY A;  2DFI A;  2W84 A;  1WRJ A;  5JFR A;  1D8J A;  3EDP A;  2IP2 A;  3K0L A;  4LG0 B;  1YS6 A;  5D6F A;  2EA4 A;  2OU2 A;  3I53 A;  4Y15 A;  5E1Z B;  3ABU A;  2Q2E A;  4EM2 A;  3BJ6 A;  5DCM A;  3DPL C;  3BRO A;  1Z91 A;  2JTV A;  3KZZ A;  2K86 A;  1ZLJ A;  2BGC A;  2QQA A;  4XSZ F;  3RKY A;  4KMF A;  3HSE A;  1HW5 A;  1ZAR A;  4B8X A;  4N9H A;  2H94 A;  2MC3 A;  5E18 F;  1KU2 A;  3WTX C;  1YQA A;  4M71 A;  1W7P D;  4QWQ A;  2YX4 A;  1ZHF A;  4Q4Z F;  4BAY A;  1UHM A;  3CLO A;  1IXR C;  1XDU A;  3Q9V A;  1JHF A;  5HS8 A;  4WK8 F;  2VOD A;  2XGX A;  4M9Z A;  2M30 A;  4ENN A;  3LWF A;  3RI4 A;  4CHU A;  4KFC A;  5L3G A;  1ZGJ A;  4ZYE A;  1YW8 A;  2EFQ A;  2NS0 A;  3LFK A;  1XGN A;  4LLN A;  4LD5 A;  4HF2 A;  2MA3 A;  2WV0 A;  4LB5 A;  1Z6T A;  4HYE A;  2PLY A;  4NHJ A;  4IJA A;  2FBI A;  1T98 A;  4XLN F;  1XSV A;  2EV0 A;  4AIK A;  1U2W A;  3K1P A;  2G7U A;  3ZQ7 A;  4S05 A;  3AAF A;  4ENK A;  3WE2 A;  2GXB A;  3FM5 A;  2ADU A;  2IJL A;  2QQ9 A;  4HF1 A;  3GUD A;  4XBF A;  3V8J A;  2DAO A;  1LDD A;  4RAZ A;  3K9T A;  1XGS A;  2HGC A;  2HOE A;  5D5W B;  4ON0 A;  1ZYR F;  4A5N A;  3FMQ A;  5JHU A;  5DUI A;  1MDM B;  4ASN A;  5CVU A;  1KYZ A;  4P9F A;  4P9U A;  2D1H A;  2O03 A;  1UCR A;  2F2E A;  1KYW A;  2D1V A;  3L9F A;  3R60 A;  5ICF A;  4KNY A;  4CXF A;  3IKT A;  3V8K A;  2W85 A;  4NB5 A;  1LDK B;  1XD7 A;  5IT9 Z;  1TQP A;  3GW2 A;  4WCG A;  4IHT A;  4M6Y A;  3LA3 A;  1IW7 F;  5LGT A;  3LA7 A;  4L5I A;  1W7P B;  5HDG A;  1TBX A;  5IT9 K;  4H0E A;  4RB3 C;  4IRG A;  1J0R A;  1BJA A;  4L0Y B;  3LQQ A;  2JZY A;  1Z1D A;  2MD5 A;  4ZYD A;  1ODD A;  5F6F A;  4KN4 X;  2QEN A;  3ZMZ A;  3KLN A;  3L7W A;  2BBY A;  3EQL F;  3CUQ A;  1R1U A;  4QLC U;  1KQ8 A;  5DYM A;  3ZP5 A;  4KT5 C;  1FWZ A;  2FRH A;  5HOO A;  2A69 F;  4EM0 B;  4ENM A;  2AXL A;  3MCZ A;  2P6S A;  2L01 A;  4RGS A;  1Z9C A;  2ISZ A;  1FT9 A;  2Y75 A;  3I5U A;  3T0Y A;  2GIV A;  2M45 A;  2H09 A;  4U7D A;  5J8C A;  3WOD F;  4HX8 A;  2V1D A;  3T8T A;  1I6X A;  2Y0M A;  3K1N A;  2QM3 A;  2V6C A;  4MTD A;  3RKX A;  5ILS A;  1BC8 C;  4RB0 A;  1SD5 A;  1QPM A;  3NQO A;  3WU1 B;  1T38 A;  5ED4 A;  3EET A;  2X0L A;  2STT A;  2ZXJ A;  5FFX A;  2OBP A;  5DEQ A;  3BJO A;  1EH8 A;  1T39 A;  2EFW A;  2P8T A;  2FXA A;  2DI3 A;  1FPQ A;  3M7G A;  2IT0 A;  4ZYG A;  3WTU C;  3I64 A;  1RI7 A;  4I2O A;  2A5Y B;  2PJP A;  2HZT A;  2NNN A;  2ISY A;  4HX4 A;  3FM3 A;  3KLO A;  2XKP A;  4ZZD A;  4XLP F;  3CDH A;  2HFH A;  1NHA A;  4EGZ A;  1IN6 A;  5BPD A;  3RTR A;  2STW A;  2YU3 A;  2G7H A;  4LMY A;  1HXD A;  1XSX A;  2O61 A;  2ELH A;  4A5M A;  5EEG A;  1Y0U A;  1HQC A;  4UVC A;  4FHT A;  3GFJ A;  4L9J A;  3QPH A;  4L9N A;  1HKQ A;  1QZZ A;  5J6X A;  3RYP A;  4GYI A;  4WXH A;  3OOP A;  2DTR A;  2R7D A;  3M8F A;  4G6Q A;  2AS5 F;  1G4D A;  4WXD A;  3JAM Z;  1TW2 A;  2O0Y A;  1W4M A;  4OU0 A;  1H0M A;  1IUY A;  1Z6R A;  2LSO A;  2BE5 F;  5FO5 A;  2HTS A;  1W5S A;  2ZNZ A;  1E2X A;  3TDZ C;  4A0X A;  2L3D A;  4EVI A;  3J80 Z;  3FX3 A;  5K1Y A;  1UB9 A;  2EK5 A;  1BM9 A;  1TTY A;  1MZB A;  1B9N A;  1YIO A;  3FZV A;  3HOT A;  3D0S A;  4HF0 A;  3IC7 A;  3KET A;  3VOE A;  2COM A;  4KIC A;  4UV8 A;  1FYM A;  3VFZ A;  2JT1 A;  2DBB A;  2WTE A;  3F23 A;  2A07 F;  2IW5 A;  4R79 A;  3ZPL A;  2QUF A;  1P4X A;  3V4G A;  2XHK A;  2EFO A;  4RAY A;  2VE8 A;  1KU9 A;  1MGT A;  3JSP A;  1K79 A;  3I59 B;  5H20 A;  1ZRD A;  2QVO A;  3DPT A;  3LST A;  2A6H F;  2WWY A;  4BHP A;  1SFX A;  4GGG A;  4LLL A;  4OOI A;  1YFH A;  3QU6 A;  1HSJ A;  5E8I A;  4M72 A;  4L9V A;  2XAJ A;  2W24 A;  2OD5 A;  2QBY B;  3IWF A;  4LK1 F;  1R5G A;  4CYD A;  1U5T A;  4PGG A;  2VE9 A;  1DPR A;  2FBH A;  1RNL A;  3WE3 A;  3LAP A;  1XB4 A;  3ML6 A;  4E70 A;  4F7Z A;  1MJA A;  4HQE A;  2R3S A;  3B73 A;  1FLI A;  4OIO F;  3F6V A;  4CZZ A;  3E6B A;  4Q47 A;  3V7S A;  5FB2 A;  1J7K A;  4LFU A;  2TDX A;  1SAX A;  1ULY A;  3REO A;  5LHG A;  2V1U A;  2P6T A;  2FNP A;  3OV8 A;  5DD4 A;  1FSH A;  1OMI A;  3HSF A;  4LLG F;  4A6D A;  1XCV A;  3IL2 A;  1XGO A;  3QRF F;  5BQT A;  3ROU A;  3RJP A;  2GAU A;  4HZF A;  3R0J A;  4AD9 A;  3TDU C;  1ZAO A;  3E5X A;  1O3T A;  1MJB A;  1S7A A;  4ESB A;  3CUQ C;  1IN8 A;  3BY6 A;  4UXN A;  2DU9 A;  1R1T A;  3SZP A;  4ZH4 F;  3O6B B;  2D2W A;  1FNN A;  1LEA A;  2GA1 A;  3HHG A;  4JBA A;  3JTG A;  3MEX A;  1GVJ A;  1XMK A;  5AIQ A;  3CO7 C;  1PDN C;  3F8B A;  4DNC A;  1IRF A;  1FBQ A;  1LQ1 A;  1JHH A;  3I71 A;  2HS5 A;  3SXY A;  5F1R A;  4FX4 A;  3I54 A;  1WI9 A;  1IN4 A;  3HRS A;  3ZMU A;  3GVA A;  4N9I A;  4L0Z B;  2ESH A;  3NRV A;  2DK8 A;  2FE3 A;  4L9T A;  4MNU A;  3KZY A;  5LLQ A;  5HLH A;  1DPU A;  1WSU A;  4NQW A;  3B02 A;  1SD4 A;  2PN6 A;  3TKY A;  5AIP A;  1FYL A;  4AWX B;  4HLX A;  1V4R A;  4P55 A;  1Q1H A;  2P5V A;  3G73 A;  1O7F A;  1KA8 A;  3WGG A;  2E1C A;  2DQR A;  2VOP A;  1G3W A;  2W25 A;  2M8E A;  3CUQ B;  4G7O F;  1O3S A;  1YTY A;  1USS A;  1KGS A;  2IRF G;  1DUX C;  3RPU A;  1BI1 A;  2CGP A;  4HOB A;  1D8K A;  2RV8 A;  3Q9S A;  2ZME A;  4U7B A;  2ZJ2 A;  5ICE A;  2X4H A;  1D5V A;  3I58 A;  5BS6 A;  1BC7 C;  3R4K A;  3V7C A;  2FMY A;  2ZKZ A;  4BH9 A;  5FLX Z;  4G7Z F;  4N0B A;  5D5V B;  1STZ A;  2DQL A;  2Y48 A;  1KU7 A;  5CYV A;  2VON A;  3S2W A;  2MH9 A;  1P4W A;  1D3Y A;  5FLX K;  4DQ2 A;  1T0F A; 
#chains in the Genus database with same CATH topology
 5L3D A;  3GCM A;  5LEJ A;  4XLE A;  2CQQ A;  3P9C A;  4A3L J;  2Z3Y A;  2P5K A;  2CUE A;  1ZH5 A;  2GM4 A;  1QBJ A;  5HDN A;  3PNV A;  3F8N A;  2LF7 A;  2LR8 A;  4BL0 B;  5HS9 A;  2YUS A;  3DQV C;  1TQI A;  3UNG C;  4Z6Y A;  2BV6 A;  2FU4 A;  1ETV A;  1TNS A;  3CF5 F;  2GXA A;  4JX6 A;  1K7A A;  1W1W E;  3G6E I;  1AA7 A;  1E0E A;  5CVI A;  2H8W A;  1AHD P;  2L54 A;  3WTY C;  4KDP A;  2CG4 A;  3E97 A;  1SVL A;  3HRU A;  2PFB A;  2F4O B;  2RQP A;  2LD5 A;  2M2E A;  1HDD C;  1Z3X A;  3QAH A;  4O6J A;  3W2V A;  1IF1 A;  1Z7U A;  2VBY A;  2X1D A;  1LFU P;  1MMN A;  5K7Z A;  4NUB A;  1EH7 A;  1MND A;  2P81 A;  4IPA A;  1MKM A;  4JX4 A;  4BEH A;  2DA1 A;  2XAS A;  3FHZ A;  5FKL A;  2CJJ A;  4KT6 A;  4IHY A;  4BQN A;  3T8R A;  2XSJ C;  4LGW A;  1F43 A;  1WGX A;  1X1D A;  3CP2 A;  3H5N A;  4P5O A;  4NC6 A;  4IRI A;  2XPW A;  2ZFW A;  4XKB A;  5B1A H;  3A01 B;  3DEE A;  1IAW A;  2CW0 F;  3C18 A;  3K2A A;  1H9G A;  3NAU A;  3H0D A;  3FF5 A;  2A3S A;  3FXQ A;  1RR8 C;  3GF2 A;  3JTH A;  4RLQ A;  2PX9 A;  3U21 A;  4FCY A;  2DMQ A;  3WU0 A;  4EJT A;  1S29 A;  2KIM A;  2BHZ A;  3BTC A;  1G8X A;  2V9K A;  3CP8 A;  3ZN0 A;  1GVD A;  2UZK A;  2RVC A;  1LE8 A;  2DA4 A;  4RM2 A;  5BOX A;  1BI2 A;  3F6O A;  4Y7N J;  1BI0 A;  1O3Q A;  3G2B A;  3H0G J;  3BDD A;  3KEQ A;  1REP C;  2ESN A;  4UUV A;  3E3V A;  2E1N A;  2F4I A;  2MH2 A;  1Z67 A;  4PCQ A;  4LIV A;  2V9P A;  2EV6 A;  2BVL A;  3KYD B;  2B7E A;  2B63 J;  1BR2 A;  4BS9 A;  2OPT A;  1UEL B;  4L18 B;  3BG5 A;  2LYC A;  1LDJ A;  1QRY A;  1U5T C;  2DMP A;  2KP6 A;  4XL9 A;  2BOL A;  3H3U A;  5H2F C;  2KQR A;  5KK1 A;  2WB1 A;  2EZH A;  1A6I A;  1OFC X;  3E1S A;  4MLO A;  4A0Y A;  2HEO A;  3OYI A;  1ZGA A;  4KA4 A;  1ON2 A;  2IS2 A;  1UMQ A;  2DA2 A;  2E36 A;  2UXX A;  4UHT A;  5F0H A;  1BBY A;  5D4R A;  2KIS A;  5CVV A;  4I0B A;  3A2K A;  3FXU A;  4IKF A;  3RIR A;  4EV0 A;  2ECB A;  4EJU A;  1HW2 A;  1F1Z A;  4IXA A;  4WWC A;  1XN7 A;  1FYK A;  3ZXS A;  4U0W A;  1P92 A;  3CTA A;  1MDM A;  3VSL A;  3T1B A;  2HQN A;  1UHW A;  2FOK A;  1TWC J;  1RIO H;  2ME0 A;  1YI2 I;  1JXS A;  2ACJ A;  4S04 A;  4AIJ A;  2K27 A;  5L3C A;  4Y13 A;  3VOD A;  2CUF A;  2VJ5 A;  2IVM A;  3ABK H;  2Q0O A;  1Z3Y A;  4B48 A;  1BW6 A;  1QGP A;  2CQN A;  2M7A A;  2DXI A;  3LQR A;  2XVC A;  1HKT A;  4RB1 A;  2X48 A;  4HLY A;  1ZG1 A;  1BI3 A;  1I3Q J;  1OPC A;  2HDW A;  2J5P A;  4KMU X;  2HPM A;  1T2K A;  3I0T A;  5IPA A;  4X6A J;  2ZJP F;  2L7K A;  4HDV A;  1TL8 A;  1HKS A;  2QLZ A;  1B59 A;  1O57 A;  2R7W A;  1KU3 A;  3TBI A;  1QVU A;  3GLL A;  2VPL A;  2X51 A;  4II2 A;  2VQC A;  3CCU I;  2XAG A;  1FC3 A;  3TP0 A;  3LSI A;  4TV7 A;  3TO9 A;  5TRD A;  2ZB9 A;  3GFL A;  4I02 A;  2Z9O A;  3KCC A;  2RN7 A;  4IX7 A;  1DDN A;  4CIC A;  1AOY A;  3CUO A;  1B8I A;  3KP4 A;  2LBF A;  1VTN C;  1SAN A;  4FX0 A;  4YEJ A;  3K2Z A;  1OCP A;  2QWW A;  2EA2 A;  2PEX A;  2DW4 A;  1MSE C;  5J1Y A;  5ICC A;  1CQT A;  1B72 A;  4PDK A;  5ERI A;  4BHC A;  4GXO A;  1B9M A;  2TRT A;  4D0P A;  4UNO A;  2NXN B;  2IGK A;  5EDN A;  2EPF A;  2Y9Y A;  2VQG A;  1UHS A;  1P7J A;  1MNM C;  2EFP A;  3FKI J;  1FIA A;  5M3M J;  3F72 A;  3S17 J;  3DU5 A;  1U5T B;  5GTH C;  3IKV A;  4XMY A;  2RC4 A;  3K4N A;  3F8F A;  2R7R A;  5M5X J;  3CCM I;  1BOB A;  3VYT B;  1D5Y A;  1HBX G;  4RLF A;  4LOC A;  2F5D A;  1S7O A;  5LRR A;  3HOY J;  2EB7 A;  4AUX A;  3A03 A;  5M3F J;  3K10 A;  2JA5 J;  3WTV C;  4YEL A;  2IS1 A;  5H6R A;  4XOT A;  1JJ8 C;  3O2P E;  1SFE A;  1MW7 A;  3A1Y A;  5F64 A;  1CF7 A;  5E3M A;  2L9S A;  1FBU A;  4KIG A;  3BR2 A;  2Z99 A;  3E6D A;  3CCY A;  2IGN A;  5FKN A;  2H27 A;  4BNC A;  1U9N A;  2HZD A;  1XTA A;  1JKQ C;  2BY0 A;  2DO7 A;  5GAG J;  2VJI A;  1N75 A;  5ILV A;  5K5Q A;  1R49 A;  1ERD A;  1YJ9 I;  3TMO A;  3ZMT A;  3L09 A;  3W6K B;  3S93 A;  3V7R A;  5LBQ A;  2LKP A;  4UB8 C;  4XM3 A;  2CQ7 A;  1IZ1 A;  4IEJ A;  5IT3 A;  3L2W A;  1BL0 A;  4HV5 A;  5HLI A;  3CJQ B;  3OY9 A;  9ANT A;  1MJ9 A;  2CV2 A;  1I3A A;  1XGM A;  3QYE A;  1KON A;  4G8X A;  1YO5 C;  2E19 A;  3ESW B;  5DV5 A;  1Z05 A;  3K4K A;  4LB6 B;  2R93 J;  4ZZL A;  2E7X A;  3L2R A;  3HSR A;  3TOA A;  5CQE A;  2DMU A;  3ZMV A;  1W0T A;  3X2Q H;  2E35 A;  3GZ5 A;  3MFK A;  3HYI A;  3DBR B;  4D9J A;  4Q5S F;  1R7J A;  2NRA C;  2J5O A;  1IN7 A;  4J01 A;  1ACI A;  4B09 A;  1JKP C;  5H6Q A;  2MGQ A;  3HEF A;  2NVU B;  4UUT A;  4XN0 A;  5GAH J;  2OJE D;  4KIT B;  3VSK A;  1HDP A;  3DKX A;  5DS9 A;  3DFG A;  3LSR A;  2JSC A;  5FKK A;  4WX9 A;  3QQA A;  1EF4 A;  1R36 A;  4CGZ A;  2VBZ A;  4R8H A;  4AVP A;  3ZCO A;  4YFN F;  2HNH A;  3SYT A;  1GXP A;  2JWT A;  3RPU D;  4DYR A;  4M9X A;  5ICG A;  1SD7 A;  2KIF A;  2KIU A;  5TJJ A;  3PIO F;  1J75 A;  4OIN F;  3QU3 A;  3HIF A;  1JJ6 C;  3VEP A;  1FOK A;  2BXY A;  3BTI A;  4A2U A;  4DZP A;  3TO7 A;  1PUF B;  3PO2 J;  3AG3 H;  2R5Y B;  1R5I D;  3FK7 A;  3OYF A;  4D7N A;  1TWA J;  2JUC A;  3E5U A;  5FD5 A;  3OYN A;  2P0W A;  2ZME C;  3PQJ A;  3SFZ A;  3KEY A;  1OIS A;  3ASN H;  4HQM A;  1POG A;  2BW3 A;  3BC8 A;  3R6S A;  4EJV A;  2XV4 S;  5JI6 A;  1HOM A;  5L3E A;  4RAF A;  4RDU A;  4LJZ F;  3TW6 A;  2K4B A;  5DCM B;  5LEK A;  1ZRC A;  4PGH A;  3CMM A;  1P6R A;  1E3H A;  3LA2 A;  4KJZ A;  1G6N A;  3ULQ B;  4CCK A;  3ZMS A;  2JVG A;  2O5R A;  1BOA A;  1UST A;  1S9H A;  3Q3S A;  5JLW A;  1B6A A;  5M5Y J;  4C2T A;  2PMZ N;  4KIF A;  2RGV A;  2VL8 A;  1T0F C;  3SDB A;  3PSF A;  5HNF A;  1MH3 A;  3ERE D;  3P9K A;  1I1S A;  1TNT A;  2XIG A;  5FKO A;  1TWH J;  1MBF A;  3W3C A;  2PI0 A;  1SD6 A;  3M9A A;  1Z0X A;  2A5W A;  4BY7 J;  3ZMD A;  2BEO A;  4IO9 F;  1S72 I;  1VZ0 A;  2ZXI A;  4NQW B;  1T6S A;  2DJN A;  2JPC A;  1MD0 A;  3ASO H;  4XR6 A;  4GFB A;  3FBI B;  3P5J A;  3ELK A;  2HXI A;  1LUJ B;  4E7L A;  4U0V A;  2VC1 A;  3GTK J;  3I56 I;  3DXJ F;  2OQG A;  2A6E F;  2OCE A;  2L4M A;  3ABT A;  2CV1 A;  4JQF A;  1JGS A;  1G3S A;  4A3D J;  1PP7 U;  5D5U B;  3QOP A;  4HST A;  1SAU A;  3BWG A;  2VBW A;  1IJW C;  1IRG A;  2VXZ A;  3H3Z A;  1ZN2 A;  2Z1D A;  2K7L A;  3M07 A;  5D6E A;  1QHG A;  4BQA A;  3DF8 A;  2M1B A;  2W1O A;  2VI6 A;  3BTJ A;  3FMR A;  3KX2 A;  4HX7 A;  5FRN A;  3WTT C;  4XKC A;  2IA1 A;  4G6T B;  2F5C A;  5IP9 J;  4BE1 A;  1FOX A;  1VND A;  1MMA A;  4YG2 F;  3FK6 A;  3EYY A;  2F48 A;  3JRE A;  4DBQ A;  5F0C A;  4C2M J;  5LD2 C;  4BGD A;  3N97 A;  3GME A;  4XIC A;  5GPA A;  2L7M P;  1GLN A;  2EV5 A;  4GDF A;  4M6V A;  2O7O A;  3FDY A;  1VQ6 I;  1WQ2 A;  1APL C;  4RM3 A;  2LP0 A;  4OWR B;  2LDU A;  1U3E M;  4CA0 A;  1GXQ A;  2GBY A;  3F3X A;  1U78 A;  2JA7 J;  2OF7 A;  2PBI A;  1MMD A;  1RR7 A;  1SMT A;  2OQR A;  5EG0 B;  1LVA A;  2LY9 A;  4HW0 A;  4BJ6 C;  2XRO A;  1ZRF A;  2WY8 Q;  3PNY A;  1N78 A;  1QZE A;  2EIN H;  3HOW J;  3I4M J;  2O8X A;  3G3Z A;  3M8E A;  1YE9 A;  2K5C A;  5FRO A;  2GA2 A;  3ISP A;  3GEZ A;  5JHF A;  5J1R A;  1BJZ A;  1ETQ A;  1FX7 A;  1YJW I;  2IPQ X;  4BBS J;  1QHH D;  2COB A;  1V5E A;  5K7H A;  2JUG A;  1KQ9 A;  1IV8 A;  1F9N A;  2UV1 A;  5J4V A;  1FOW A;  2NAZ A;  1H89 C;  1CGP A;  2LK2 A;  3PL8 A;  5D8K B;  1QO0 D;  2ZC2 A;  4ESJ A;  3M3Y J;  4OMZ A;  2GQQ A;  2FD5 A;  3EYI A;  1Y8R B;  2CWE A;  2NS8 A;  4HEA 2;  2GWR A;  2EBI A;  1W5C C;  3HOX J;  4XSX F;  3KFW X;  2VJ4 A;  2CYY A;  3M1E A;  3L2C A;  5EEH A;  1HLV A;  3GFM A;  3HHH A;  4MTE A;  2EH3 A;  4UVA A;  5L3F A;  2KHM A;  4CCM A;  2V79 A;  5JVG F;  1K6O A;  2CV0 A;  1SVO A;  2G0E A;  3IRQ A;  3HTS B;  2XF5 A;  3VB2 A;  1VQK I;  5E17 F;  2UWM A;  2Y0S N;  1EV7 A;  1S6L A;  3HJE A;  4CCL A;  5CVJ A;  3MZY A;  2VT3 A;  2H6B A;  2XAF A;  5L3B A;  5D4S A;  5EEA A;  2VLA A;  4M9S A;  4H4K C;  5EGO A;  3OYA A;  4O5V A;  2JVH A;  1EA3 A;  1LNW A;  4RS8 A;  2ZXW H;  4IQJ A;  2YR2 A;  3MQ0 A;  4IZZ A;  3ZN1 A;  5HS7 A;  3BR1 A;  1UFM A;  4HG2 A;  2JJ7 A;  5F04 A;  3UR3 C;  1AKH A;  2FEZ A;  3FHN A;  1X19 A;  3WGH A;  2CFX A;  2VBX A;  1WWX A;  1S7E A;  2LMD A;  1IXC A;  5E8G A;  1LVK A;  1D0X A;  1U6G A;  3PNT A;  4Y33 A;  1WJF A;  1K6Y A;  1WJB A;  2K02 A;  3TL4 X;  1G3Y A;  3MKW B;  1U0J A;  1GHC A;  2Y31 A;  1ZR4 A;  1VQM I;  3K6G A;  2RKH A;  3WTS C;  2CS3 A;  3CZ6 A;  1IXS B;  3HUG A;  3NAR A;  2DK5 A;  4E4H A;  5HDK A;  4HV6 A;  2A61 A;  2K4J A;  2KJC A;  2MLK A;  3MKY B;  1LE8 B;  1AWC A;  1WH7 A;  5F27 A;  2ETH A;  1V5G A;  1Y6I A;  1RZ4 A;  1U8R A;  3S1N J;  5F0F A;  4CYC A;  2JK3 A;  2M0C A;  3LSP A;  1F5T A;  2M87 A;  4IVN A;  5CLS A;  3L00 A;  4XOR A;  4ETS A;  3WHB A;  1PJR A;  4EGY A;  2V4J C;  4XN3 A;  2PMH A;  5FJ8 J;  2JA6 J;  2FBK A;  1VF9 A;  2KRF A;  2PMU A;  2NVX J;  2L4A A;  4JYK A;  3P9I A;  4KN7 X;  4I0A A;  3BCA A;  4M3F A;  3IRR A;  1ZG5 A;  2H8R A;  2XB5 A;  4D7M A;  4YIF A;  1I50 J;  3K69 A;  2DMT A;  2R7F A;  1RKW A;  2A68 F;  3FXR A;  4XLH A;  2HDD A;  2CQK A;  1R1V A;  3JRD A;  1IN5 A;  4A12 A;  3L2Q A;  3U2R A;  2F5E A;  1ETX A;  2NOG A;  2I8D A;  3RYR A;  1FMV A;  3DLA A;  2DMN A;  2BHY A;  3CDI A;  3HTU A;  2HVS A;  1W0U A;  1O3R A;  2EWN A;  2KMU A;  4CDG A;  2ZJQ F;  2PMZ A;  1K78 A;  3DPU A;  3GZ6 A;  3MMY B;  3OSG A;  2ZO4 A;  5E1W A;  3SZT A;  1ZR2 A;  4P1W A;  2LVS A;  1EH6 A;  2RDP A;  3J81 Z;  1X1P A;  5A2Q Z;  3CCE I;  3R61 A;  3HOS A;  3GTP J;  2TCT A;  2ELJ A;  4ESF A;  1RKT A;  2Q8K A;  4BXU A;  5GAD J;  3S1R J;  5BPI A;  2CU7 A;  3BQY A;  4HNU A;  2OCC H;  2OV7 A;  4R1H A;  3J81 K;  2DPU A;  3QOD A;  4LG0 A;  4IRH A;  4MIM A;  5A2Q K;  2KZV A;  2XRN A;  4ZYA A;  2O6G E;  3W6V A;  1X2M A;  5FFZ A;  5DCF A;  1LPQ A;  3ECO A;  1L0O C;  4OIP F;  2GXG A;  3Q0V A;  1X3U A;  2EFN A;  1SVM A;  1RUO A;  3D5S C;  4B1R A;  3CME I;  1JE8 A;  2C6Y A;  2M4G A;  1I1G A;  2FML A;  4PJ0 C;  4UB6 C;  2QQB A;  5HVQ C;  5FRM A;  3MKZ A;  2Z5U A;  3HRT A;  2MG4 A;  4B4C A;  2W00 A;  1OCZ H;  2BY2 A;  4MEX F;  2Z33 A;  3J7A O;  1I5Z A;  3LAJ A;  3W6J B;  4XKW A;  5DTD A;  2XGC A;  2CUJ A;  3C3W A;  3HL2 A;  2HDC A;  2L7Z A;  3OOU A;  1TQM A;  1WCM J;  2HYG D;  2RNJ A;  1B8I B;  4P96 A;  3CD6 I;  2HYJ A;  2EIJ H;  5HOD A;  3TGN A;  1G2H A;  1B4A A;  1XDS A;  3CC7 I;  3QPS A;  1ETY A;  2M8G X;  2QZ8 A;  4DYC A;  2W7N A;  4ENJ A;  2GZW A;  1B72 B;  2HVR A;  1R23 A;  1R4N B;  4F55 A;  5GAE J;  2L0K A;  2WAQ N;  2WAE A;  4XRM A;  5CVR A;  2MD0 A;  5JVT A;  3IH4 A;  3HOV J;  1LB2 A;  4MQV A;  1ON1 A;  1P2F A;  1XPX A;  1H9T A;  2MSY A;  3SZG A;  3OL4 A;  2HKX A;  2I5U A;  3JRG A;  4X1E A;  2VQL A;  4KUM A;  1ORK A;  2DOD A;  3HZJ A;  4B47 A;  2HWV A;  3QOE A;  4HSR A;  2CMP A;  2VPR A;  3KP3 A;  4BJ5 C;  3OYJ A;  2V9V A;  1R4M B;  4XON A;  3CJN A;  3QYF A;  4G9Y A;  1FP1 D;  3WGI A;  1NK3 P;  2PJR A;  5CQG A;  1K83 J;  4YFX F;  5B5E C;  2UXN A;  3IAM 2;  1W36 C;  2QKL B;  4HA8 A;  1VQ5 I;  2IEK A;  2LF8 A;  1BR4 A;  2X1C A;  4W1U A;  1CF7 B;  5CJ9 A;  3KIO A;  3KP6 A;  1FJL A;  1FY7 A;  2JMW A;  2K9N A;  3F8C A;  4RBO A;  1MSF C;  2QSG X;  4GO1 A;  3PQK A;  4E7J A;  1J9I A;  4PFO A;  3BCB A;  3MVP A;  3OWT A;  3RQ4 A;  4UVB A;  1JTX A;  2BZT A;  1TLH B;  4K2E A;  3FWE A;  5E1X A;  4D1Q A;  1F4K A;  4CO8 A;  3BOQ A;  5J47 A;  3F22 A;  1C0W A;  1LKX A;  3H1C A;  1V55 H;  2XF6 A;  4OAY A;  4F92 B;  3CCV I;  3TOB A;  3FMS A;  2NYX A;  2IA2 A;  5IOY A;  2L02 A;  1ENH A;  2F5F A;  4JK1 X;  2V26 A;  3BZC A;  1D0Y A;  3O8H A;  4PJM A;  3QPT A;  2VOO A;  2ZFU A;  3OIO A;  4BDZ A;  4KIS A;  1GT0 C;  1J5Y A;  1J2X A;  3G4S I;  5LGU A;  3ZQL A;  4II3 A;  3ECH A;  2RNG A;  3F8M A;  2VN2 A;  2A05 A;  4LK0 F;  4U88 A;  1LEB A;  3OYM A;  3JRB A;  4W97 A;  4A6E A;  1YYV A;  3M8J A;  1ZLK A;  3S3N A;  2LRD A;  1JUP A;  2W48 A;  2M3A A;  1Y56 A;  5LGN A;  2PG4 A;  3JW4 A;  3H5R A;  2IA0 A;  2M9H A;  3ZOB A;  4FAS D;  4F93 B;  5GPC A;  2DDA A;  2OZ6 A;  3QP6 A;  5F1J A;  1V3F A;  2X9D A;  3IH3 A;  1MMS A;  2KKO A;  1PUE E;  1FP2 A;  2IBD A;  3BG9 A;  1VQP I;  1W7P A;  2XDV A;  4G7H F;  2N8G A;  3SFI A;  3OYD A;  3WG9 A;  5AON A;  4A3J J;  3Q0W A;  1MBE A;  3ABL H;  4I98 B;  4ZDP A;  1OCC H;  3WTW C;  1K4S A;  1OQY A;  3FXO A;  4HDU A;  2HYF A;  1Z7L A;  4B43 A;  4E6K G;  1XS9 A;  5IYB J;  3S1M J;  3U1K A;  2HQA A;  2P5L C;  2BY3 A;  5DDG A;  1PP8 F;  3LOC A;  4UV9 A;  1DGW Y;  4Y17 A;  4IHS A;  4YFK F;  2JSP A;  1E17 A;  2HTJ A;  3E6M A;  4G94 A;  3CO6 C;  3A01 A;  3DTI A;  4A0Z A;  2BW3 B;  5DD8 A;  4WF2 A;  1JTY A;  4CCO A;  4OIR F;  1Z77 A;  2DT5 A;  1MBH A;  1T08 B;  3GXO A;  1GDT A;  1S3J A;  2HI3 A;  2LNB A;  2V1N A;  2VKH A;  3LSM A;  4AM3 A;  2OC6 A;  5TGT A;  1IRZ A;  2O3F A;  4DYQ A;  2EJR A;  1BW5 A;  4EMS A;  4XLC A;  2M5W A;  1OR7 A;  3PUB A;  1RET A;  4FIS A;  2XB0 X;  3KP7 A;  1DP7 P;  2M0M A;  1NG6 A;  4IL6 C;  1S8N A;  4BHB A;  1KQ0 A;  2JA2 A;  1J59 A;  3SHF A;  1FBS A;  2XRL A;  2E34 A;  2YPR A;  4RGR A;  4EJW A;  2K85 A;  3TO6 A;  3R0A A;  4PJL A;  2XGE A;  2V7F A;  3CC2 I;  2XAH A;  1ONV A;  1NG7 A;  5JR3 A;  4UY8 I;  1O7L A;  5DUK A;  3IHU A;  3JRI A;  4L5J A;  1HF0 A;  2FA5 A;  4M6X A;  3KP5 A;  5KHD A;  5IP6 A;  1YOV B;  1OCT C;  3BJA A;  4EJO A;  4BXF A;  3DEU A;  2CO5 A;  1D1A A;  1XMA A;  2B0L A;  2R5Z A;  3GFI A;  3ZR8 X;  4MGR A;  3VYU B;  3BZ6 A;  2DCE A;  3HDD A;  3IWZ A;  3JAM K;  3SQN A;  5HLG A;  3OR1 C;  3O8G A;  4M74 A;  3RKW A;  3T5X A;  1D1B A;  1ZG3 A;  2KJB A;  6PAX A;  4O3M A;  2VUM J;  4HBL A;  1ETW A;  1YG2 A;  1MIJ A;  3OYB A;  1L3L A;  2P7V B;  3PFI A;  3D5R C;  3MZH A;  4DGW B;  4BKX A;  2WBM A;  3F0C A;  3C2B A;  3S3O A;  2ZNY A;  4BDY A;  1FTZ A;  2ID6 A;  2Q1Z B;  1JKO C;  3VWB A;  3MWM A;  4UUS A;  1YS7 A;  2ZXH A;  2W57 A;  2ZBK A;  3GTM J;  4I01 A;  1QZY A;  2EZI A;  4GCV A;  1D1C A;  1SFO J;  1RC9 A;  3J80 K;  4EQQ A;  4PUS A;  2R0Q C;  3N05 A;  2LY1 A;  1VQ7 I;  2HQR A;  5D8L B;  1R58 A;  2FNA A;  2JN6 A;  3DP7 A;  3BT9 A;  3HRM A;  4S0H B;  1IGN A;  1QNT A;  4RGU A;  1YX5 A;  2VC0 A;  4EM1 A;  1HW1 A;  1QQI A;  2EIM H;  4RGX A;  1UG0 A;  1SMY F;  3QP5 A;  2ME6 A;  1G3T A;  3COA C;  3WHC A;  2DFF A;  1ZRE A;  4AIH A;  5E3L A;  2VKE A;  3O3K A;  4BU2 A;  4LG3 A;  3FXK A;  4M73 A;  4RB2 C;  3LSK A;  4YRV A;  5M5W J;  1VQO I;  4XRS G;  1WI3 A;  1MH4 A;  1AU7 A;  2QYO A;  5K5O A;  3N4M A;  1OJL A;  4IQ4 A;  5FGM A;  1GV5 A;  1XSD A;  3D5L A;  4DZJ A;  2VKV A;  3JRF A;  2E60 A;  2DOA A;  1RRJ A;  3HB9 A;  1XCB A;  1ZGW A;  4IHV A;  2DPD A;  2P4W A;  3V8L A;  1X4P A;  3I4P A;  2EZK A;  3NEU A;  4NBQ A;  1ZKG A;  2FSW A;  1YLF A;  2NS7 A;  2DT7 B;  1VQ9 I;  3D1N I;  4KYW A;  4L5E A;  2AHQ A;  3M4O J;  5D5X B;  5BMZ A;  5J40 A;  2AQE A;  3G1O A;  3AG1 H;  3DU6 A;  3RZO J;  2JRT A;  3QPL A;  3GLX A;  1OKR A;  2QSF X;  4HAM A;  4Q48 A;  2MBF A;  2X6X A;  3U1D A;  2DFH A;  2YSR A;  2JPB A;  1YHQ I;  1UZC A;  2W4S A;  2H6C A;  4FET A;  2HR3 A;  1TT5 B;  2XF7 A;  3DKW A;  4FT8 A;  4I09 A;  4QSH A;  4BYY A;  1LJ9 A;  2R7Q A;  4Y52 J;  3C7J A;  4EEF G;  2BY1 A;  2YX7 A;  1IO2 A;  2D45 A;  1YW7 A;  4MHG A;  2XAQ A;  4BY1 J;  3GWZ A;  2ZCW A;  2MLG A;  4GYG A;  5J8F A;  2EZL A;  2WAF A;  4HNV A;  4IHX A;  1TWF J;  2FQ3 A;  3E5Q A;  1WZ2 A;  4M3G A;  3DCF A;  1DGR M;  4F91 B;  1R00 A;  1HC8 A;  1BIA A;  2HXO A;  2KPM A;  5KVR A;  4MEY F;  2K3P A;  1JT0 A;  1X3Z B;  4I7H A;  4MFE A;  2H1K A;  2NVQ J;  3HGG A;  1W5T A;  2XPU A;  4PFP A;  5GTI C;  3Q5F A;  2EQR A;  4XRF A;  2Y30 A;  5K5R A;  2DDB A;  3C1D A;  5DM6 F;  3K1M A;  3WTZ A;  2WC2 A;  2R7X A;  3I55 I;  2BVM A;  2L9V A;  1RUN A;  3CES A;  3GYH X;  3BPX A;  1HST A;  2HPI A;  1E3O C;  5FD6 A;  5K7F A;  2PQ8 A;  3IAS 2;  3I3L A;  2L5Q A;  4C3H J;  1R5H A;  3RDI A;  1FZP B;  3BP8 A;  3EUH A;  3P7N A;  1I27 A;  4XOP A;  3HG9 A;  2E5N A;  1FSE A;  2OAZ A;  2CH0 A;  1FIP A;  4IOA F;  3MAJ A;  3DEW A;  2VT2 A;  3DKY A;  4U0Y A;  3J7Y J;  3QYB A;  5LRS A;  2K3F A;  3TQN A;  5KAF C;  2IGO A;  2CSO A;  2QEX I;  1RPW A;  1M1E B;  5ILU A;  3F21 A;  5LHI A;  2P7C B;  2WY7 Q;  2KRH A;  1R22 A;  2G9W A;  4G6D A;  4WXC A;  1XX5 A;  2R7Z J;  4I6Z A;  3H92 A;  2V1X A;  1OYW A;  3K70 C;  2E2J J;  1SFU A;  3NWS A;  2ZME B;  1OYI A;  4YII A;  4B3X A;  1B1B A;  1OYY A;  4M3D A;  5LHH A;  3DV8 A;  2E7W A;  4OIQ F;  3U9G A;  4OMY A;  5EZG A;  2FUG 2;  3RPQ A;  1ZEL A;  4IF4 A;  4A3M J;  2BYV E;  1J09 A;  3JSO A;  3GX4 X;  3DTK A;  2DOE A;  2MC4 A;  1JT6 A;  4YIR X;  4MQ9 F;  3S2H J;  4KIB A;  4BBR J;  4CCN A;  3GO5 A;  2FF4 A;  2F5V A;  5KCM A;  3OYK A;  3I59 A;  4I76 A;  4M3B A;  1A04 A;  5E20 A;  2HOT A;  4Z2Y A;  1BIB A;  2XKO A;  1TW3 A;  2LC2 A;  3W2W A;  2XUB A;  3KEO A;  1KZH A;  1BN5 A;  2DJI A;  3LSG A;  3S3M A;  2HKO A;  2WAD A;  2DA5 A;  1YW9 A;  2NNY A;  2DLL A;  2E2H J;  2OZU A;  3KE2 A;  1P4A A;  1WKM A;  3BPV A;  2VQH A;  3GTJ J;  1K78 B;  3OYG A;  2VXD A;  2CW8 A;  4PZJ A;  3E6C C;  3DTE A;  2X6W A;  3KP2 A;  1FMW A;  2CRG A;  1IRX A;  5GP9 A;  4ZYH A;  5IP7 J;  2OA4 A;  3PJR A;  3AL0 C;  1RES A;  1WJA A;  2QBY A;  2DFI A;  4ZTF A;  1YRN A;  2W84 A;  2NVT J;  2L2O A;  1WRJ A;  4GRI A;  2KT0 A;  5JFR A;  1D8J A;  4PJN A;  3HKZ N;  2FQ4 A;  3EDP A;  2DA3 A;  2LOO A;  2IP2 A;  2VAS A;  3K0L A;  3KYC B;  3JRH A;  3RSN A;  4LG0 B;  1YS6 A;  5D6F A;  2EA4 A;  2OU2 A;  3I53 A;  4Y15 A;  3K4M A;  5E1Z B;  1T95 A;  1T33 A;  1IG7 A;  3ABU A;  2Q2E A;  3LFU A;  4F52 A;  2WB1 N;  4EM2 A;  3BJ6 A;  5DCM A;  3DPL C;  3BRO A;  1Z91 A;  2JTV A;  3KZZ A;  2K86 A;  1WPK A;  1ZLJ A;  2VKD A;  2BGC A;  2QQA A;  4XSZ F;  3H5A A;  3RKY A;  5C4X J;  1U8B A;  5B1B H;  5CKT A;  4KMF A;  5J1U A;  3HSE A;  1OCR H;  1HW5 A;  1ZAR A;  4B8X A;  2OTL I;  3SEQ A;  4N9H A;  2H94 A;  4BEH B;  2ZSI B;  2LKS A;  4DBR A;  3SJM A;  2QQ8 A;  2MC3 A;  5E18 F;  2QF7 A;  1KU2 A;  3MN2 A;  1X3W B;  3JR9 A;  2M34 A;  3WTX C;  1YQA A;  4M71 A;  4BUP A;  1W7P D;  2LRE A;  2K40 A;  2YS9 A;  3V42 A;  4QWQ A;  2YX4 A;  1ZHF A;  4Q4Z F;  2Y2Z A;  4BAY A;  1UHM A;  3CLO A;  2KZG A;  1IXR C;  1OCO H;  2EIK H;  4NNJ A;  1XDU A;  3Q9V A;  1JHF A;  4QPQ A;  4C3I J;  2HOS A;  1VFC A;  5HS8 A;  4WK8 F;  2VOD A;  2CQX A;  1A31 A;  3KZI C;  5EYR A;  3H36 A;  4FE7 A;  4DOZ A;  2XGX A;  2L9N A;  1MBJ A;  1K61 A;  1VQL I;  3CCS I;  4M9Z A;  2M30 A;  4ENN A;  3LWF A;  3RI4 A;  4CHU A;  4KFC A;  4HPQ A;  5L3G A;  1ZGJ A;  4ZYE A;  4E7K A;  1YW8 A;  3TP3 A;  1P9Q C;  2EFQ A;  2NS0 A;  3LFK A;  2PJR B;  1XGN A;  3OS0 A;  4LLN A;  3MD2 A;  4LD5 A;  3K4C A;  3WG7 H;  2MA3 A;  5J4Y A;  4HF2 A;  2WV0 A;  3HOZ J;  4LB5 A;  1Z6T A;  2MW8 A;  4HYE A;  4BQO A;  1SEU A;  2PLY A;  4NHJ A;  4IJA A;  2DN0 A;  1I39 A;  1T98 A;  2FBI A;  4XLN F;  1XSV A;  1ETK A;  2EV0 A;  4AIK A;  1U2W A;  3K1P A;  1OR7 C;  2G7U A;  3ZQ7 A;  4S05 A;  3AAF A;  2KRC A;  4ENK A;  3WE2 A;  2GXB A;  3AL0 B;  3FM5 A;  2ADU A;  2X1E A;  3FIS A;  5KNL A;  2IJL A;  2QQ9 A;  4M3E A;  4ZC3 A;  5EG0 A;  4HF1 A;  3I4N J;  3GUD A;  3CCR I;  4XBF A;  4Y3O A;  3V8J A;  3ZQQ A;  2DAO A;  1LDD A;  4RAZ A;  3K9T A;  1XGS A;  2DOF A;  2ID3 A;  2UUZ A;  2HGC A;  2HOE A;  4A69 C;  5D5W B;  4ON0 A;  1ZYR F;  3CQZ J;  3PM1 A;  4A5N A;  3BR3 A;  3FMQ A;  5JHU A;  3ZQG A;  5DUI A;  1MDM B;  4XID A;  4Y4R A;  4ASN A;  5CVU A;  1LFB A;  3E0J B;  4DIQ A;  5HNH A;  3SEZ A;  5FLV A;  3WU2 C;  2CW7 A;  5C44 J;  1KYZ A;  4P9F A;  4P9U A;  2D1H A;  1X58 A;  2O03 A;  1UCR A;  3PSI A;  2F2E A;  1KYW A;  2D1V A;  1TC3 C;  4G12 A;  3G71 I;  3L9F A;  2HU9 A;  3R60 A;  1GUU A;  4LIU A;  5ICF A;  4CXF A;  4KNY A;  3OIP A;  3A4C A;  2E1O A;  3IKT A;  2OTJ I;  3V8K A;  2W85 A;  4JOM A;  4NB5 A;  4DW6 A;  2R7S A;  1LDK B;  5EZH A;  3EUK L;  5E79 C;  1XD7 A;  4ZDL A;  3CF2 A;  2JRM A;  4XK4 A;  1VQN I;  3JRA A;  3F9K A;  5IT9 Z;  1TQP A;  3GW2 A;  4WCG A;  4IHT A;  4M6Y A;  3LA3 A;  4N4N B;  3J7Z I;  1IW7 F;  4E7S A;  5LGT A;  3UKG A;  3LA7 A;  4L5I A;  2R7T A;  1W7P B;  5HDG A;  1MNE A;  3G1L A;  2LBF B;  1TBX A;  4CCJ A;  4V2F A;  5IT9 K;  4H0E A;  4RB3 C;  3CJR B;  4IRG A;  3S2D J;  1J0R A;  1BJA A;  4XQF A;  2HVQ A;  3BR5 A;  3JCU C;  2FJ1 A;  4L0Y B;  3LQQ A;  2JZY A;  1Z1D A;  3S16 J;  2MD5 A;  3K4L A;  4ZYD A;  1ODD A;  5F6F A;  5B66 C;  5JLX A;  3DLL F;  1JI8 A;  3S1Q J;  4ABZ A;  2XAU A;  4KN4 X;  2WV1 A;  2QEN A;  1W36 D;  3ZMZ A;  4PSX A;  3KLN A;  3L7W A;  3OS1 A;  1PYV A;  2BBY A;  3EQL F;  4IHW A;  3CUQ A;  1R1U A;  3ZQI A;  3GBG A;  4QLC U;  2DTZ A;  1KQ8 A;  4NC8 A;  5J3L A;  3OS2 A;  5DYM A;  3LSH A;  4KT5 C;  1FWZ A;  3ZP5 A;  1FEX A;  2FRH A;  5HOO A;  2A69 F;  2GIZ A;  4EM0 B;  4C9Y A;  4ENM A;  1XG1 A;  3H3V K;  2AXL A;  3MCZ A;  2P6S A;  2L01 A;  4RGS A;  1Z9C A;  2ISZ A;  1FT9 A;  1YJN I;  2Y75 A;  3I5U A;  3T0Y A;  2GIV A;  2IGM A;  2A6T A;  2M45 A;  1X1C A;  2H09 A;  5IOZ A;  3HKZ A;  5IYC J;  4U7D A;  3AG2 H;  4CUG A;  2R5Z B;  1XC5 A;  4N4O B;  3IUO A;  5J8C A;  3WOD F;  4HX8 A;  2OUM A;  1GV2 A;  2Y0S A;  2V1D A;  3T8T A;  2ICW G;  4A3I J;  4U87 A;  1I6X A;  2Y0M A;  1UG2 A;  3K1N A;  1ZQ3 P;  2QM3 A;  2V6C A;  4MTD A;  4ZTJ A;  3RKX A;  4A3C J;  5ILS A;  4F3Q A;  4A3G J;  4AID A;  1BC8 C;  4RB0 A;  4B3A A;  2F4M B;  1V54 H;  3HC7 A;  3HGY A;  2KLO A;  1SD5 A;  1QPM A;  2QA4 I;  3NQO A;  3VDX A;  3WU1 B;  1T38 A;  1F36 A;  2R7U A;  4PSW A;  5ED4 A;  3EET A;  2X0L A;  4BAC A;  2STT A;  2AQF A;  2ZXJ A;  4D5C A;  1VQ8 I;  4UUS B;  3HXL A;  5LFA A;  4E7I A;  4C30 A;  5FFX A;  3RKQ A;  1QPI A;  2OBP A;  3K7A J;  3VPR A;  5DEQ A;  4PJJ A;  4CSW A;  3BJO A;  1EH8 A;  2XPV A;  1T39 A;  2EFW A;  1WFX A;  2P8T A;  2R7O A;  2FXA A;  2DI3 A;  2E2I J;  4LIT A;  1SC7 A;  1FPQ A;  3M7G A;  2IT0 A;  1VI0 A;  4ZYG A;  3ZQH A;  5B3S H;  3S32 A;  5EF6 A;  3WTU C;  3EUH C;  3I64 A;  3JRC A;  1RI7 A;  4I2O A;  1A36 A;  2A5Y B;  2PJP A;  2HZT A;  2NNN A;  2ISY A;  1XMX A;  4HX4 A;  4AU7 A;  3FM3 A;  3KLO A;  2XKP A;  2VJJ A;  4ZZD A;  4CH7 A;  1MBG A;  1H8A C;  4XLP F;  2L7F P;  3CDH A;  2HFH A;  3C2G A;  4XKV A;  3PIP F;  1MMG A;  2Y69 H;  3A02 A;  2EIL H;  2FOW A;  1NHA A;  2QSH X;  5IY5 H;  4EGZ A;  1IN6 A;  5BPD A;  3RTR A;  3BG6 A;  5FKM A;  3A0B C;  2STW A;  2YU3 A;  2G7H A;  2R4G A;  4LMY A;  1HXD A;  1XSX A;  2O61 A;  2ELH A;  3BLY A;  4A5M A;  2GOM A;  5EEG A;  1Y0U A;  1HQC A;  2IXS A;  4UVC A;  3BZK A;  4FHT A;  1JUS A;  3GFJ A;  4L9J A;  3QPH A;  4L9N A;  5C3E J;  2CUZ A;  1HKQ A;  1QZZ A;  5J6X A;  3RYP A;  4FE4 A;  4FTH A;  2HOA A;  1ZTR A;  4QPO A;  1QA6 A;  4HRI A;  1Y1W J;  4GYI A;  4WXH A;  3OOP A;  2DTR A;  2MYS A;  2R7D A;  3M8F A;  3OR2 C;  4G6Q A;  2AS5 F;  1G4D A;  4WXD A;  3JAM Z;  1TW2 A;  1NTC A;  2K9M A;  2O0Y A;  3BG7 A;  1WHU A;  1W4M A;  3Q0U A;  4AYB N;  2LG4 A;  3FKJ A;  4OU0 A;  1Q1V A;  2LFB A;  1H0M A;  3ABM H;  2RRE A;  1N25 A;  1IUY A;  4XLF A;  1IC8 A;  3BR6 A;  1Z6R A;  2LSO A;  3BG3 A;  3CCQ I;  1TT0 A;  2BE5 F;  5FO5 A;  2O8K A;  2HTS A;  1W5S A;  2ZNZ A;  1E2X A;  2L9R A;  3TDZ C;  1ZK8 A;  1R71 A;  3HPG A;  2W82 A;  4A0X A;  2L3D A;  2RAE A;  4EVI A;  3J80 Z;  1BR1 A;  3K4J A;  1NK2 P;  5CPR B;  2KDO A;  2E5Z A;  2KFD A;  3FXL A;  1MBK A;  2DT6 A;  3FX3 A;  5KAI C;  5TIS C;  1WVR A;  5K1Y A;  4QTR A;  1UB9 A;  1ITY A;  3OYE A;  2H1L A;  1WJ5 A;  2EK5 A;  2MAB A;  1BM9 A;  3AFH A;  1TTY A;  1MZB A;  1B9N A;  4A93 J;  1EJ9 A;  1YIO A;  1YX3 A;  3DWL E;  3FIW A;  4QIW N;  1WJD A;  3FXJ A;  3KPH A;  1YIT I;  4XNF A;  3FZV A;  2FX0 A;  3HOT A;  2O9L A;  3D0S A;  4HF0 A;  3E7L A;  2V6E A;  2HQ5 A;  2DYS H;  3IC7 A;  2E1M C;  3KET A;  2WAQ A;  5HLT A;  3J7A Y;  1DP3 A;  3VOE A;  3FBN B;  2COM A;  1IDY A;  4KIC A;  1S5L C;  1Z21 A;  1TWG J;  2Z16 A;  5C4J J;  1HA8 A;  4UV8 A;  2IAI A;  1FYM A;  4EAT A;  2E71 A;  4NC7 A;  1TZL A;  2JT1 A;  3VFZ A;  2DBB A;  2XGD A;  2WTE A;  3F23 A;  1R6R A;  3OYL A;  2A07 F;  2IW5 A;  4R79 A;  3ZPL A;  4E7Z A;  2QUF A;  3EPZ A;  1P4X A;  3B6C A;  3V4G A;  2XHK A;  4A3K J;  2EFO A;  3MZ8 A;  4RAY A;  2NVY J;  2VE8 A;  1KU9 A;  1MGT A;  1Y8Q B;  3JSP A;  3L2U A;  3GTL J;  1K79 A;  3I59 B;  5H20 A;  1ZRD A;  2QVO A;  2LKX A;  3DPT A;  3CJT B;  3LST A;  1X4O A;  4IOC F;  2A6H F;  2WWY A;  4D5F A;  4BHP A;  4ZJZ A;  1SFX A;  4BE2 A;  4V19 K;  4RAG A;  4A3B J;  1LFP A;  4GGG A;  4LLL A;  3BQZ A;  4OOI A;  2ELK A;  4JP0 A;  1YFH A;  5FLM J;  3QU6 A;  1HSJ A;  5E8I A;  4M72 A;  4L9V A;  2XAJ A;  3ZQC A;  1VQ4 I;  3LSJ A;  1UAA A;  3EUA A;  2W24 A;  1QU3 A;  2OD5 A;  4ITV A;  2QBY B;  3IWF A;  4LK1 F;  3ZGK A;  1R5G A;  3K4B A;  1YRN B;  1EKE A;  4CYD A;  1U5T A;  1IUF A;  4PGG A;  3VYS B;  4BE0 A;  1ETO A;  1WJE A;  4I99 C;  2IS4 A;  2VE9 A;  1DPR A;  1E3P A;  2FBH A;  3CMA I;  1RNL A;  4PK4 A;  2KDZ A;  2KL4 A;  3OIQ A;  3WE3 A;  2Q2E B;  1JUM A;  1DU0 A;  1IV6 A;  3IP4 B;  3LAP A;  2VB6 A;  3CLQ A;  3NWT A;  2JQ7 A;  5EGO B;  1XB4 A;  4XLA A;  3ML6 A;  4E70 A;  4F7Z A;  4XRS A;  1MJA A;  4HNT A;  4HQE A;  1OLT A;  2R3S A;  3B73 A;  1FLI A;  2I10 A;  4OIO F;  1U9O A;  2WA0 A;  1AKH B;  1D0Z A;  3F6V A;  4CZZ A;  3C2H A;  3E6B A;  4Q47 A;  3V7S A;  3CCJ I;  3RCO A;  3IH2 A;  4JX5 A;  3ZQF A;  5FB2 A;  1J7K A;  4LFU A;  3OSF A;  1JKR C;  2AO9 A;  2TDX A;  3LL7 A;  1SAX A;  2RQQ A;  1ULY A;  3REO A;  5LHG A;  2V1U A;  2K9S A;  2K9L A;  1BA5 A;  2E1M B;  2FNP A;  2P6T A;  1X1B A;  3OV8 A;  5DD4 A;  3SDG A;  3HUG B;  3AKZ A;  1FSH A;  2AXT C;  1OMI A;  3ONQ A;  3HSF A;  4LLG F;  4A6D A;  1XCV A;  3K70 D;  2R7V A;  1UJ8 A;  2DA7 A;  3B6A A;  3H9J A;  3IL2 A;  1XGO A;  2ZJR F;  3QRF F;  3AG4 H;  4ANJ A;  3L2V A;  5BQT A;  3ROU A;  4CYC B;  3RJP A;  1T8I A;  4DJA A;  4MO7 A;  3ZRG A;  5E3O A;  2GAU A;  1Y0N A;  4HZF A;  3R0J A;  2K9Q A;  3G1M A;  4AD9 A;  5F08 A;  1Y39 A;  2LTP A;  4AVZ A;  3OYH A;  3W2A A;  3TDU C;  1ZAO A;  2ZSH B;  3E5X A;  1O3T A;  2XC7 A;  1MJB A;  1FOY A;  3MKL A;  1S7A A;  1X1A A;  4ESB A;  1G59 A;  3CUQ C;  3HPH A;  2XSD C;  2CFO A;  1IN8 A;  3BR0 A;  3BY6 A;  1DU6 A;  3ERM A;  4UXN A;  2DU9 A;  3GTQ J;  1FTT A;  2X85 A;  3GZN B;  3H9G A;  1PUF A;  4A3E J;  2LH9 A;  4J19 A;  1R1T A;  2R5Y A;  3SZP A;  2ECC A;  3O6B B;  4ZH4 F;  4E7H A;  2D2W A;  1FNN A;  2QCO A;  2B9S A;  1LEA A;  2R92 J;  4AYB A;  2GA1 A;  3CDL A;  3LMM A;  3HHG A;  4JBA A;  3JTG A;  3MEX A;  3PUF A;  1GVJ A;  3TW7 A;  1XMK A;  1QVT A;  5AIQ A;  3CO7 C;  1PDN C;  5EJC A;  4AC0 A;  2YU9 J;  1SFK A;  3F8B A;  4DNC A;  1HCR A;  1IRF A;  1FBQ A;  1P7I A;  1LQ1 A;  4C2U A;  1JHH A;  3I71 A;  2HS5 A;  4B44 A;  3SXY A;  2QKM B;  5F1R A;  4FX4 A;  1JGG A;  3I54 A;  4ZDO A;  1WI9 A;  1IN4 A;  3HRS A;  3S14 J;  3HM5 A;  3H9Q A;  1H88 C;  3ZMU A;  4J00 A;  3GVA A;  4N9I A;  3A0H C;  3CC4 I;  3GTG J;  1K4T A;  4L0Z B;  2NOJ B;  2ESH A;  3NRV A;  2LLK A;  3CCL I;  2DK8 A;  2FE3 A;  1X2N A;  3CMY A;  1A5J A;  4L9T A;  4MNU A;  3KZY A;  5LLQ A;  5HLH A;  1DPU A;  1WSU A;  4NQW A;  1YIJ I;  3RQI A;  4BQQ A;  3B02 A;  1SD4 A;  2PN6 A;  3TKY A;  5E3N A;  2X6O A;  3BTL A;  5AIP A;  3DBH B;  1FYL A;  3PFY A;  2X6Y A;  4AWX B;  3I9V 2;  3S8P A;  2GLO A;  4HLX A;  1V4R A;  4P55 A;  3VYR B;  1T56 A;  2IS6 A;  1Q1H A;  2DYR H;  2P5V A;  4C3J J;  3G73 A;  1O7F A;  2BXZ A;  4RA2 A;  3M1C A;  2M4K A;  1KA8 A;  3WGG A;  3PO3 J;  2DA6 A;  2E1C A;  2DQR A;  3OL3 A;  1G3W A;  2W25 A;  3GTO J;  3HOU J;  1A6Q A;  2VOP A;  2M8E A;  3KYL A;  4V2G A;  3CUQ B;  1R9T J;  2Y9Z A;  3H35 A;  4G7O F;  1IDZ A;  3L1P A;  3HBL A;  1O3S A;  3OYC A;  1YTY A;  1USS A;  1KGS A;  2IRF G;  4A3F J;  1PVE A;  3TED A;  1DUX C;  1TP4 A;  2Z2S B;  3OMY A;  3RPU A;  1BI1 A;  2CGP A;  2MFZ A;  4HOB A;  4CZC A;  2JA8 J;  1D8K A;  2RV8 A;  3Q9S A;  4MFD A;  2ZME A;  1Y1V J;  5BNG A;  1WH5 A;  2F6C A;  3S15 J;  4U7B A;  2DFE A;  2QGU A;  2ZJ2 A;  2GOX B;  5ICE A;  2X4H A;  4FQG A;  1V5F A;  1D5V A;  4BXX J;  1O4X A;  3I58 A;  1DQU A;  5BS6 A;  3FXM A;  1BC7 C;  3R4K A;  3V7C A;  2FMY A;  4OAZ A;  2VIX A;  2KIQ A;  3LNQ A;  2ZKZ A;  5IYD J;  4X0G A;  4BH9 A;  1WJC A;  3DBL B;  1I6H J;  5FLX Z;  4NDL A;  3QWL A;  4G7Z F;  4N0B A;  1N77 A;  5D5V B;  1STZ A;  2DQL A;  2Y48 A;  1KU7 A;  5CYV A;  5DM7 F;  2VON A;  3S2W A;  1NH3 A;  2MH9 A;  4RMN A;  1P4W A;  3IV5 A;  2M7B A;  2LY2 A;  4BJT A;  1D3Y A;  2D5V A;  5FLX K;  3RZD J;  4DQ2 A;  1A35 A;  1T0F A; 
#chains in the Genus database with same CATH homology
 5L3D A;  5LEJ A;  3P9C A;  2Z3Y A;  2P5K A;  1ZH5 A;  1QBJ A;  5HDN A;  3F8N A;  2LF7 A;  5HS9 A;  3DQV C;  1TQI A;  2BV6 A;  2FU4 A;  1TNS A;  1K7A A;  5CVI A;  2L54 A;  3WTY C;  4KDP A;  2CG4 A;  3E97 A;  3HRU A;  2PFB A;  2RQP A;  3QAH A;  4O6J A;  1IF1 A;  1Z7U A;  2VBY A;  1EH7 A;  4IPA A;  1MKM A;  3FHZ A;  2XAS A;  3T8R A;  4LGW A;  4P5O A;  4IRI A;  2ZFW A;  1IAW A;  2CW0 F;  3C18 A;  1H9G A;  3FF5 A;  2A3S A;  3FXQ A;  3GF2 A;  3JTH A;  3WU0 A;  4EJT A;  1S29 A;  2KIM A;  3ZN0 A;  2UZK A;  2RVC A;  5BOX A;  1BI2 A;  3F6O A;  1BI0 A;  1O3Q A;  3BDD A;  3KEQ A;  1REP C;  2ESN A;  4UUV A;  3E3V A;  2E1N A;  2MH2 A;  4PCQ A;  2EV6 A;  4L18 B;  1LDJ A;  1U5T C;  3H3U A;  5KK1 A;  2HEO A;  4A0Y A;  1ZGA A;  4KA4 A;  1ON2 A;  4UHT A;  2UXX A;  1BBY A;  5D4R A;  5CVV A;  4I0B A;  3FXU A;  3RIR A;  4EV0 A;  4EJU A;  1HW2 A;  1F1Z A;  4IXA A;  4WWC A;  1XN7 A;  1FYK A;  4U0W A;  1P92 A;  3CTA A;  1MDM A;  3T1B A;  2HQN A;  1UHW A;  2FOK A;  1RIO H;  1JXS A;  2ACJ A;  4S04 A;  4AIJ A;  2K27 A;  5L3C A;  4Y13 A;  3VOD A;  2IVM A;  2Q0O A;  1QGP A;  3LQR A;  2XVC A;  1HKT A;  4RB1 A;  4HLY A;  1ZG1 A;  1BI3 A;  1OPC A;  2J5P A;  4KMU X;  1T2K A;  3I0T A;  4HDV A;  1HKS A;  2QLZ A;  1B59 A;  1O57 A;  1KU3 A;  2XAG A;  1FC3 A;  4TV7 A;  3TO9 A;  5TRD A;  3GFL A;  4I02 A;  2Z9O A;  3KCC A;  2RN7 A;  1DDN A;  1AOY A;  4CIC A;  3CUO A;  3KP4 A;  1VTN C;  4FX0 A;  3K2Z A;  2QWW A;  2EA2 A;  2PEX A;  2DW4 A;  5ICC A;  4PDK A;  5ERI A;  4BHC A;  4GXO A;  1B9M A;  4D0P A;  4UNO A;  2EFP A;  3F72 A;  1U5T B;  3IKV A;  2RC4 A;  3F8F A;  1HBX G;  2F5D A;  1S7O A;  5LRR A;  2EB7 A;  3WTV C;  5H6R A;  3O2P E;  1SFE A;  5F64 A;  1CF7 A;  1FBU A;  4KIG A;  2Z99 A;  3E6D A;  2H27 A;  4BNC A;  2DO7 A;  5ILV A;  5K5Q A;  3ZMT A;  3L09 A;  3W6K B;  3V7R A;  5LBQ A;  2LKP A;  1IZ1 A;  5IT3 A;  4HV5 A;  5HLI A;  1MJ9 A;  1XGM A;  4G8X A;  1YO5 C;  5DV5 A;  1Z05 A;  4LB6 B;  4ZZL A;  2E7X A;  3HSR A;  3TOA A;  3ZMV A;  3GZ5 A;  3MFK A;  3HYI A;  4Q5S F;  1R7J A;  2NRA C;  2J5O A;  1IN7 A;  4B09 A;  5H6Q A;  3DFG A;  2JSC A;  4WX9 A;  1R36 A;  4CGZ A;  2VBZ A;  4R8H A;  4AVP A;  4YFN F;  1GXP A;  4M9X A;  5ICG A;  1SD7 A;  2KIF A;  2KIU A;  5TJJ A;  1J75 A;  4OIN F;  3QU3 A;  3HIF A;  3VEP A;  1FOK A;  4A2U A;  3TO7 A;  3E5U A;  5FD5 A;  3PQJ A;  3SFZ A;  4HQM A;  3R6S A;  4EJV A;  2XV4 S;  5JI6 A;  5L3E A;  4LJZ F;  2K4B A;  5DCM B;  5LEK A;  1ZRC A;  4PGH A;  1P6R A;  3LA2 A;  1G6N A;  3ULQ B;  3ZMS A;  1BOA A;  1UST A;  1B6A A;  4KIF A;  2RGV A;  3ERE D;  3P9K A;  1I1S A;  1TNT A;  2XIG A;  2PI0 A;  1SD6 A;  3M9A A;  3ZMD A;  2BEO A;  1T6S A;  2JPC A;  1MD0 A;  3ELK A;  4U0V A;  2VC1 A;  3DXJ F;  2OQG A;  2A6E F;  3ABT A;  2L4M A;  4JQF A;  1JGS A;  1G3S A;  1PP7 U;  5D5U B;  3QOP A;  3BWG A;  2VBW A;  1IRG A;  2VXZ A;  3H3Z A;  1ZN2 A;  2K7L A;  5D6E A;  4BQA A;  3DF8 A;  2M1B A;  4HX7 A;  3FMR A;  3WTT C;  2IA1 A;  2F5C A;  4YG2 F;  3EYY A;  3N97 A;  2EV5 A;  1WQ2 A;  2LDU A;  1U3E M;  1GXQ A;  3F3X A;  1U78 A;  2PBI A;  1SMT A;  2OQR A;  1LVA A;  4HW0 A;  2XRO A;  1ZRF A;  2O8X A;  3G3Z A;  3M8E A;  2GA2 A;  3ISP A;  3GEZ A;  1FX7 A;  2IPQ X;  1KQ9 A;  1F9N A;  2NAZ A;  1CGP A;  5D8K B;  1QO0 D;  4ESJ A;  4OMZ A;  2GQQ A;  3EYI A;  2CWE A;  2GWR A;  4XSX F;  3KFW X;  2CYY A;  3M1E A;  3L2C A;  5EEH A;  3GFM A;  3HHH A;  4MTE A;  4UVA A;  5L3F A;  2V79 A;  1K6O A;  3IRQ A;  3HTS B;  3VB2 A;  5E17 F;  2UWM A;  1EV7 A;  1S6L A;  5CVJ A;  3MZY A;  2VT3 A;  2H6B A;  2XAF A;  5L3B A;  5D4S A;  4M9S A;  4O5V A;  1LNW A;  4RS8 A;  2YR2 A;  3MQ0 A;  3ZN1 A;  5HS7 A;  1UFM A;  2FEZ A;  3WGH A;  2CFX A;  2VBX A;  1WWX A;  1IXC A;  5E8G A;  1U6G A;  2K02 A;  1G3Y A;  1GHC A;  2RKH A;  3WTS C;  1IXS B;  3HUG A;  2DK5 A;  5HDK A;  4HV6 A;  2A61 A;  2K4J A;  2KJC A;  2MLK A;  1AWC A;  2ETH A;  1RZ4 A;  1U8R A;  1F5T A;  2M87 A;  4IVN A;  5CLS A;  3L00 A;  4ETS A;  4EGY A;  2PMH A;  2FBK A;  2KRF A;  2PMU A;  2L4A A;  3P9I A;  4KN7 X;  4I0A A;  3IRR A;  1ZG5 A;  4YIF A;  3K69 A;  2R7F A;  3FXR A;  2A68 F;  2CQK A;  1R1V A;  1IN5 A;  4A12 A;  3U2R A;  2F5E A;  3RYR A;  3HTU A;  1O3R A;  2EWN A;  4CDG A;  1K78 A;  3GZ6 A;  2ZO4 A;  5E1W A;  3SZT A;  1EH6 A;  2RDP A;  3J81 Z;  5A2Q Z;  3R61 A;  3HOS A;  4ESF A;  2Q8K A;  4BXU A;  5BPI A;  4R1H A;  3J81 K;  2DPU A;  4LG0 A;  4IRH A;  5A2Q K;  2XRN A;  2O6G E;  5FFZ A;  5DCF A;  3ECO A;  1L0O C;  4OIP F;  2GXG A;  1X3U A;  2EFN A;  1RUO A;  1JE8 A;  2C6Y A;  1I1G A;  2FML A;  2QQB A;  5HVQ C;  2Z5U A;  3HRT A;  4MEX F;  2Z33 A;  3J7A O;  1I5Z A;  3LAJ A;  3W6J B;  3C3W A;  2HDC A;  1TQM A;  2HYG D;  2RNJ A;  4P96 A;  3TGN A;  1B4A A;  1XDS A;  2QZ8 A;  4ENJ A;  2GZW A;  1R23 A;  5CVR A;  5JVT A;  1LB2 A;  4MQV A;  1ON1 A;  1P2F A;  1H9T A;  2HKX A;  4KUM A;  2HWV A;  3KP3 A;  2V9V A;  3CJN A;  4G9Y A;  1FP1 D;  3WGI A;  4YFX F;  2UXN A;  4HA8 A;  2LF8 A;  1CF7 B;  5CJ9 A;  3KP6 A;  1FY7 A;  3F8C A;  4GO1 A;  3PQK A;  1J9I A;  4UVB A;  4K2E A;  1TLH B;  3FWE A;  5E1X A;  1F4K A;  4CO8 A;  3BOQ A;  3F22 A;  1C0W A;  3TOB A;  3FMS A;  2NYX A;  2IA2 A;  2L02 A;  2F5F A;  4JK1 X;  3QPT A;  2VOO A;  1J5Y A;  1J2X A;  5LGU A;  3ECH A;  3F8M A;  2VN2 A;  4LK0 F;  4U88 A;  1LEB A;  4A6E A;  1YYV A;  1ZLK A;  5LGN A;  2PG4 A;  3JW4 A;  2IA0 A;  2OZ6 A;  3QP6 A;  1V3F A;  2KKO A;  1PUE E;  1FP2 A;  1W7P A;  4G7H F;  3WG9 A;  5AON A;  4I98 B;  3WTW C;  4HDU A;  2HYF A;  1PP8 F;  2P5L C;  5DDG A;  4UV9 A;  4Y17 A;  4IHS A;  4YFK F;  1E17 A;  2HTJ A;  3E6M A;  4G94 A;  3CO6 C;  4A0Z A;  5DD8 A;  4WF2 A;  4OIR F;  2DT5 A;  3GXO A;  1S3J A;  2LNB A;  2O3F A;  2EJR A;  4EMS A;  2M5W A;  1OR7 A;  3KP7 A;  1DP7 P;  1S8N A;  4BHB A;  1KQ0 A;  1J59 A;  3SHF A;  1FBS A;  2YPR A;  4EJW A;  4RGR A;  3TO6 A;  3R0A A;  2XAH A;  1ONV A;  5JR3 A;  1O7L A;  5DUK A;  3IHU A;  4L5J A;  2FA5 A;  4M6X A;  3KP5 A;  3BJA A;  4EJO A;  3DEU A;  2CO5 A;  2B0L A;  1XMA A;  3GFI A;  4MGR A;  3BZ6 A;  3IWZ A;  3JAM K;  3SQN A;  5HLG A;  4M74 A;  3RKW A;  3T5X A;  1ZG3 A;  2KJB A;  6PAX A;  4O3M A;  4HBL A;  1YG2 A;  1L3L A;  2P7V B;  3PFI A;  3MZH A;  2ZNY A;  3MWM A;  1YS7 A;  2W57 A;  2ZBK A;  4I01 A;  1QZY A;  4GCV A;  3J80 K;  4EQQ A;  2HQR A;  5D8L B;  1R58 A;  2FNA A;  3DP7 A;  3HRM A;  1QNT A;  4RGU A;  2VC0 A;  4EM1 A;  1HW1 A;  1QQI A;  4RGX A;  1SMY F;  3QP5 A;  1G3T A;  3COA C;  1ZRE A;  4AIH A;  3O3K A;  4M73 A;  4RB2 C;  2QYO A;  5K5O A;  3N4M A;  5FGM A;  1XSD A;  3D5L A;  1XCB A;  2DPD A;  2P4W A;  3V8L A;  3I4P A;  3NEU A;  2FSW A;  1YLF A;  4KYW A;  5D5X B;  5BMZ A;  2JRT A;  3GLX A;  1OKR A;  4HAM A;  4Q48 A;  2MBF A;  3U1D A;  2YSR A;  2JPB A;  2H6C A;  2HR3 A;  4FT8 A;  3DKW A;  4I09 A;  4BYY A;  1LJ9 A;  3C7J A;  2YX7 A;  2D45 A;  1YW7 A;  4MHG A;  2XAQ A;  3GWZ A;  2ZCW A;  2MLG A;  4GYG A;  5J8F A;  2FQ3 A;  3E5Q A;  1R00 A;  1BIA A;  5KVR A;  4MEY F;  4I7H A;  1W5T A;  3Q5F A;  4XRF A;  5K5R A;  3C1D A;  3K1M A;  3WTZ A;  2WC2 A;  1RUN A;  3GYH X;  3BPX A;  1HST A;  5FD6 A;  2PQ8 A;  1FZP B;  1R5H A;  3RDI A;  3BP8 A;  3EUH A;  3P7N A;  1I27 A;  1FSE A;  2OAZ A;  3MAJ A;  2VT2 A;  4U0Y A;  5LRS A;  3TQN A;  2CSO A;  5ILU A;  3F21 A;  5LHI A;  2P7C B;  1R22 A;  2G9W A;  4G6D A;  4WXC A;  3H92 A;  2V1X A;  1OYW A;  1SFU A;  2ZME B;  1OYI A;  4YII A;  1B1B A;  1OYY A;  5LHH A;  3DV8 A;  2E7W A;  4OIQ F;  3U9G A;  4OMY A;  3RPQ A;  4IF4 A;  2BYV E;  3GX4 X;  3JSO A;  4MQ9 F;  4KIB A;  3GO5 A;  2FF4 A;  3I59 A;  5E20 A;  1A04 A;  4Z2Y A;  1BIB A;  2XKO A;  1TW3 A;  2XUB A;  3KEO A;  1BN5 A;  2HKO A;  1YW9 A;  2NNY A;  2DLL A;  2OZU A;  3KE2 A;  1P4A A;  1WKM A;  3BPV A;  1K78 B;  4PZJ A;  3E6C C;  3KP2 A;  4ZYH A;  2OA4 A;  2QBY A;  2DFI A;  2W84 A;  1WRJ A;  5JFR A;  1D8J A;  3EDP A;  2IP2 A;  3K0L A;  4LG0 B;  1YS6 A;  5D6F A;  2EA4 A;  2OU2 A;  3I53 A;  4Y15 A;  5E1Z B;  3ABU A;  2Q2E A;  4EM2 A;  3BJ6 A;  5DCM A;  3DPL C;  3BRO A;  1Z91 A;  2JTV A;  3KZZ A;  2K86 A;  1ZLJ A;  2BGC A;  2QQA A;  4XSZ F;  3RKY A;  4KMF A;  3HSE A;  1HW5 A;  1ZAR A;  4B8X A;  4N9H A;  2H94 A;  2MC3 A;  5E18 F;  1KU2 A;  3WTX C;  1YQA A;  4M71 A;  1W7P D;  4QWQ A;  2YX4 A;  1ZHF A;  4Q4Z F;  4BAY A;  1UHM A;  3CLO A;  1IXR C;  1XDU A;  3Q9V A;  1JHF A;  5HS8 A;  4WK8 F;  2VOD A;  2XGX A;  4M9Z A;  2M30 A;  4ENN A;  3LWF A;  3RI4 A;  4CHU A;  4KFC A;  5L3G A;  1ZGJ A;  4ZYE A;  1YW8 A;  2EFQ A;  2NS0 A;  3LFK A;  1XGN A;  4LLN A;  4LD5 A;  4HF2 A;  2MA3 A;  2WV0 A;  4LB5 A;  1Z6T A;  4HYE A;  2PLY A;  4NHJ A;  4IJA A;  2FBI A;  1T98 A;  4XLN F;  1XSV A;  2EV0 A;  4AIK A;  1U2W A;  3K1P A;  2G7U A;  3ZQ7 A;  4S05 A;  3AAF A;  4ENK A;  3WE2 A;  2GXB A;  3FM5 A;  2ADU A;  2IJL A;  2QQ9 A;  4HF1 A;  3GUD A;  4XBF A;  3V8J A;  2DAO A;  1LDD A;  4RAZ A;  3K9T A;  1XGS A;  2HGC A;  2HOE A;  5D5W B;  4ON0 A;  1ZYR F;  4A5N A;  3FMQ A;  5JHU A;  5DUI A;  1MDM B;  4ASN A;  5CVU A;  1KYZ A;  4P9F A;  4P9U A;  2D1H A;  2O03 A;  1UCR A;  2F2E A;  1KYW A;  2D1V A;  3L9F A;  3R60 A;  5ICF A;  4KNY A;  4CXF A;  3IKT A;  3V8K A;  2W85 A;  4NB5 A;  1LDK B;  1XD7 A;  5IT9 Z;  1TQP A;  3GW2 A;  4WCG A;  4IHT A;  4M6Y A;  3LA3 A;  1IW7 F;  5LGT A;  3LA7 A;  4L5I A;  1W7P B;  5HDG A;  1TBX A;  5IT9 K;  4H0E A;  4RB3 C;  4IRG A;  1J0R A;  1BJA A;  4L0Y B;  3LQQ A;  2JZY A;  1Z1D A;  2MD5 A;  4ZYD A;  1ODD A;  5F6F A;  4KN4 X;  2QEN A;  3ZMZ A;  3KLN A;  3L7W A;  2BBY A;  3EQL F;  3CUQ A;  1R1U A;  4QLC U;  1KQ8 A;  5DYM A;  3ZP5 A;  4KT5 C;  1FWZ A;  2FRH A;  5HOO A;  2A69 F;  4EM0 B;  4ENM A;  2AXL A;  3MCZ A;  2P6S A;  2L01 A;  4RGS A;  1Z9C A;  2ISZ A;  1FT9 A;  2Y75 A;  3I5U A;  3T0Y A;  2GIV A;  2M45 A;  2H09 A;  4U7D A;  5J8C A;  3WOD F;  4HX8 A;  2V1D A;  3T8T A;  1I6X A;  2Y0M A;  3K1N A;  2QM3 A;  2V6C A;  4MTD A;  3RKX A;  5ILS A;  1BC8 C;  4RB0 A;  1SD5 A;  1QPM A;  3NQO A;  3WU1 B;  1T38 A;  5ED4 A;  3EET A;  2X0L A;  2STT A;  2ZXJ A;  5FFX A;  2OBP A;  5DEQ A;  3BJO A;  1EH8 A;  1T39 A;  2EFW A;  2P8T A;  2FXA A;  2DI3 A;  1FPQ A;  3M7G A;  2IT0 A;  4ZYG A;  3WTU C;  3I64 A;  1RI7 A;  4I2O A;  2A5Y B;  2PJP A;  2HZT A;  2NNN A;  2ISY A;  4HX4 A;  3FM3 A;  3KLO A;  2XKP A;  4ZZD A;  4XLP F;  3CDH A;  2HFH A;  1NHA A;  4EGZ A;  1IN6 A;  5BPD A;  3RTR A;  2STW A;  2YU3 A;  2G7H A;  4LMY A;  1HXD A;  1XSX A;  2O61 A;  2ELH A;  4A5M A;  5EEG A;  1Y0U A;  1HQC A;  4UVC A;  4FHT A;  3GFJ A;  4L9J A;  3QPH A;  4L9N A;  1HKQ A;  1QZZ A;  5J6X A;  3RYP A;  4GYI A;  4WXH A;  3OOP A;  2DTR A;  2R7D A;  3M8F A;  4G6Q A;  2AS5 F;  1G4D A;  4WXD A;  3JAM Z;  1TW2 A;  2O0Y A;  1W4M A;  4OU0 A;  1H0M A;  1IUY A;  1Z6R A;  2LSO A;  2BE5 F;  5FO5 A;  2HTS A;  1W5S A;  2ZNZ A;  1E2X A;  3TDZ C;  4A0X A;  2L3D A;  4EVI A;  3J80 Z;  3FX3 A;  5K1Y A;  1UB9 A;  2EK5 A;  1BM9 A;  1TTY A;  1MZB A;  1B9N A;  1YIO A;  3FZV A;  3HOT A;  3D0S A;  4HF0 A;  3IC7 A;  3KET A;  3VOE A;  2COM A;  4KIC A;  4UV8 A;  1FYM A;  3VFZ A;  2JT1 A;  2DBB A;  2WTE A;  3F23 A;  2A07 F;  2IW5 A;  4R79 A;  3ZPL A;  2QUF A;  1P4X A;  3V4G A;  2XHK A;  2EFO A;  4RAY A;  2VE8 A;  1KU9 A;  1MGT A;  3JSP A;  1K79 A;  3I59 B;  5H20 A;  1ZRD A;  2QVO A;  3DPT A;  3LST A;  2A6H F;  2WWY A;  4BHP A;  1SFX A;  4GGG A;  4LLL A;  4OOI A;  1YFH A;  3QU6 A;  1HSJ A;  5E8I A;  4M72 A;  4L9V A;  2XAJ A;  2W24 A;  2OD5 A;  2QBY B;  3IWF A;  4LK1 F;  1R5G A;  4CYD A;  1U5T A;  4PGG A;  2VE9 A;  1DPR A;  2FBH A;  1RNL A;  3WE3 A;  3LAP A;  1XB4 A;  3ML6 A;  4E70 A;  4F7Z A;  1MJA A;  4HQE A;  2R3S A;  3B73 A;  1FLI A;  4OIO F;  3F6V A;  4CZZ A;  3E6B A;  4Q47 A;  3V7S A;  5FB2 A;  1J7K A;  4LFU A;  2TDX A;  1SAX A;  1ULY A;  3REO A;  5LHG A;  2V1U A;  2P6T A;  2FNP A;  3OV8 A;  5DD4 A;  1FSH A;  1OMI A;  3HSF A;  4LLG F;  4A6D A;  1XCV A;  3IL2 A;  1XGO A;  3QRF F;  5BQT A;  3ROU A;  3RJP A;  2GAU A;  4HZF A;  3R0J A;  4AD9 A;  3TDU C;  1ZAO A;  3E5X A;  1O3T A;  1MJB A;  1S7A A;  4ESB A;  3CUQ C;  1IN8 A;  3BY6 A;  4UXN A;  2DU9 A;  1R1T A;  3SZP A;  4ZH4 F;  3O6B B;  2D2W A;  1FNN A;  1LEA A;  2GA1 A;  3HHG A;  4JBA A;  3JTG A;  3MEX A;  1GVJ A;  1XMK A;  5AIQ A;  3CO7 C;  1PDN C;  3F8B A;  4DNC A;  1IRF A;  1FBQ A;  1LQ1 A;  1JHH A;  3I71 A;  2HS5 A;  3SXY A;  5F1R A;  4FX4 A;  3I54 A;  1WI9 A;  1IN4 A;  3HRS A;  3ZMU A;  3GVA A;  4N9I A;  4L0Z B;  2ESH A;  3NRV A;  2DK8 A;  2FE3 A;  4L9T A;  4MNU A;  3KZY A;  5LLQ A;  5HLH A;  1DPU A;  1WSU A;  4NQW A;  3B02 A;  1SD4 A;  2PN6 A;  3TKY A;  5AIP A;  1FYL A;  4AWX B;  4HLX A;  1V4R A;  4P55 A;  1Q1H A;  2P5V A;  3G73 A;  1O7F A;  1KA8 A;  3WGG A;  2E1C A;  2DQR A;  2VOP A;  1G3W A;  2W25 A;  2M8E A;  3CUQ B;  4G7O F;  1O3S A;  1YTY A;  1USS A;  1KGS A;  2IRF G;  1DUX C;  3RPU A;  1BI1 A;  2CGP A;  4HOB A;  1D8K A;  2RV8 A;  3Q9S A;  2ZME A;  4U7B A;  2ZJ2 A;  5ICE A;  2X4H A;  1D5V A;  3I58 A;  5BS6 A;  1BC7 C;  3R4K A;  3V7C A;  2FMY A;  2ZKZ A;  4BH9 A;  5FLX Z;  4G7Z F;  4N0B A;  5D5V B;  1STZ A;  2DQL A;  2Y48 A;  1KU7 A;  5CYV A;  2VON A;  3S2W A;  2MH9 A;  1P4W A;  1D3Y A;  5FLX K;  4DQ2 A;  1T0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...