4EJUA

Staphylococcus epidermidis tcar full length
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
149
Chain Sequence
RRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLEKPDSNTDQRLKIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the antibiotic recognition mechanism of MarR family proteins
rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription regulator
molecule keywords Transcriptional regulator TcaR
total genus 47
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ejuA00
2DBBA 2VT3A 4HF0A 1IRGA 1S29A 3WGIA 1FBSA 1YTYA 1DP7P 1REPC 2RC4A 4PCQA 1MD0A 1YS7A 4JQFA 2O3FA 3RIRA 4U0YA 3WTWC 5J8FA 3FXQA 4ENKA 2LSOA 3GEZA 3U1DA 5ILSA 3RKXA 1P4AA 2QBYB 4Y17A 2R3SA 5LHHA 4HQEA 5DCFA 2PBIA 4BQAA 1O7FA 2X4HA 4KDPA 4EV0A 6PAXA 2L4AA 1MJBA 3ZMTA 5L3CA 3QPHA 2FA5A 5H6RA 3TDZC 4MNUA 4S04A 1T0FA 3ROUA 3ULQB 4KMFA 1YQAA 2HS5A 4YFKF 3ZMZA 1Z6TA 1T39A 3KLNA 2NNYA 1ZYRF 2QUFA 5IT9Z 4AIJA 1ZG5A 2M45A 3DQVC 1W7PB 4GYIA 2E7XA 1HW5A 5AIQA 1FYKA 1O7LA 1JHFA 2GAUA 1B59A 2FSWA 1FWZA 2MH2A 2HYGD 4HQMA 2K86A 4IRGA 1J2XA 1XDUA 5BOXA 1QPMA 4U88A 3JW4A 1BI2A 2XKOA 4HX8A 4P55A 4RGRA 2L3DA 1P4WA 2FE3A 3E6DA 1D5VA 3KP4A 4WXDA 3LA3A 1F1ZA 1LEBA 3CUQA 5DD4A 3K1MA 2KJBA 4Q48A 2CSOA 2GXBA 2YPRA 2MBFA 4P9FA 5K1YA 3F8BA 3J80Z 3GUDA 3I0TA 1FPQA 4HLXA 2D1VA 4EM0B 3NRVA 3GZ6A 3G3ZA 5LGUA 1OYWA 2ZMEB 1L3LA 2Z9OA 2XAFA 4ZZLA 5AIPA 2NNNA 4A0ZA 3K69A 3I58A 3WTUC 3FZVA 2K27A 2XVCA 5H6QA 1FOKA 1LEAA 4EJWA 4CXFA 3WTTC 4A0XA 1BJAA 1JHHA 1W7PA 1IUYA 3V4GA 4M9ZA 1BM9A 5BS6A 4CHUA 4ZYEA 3RPQA 1CGPA 4L9VA 3T5XA 2P7VB 1B9NA 1YLFA 1IRFA 2MC3A 3WG9A 1MDMB 3GFMA 1RUOA 3CUOA 3WTXC 4ENMA 4UNOA 2ZCWA 4PGGA 3Q9VA 2DQLA 1XCVA 4A12A 3C3WA 1RNLA 3LQQA 4L9TA 2EJRA 4YIIA 2PJPA 1WSUA 3WU0A 3SXYA 3IC7A 1D8KA 4KA4A 2FRHA 1U3EM 5FB2A 2VOPA 5LGTA 2GIVA 2LF7A 1SMTA 2OQGA 4MQVA 1I5ZA 1DPUA 1ZG3A 2XGXA 3DP7A 4UHTA 2FU4A 4PZJA 2IA1A 3V8JA 3H92A 1W5SA 4I0BA 1S7AA 1FT9A 1MGTA 3I54A 5LRSA 5BPIA 3HRTA 4I7HA 4WXCA 2O0YA 2ETHA 1T6SA 5CVJA 3REOA 3FMRA 5D4RA 4G6DA 2P5VA 4KIFA 5TJJA 3IRQA 3RKWA 4I01A 1HSTA 4HV5A 2ACJA 4AIHA 2CYYA 2QVOA 2ZBKA 2BYVE 1R1VA 5HDKA 3ZP5A 1XN7A 2LF8A 1FSEA 2WV0A 2O03A 5E17F 3B73A 3M7GA 1KU3A 1UCRA 4A5MA 2L02A 2HEOA 1H0MA 2HKOA 4Q4ZF 3HHGA 2FNPA 1Z9CA 2VODA 2GQQA 2FEZA 2Y0MA 1YG2A 1XSVA 3E6BA 2VE8A 1I1GA 1KGSA 4S05A 1ZRDA 2ISYA 5DEQA 4K2EA 4U0VA 2M87A 2HWVA 4RB2C 4NB5A 1LDDA 1ZARA 1L0OC 1IXRC 3ISPA 1WWXA 1FBQA 2FBKA 2VXZA 1S6LA 1RIOH 1HSJA 1KU7A 5E8IA 1QO0D 3E97A 2RN7A 2EFQA 3F6OA 2FBHA 3FMSA 3BDDA 3R6SA 4R8HA 2UXNA 2K7LA 4RB0A 5HLGA 3IHUA 1I6XA 2A3SA 1QBJA 2CFXA 5DDGA 3TGNA 4IRHA 1R23A 1YS6A 1QQIA 3VB2A 5HLHA 2W57A 4LB5A 3SZTA 3JSOA 4GXOA 2EV5A 2DPUA 3MFKA 2ZNZA 3AAFA 3JAMZ 1DDNA 1H9GA 4IVNA 2H6CA 1SFUA 4RS8A 1H9TA 3G73A 2QQ9A 1TW2A 1OPCA 2EWNA 2VBWA 4A2UA 2X0LA 2HTJA 1J5YA 3MAJA 2P4WA 4BHCA 2OD5A 5FGMA 1G6NA 2DI3A 2FMLA 3MZHA 4RAZA 1IN8A 3ZPLA 3I53A 3RI4A 4N0BA 1XGMA 4G8XA 3WE3A 2QM3A 2P7CB 3M9AA 2HDCA 2M8EA 4EGZA 2FBIA 3HTUA 3MQ0A 5HS8A 1UHWA 2KIUA 5L3FA 1TQIA 1W7PD 4A0YA 2M5WA 1EH8A 2PEXA 4XLNF 5FLXK 1R58A 5J6XA 5HDNA 2EV6A 4Z2YA 4ZH4F 2JT1A 3E3VA 1BI1A 3DPTA 5ICGA 1USTA 3CUQC 4ON0A 3F8NA 2P6SA 3DPLC 4KN4X 2HTSA 2ZJ2A 1ZHFA 3RKYA 2F5EA 4E70A 2H94A 5LHGA 4G7HF 1ZGJA 1S3JA 1BC8C 2QQBA 3GW2A 3BPXA 5KK1A 1XSDA 4WF2A 5JHUA 4BHPA 2RNJA 4FHTA 1KQ8A 2V1UA 4LLLA 3B02A 2H6BA 1KQ0A 3GF2A 2W84A 5JR3A 4N9HA 3V8LA 5ILVA 1R22A 3J80K 2H09A 3DKWA 4RAYA 1LVAA 1MJAA 3BJAA 1R5GA 2ZO4A 4WWCA 4TV7A 3J81K 2E7WA 4ESFA 5BPDA 5K5RA 1TQMA 2K4BA 1HW2A 3SQNA 3TO7A 1OYIA 1X3UA 2OZUA 2HFHA 4R79A 2G7UA 2GA2A 3P9KA 4AD9A 2YR2A 2A6EF 2B0LA 1QGPA 4WCGA 2XROA 5A2QZ 3QAHA 4G7OF 3IL2A 4WX9A 1DUXC 3J81Z 5AONA 1B9MA 2EFNA 4M6YA 4HZFA 2BGCA 3KEQA 4MEYF 3L09A 3KP7A 4O3MA 1BIBA 3TOAA 1B6AA 2DFIA 3RTRA 2R7DA 5D8KB 5LEKA 1WQ2A 3BP8A 3T8TA 3K1PA 2NAZA 3KLOA 1J9IA 3D0SA 4L9JA 4FX0A 3LSTA 3JTGA 2JTVA 1RZ4A 5D5VB 1E17A 3GFLA 2J5PA 3ECOA 2RGVA 1HKTA 2ZFWA 3LAPA 3GZ5A 4CYDA 5CYVA 4LK0F 3WE2A 1P6RA 4LB6B 2CGPA 1IN6A 2IJLA 4YFXF 1XCBA 3QU3A 1EH6A 1IAWA 3LWFA 2V6CA 5HS7A 3VFZA 3ML6A 1YO5C 2V1DA 2FF4A 5F6FA 4RB1A 5J8CA 3LA7A 3GXOA 3V7CA 3KZZA 4I0AA 4XSZF 4LG0B 5HLIA 1G3SA 5LBQA 3CO7C 1RI7A 1P4XA 1W4MA 4MHGA 2O61A 3TO9A 5L3BA 3CLOA 4NHJA 3P7NA 1BI3A 1IZ1A 2XAGA 1RUNA 1AWCA 2IP2A 3ZN1A 2EB7A 1KU2A 4LMYA 3U2RA 2J5OA 5LGNA 1S7OA 3VOEA 2NS0A 4QWQA 4AWXB 2FXAA 1UFMA 1KU9A 3FMQA 2HR3A 1OMIA 3DV8A 2G7HA 1LQ1A 5FD5A 4ENJA 4GYGA 2QYOA 1O57A 1T2KA 5ICEA 1ZLKA 3CTAA 3K0LA 3HSEA 1CF7A 2KIMA 1USSA 1HXDA 1XB4A 3KP6A 3ECHA 5A2QK 1JXSA 3CUQB 3QRFF 5K5QA 3KEOA 3F3XA 1FP1D 5KVRA 2JZYA 4I02A 2HQRA 2XHKA 2BE5F 3KZYA 4XRFA 4ETSA 4LG0A 1BBYA 1YIOA 1XD7A 2KJCA 3IKTA 1UHMA 1SFXA 2WWYA 3M8FA 3O2PE 2P6TA 1GXPA 5ERIA 4HOBA 3L2CA 1FX7A 3C7JA 1FC3A 1MDMA 3WTVC 4A6EA 4ENNA 2JPBA 4GCVA 3R4KA 4OIQF 1JE8A 5H20A 4HX7A 1EV7A 2QZ8A 3GLXA 3SHFA 3GX4X 1PDNC 5D5UB 3BWGA 1XGSA 1C0WA 3KP5A 2PFBA 2WC2A 2D45A 3QP6A 4OIRF 4RB3C 1XMAA 3O6BB 1HKSA 1U5TA 3OOPA 5LRRA 1F4KA 4OIPF 5DV5A 4IJAA 3J7AO 1ZH5A 3GFJA 5E20A 1P2FA 4LD5A 5E1ZB 2DU9A 3HSFA 1U5TB 3LQRA 2IA0A 2WTEA 2Z99A 1SD5A 4EMSA 1ULYA 3KP3A 4EGYA 2RVCA 4F7ZA 3IWFA 2GXGA 4BHBA 3EYIA 2VE9A 3N4MA 2V1XA 4IF4A 3I59A 2EFOA 3GVAA 4L18B 4QLCU 1J0RA 2Q8KA 3E5UA 1ON1A 1XGNA 3BOQA 3CDHA 4O6JA 3Q5FA 3I64A 3HRMA 5FFXA 3CO6C 3H3UA 3GWZA 5CLSA 5E8GA 1ZREA 4H0EA 1G4DA 3F22A 1FYLA 2DK8A 4WK8F 1CF7B 1OR7A 1KQ9A 3C18A 2GA1A 1TNSA 2VC0A 1Y0UA 1G3TA 4MEXF 4XBFA 4U0WA 2NRAC 4OINF 4CDGA 5FLXZ 1K7AA 2IA2A 2IPQX 1TNTA 3TO6A 4EM1A 4U7DA 4OIOF 4RGUA 2OA4A 3BJ6A 4MTEA 3V8KA 2HKXA 1BI0A 3COAC 1LNWA 1IN5A 2MD5A 2PMUA 1ONVA 2AXLA 4UVCA 3KETA 2ZXJA 2EA4A 3DEUA 1P92A 2ZNYA 3T8RA 1U2WA 3RYRA 4HDUA 4HLYA 2BEOA 2P5LC 4LK1F 4G94A 4YIFA 3QP5A 1G3WA 1QZZA 4EJTA 4AVPA 2DT5A 4HA8A 3GYHX 3K2ZA 1U5TC 4O5VA 3FM3A 3WGHA 2STTA 4UV8A 2AS5F 2MA3A 3R0AA 1Z1DA 2COMA 1SAXA 5FD6A 2A6HF 2LKPA 1O3QA 1SMYF 3QPTA 1ZG1A 2QLZA 2EV0A 5DCMA 3IWZA 3LAJA 3E5QA 1QNTA 3ERED 2A07F 5IT9K 1F9NA 3LA2A 1VTNC 4KYWA 5BMZA 2HOEA 4EJVA 2E1NA 5DYMA 4KNYA 3MEXA 5ILUA 3V7SA 4HYEA 3P9IA 4XSXF 2QQAA 2IVMA 4DNCA 3KFWX 2DLLA 3ZMVA 4CZZA 1R7JA 4ESBA 2DPDA 4KIGA 4UVBA 3ZMSA 2A5YB 3HYIA 1YFHA 1ZRFA 2F5DA 2JPCA 3ZQ7A 3DXJF 1V4RA 1MKMA 2W25A 1LDJA 2ISZA 5CVRA 2XASA 3D5LA 4AIKA 3GO5A 4YFNF 4PGHA 3FXRA 2YU3A 4CGZA 4JK1X 3W6JB 2P5KA 3T1BA 2VBXA 3BPVA 3R60A 1WRJA 1YW9A 1S8NA 4GGGA 1ZLJA 1TW3A 4MTDA 1FYMA 2L01A 1HQCA 3W6KB 2JRTA 4HAMA 1D8JA 3ZN0A 3RYPA 4M73A 2KIFA 4EQQA 1R5HA 3HSRA 3HHHA 4ZYHA 1QZYA 1PP8F 2IRFG 2R7FA 2H27A 2XAQA 2OU2A 2E1CA 1G3YA 4RGSA 4GO1A 2EA2A 2ELHA 3RDIA 2A69F 5D5WB 5IT3A 4BH9A 1XDSA 2LNBA 3E6MA 5ICFA 4LFUA 5ICCA 3WTYC 4KUMA 4R1HA 1Z05A 5JVTA 2MH9A 2OZ6A 3KE2A 2D2WA 2XIGA 2XAJA 2KKOA 4L0ZB 1MZBA 2V9VA 4WXHA 1FBUA 3R0JA 4HW0A 4YG2F 1Z7UA 3BJOA 1ON2A 1R1TA 5DCMB 3GFIA 2V79A 3F6VA 1XSXA 2ESNA 1Z91A 4OMZA 2EK5A 2VN2A 2F5CA 2ZKZA 3ABTA 3O3KA 4OU0A 4JBAA 5LEJA 1FNNA 4EJUA 1K6OA 4RGXA 2XRNA 4EVIA 4G7ZF 1EH7A 2OAZA 3MCZA 1IN4A 2Z33A 4D0PA 2HGCA 2Y48A 3I4PA 5FO5A 1LB2A 4UUVA 3FWEA 2UXXA 2DAOA 2PMHA 4G6QA 1YW7A 2O8XA 1J7KA 1ZRCA 4OMYA 4HBLA 3K1NA 4ASNA 3F8FA 3H3ZA 1K79A 1U78A 4NQWA 4HF2A 3EYYA 2KRFA 2PG4A 2HQNA 1V3FA 2Z3YA 1JGSA 1B1BA 3PQKA 3KCCA 1U6GA 3HOTA 1SFEA 1D3YA 2TDXA 1WI9A 5E1WA 3KP2A 3PFIA 2XKPA 5HDGA 2PLYA 1IF1A 2K02A 2DK5A 2QBYA 1K78B 4B8XA 3ELKA 3HRUA 5BQTA 4IRIA 3MWMA 4N9IA 1BOAA 2C6YA 1ZN2A 3NQOA 2XV4S 4XLPF 1U8RA 1J59A 3MZYA 2Q2EA 4MQ9F 2QENA 2DTRA 4EM2A 3EQLF 3IRRA 4PDKA 1E2XA 2VBYA 2LDUA 4ESJA 3M1EA 2STWA 4P5OA 3BZ6A 3WTZA 3T0YA 5DUIA 1PP7U 2F5FA 1IXCA 5L3GA 2L54A 2CG4A 5L3EA 4IHSA 1LDKB 2QWWA 4LLGF 5DD8A 2Q0OA 1HBXG 3C1DA 4Y13A 4HF1A 3WODF 1HKQA 4FX4A 2ESHA 2RV8A 1A04A 2YSRA 2PN6A 4HX4A 4M74A 2Z5UA 4L0YB 4OOIA 1KYWA 4M9XA 3TOBA 1I1SA 2FQ3A 3QU6A 1O3SA 1FP2A 4LGWA 5D5XB 3R61A 2JSCA 4M71A 3CJNA 1PUEE 5D4SA 2VC1A 4CICA 2IT0A 2FOKA 5TRDA 2PI0A 3JTHA 3F23A 4BXUA 3F21A 4KFCA 3IKVA 3N97A 4A5NA 1HW1A 4BYYA 2W85A 1GXQA 1YW8A 4LLNA 1TQPA 2A61A 4HDVA 2PQ8A 5F64A 3HRSA 1GVJA 4FT8A 4L5IA 3L00A 3RJPA 2O6GE 5D8LB 5CVUA 1IW7F 3ZMUA 2CW0F 4L5JA 2NYXA 3E5XA 1Q1HA 5L3DA 3FHZA 2OQRA 4P9UA 1SD7A 5DUKA 2RQPA 4L9NA 4Q47A 4Q5SF 3WU1B 2DQRA 3BROA 1IN7A 3BY6A 5EEHA 2A68F 4IXAA 4ZYGA 5FFZA 4ZYDA 2VOOA 2XUBA 2YX4A 3SFZA 2CO5A 1GHCA 4P96A 2EFWA 3WGGA 2XAHA 2UWMA 4BAYA 1R00A 2MLGA 1UB9A 1XGOA 2DW4A 2GWRA 1YYVA 2Y75A 3DFGA 3SZPA 4KIBA 1KA8A 3TKYA 5K5OA 2VT2A 3I71A 1FSHA 2D1HA 1NHAA 1WKMA 4Y15A 4A6DA 3EUHA 1T38A 4KN7X 4KT5C 3ZMDA 3LFKA 3FX3A 3K9TA 1OKRA 4CO8A 2MLKA 3F8MA 4DQ2A 3F72A 2F2EA 3HOSA 3EETA 1MJ9A 4M6XA 3U9GA 3FF5A 5LHIA 3VODA 1BN5A 4UV9A 3JAMK 2EFPA 2RKHA 2BBYA 3FM5A 4ZZDA 4IPAA 1ZGAA 3Q9SA 5D6FA 4I2OA 1TLHB 5CJ9A 2VONA 3P9CA 4KMUX 2IW5A 1STZA 2YX7A 4EJOA 4G9YA 2DO7A 3QOPA 4M72A 3NEUA 4MGRA 3L7WA 1OYYA 3HIFA 2G9WA 4M9SA 5ED4A 1ODDA 4UXNA 1TTYA 5HVQC 1AOYA 4B09A 1O3TA 1W5TA 2P8TA 4U7BA 2HZTA 2FNAA 3EDPA 3JSPA 5E18F 1B4AA 3OV8A 1SD6A 2ADUA 4UVAA 1ZAOA 3VEPA 1LJ9A 3HUGA 3RPUA 3I5UA 2ZMEA 1F5TA 2VBZA 2OBPA 5LLQA 2RDPA 3HTSB 1R1UA 1FY7A 2K4JA 5HS9A 3DF8A 3PQJA 3E6CC 3V7RA 1XMKA 1DPRA 1KYZA 2GZWA 4I09A 3S2WA 5HOOA 5F1RA 1IXSB 1J75A 1K78A 3L9FA 3M8EA 5JI6A 2HYFA 3ABUA 2W24A 5CVVA 5JFRA 1I27A 2CWEA 3F8CA 3TQNA 2UZKA 2L4MA 2CQKA 1FLIA 2M1BA 3I59B 2FMYA 1BIAA 2M30A 2BV6A 4I98B 5CVIA 5EEGA 3FXUA 4BNCA 4HV6A 1TBXA 1Z6RA 1O3RA 1T98A 1SD4A 5E1XA 5D6EA 1FZPB 3TDUC 3WTSC 1R36A 4LJZF 1BC7C 4KICA 4IHTA
chains in the Genus database with same CATH superfamily
1WJBA 2DBBA 4HRIA 5J40A 2ME6A 1G59A 2VT3A 2IEKA 4HF0A 1S5LC 5GAGJ 1IRGA 4UUTA 1S29A 4E7HA 3WGIA 1FBSA 1YTYA 1DP7P 1REPC 2RC4A 4PCQA 1MD0A 5JLXA 1YS7A 2LK2A 4JQFA 2O3FA 4PK4A 1HLVA 3RIRA 2XGEA 3J7ZI 4FASD 4QTRA 4U0YA 3WTWC 5J8FA 3GTQJ 2FQ4A 3FXQA 1RESA 4ENKA 2KZVA 2LSOA 2KT0A 3GEZA 4J00A 1MSEC 3U1DA 1MBHA 5ILSA 3RKXA 4IQ4A 1OCCH 1P4AA 1SVLA 2VPLA 3BG5A 2QBYB 2F48A 2KFDA 4Y17A 1H88C 4AVZA 2R3SA 5LHHA 2KIQA 4HQEA 4RM3A 3L1PA 4C3IJ 5DCFA 1VQLI 4XN0A 2M0CA 2PBIA 1O7FA 2X4HA 3EUAA 2R4GA 3QWLA 4BQAA 3EUHC 4KDPA 4EV0A 6PAXA 2L4AA 1MJBA 4QPOA 4F91B 3ZMTA 5L3CA 2DFEA 3QPHA 2FA5A 3HM5A 5H6RA 1HDPA 3TDZC 2ID3A 4MNUA 2GXAA 1BJZA 2L5QA 4S04A 3FISA 1T0FA 1MBGA 3HBLA 4M3DA 2VB6A 3ROUA 3ULQB 4LG3A 1YQAA 2HS5A 4YFKF 2GLOA 4KMFA 1MNEA 3ZMZA 1Z6TA 2JQ7A 5JLWA 1T39A 2A5WA 1NK2P 3KLNA 2NNYA 2MSYA 1ZYRF 2QUFA 2ID6A 5IT9Z 2ZFUA 4AIJA 3JRGA 1ZG5A 2M45A 3DQVC 1W7PB 1VQKI 4GYIA 4BL0B 3SYTA 1NTCA 2E7XA 1HW5A 1E3OC 5AIQA 1FYKA 1UELB 1O7LA 1JHFA 2PJRB 2JUCA 2GAUA 1SC7A 1B59A 5FLMJ 2FSWA 4CCMA 3H0GJ 5FKNA 4HNVA 1WGXA 1FWZA 2NXNB 2MH2A 2COBA 2HYGD 4E7LA 4QIWN 4HQMA 2K86A 4IRGA 2ME0A 3BCAA 1J2XA 1XDUA 5BOXA 4XLEA 2KZGA 1QPMA 2DA4A 1VZ0A 3HKZN 2HQAA 1VQMI 4U88A 3JW4A 1BI2A 2XKOA 3AG3H 4HX8A 4P55A 2E1OA 4RGRA 1XTAA 2HZDA 2L3DA 1P4WA 2Y9ZA 2FE3A 3E6DA 3X2QH 5B5EC 1D5VA 3KP4A 2M7BA 1VQ9I 2HVQA 5EG0B 4WXDA 4HNUA 3LA3A 1F1ZA 2V9PA 1LEBA 3CUQA 5DD4A 2L7MP 3K1MA 2KJBA 2VKEA 3IAM2 4Q48A 1F43A 3HL2A 3BQZA 2VJ4A 3OYFA 2CSOA 2GXBA 2YPRA 1ZGWA 3CC2I 2MBFA 4P9FA 5K1YA 5GTHC 5K7ZA 3F8BA 3HOZJ 3J80Z 4XLFA 3GUDA 1DU6A 3I0TA 1FPQA 4HLXA 5F0CA 3JRFA 3G71I 2D1VA 2EZHA 4I6ZA 2HU9A 4HPQA 1VNDA 4EM0B 3NRVA 3GZ6A 3G3ZA 2HXOA 5LGUA 1OYWA 2LBFA 2ZMEB 4XICA 1L3LA 2Z9OA 2OUMA 2XAFA 5KNLA 4UUSB 4ZZLA 3ZQFA 1FMVA 2NNNA 5AIPA 3GTGJ 4A0ZA 4X1EA 1MBJA 3K69A 3I58A 4C9YA 3WTUC 2CQNA 3DKXA 4A3DJ 3FZVA 2TRTA 2K27A 2XVCA 5H6QA 3IH3A 2X6OA 1FOKA 1LEAA 2OV7A 1S72I 4NQWB 4EJWA 4CXFA 3WTTC 1OQYA 3W2VA 2OF7A 3Q0UA 4A0XA 1JT0A 4CH7A 1E3HA 1BJAA 1JHHA 1W7PA 1IUYA 3V4GA 4B3AA 2CU7A 4M9ZA 1WH5A 1X1BA 1BM9A 2DYSH 5GAHJ 3H5NA 3DTIA 5BS6A 3F9KA 4CHUA 4ZYEA 1TWFJ 4LITA 3RPQA 1CGPA 4L9VA 3RQ4A 3T5XA 2P7VB 1B9NA 1YLFA 1Y1VJ 2E36A 2L7KA 1IRFA 5EJCA 2MC3A 2XF5A 2KDZA 2IS2A 3WG9A 1MDMB 3UR3C 3JRAA 2Z1DA 3PNTA 1UZCA 4DJAA 3GFMA 4D1QA 1RUOA 3CUOA 1T08B 3WTXC 4ENMA 4HG2A 4UNOA 2ZCWA 4PGGA 4CYCA 3Q9VA 3BC8A 4BY7J 2NVTJ 2R7QA 2DQLA 4XKCA 1XCVA 1WJFA 1T0FC 4A12A 3C3WA 2CV0A 2IS1A 3VWBA 1RNLA 3LQQA 1X3ZB 4L9TA 2ECCA 2EJRA 4YIIA 2BVLA 2PJPA 1WSUA 2YS9A 1X2MA 5KCMA 2JUGA 3H36A 4DIQA 3WU0A 3TP0A 3OMYA 1O4XA 2BHZA 3SXYA 4GDFA 3IC7A 1D8KA 3FK6A 3ABMH 1TZLA 3PUFA 3ZCOA 3OYCA 1N25A 4KA4A 2FRHA 1U3EM 1ETYA 5FB2A 2VOPA 2HYJA 5LGTA 2GIVA 4YRVA 1TL8A 2KQRA 2LF7A 2X48A 3ABLH 3ASNH 4D9JA 1SMTA 2OQGA 3A01A 4MQVA 1I5ZA 4RDUA 3OS1A 1DPUA 2MG4A 1MMSA 1ZG3A 3CCSI 2R5YA 4LIVA 2X9DA 2XGXA 3ZQGA 2R7TA 3DP7A 3GTMJ 4UHTA 1YE9A 2FU4A 3FXKA 4PZJA 2IA1A 3V8JA 4CUGA 3H92A 3OSFA 1W5SA 4I0BA 1WI3A 1S7AA 1P7JA 2P0WA 1FT9A 1MGTA 3I54A 5LRSA 5BPIA 1WJCA 3HRTA 4I7HA 4WXCA 5C4XJ 1PVEA 2O0YA 1U0JA 5M3MJ 4JX4A 1G2HA 3OYDA 2ETHA 3CMYA 5DM7F 1T56A 1T6SA 5CVJA 1LE8B 2QF7A 2DN0A 2E34A 3KYDB 4EEFG 3REOA 3FMRA 1CQTA 5D4RA 4G6DA 1WH7A 1POGA 2P5VA 4KIFA 5TJJA 3IRQA 3RKWA 4I01A 1HSTA 3H9GA 4HV5A 2EILH 2XPUA 5IY5H 2ACJA 4AIHA 1P7IA 1GV5A 3RKQA 2H1KA 1VQNI 3OYBA 2CYYA 3K6GA 1RKTA 2QVOA 2ZBKA 2BYVE 4JX5A 4NNJA 1R1VA 1BW5A 3HXLA 3PFYA 5HDKA 3ZP5A 1WZ2A 1XN7A 3GZNB 3ZGKA 2LF8A 1VFCA 4M6VA 3W2WA 1FSEA 2WV0A 2V6EA 1QA6A 2O03A 3S1NJ 5EG0A 5E17F 3B73A 3BLYA 4M3BA 1FIPA 3M7GA 1KU3A 3DEEA 1UCRA 2L7FP 4A5MA 2L02A 4AU7A 3KZIC 2HEOA 4A69C 4J19A 2R7OA 2HKOA 4Q4ZF 1H0MA 3H3VK 3HHGA 2FNPA 2CQXA 2JA6J 3WU2C 1Z9CA 2VODA 2X1CA 1WFXA 2V9KA 3M1CA 3CCJI 2DA2A 3OYKA 1DGWY 3SDGA 2GQQA 1K4TA 1RPWA 2FEZA 2Y0MA 1YG2A 1XSVA 4F3QA 4FCYA 3BG6A 1MMNA 3E6BA 2VE8A 1ZKGA 1I1GA 1KGSA 1OCTC 4S05A 4DYCA 4YIRX 1IG7A 1FTTA 1ENHA 3I3LA 1AHDP 3LSHA 1ZRDA 2ISYA 5DEQA 2L0KA 4K2EA 4B3XA 1BR2A 3OYNA 2DMUA 4BEHA 1IDYA 4P1WA 3K4BA 4U0VA 4BS9A 2M87A 2OTLI 3PJRA 2HWVA 2CQ7A 2X1EA 1H8AC 4RB2C 3CP2A 3MD2A 1LDDA 1JUMA 4NB5A 1ZARA 1L0OC 4EATA 1IXRC 3PSFA 2ZJPF 5B66C 4E7JA 3ISPA 1WWXA 3S93A 4OWRB 1FBQA 5C4JJ 3PIOF 4IQJA 1LUJB 1X1AA 2FBKA 2VXZA 1S6LA 4X6AJ 3CMMA 3RCOA 3ZOBA 2EIJH 1RIOH 3J7AY 1DGRM 1HSJA 3DBLB 1KU7A 5E8IA 3H35A 1QO0D 3OYEA 3A0BC 4F52A 1D0XA 3E97A 4BQQA 2CV2A 3SDBA 4KITB 2RN7A 3KYLA 2EFQA 3F6OA 2VQCA 2AO9A 1R9TJ 2FBHA 1EKEA 3FMSA 2X6YA 1Z21A 3BDDA 3R6SA 4R8HA 2UXNA 1EA3A 2X1DA 5GADJ 2K7LA 4RB0A 5HLGA 1VQ6I 1EJ9A 1GUUA 3IHUA 4BKXA 1I6XA 3OYIA 2A3SA 1QBJA 2CFXA 5DDGA 2KHMA 3FXOA 3TGNA 4IRHA 1R23A 1YS6A 2R0QC 1QQIA 3VB2A 3CC7I 5GP9A 2Y9YA 5HLHA 2W57A 4LB5A 3QQAA 1ACIA 3SZTA 3JSOA 3C2BA 3JRCA 2V26A 4GXOA 2R7WA 2B63J 2EV5A 3ZQCA 2DPUA 3MFKA 2ZNZA 3AAFA 3JAMZ 1DDNA 4A3BJ 1H9GA 1UJ8A 4IVNA 2H6CA 4I76A 1YJWI 1SFUA 4RS8A 1H9TA 3G73A 3AL0C 4MFEA 1YJNI 2QEXI 2QQ9A 1TW2A 3VYRB 4JOMA 1OPCA 2EWNA 2VBWA 4A2UA 1A35A 1ZQ3P 1K83J 3GMEA 4XR6A 3CDLA 2X0LA 2HTJA 1J5YA 3L2RA 5HODA 1Q1VA 3MAJA 1MNMC 2P4WA 4BHCA 2OD5A 2A05A 1WPKA 5FGMA 1G6NA 2DI3A 2FMLA 4A3FJ 3U1KA 1K61A 3G1LA 3MZHA 5EDNA 4RAZA 2IAIA 4PSWA 1IN8A 1FOWA 3BR5A 3DLAA 2OTJI 2EBIA 2IGOA 1DQUA 1FJLA 3ZPLA 1ZTRA 4PUSA 3I53A 3CJQB 3RI4A 4N0BA 3CCEI 1XGMA 4G8XA 3WE3A 5F04A 3NWSA 2QM3A 3CCVI 5EZHA 2P7CB 2VASA 3M9AA 1JKOC 3H1CA 5GTIC 2HDCA 2WAEA 2M8EA 4A3KJ 4EGZA 2FBIA 3HTUA 3QYFA 3VYSB 3MQ0A 5EF6A 1D0ZA 2VIXA 5HS8A 3JRHA 1HDDC 1UHWA 2KIUA 3OL4A 4ZDOA 5L3FA 2DJNA 1VF9A 1TQIA 3SZGA 2BY2A 1W7PD 4CCOA 3VPRA 4A0YA 2M5WA 1V5GA 2CW7A 1EH8A 2PEXA 4XLNF 5FLXK 3MKYB 1R58A 5J6XA 3MVPA 2NVYJ 5HDNA 2EV6A 4Z2YA 1RRJA 4ZH4F 2JT1A 3LOCA 4BE0A 3E3VA 2NS8A 1BI1A 2K85A 3DPTA 5ICGA 2LTPA 1USTA 3CUQC 2VI6A 1R4NB 2QSFX 4ON0A 1LKXA 4Y52J 3F8NA 2P6SA 5KAFC 3DPLC 2DA6A 4PJLA 2X6WA 4KN4X 2PMZN 2E5NA 2E2IJ 2HTSA 2QSHX 2ZJ2A 4I99C 4RBOA 1ZHFA 3B6CA 3RKYA 2IBDA 2F5EA 4GRIA 4CZCA 3FBNB 1Y56A 1FMWA 2H94A 4E70A 3S17J 5B3SH 2HOSA 3ZQLA 4ZTFA 1KONA 5LHGA 4G7HF 2XB0X 4B44A 1ZGJA 3UKGA 1S3JA 2E71A 5F08A 1BC8C 2QQBA 3GW2A 3BPXA 2VKVA 2DMPA 2NOGA 5KK1A 1RR8C 3PSIA 1XSDA 2AHQA 3HGYA 4WF2A 5M5WJ 1B72B 4DBRA 4IEJA 3FKIJ 5JHUA 2Y30A 2R5ZA 4BHPA 2RNJA 4S0HB 4FHTA 2K9LA 1KQ8A 2V1UA 4LLLA 3B02A 2H6BA 1KQ0A 3GF2A 2PJRA 2W84A 5JR3A 4N9HA 1QU3A 3GTKJ 1HA8A 3MKLA 2R7VA 3HGGA 3C2GA 4KT6A 3V8LA 1T33A 5FKMA 3OIOA 4UUSA 5ILVA 1R22A 3J80K 5GAEJ 2LOOA 2H09A 3DKWA 3K10A 5J47A 4MIMA 4RAYA 1LVAA 1MJAA 2K9NA 3BJAA 4E6KG 1R5GA 2ZO4A 1NG6A 3CJRB 3MKWB 1FTZA 4FE7A 4WWCA 4TV7A 1X58A 3QPSA 4M3EA 2E7WA 3J81K 2NVUB 4ESFA 3S32A 5BPDA 3FBIB 5K5RA 1TQMA 2K4BA 3FDYA 2LY2A 1XMXA 1HW2A 1HCRA 3SQNA 3TO7A 4A93J 4DYRA 2HDDA 3ERMA 1OYIA 1X3UA 2OZUA 1FOXA 2HFHA 3IUOA 2ZSIB 3CC4I 1IDZA 3Q3SA 4R79A 3TL4X 2G7UA 2GA2A 1Z0XA 2LRDA 2HOTA 3DTEA 3P9KA 3HDDA 3BR6A 4AD9A 1D5YA 2YR2A 2A6EF 2B0LA 1IV8A 1VQ5I 1QGPA 1EF4A 4WCGA 2RNGA 2HNHA 3ABKH 2XROA 4BGDA 5A2QZ 3QAHA 2XSDC 2KL4A 3MN2A 1P9QC 4G7OF 3P5JA 2DFHA 3IL2A 1X1PA 4WX9A 1DUXC 2X51A 3CCUI 3VYTB 3BG9A 3J81Z 5AONA 1B9MA 2EFNA 2K9QA 3WHCA 2BY1A 4ABZA 4M6YA 4HZFA 2BGCA 2DA7A 3KEQA 4MEYF 3VSLA 3L09A 1IV6A 3KP7A 2DA1A 4O3MA 1BIBA 3TOAA 1B6AA 2DFIA 3RTRA 3AG4H 5F27A 2R7DA 1DU0A 1T95A 2GOMA 3GTOJ 5D8KB 5LEKA 3K4CA 1JKRC 1WQ2A 5HNFA 3BP8A 3BTJA 3K4MA 3T8TA 3K1PA 4XN3A 2NAZA 3KLOA 1J9IA 3D0SA 2O7OA 3HZJA 1R4MB 3HOUJ 4L9JA 2DMTA 2VJ5A 4B47A 4FX0A 2ZB9A 3LSTA 5C3EJ 2LG4A 2E1MC 5JVGF 1OISA 3JTGA 4A3JJ 5FLVA 3VYUB 2JTVA 3IP4B 1RZ4A 5D5VB 2JSPA 1E17A 2AXTC 3GFLA 4CCJA 2JRMA 3ZQQA 2J5PA 3ECOA 4BXXJ 3A02A 2RGVA 2VL8A 1HKTA 5E3LA 2ZFWA 3LAPA 3OWTA 5J1RA 3GZ5A 1JT6A 3S2DJ 4CYDA 2BY3A 5CYVA 1A36A 2M3AA 3OIQA 1D0YA 4LK0F 4N4OB 3WE2A 1P6RA 4LB6B 2CGPA 2RREA 1IN6A 2IJLA 3OYHA 4YFXF 1XCBA 4XORA 2LC2A 1Z67A 2QSGX 3QU3A 3GTJJ 4QSHA 2E35A 2JN6A 1EH6A 1IAWA 1X4PA 3LWFA 2V6CA 5HS7A 3VFZA 1B72A 3ML6A 1YO5C 2CMPA 2V1DA 2FF4A 4CSWA 4BXFA 5F6FA 4RB1A 1AKHA 5CKTA 2DDAA 5J8CA 3LA7A 2R7UA 5IOZA 3GXOA 1GV2A 1AA7A 2PMZA 2XC7A 1LFUP 3V7CA 3KZZA 5CQEA 4I0AA 4XSZF 4LG0B 5HLIA 1G3SA 5LBQA 3CO7C 1RI7A 1Z77A 1P4XA 1W4MA 4MHGA 2O61A 3OOUA 1LVKA 3TO9A 4A3LJ 5L3BA 3CLOA 3RSNA 4C2UA 2VUMJ 1A31A 5GPAA 4UY8I 3CF2A 4NHJA 1OCOH 3P7NA 5J4YA 3BG7A 3M3YJ 1BI3A 2Z16A 3TMOA 1OR7C 1IZ1A 2XAGA 1RUNA 1AWCA 3OYLA 2IP2A 3ZN1A 2EB7A 1KU2A 4LMYA 2V4JC 3U2RA 2DT6A 1D1BA 2J5OA 1S7OA 2MGQA 5LGNA 3OR1C 1ZR2A 3VOEA 2NS0A 1Z3XA 4QWQA 4AWXB 2FXAA 4XK4A 1UFMA 1KU9A 2OCEA 3FMQA 2DCEA 3G1MA 2KMUA 2HR3A 1OMIA 1R5ID 1SANA 2W1OA 3DV8A 1V55H 2G7HA 1LQ1A 1IUFA 5FD5A 4ENJA 4GYGA 2QYOA 1Y8RB 1O57A 1T2KA 1U8BA 4AUXA 5ICEA 1ZLKA 3CTAA 3FHNA 3OS2A 4KJZA 1TT5B 1TWCJ 3K0LA 3HSEA 5J4VA 1VQOI 2DT7B 1CF7A 2KIMA 1USSA 4XQFA 1VQ4I 1HXDA 1MMAA 1XB4A 2H8WA 3KP6A 3ECHA 4D7NA 5A2QK 1JXSA 3LSRA 2I5UA 1BL0A 3CUQB 3QRFF 4IHYA 5K5QA 3KEOA 5TISC 4IHXA 3PNVA 4ZYAA 3F3XA 1FP1D 1XC5A 5EZGA 5KVRA 2JZYA 1X3WB 2B9SA 3VSKA 4I02A 1I39A 2HQRA 3W2AA 2KDOA 2K9MA 2XF7A 2XHKA 2BE5F 3KZYA 1PUFB 3PIPF 4AIDA 2L7ZA 3K4KA 4L5EA 4XRFA 4DZPA 2KP6A 4ETSA 3FXLA 2L9VA 4LG0A 1S9HA 1BBYA 4NC8A 1YIOA 1XD7A 3A2KA 2VPRA 2E60A 2KJCA 3OYAA 2XDVA 1X1DA 2CUZA 3IKTA 1UHMA 2K3FA 1SFXA 3CQZJ 2WWYA 3S3NA 1IRZA 4IHWA 2ZJRF 3GTLJ 1K6YA 3CCYA 3M8FA 3O2PE 1WVRA 2P6TA 5DTDA 4CA0A 4B1RA 1D1AA 3Q0VA 1XX5A 1GXPA 5CQGA 5ERIA 4HOBA 1OLTA 3A03A 2HPIA 3L2CA 1FX7A 3C7JA 3WG7H 1FC3A 3U21A 1MDMA 1ERDA 3WTVC 1N77A 4A6EA 3W6VA 4IHVA 2DYRH 4ENNA 3S3MA 3HOYJ 2JPBA 2DOFA 1SVOA 2LP0A 1RKWA 4GCVA 3R4KA 2DMNA 4OIQF 1JE8A 4A3CJ 2JA2A 5H20A 2AQEA 4HX7A 3HOVJ 2FJ1A 3E7LA 5FROA 3HB9A 1EV7A 2QZ8A 3GLXA 3SHFA 3ZR8X 3GX4X 1PDNC 5D5UB 3JRBA 3BWGA 1XGSA 1C0WA 3KP5A 2A6TA 2OJED 2PFBA 2WC2A 2D45A 3QP6A 4OIRF 4RB3C 4ANJA 1XMAA 3O6BB 2O8KA 3H0DA 4XKBA 1XS9A 1HKSA 1U5TA 3OOPA 5LRRA 1JKQC 1F4KA 2IS6A 2XSJC 4OIPF 5DV5A 5M5YJ 4Y7NJ 4IJAA 4E7ZA 3J7AO 1TWAJ 1ZH5A 3GFJA 4ZTJA 5E20A 5IYCJ 1P2FA 4LD5A 1MMDA 5E1ZB 1AKHB 2DU9A 3HSFA 1J09A 1ITYA 1U5TB 3LQRA 2IA0A 2WTEA 2Z99A 2CUEA 5EGOB 2CV1A 4V19K 1SD5A 4EMSA 3DWLE 1ULYA 3KP3A 1JUSA 3HPGA 1IGNA 4EGYA 2RVCA 4HSRA 4F7ZA 3UNGC 3IWFA 2GXGA 4XLHA 1D1CA 1R6RA 4BHBA 3EYIA 2VE9A 3N4MA 1SFKA 2V1XA 3JRIA 4IF4A 3I59A 2L9SA 1HC8A 2EFOA 1WJ5A 3I56I 5H2FC 5FJ8J 1X4OA 2R5YB 4IO9F 1XPXA 3KIOA 4BUPA 2E2JJ 3PM1A 4B43A 3GVAA 1ETWA 2DOEA 2P81A 4L18B 4QLCU 3A01B 3E0JB 1SVMA 1J0RA 2Q8KA 3E5UA 4BJ5C 1ON1A 2BVMA 1NG7A 3HKZA 3S14J 1IC8A 1W1WE 1XGNA 3BOQA 3CDHA 4XLAA 4O6JA 2Q1ZB 3Q5FA 4BE2A 3PO2J 1HOMA 3I64A 4C2TA 3S15J 3HRMA 2HQ5A 2F6CA 5EEAA 2KRHA 2VQLA 5FFXA 3CO6C 5C44J 3H3UA 3GWZA 4A3GJ 1ZK8A 5CLSA 4BE1A 3Q0WA 2VKDA 5E8GA 3D5SC 1ZR4A 1ZREA 4H0EA 2Y0SA 1G4DA 2CH0A 3F22A 2DK8A 4WK8F 1FYLA 2MC4A 4QPQA 1CF7B 4XIDA 3PO3J 3AG2H 5IP6A 1OR7A 2BXZA 2VQHA 3CZ6A 1KQ9A 3JCUC 3C18A 2GA1A 4F92B 1TNSA 2V7FA 2VC0A 1Y0UA 1JTYA 1G3TA 2FUG2 4BJTA 3GCMA 1PYVA 4MEXF 4XBFA 1JTXA 4U0WA 3HOWJ 4A3IJ 1IJWC 4OINF 4CDGA 5FLXZ 1K7AA 2NRAC 4XRMA 3DTKA 2IA2A 2IPQX 1TNTA 3TO6A 4EM1A 1PUFA 1B8IA 4U7DA 2EIKH 3O8GA 4H4KC 1YHQI 4OIOF 3LL7A 4RGUA 3HC7A 2OA4A 5F0HA 4IHTA 4RLQA 3BJ6A 4YELA 2HVSA 3BR0A 4MTEA 3V8KA 1MW7A 2HKXA 1BI0A 2W00A 3OY9A 1LNWA 3NWTA 3COAC 5J1YA 1IN5A 2MD5A 2PMUA 4XMYA 1ONVA 2AXLA 3TW6A 4UVCA 3KETA 2ZXJA 2EA4A 3DEUA 1P92A 2ZNYA 1YI2I 1M1EB 3T8RA 2DMQA 3DPUA 4XOTA 1U2WA 3RYRA 4HDUA 2DDBA 4HLYA 2BEOA 2P5LC 5M5XJ 1JJ8C 4IX7A 4LK1F 4PSXA 4G94A 3I55I 4YIFA 2DODA 3QP5A 4XRSG 3H9QA 3LSGA 4PJ0C 1G3WA 1QZZA 3B6AA 2GOXB 4EJTA 3DCFA 3O8HA 4AVPA 2DT5A 3CCRI 3RZDJ 1AU7A 4HA8A 3GYHX 3K2ZA 1IO2A 1U5TC 4O5VA 3FM3A 3WGHA 2STTA 4UV8A 2AS5F 2MA3A 3R0AA 2HI3A 1E0EA 1Z1DA 2COMA 1SAXA 1V5FA 5FD6A 2XPWA 2A6HF 4XL9A 2LKPA 2KPMA 1O3QA 1SMYF 2ZMEC 3QPTA 1ZG1A 2R92J 2QLZA 2EV0A 3I4MJ 5DCMA 1TWHJ 1LE8A 3IWZA 4ZDLA 3LSJA 2Y0SN 4LOCA 2ZXWH 4NC6A 3LAJA 1JUPA 3E5QA 1QNTA 4XRSA 2M7AA 3ERED 4J01A 3L2UA 2A07F 4GFBA 2ICWG 2MYSA 3K4NA 2MABA 1OCRH 3VDXA 1ETOA 5IT9K 1F9NA 3LA2A 5J3LA 3IAS2 1YX3A 1VTNC 1OFCX 4KYWA 2V1NA 5FKOA 2HOEA 5BMZA 4BDZA 4EJVA 2E1NA 3S3OA 4KISA 2M0MA 2LKSA 5DYMA 3D5RC 2ZJQF 3TP3A 4KNYA 3MEXA 5ILUA 3V7SA 2Z2SB 4HYEA 3P9IA 4XSXF 4E7KA 2QQAA 4BJ6C 1HF0A 2DXIA 4RA2A 2G0EA 2QA4I 4G12A 2CJJA 2IVMA 4DNCA 4XKVA 3KFWX 3CMAI 2DLLA 4XKWA 3ZMVA 3BTLA 1W0UA 4CZZA 2JA7J 1R7JA 1Y39A 4ESBA 2DPDA 4KIGA 2XB5A 4UVBA 2DA5A 3ZMSA 2A5YB 2QKMB 3HYIA 2CS3A 1YFHA 1ZRFA 2F5DA 2JPCA 3ZQ7A 1V5EA 3DXJF 1LFPA 3A0HC 1V4RA 5B1AH 2CW8A 1MKMA 2W25A 3WHBA 2Y69H 1X19A 1ZELA 2F4IA 3TW7A 1LDJA 3S2HJ 1YRNB 1MBFA 5J1UA 2ISZA 2OC6A 5CVRA 2W82A 3OIPA 2XASA 3D5LA 4AIKA 1QHHD 5IP9J 2ZSHB 3EUKL 1SEUA 3GO5A 1YJ9I 4YFNF 4PGHA 2BZTA 3FXRA 2YU3A 4CGZA 4JK1X 3W6JB 2P5KA 3M07A 2K40A 1VQ8I 3T1BA 2VBXA 2WADA 5E79C 3BPVA 3R60A 1WRJA 1TWGJ 1WJAA 4G6TB 1YW9A 4V2GA 1S8NA 1QZEA 3D1NI 4GGGA 1ZLJA 1TW3A 4MTDA 2WY7Q 2L01A 1HQCA 4XOPA 1FYMA 5FRNA 3BR1A 3W6KB 2JRTA 4HAMA 3CF5F 1D8JA 3ZN0A 3RYPA 1JGGA 3ASOH 4BU2A 2R7RA 4M73A 2KIFA 4EQQA 1VI0A 1R5HA 3HSRA 3CLQA 3HHHA 4AYBN 3M4OJ 4BY1J 4ZYHA 1QZYA 3DLLF 1PP8F 2IRFG 3DBRB 2M9HA 3JRDA 5LD2C 1JKPC 3JREA 5K7HA 4FE4A 1YOVB 1BA5A 2R7FA 5GPCA 2H27A 2XAQA 2OU2A 5HNHA 1ETQA 1G3YA 2E1CA 4HSTA 1ETVA 2LLKA 4D7MA 2JJ7A 4RGSA 2BOLA 4GO1A 4BDYA 4ZC3A 2EA2A 1ORKA 2ELHA 3RDIA 2A69F 5D5WB 5IT3A 3ZRGA 2DJIA 4BH9A 5KHDA 1UG0A 4BBRJ 1XDSA 2LNBA 2OCCH 3E6MA 5ICFA 4LFUA 2BHYA 5ICCA 3WTYC 2F4MB 1N78A 4CCLA 1MNDA 2W4SA 1Z05A 2MH9A 3KE2A 4KUMA 4R1HA 2OZ6A 5JVTA 2MFZA 2X85A 2FX0A 2D2WA 2XAJA 2KKOA 2XIGA 1MZBA 4L0ZB 2V9VA 4WXHA 3G4SI 1FBUA 1XG1A 3R0JA 4HW0A 4YG2F 3IV5A 1Z7UA 2DTZA 1JI8A 3BJOA 3CCQI 2B7EA 3ESWB 1ON2A 3AFHA 1GDTA 2MD0A 1R1TA 2IGKA 5DCMB 3GFIA 5M3FJ 2V79A 3F6VA 3AL0B 3V42A 1XSXA 3RPUD 2ESNA 1MBEA 2VQGA 1Z91A 3TBIA 5FKLA 4OMZA 2JK3A 2EK5A 2VN2A 5E3OA 1X1CA 2F5CA 2ZKZA 3MKZA 4FETA 3ABTA 3O3KA 4OU0A 4JBAA 5LEJA 2NVQJ 2Y31A 4E4HA 1FNNA 4EJUA 1BW6A 1K6OA 1WCMJ 4RGXA 2LH9A 2XRNA 4EVIA 4G7ZF 1Z7LA 4UB8C 1EH7A 2OAZA 2XF6A 3MCZA 1IN4A 3H5RA 2Z33A 1MMGA 3BR2A 4D0PA 2O5RA 4PJNA 1GT0C 2HGCA 2Y48A 1LFBA 3JR9A 2L9NA 2VJJA 1A5JA 3I4PA 3LFUA 5FO5A 4IKFA 2IGNA 1LB2A 1SAUA 2R7SA 4UUVA 3FWEA 2I8DA 2UXXA 2DAOA 1UHSA 5IYDJ 2R7XA 2LVSA 2PMHA 4G6QA 1YW7A 2O8XA 2BW3A 2F5VA 2KRCA 1J7KA 3OL3A 1ZRCA 4OMYA 9ANTA 4HBLA 2H8RA 2IGMA 3K1NA 3F8FA 3LMMA 4ASNA 2LY1A 3RZOJ 1S7EA 4YEJA 3SFIA 3H3ZA 2K3PA 1K79A 1UG2A 3S8PA 4IOCF 1U78A 4NQWA 1MIJA 4Y3OA 3ONQA 3MMYB 1PJRA 3DU6A 3AG1H 3PL8A 5K7FA 4HF2A 3RQIA 1H89C 3EYYA 2KRFA 2PG4A 2HQNA 1V3FA 2Z3YA 2E1MB 1JGSA 1B1BA 5EYRA 3PQKA 2QCOA 3KCCA 1U6GA 3H9JA 3K4JA 4NUBA 3HOTA 4B4CA 1SFEA 4X0GA 1D3YA 2TDXA 1WI9A 5E1WA 3KP2A 3PFIA 3H5AA 4PFOA 2XKPA 5HDGA 2PLYA 1IF1A 2K02A 3QODA 2DK5A 2QBYA 4F93B 4MO7A 5IPAA 1K78B 1MH3A 4FQGA 4B8XA 2LMDA 4W1UA 3ELKA 1UMQA 3HRUA 2LR8A 2WA0A 1SFOJ 5BQTA 3A1YA 1QPIA 4IOAF 3G6EI 2E5ZA 4IRIA 1Z3YA 3MWMA 2HOAA 2L9RA 4N9IA 1TT0A 1BOAA 2C6YA 1ZN2A 3E1SA 3NQOA 3OR2C 3NAUA 3AKZA 2XV4S 1FOYA 4XLPF 1A6IA 2NS7A 1U8RA 1J59A 3KPHA 2RQQA 3MZYA 2Q2EA 1QHGA 4MQ9F 2QENA 1OCZH 2DTRA 1V54H 4EM2A 3L2VA 1ETXA 2QGUA 5E3MA 3EQLF 3IRRA 4Y33A 2LFBA 4MLOA 4PDKA 1E2XA 2M2EA 1RR7A 2VBYA 3IH4A 5IOYA 2LDUA 4ESJA 3M1EA 1MBKA 3FKJA 2STWA 1BR4A 2L2OA 4P5OA 1W36C 3LNQA 2WBMA 1YIJI 2JA5J 3BZ6A 2CFOA 3WTZA 3T0YA 5DUIA 2WV1A 2CUFA 1PP7U 2F5FA 1LPQA 4II3A 3OYJA 1TP4A 1IXCA 2XRLA 5L3GA 2L54A 4BBSJ 3EPZA 2CG4A 2JA8J 5L3EA 1LDKB 1MH4A 2QWWA 4IHSA 4LLGF 1WJDA 4BQNA 5DD8A 3BZCA 2Q0OA 3DKYA 4II2A 1HBXG 2W7NA 2UV1A 3C1DA 4Y13A 2HPMA 2KLOA 2LYCA 1K4SA 4DOZA 4HF1A 3HPHA 1I3AA 2R5ZB 1YITI 3WODF 2M4GA 2VXDA 1HKQA 3G1OA 4FX4A 1YRNA 2JVGA 2ESHA 2RV8A 1FEXA 3BZKA 1A04A 4F55A 2YSRA 2GBYA 2PN6A 3BT9A 3HOXJ 4HX4A 3CP8A 4JX6A 4CCNA 1Y1WJ 3KX2A 2Z5UA 4M74A 4L0YB 4OOIA 1KYWA 4M9XA 3TOBA 2OPTA 1I1SA 2FQ3A 3QU6A 1O3SA 1FP2A 3HEFA 3PUBA 1IRXA 4LGWA 2LKXA 5D5XB 3R61A 2JVHA 4CCKA 2JSCA 5CPRB 1Y8QB 3HG9A 4M71A 3L2WA 2EZKA 1A6QA 2H1LA 3CJNA 3TEDA 4B48A 4E7SA 1PUEE 1E3PA 5D4SA 2VC1A 3FK7A 2LREA 4CICA 4RAFA 3K70C 2X6XA 2IT0A 2R7ZJ 2FOKA 4IZZA 5TRDA 2PI0A 3JTHA 3F23A 3KYCB 3SEZA 4BXUA 2K5CA 3F21A 4KFCA 3IKVA 2AQFA 3N97A 2EIMH 4A5NA 1HW1A 4LIUA 4V2FA 2N8GA 2PX9A 2UUZA 3PNYA 2W85A 1GXQA 1YW8A 4BYYA 2BY0A 4LLNA 1KZHA 2M4KA 5B1BH 1TQPA 3GTPJ 3MZ8A 2A61A 4HDVA 2PQ8A 5F64A 2YUSA 3HRSA 1GVJA 1B8IB 4FT8A 4L5IA 5F1JA 4W97A 1I6HJ 5LFAA 4HNTA 3L00A 2QQ8A 3L2QA 3KEYA 3RJPA 2XGCA 1T8IA 2WB1A 3BTIA 1G8XA 2O6GE 5D8LB 5CVUA 1IW7F 3ZMUA 1R71A 1Y6IA 3BTCA 3ZQIA 2EZIA 1DP3A 2CW0F 2TCTA 1QVUA 4L5JA 3CCLI 3OS0A 3NARA 4IL6C 2NOJB 2NYXA 3E5XA 3SEQA 1Q1HA 4U87A 5L3DA 3FHZA 2OQRA 1BOBA 1RC9A 4P9UA 1SD7A 2QKLB 5DUKA 1WJEA 3S1RJ 1W0TA 3SJMA 1MSFC 3LSMA 2RQPA 4L9NA 4Q47A 4Q5SF 5FRMA 3WU1B 2DQRA 2EH3A 3BROA 4AYBA 3QYBA 4M3FA 1IN7A 3DEWA 3BY6A 5EEHA 4UB6C 1ETKA 2A68F 4IXAA 2CQQA 4ZYGA 5FFZA 4ZYDA 3BR3A 4Z6YA 2VOOA 2XUBA 2YX4A 3SFZA 2LY9A 2RAEA 3IH2A 2WAFA 2CO5A 1YX5A 3DBHB 4NBQA 1GHCA 2LBFB 2VJIA 4P96A 3N05A 2EFWA 4ZDPA 3WGGA 2XAHA 2UWMA 4BAYA 3ZQHA 2WY8Q 1R00A 3I9V2 2MLGA 1I3QJ 2HDWA 2FOWA 4BQOA 1UB9A 3S1QJ 4AM3A 3FXMA 1XGOA 2DW4A 2GWRA 5F0FA 4NDLA 2ECBA 1YYVA 4XNFA 1QVTA 4OAZA 2K9SA 2Y75A 3DFGA 3SZPA 2I10A 4KIBA 5EGOA 5FKKA 2EINH 1KA8A 4D5FA 2BW3B 3TKYA 3A4CA 2NVXJ 5K5OA 2VT2A 3I71A 4RM2A 4DZJA 1OJLA 1FSHA 2D1HA 2XGDA 1NHAA 1N75A 3CESA 1WKMA 4Y15A 4A6DA 3EUHA 4XLCA 2HXIA 3K4LA 5HLTA 1T38A 3K70D 1NH3A 1Y0NA 3CJTB 4KN7X 1OCPA 4KT5C 3ZMDA 3LFKA 3FX3A 3K9TA 1NK3P 1OKRA 4PJMA 4CO8A 2MLKA 3F8MA 4DQ2A 3F72A 2F2EA 4PJJA 3HOSA 4BACA 4DGWB 1R49A 2CUJA 2EZLA 3EETA 2HVRA 1MJ9A 4M6XA 3U9GA 3FF5A 5LHIA 3VODA 2IXSA 2O9LA 4C2MJ 1GVDA 2DOAA 1BN5A 1X2NA 4UV9A 2EFPA 2XAUA 3JAMK 2RKHA 2M34A 4A3EJ 2R93J 3BCBA 4AC0A 2BBYA 1FIAA 4CYCB 3FM5A 4XONA 4IPAA 4ZZDA 1ZGAA 3Q9SA 5D6FA 4I2OA 1TLHB 4DYQA 3QYEA 1RETA 4ITVA 1WHUA 5CJ9A 2VONA 3I4NJ 3P9CA 4E7IA 2DA3A 4KMUX 3GBGA 2IW5A 1STZA 2YX7A 4EJOA 3HUGB 1BR1A 3CCMI 4G9YA 2YU9J 2DO7A 3QOPA 4M72A 3NEUA 4MGRA 2VLAA 3L7WA 1OYYA 3HIFA 5DS9A 2G9WA 4M9SA 5ED4A 1ODDA 3M8JA 4UXNA 5KAIC 1GLNA 1TTYA 3CDIA 5E3NA 5HVQC 3CD6I 3G2BA 2KISA 4C3HJ 2ZXHA 4N4NB 3W3CA 5TGTA 4B09A 1AOYA 1O3TA 5IP7J 1W5TA 1W36D 5DM6F 1APLC 2P8TA 4U7BA 2JMWA 1TC3C 2HZTA 2W48A 4HEA2 2FNAA 3EDPA 3JSPA 2IS4A 3K2AA 5E18F 4A3MJ 2EPFA 1B4AA 2E2HJ 3OV8A 1SD6A 1VQPI 3F0CA 4BEHB 2ADUA 3OYGA 3HJEA 4UVAA 1ZAOA 4DBQA 4C30A 3VEPA 3ZXSA 1LJ9A 3HUGA 3RPUA 3I5UA 3S16J 5IYBJ 2ZMEA 2WB1N 2EQRA 1F5TA 4FISA 2VBZA 2GM4A 2WAQN 2CRGA 2OBPA 1JJ6C 5LLQA 2RDPA 2FD5A 2F4OB 3HTSB 2ELJA 1R1UA 1FY7A 1UAAA 2ZXIA 2DFFA 2K4JA 5HS9A 3DF8A 3PQJA 3E6CC 1VQ7I 3V7RA 1XMKA 4RLFA 4ZJZA 1DPRA 1KYZA 3C2HA 2GZWA 4I09A 3S2WA 4RMNA 5BNGA 5HOOA 1U9OA 4C3JJ 5F1RA 1IXSB 2LD5A 1J75A 2GIZA 2XPVA 2ZC2A 3L9FA 3OYMA 1K78A 2BXYA 2Y2ZA 3M8EA 2JWTA 3S1MJ 4XM3A 5JI6A 2HYFA 1I50J 3LSKA 3ABUA 3OSGA 2Q2EB 2W24A 4RAGA 5CVVA 4M3GA 5JFRA 1I27A 2CWEA 3F8CA 2VKHA 3LSPA 2MW8A 3TQNA 4JYKA 4MFDA 2UZKA 2L4MA 3BG3A 4D5CA 2CQKA 1FLIA 2M1BA 3I59B 4PFPA 3QPLA 2FMYA 1BIAA 4FTHA 2M30A 3FIWA 1QRYA 2BV6A 2M8GX 2E19A 4I98B 5CVIA 1F36A 5EEGA 3FXUA 4BNCA 1W5CC 4HV6A 1TBXA 3DU5A 1U9NA 3GLLA 3LSIA 3QOEA 4DW6A 3J7YJ 1Z6RA 3K7AJ 4OAYA 1T98A 1O3RA 2ELKA 1SD4A 3BQYA 2WAQA 5E1XA 5D6EA 1FZPB 2D5VA 3TDUC 3CMEI 5JHFA 3WTSC 4JP0A 4Y4RA 1R36A 3FXJA 4LJZF 1BC7C 4KICA 4NC7A
chains in the Genus database with same CATH topology
2DBBA 2VT3A 4HF0A 1IRGA 1S29A 3WGIA 1FBSA 1YTYA 1DP7P 1REPC 2RC4A 4PCQA 1MD0A 1YS7A 4JQFA 2O3FA 3RIRA 4U0YA 3WTWC 5J8FA 3FXQA 4ENKA 2LSOA 3GEZA 3U1DA 5ILSA 3RKXA 1P4AA 2QBYB 4Y17A 2R3SA 5LHHA 4HQEA 5DCFA 2PBIA 4BQAA 1O7FA 2X4HA 4KDPA 4EV0A 6PAXA 2L4AA 1MJBA 3ZMTA 5L3CA 3QPHA 2FA5A 5H6RA 3TDZC 4MNUA 4S04A 1T0FA 3ROUA 3ULQB 4KMFA 1YQAA 2HS5A 4YFKF 3ZMZA 1Z6TA 1T39A 3KLNA 2NNYA 1ZYRF 2QUFA 5IT9Z 4AIJA 1ZG5A 2M45A 3DQVC 1W7PB 4GYIA 2E7XA 1HW5A 5AIQA 1FYKA 1O7LA 1JHFA 2GAUA 1B59A 2FSWA 1FWZA 2MH2A 2HYGD 4HQMA 2K86A 4IRGA 1J2XA 1XDUA 5BOXA 1QPMA 4U88A 3JW4A 1BI2A 2XKOA 4HX8A 4P55A 4RGRA 2L3DA 1P4WA 2FE3A 3E6DA 1D5VA 3KP4A 4WXDA 3LA3A 1F1ZA 1LEBA 3CUQA 5DD4A 3K1MA 2KJBA 4Q48A 2CSOA 2GXBA 2YPRA 2MBFA 4P9FA 5K1YA 3F8BA 3J80Z 3GUDA 3I0TA 1FPQA 4HLXA 2D1VA 4EM0B 3NRVA 3GZ6A 3G3ZA 5LGUA 1OYWA 2ZMEB 1L3LA 2Z9OA 2XAFA 4ZZLA 5AIPA 2NNNA 4A0ZA 3K69A 3I58A 3WTUC 3FZVA 2K27A 2XVCA 5H6QA 1FOKA 1LEAA 4EJWA 4CXFA 3WTTC 4A0XA 1BJAA 1JHHA 1W7PA 1IUYA 3V4GA 4M9ZA 1BM9A 5BS6A 4CHUA 4ZYEA 3RPQA 1CGPA 4L9VA 3T5XA 2P7VB 1B9NA 1YLFA 1IRFA 2MC3A 3WG9A 1MDMB 3GFMA 1RUOA 3CUOA 3WTXC 4ENMA 4UNOA 2ZCWA 4PGGA 3Q9VA 2DQLA 1XCVA 4A12A 3C3WA 1RNLA 3LQQA 4L9TA 2EJRA 4YIIA 2PJPA 1WSUA 3WU0A 3SXYA 3IC7A 1D8KA 4KA4A 2FRHA 1U3EM 5FB2A 2VOPA 5LGTA 2GIVA 2LF7A 1SMTA 2OQGA 4MQVA 1I5ZA 1DPUA 1ZG3A 2XGXA 3DP7A 4UHTA 2FU4A 4PZJA 2IA1A 3V8JA 3H92A 1W5SA 4I0BA 1S7AA 1FT9A 1MGTA 3I54A 5LRSA 5BPIA 3HRTA 4I7HA 4WXCA 2O0YA 2ETHA 1T6SA 5CVJA 3REOA 3FMRA 5D4RA 4G6DA 2P5VA 4KIFA 5TJJA 3IRQA 3RKWA 4I01A 1HSTA 4HV5A 2ACJA 4AIHA 2CYYA 2QVOA 2ZBKA 2BYVE 1R1VA 5HDKA 3ZP5A 1XN7A 2LF8A 1FSEA 2WV0A 2O03A 5E17F 3B73A 3M7GA 1KU3A 1UCRA 4A5MA 2L02A 2HEOA 1H0MA 2HKOA 4Q4ZF 3HHGA 2FNPA 1Z9CA 2VODA 2GQQA 2FEZA 2Y0MA 1YG2A 1XSVA 3E6BA 2VE8A 1I1GA 1KGSA 4S05A 1ZRDA 2ISYA 5DEQA 4K2EA 4U0VA 2M87A 2HWVA 4RB2C 4NB5A 1LDDA 1ZARA 1L0OC 1IXRC 3ISPA 1WWXA 1FBQA 2FBKA 2VXZA 1S6LA 1RIOH 1HSJA 1KU7A 5E8IA 1QO0D 3E97A 2RN7A 2EFQA 3F6OA 2FBHA 3FMSA 3BDDA 3R6SA 4R8HA 2UXNA 2K7LA 4RB0A 5HLGA 3IHUA 1I6XA 2A3SA 1QBJA 2CFXA 5DDGA 3TGNA 4IRHA 1R23A 1YS6A 1QQIA 3VB2A 5HLHA 2W57A 4LB5A 3SZTA 3JSOA 4GXOA 2EV5A 2DPUA 3MFKA 2ZNZA 3AAFA 3JAMZ 1DDNA 1H9GA 4IVNA 2H6CA 1SFUA 4RS8A 1H9TA 3G73A 2QQ9A 1TW2A 1OPCA 2EWNA 2VBWA 4A2UA 2X0LA 2HTJA 1J5YA 3MAJA 2P4WA 4BHCA 2OD5A 5FGMA 1G6NA 2DI3A 2FMLA 3MZHA 4RAZA 1IN8A 3ZPLA 3I53A 3RI4A 4N0BA 1XGMA 4G8XA 3WE3A 2QM3A 2P7CB 3M9AA 2HDCA 2M8EA 4EGZA 2FBIA 3HTUA 3MQ0A 5HS8A 1UHWA 2KIUA 5L3FA 1TQIA 1W7PD 4A0YA 2M5WA 1EH8A 2PEXA 4XLNF 5FLXK 1R58A 5J6XA 5HDNA 2EV6A 4Z2YA 4ZH4F 2JT1A 3E3VA 1BI1A 3DPTA 5ICGA 1USTA 3CUQC 4ON0A 3F8NA 2P6SA 3DPLC 4KN4X 2HTSA 2ZJ2A 1ZHFA 3RKYA 2F5EA 4E70A 2H94A 5LHGA 4G7HF 1ZGJA 1S3JA 1BC8C 2QQBA 3GW2A 3BPXA 5KK1A 1XSDA 4WF2A 5JHUA 4BHPA 2RNJA 4FHTA 1KQ8A 2V1UA 4LLLA 3B02A 2H6BA 1KQ0A 3GF2A 2W84A 5JR3A 4N9HA 3V8LA 5ILVA 1R22A 3J80K 2H09A 3DKWA 4RAYA 1LVAA 1MJAA 3BJAA 1R5GA 2ZO4A 4WWCA 4TV7A 3J81K 2E7WA 4ESFA 5BPDA 5K5RA 1TQMA 2K4BA 1HW2A 3SQNA 3TO7A 1OYIA 1X3UA 2OZUA 2HFHA 4R79A 2G7UA 2GA2A 3P9KA 4AD9A 2YR2A 2A6EF 2B0LA 1QGPA 4WCGA 2XROA 5A2QZ 3QAHA 4G7OF 3IL2A 4WX9A 1DUXC 3J81Z 5AONA 1B9MA 2EFNA 4M6YA 4HZFA 2BGCA 3KEQA 4MEYF 3L09A 3KP7A 4O3MA 1BIBA 3TOAA 1B6AA 2DFIA 3RTRA 2R7DA 5D8KB 5LEKA 1WQ2A 3BP8A 3T8TA 3K1PA 2NAZA 3KLOA 1J9IA 3D0SA 4L9JA 4FX0A 3LSTA 3JTGA 2JTVA 1RZ4A 5D5VB 1E17A 3GFLA 2J5PA 3ECOA 2RGVA 1HKTA 2ZFWA 3LAPA 3GZ5A 4CYDA 5CYVA 4LK0F 3WE2A 1P6RA 4LB6B 2CGPA 1IN6A 2IJLA 4YFXF 1XCBA 3QU3A 1EH6A 1IAWA 3LWFA 2V6CA 5HS7A 3VFZA 3ML6A 1YO5C 2V1DA 2FF4A 5F6FA 4RB1A 5J8CA 3LA7A 3GXOA 3V7CA 3KZZA 4I0AA 4XSZF 4LG0B 5HLIA 1G3SA 5LBQA 3CO7C 1RI7A 1P4XA 1W4MA 4MHGA 2O61A 3TO9A 5L3BA 3CLOA 4NHJA 3P7NA 1BI3A 1IZ1A 2XAGA 1RUNA 1AWCA 2IP2A 3ZN1A 2EB7A 1KU2A 4LMYA 3U2RA 2J5OA 5LGNA 1S7OA 3VOEA 2NS0A 4QWQA 4AWXB 2FXAA 1UFMA 1KU9A 3FMQA 2HR3A 1OMIA 3DV8A 2G7HA 1LQ1A 5FD5A 4ENJA 4GYGA 2QYOA 1O57A 1T2KA 5ICEA 1ZLKA 3CTAA 3K0LA 3HSEA 1CF7A 2KIMA 1USSA 1HXDA 1XB4A 3KP6A 3ECHA 5A2QK 1JXSA 3CUQB 3QRFF 5K5QA 3KEOA 3F3XA 1FP1D 5KVRA 2JZYA 4I02A 2HQRA 2XHKA 2BE5F 3KZYA 4XRFA 4ETSA 4LG0A 1BBYA 1YIOA 1XD7A 2KJCA 3IKTA 1UHMA 1SFXA 2WWYA 3M8FA 3O2PE 2P6TA 1GXPA 5ERIA 4HOBA 3L2CA 1FX7A 3C7JA 1FC3A 1MDMA 3WTVC 4A6EA 4ENNA 2JPBA 4GCVA 3R4KA 4OIQF 1JE8A 5H20A 4HX7A 1EV7A 2QZ8A 3GLXA 3SHFA 3GX4X 1PDNC 5D5UB 3BWGA 1XGSA 1C0WA 3KP5A 2PFBA 2WC2A 2D45A 3QP6A 4OIRF 4RB3C 1XMAA 3O6BB 1HKSA 1U5TA 3OOPA 5LRRA 1F4KA 4OIPF 5DV5A 4IJAA 3J7AO 1ZH5A 3GFJA 5E20A 1P2FA 4LD5A 5E1ZB 2DU9A 3HSFA 1U5TB 3LQRA 2IA0A 2WTEA 2Z99A 1SD5A 4EMSA 1ULYA 3KP3A 4EGYA 2RVCA 4F7ZA 3IWFA 2GXGA 4BHBA 3EYIA 2VE9A 3N4MA 2V1XA 4IF4A 3I59A 2EFOA 3GVAA 4L18B 4QLCU 1J0RA 2Q8KA 3E5UA 1ON1A 1XGNA 3BOQA 3CDHA 4O6JA 3Q5FA 3I64A 3HRMA 5FFXA 3CO6C 3H3UA 3GWZA 5CLSA 5E8GA 1ZREA 4H0EA 1G4DA 3F22A 1FYLA 2DK8A 4WK8F 1CF7B 1OR7A 1KQ9A 3C18A 2GA1A 1TNSA 2VC0A 1Y0UA 1G3TA 4MEXF 4XBFA 4U0WA 2NRAC 4OINF 4CDGA 5FLXZ 1K7AA 2IA2A 2IPQX 1TNTA 3TO6A 4EM1A 4U7DA 4OIOF 4RGUA 2OA4A 3BJ6A 4MTEA 3V8KA 2HKXA 1BI0A 3COAC 1LNWA 1IN5A 2MD5A 2PMUA 1ONVA 2AXLA 4UVCA 3KETA 2ZXJA 2EA4A 3DEUA 1P92A 2ZNYA 3T8RA 1U2WA 3RYRA 4HDUA 4HLYA 2BEOA 2P5LC 4LK1F 4G94A 4YIFA 3QP5A 1G3WA 1QZZA 4EJTA 4AVPA 2DT5A 4HA8A 3GYHX 3K2ZA 1U5TC 4O5VA 3FM3A 3WGHA 2STTA 4UV8A 2AS5F 2MA3A 3R0AA 1Z1DA 2COMA 1SAXA 5FD6A 2A6HF 2LKPA 1O3QA 1SMYF 3QPTA 1ZG1A 2QLZA 2EV0A 5DCMA 3IWZA 3LAJA 3E5QA 1QNTA 3ERED 2A07F 5IT9K 1F9NA 3LA2A 1VTNC 4KYWA 5BMZA 2HOEA 4EJVA 2E1NA 5DYMA 4KNYA 3MEXA 5ILUA 3V7SA 4HYEA 3P9IA 4XSXF 2QQAA 2IVMA 4DNCA 3KFWX 2DLLA 3ZMVA 4CZZA 1R7JA 4ESBA 2DPDA 4KIGA 4UVBA 3ZMSA 2A5YB 3HYIA 1YFHA 1ZRFA 2F5DA 2JPCA 3ZQ7A 3DXJF 1V4RA 1MKMA 2W25A 1LDJA 2ISZA 5CVRA 2XASA 3D5LA 4AIKA 3GO5A 4YFNF 4PGHA 3FXRA 2YU3A 4CGZA 4JK1X 3W6JB 2P5KA 3T1BA 2VBXA 3BPVA 3R60A 1WRJA 1YW9A 1S8NA 4GGGA 1ZLJA 1TW3A 4MTDA 1FYMA 2L01A 1HQCA 3W6KB 2JRTA 4HAMA 1D8JA 3ZN0A 3RYPA 4M73A 2KIFA 4EQQA 1R5HA 3HSRA 3HHHA 4ZYHA 1QZYA 1PP8F 2IRFG 2R7FA 2H27A 2XAQA 2OU2A 2E1CA 1G3YA 4RGSA 4GO1A 2EA2A 2ELHA 3RDIA 2A69F 5D5WB 5IT3A 4BH9A 1XDSA 2LNBA 3E6MA 5ICFA 4LFUA 5ICCA 3WTYC 4KUMA 4R1HA 1Z05A 5JVTA 2MH9A 2OZ6A 3KE2A 2D2WA 2XIGA 2XAJA 2KKOA 4L0ZB 1MZBA 2V9VA 4WXHA 1FBUA 3R0JA 4HW0A 4YG2F 1Z7UA 3BJOA 1ON2A 1R1TA 5DCMB 3GFIA 2V79A 3F6VA 1XSXA 2ESNA 1Z91A 4OMZA 2EK5A 2VN2A 2F5CA 2ZKZA 3ABTA 3O3KA 4OU0A 4JBAA 5LEJA 1FNNA 4EJUA 1K6OA 4RGXA 2XRNA 4EVIA 4G7ZF 1EH7A 2OAZA 3MCZA 1IN4A 2Z33A 4D0PA 2HGCA 2Y48A 3I4PA 5FO5A 1LB2A 4UUVA 3FWEA 2UXXA 2DAOA 2PMHA 4G6QA 1YW7A 2O8XA 1J7KA 1ZRCA 4OMYA 4HBLA 3K1NA 4ASNA 3F8FA 3H3ZA 1K79A 1U78A 4NQWA 4HF2A 3EYYA 2KRFA 2PG4A 2HQNA 1V3FA 2Z3YA 1JGSA 1B1BA 3PQKA 3KCCA 1U6GA 3HOTA 1SFEA 1D3YA 2TDXA 1WI9A 5E1WA 3KP2A 3PFIA 2XKPA 5HDGA 2PLYA 1IF1A 2K02A 2DK5A 2QBYA 1K78B 4B8XA 3ELKA 3HRUA 5BQTA 4IRIA 3MWMA 4N9IA 1BOAA 2C6YA 1ZN2A 3NQOA 2XV4S 4XLPF 1U8RA 1J59A 3MZYA 2Q2EA 4MQ9F 2QENA 2DTRA 4EM2A 3EQLF 3IRRA 4PDKA 1E2XA 2VBYA 2LDUA 4ESJA 3M1EA 2STWA 4P5OA 3BZ6A 3WTZA 3T0YA 5DUIA 1PP7U 2F5FA 1IXCA 5L3GA 2L54A 2CG4A 5L3EA 4IHSA 1LDKB 2QWWA 4LLGF 5DD8A 2Q0OA 1HBXG 3C1DA 4Y13A 4HF1A 3WODF 1HKQA 4FX4A 2ESHA 2RV8A 1A04A 2YSRA 2PN6A 4HX4A 4M74A 2Z5UA 4L0YB 4OOIA 1KYWA 4M9XA 3TOBA 1I1SA 2FQ3A 3QU6A 1O3SA 1FP2A 4LGWA 5D5XB 3R61A 2JSCA 4M71A 3CJNA 1PUEE 5D4SA 2VC1A 4CICA 2IT0A 2FOKA 5TRDA 2PI0A 3JTHA 3F23A 4BXUA 3F21A 4KFCA 3IKVA 3N97A 4A5NA 1HW1A 4BYYA 2W85A 1GXQA 1YW8A 4LLNA 1TQPA 2A61A 4HDVA 2PQ8A 5F64A 3HRSA 1GVJA 4FT8A 4L5IA 3L00A 3RJPA 2O6GE 5D8LB 5CVUA 1IW7F 3ZMUA 2CW0F 4L5JA 2NYXA 3E5XA 1Q1HA 5L3DA 3FHZA 2OQRA 4P9UA 1SD7A 5DUKA 2RQPA 4L9NA 4Q47A 4Q5SF 3WU1B 2DQRA 3BROA 1IN7A 3BY6A 5EEHA 2A68F 4IXAA 4ZYGA 5FFZA 4ZYDA 2VOOA 2XUBA 2YX4A 3SFZA 2CO5A 1GHCA 4P96A 2EFWA 3WGGA 2XAHA 2UWMA 4BAYA 1R00A 2MLGA 1UB9A 1XGOA 2DW4A 2GWRA 1YYVA 2Y75A 3DFGA 3SZPA 4KIBA 1KA8A 3TKYA 5K5OA 2VT2A 3I71A 1FSHA 2D1HA 1NHAA 1WKMA 4Y15A 4A6DA 3EUHA 1T38A 4KN7X 4KT5C 3ZMDA 3LFKA 3FX3A 3K9TA 1OKRA 4CO8A 2MLKA 3F8MA 4DQ2A 3F72A 2F2EA 3HOSA 3EETA 1MJ9A 4M6XA 3U9GA 3FF5A 5LHIA 3VODA 1BN5A 4UV9A 3JAMK 2EFPA 2RKHA 2BBYA 3FM5A 4ZZDA 4IPAA 1ZGAA 3Q9SA 5D6FA 4I2OA 1TLHB 5CJ9A 2VONA 3P9CA 4KMUX 2IW5A 1STZA 2YX7A 4EJOA 4G9YA 2DO7A 3QOPA 4M72A 3NEUA 4MGRA 3L7WA 1OYYA 3HIFA 2G9WA 4M9SA 5ED4A 1ODDA 4UXNA 1TTYA 5HVQC 1AOYA 4B09A 1O3TA 1W5TA 2P8TA 4U7BA 2HZTA 2FNAA 3EDPA 3JSPA 5E18F 1B4AA 3OV8A 1SD6A 2ADUA 4UVAA 1ZAOA 3VEPA 1LJ9A 3HUGA 3RPUA 3I5UA 2ZMEA 1F5TA 2VBZA 2OBPA 5LLQA 2RDPA 3HTSB 1R1UA 1FY7A 2K4JA 5HS9A 3DF8A 3PQJA 3E6CC 3V7RA 1XMKA 1DPRA 1KYZA 2GZWA 4I09A 3S2WA 5HOOA 5F1RA 1IXSB 1J75A 1K78A 3L9FA 3M8EA 5JI6A 2HYFA 3ABUA 2W24A 5CVVA 5JFRA 1I27A 2CWEA 3F8CA 3TQNA 2UZKA 2L4MA 2CQKA 1FLIA 2M1BA 3I59B 2FMYA 1BIAA 2M30A 2BV6A 4I98B 5CVIA 5EEGA 3FXUA 4BNCA 4HV6A 1TBXA 1Z6RA 1O3RA 1T98A 1SD4A 5E1XA 5D6EA 1FZPB 3TDUC 3WTSC 1R36A 4LJZF 1BC7C 4KICA 4IHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBB A;  2VT3 A;  4HF0 A;  1IRG A;  1S29 A;  3WGI A;  1FBS A;  1YTY A;  1DP7 P;  1REP C;  2RC4 A;  4PCQ A;  1MD0 A;  1YS7 A;  4JQF A;  2O3F A;  3RIR A;  4U0Y A;  3WTW C;  5J8F A;  3FXQ A;  4ENK A;  2LSO A;  3GEZ A;  3U1D A;  5ILS A;  3RKX A;  1P4A A;  2QBY B;  4Y17 A;  2R3S A;  5LHH A;  4HQE A;  5DCF A;  2PBI A;  4BQA A;  1O7F A;  2X4H A;  4KDP A;  4EV0 A;  6PAX A;  2L4A A;  1MJB A;  3ZMT A;  5L3C A;  3QPH A;  2FA5 A;  5H6R A;  3TDZ C;  4MNU A;  4S04 A;  1T0F A;  3ROU A;  3ULQ B;  4KMF A;  1YQA A;  2HS5 A;  4YFK F;  3ZMZ A;  1Z6T A;  1T39 A;  3KLN A;  2NNY A;  1ZYR F;  2QUF A;  5IT9 Z;  4AIJ A;  1ZG5 A;  2M45 A;  3DQV C;  1W7P B;  4GYI A;  2E7X A;  1HW5 A;  5AIQ A;  1FYK A;  1O7L A;  1JHF A;  2GAU A;  1B59 A;  2FSW A;  1FWZ A;  2MH2 A;  2HYG D;  4HQM A;  2K86 A;  4IRG A;  1J2X A;  1XDU A;  5BOX A;  1QPM A;  4U88 A;  3JW4 A;  1BI2 A;  2XKO A;  4HX8 A;  4P55 A;  4RGR A;  2L3D A;  1P4W A;  2FE3 A;  3E6D A;  1D5V A;  3KP4 A;  4WXD A;  3LA3 A;  1F1Z A;  1LEB A;  3CUQ A;  5DD4 A;  3K1M A;  2KJB A;  4Q48 A;  2CSO A;  2GXB A;  2YPR A;  2MBF A;  4P9F A;  5K1Y A;  3F8B A;  3J80 Z;  3GUD A;  3I0T A;  1FPQ A;  4HLX A;  2D1V A;  4EM0 B;  3NRV A;  3GZ6 A;  3G3Z A;  5LGU A;  1OYW A;  2ZME B;  1L3L A;  2Z9O A;  2XAF A;  4ZZL A;  5AIP A;  2NNN A;  4A0Z A;  3K69 A;  3I58 A;  3WTU C;  3FZV A;  2K27 A;  2XVC A;  5H6Q A;  1FOK A;  1LEA A;  4EJW A;  4CXF A;  3WTT C;  4A0X A;  1BJA A;  1JHH A;  1W7P A;  1IUY A;  3V4G A;  4M9Z A;  1BM9 A;  5BS6 A;  4CHU A;  4ZYE A;  3RPQ A;  1CGP A;  4L9V A;  3T5X A;  2P7V B;  1B9N A;  1YLF A;  1IRF A;  2MC3 A;  3WG9 A;  1MDM B;  3GFM A;  1RUO A;  3CUO A;  3WTX C;  4ENM A;  4UNO A;  2ZCW A;  4PGG A;  3Q9V A;  2DQL A;  1XCV A;  4A12 A;  3C3W A;  1RNL A;  3LQQ A;  4L9T A;  2EJR A;  4YII A;  2PJP A;  1WSU A;  3WU0 A;  3SXY A;  3IC7 A;  1D8K A;  4KA4 A;  2FRH A;  1U3E M;  5FB2 A;  2VOP A;  5LGT A;  2GIV A;  2LF7 A;  1SMT A;  2OQG A;  4MQV A;  1I5Z A;  1DPU A;  1ZG3 A;  2XGX A;  3DP7 A;  4UHT A;  2FU4 A;  4PZJ A;  2IA1 A;  3V8J A;  3H92 A;  1W5S A;  4I0B A;  1S7A A;  1FT9 A;  1MGT A;  3I54 A;  5LRS A;  5BPI A;  3HRT A;  4I7H A;  4WXC A;  2O0Y A;  2ETH A;  1T6S A;  5CVJ A;  3REO A;  3FMR A;  5D4R A;  4G6D A;  2P5V A;  4KIF A;  5TJJ A;  3IRQ A;  3RKW A;  4I01 A;  1HST A;  4HV5 A;  2ACJ A;  4AIH A;  2CYY A;  2QVO A;  2ZBK A;  2BYV E;  1R1V A;  5HDK A;  3ZP5 A;  1XN7 A;  2LF8 A;  1FSE A;  2WV0 A;  2O03 A;  5E17 F;  3B73 A;  3M7G A;  1KU3 A;  1UCR A;  4A5M A;  2L02 A;  2HEO A;  1H0M A;  2HKO A;  4Q4Z F;  3HHG A;  2FNP A;  1Z9C A;  2VOD A;  2GQQ A;  2FEZ A;  2Y0M A;  1YG2 A;  1XSV A;  3E6B A;  2VE8 A;  1I1G A;  1KGS A;  4S05 A;  1ZRD A;  2ISY A;  5DEQ A;  4K2E A;  4U0V A;  2M87 A;  2HWV A;  4RB2 C;  4NB5 A;  1LDD A;  1ZAR A;  1L0O C;  1IXR C;  3ISP A;  1WWX A;  1FBQ A;  2FBK A;  2VXZ A;  1S6L A;  1RIO H;  1HSJ A;  1KU7 A;  5E8I A;  1QO0 D;  3E97 A;  2RN7 A;  2EFQ A;  3F6O A;  2FBH A;  3FMS A;  3BDD A;  3R6S A;  4R8H A;  2UXN A;  2K7L A;  4RB0 A;  5HLG A;  3IHU A;  1I6X A;  2A3S A;  1QBJ A;  2CFX A;  5DDG A;  3TGN A;  4IRH A;  1R23 A;  1YS6 A;  1QQI A;  3VB2 A;  5HLH A;  2W57 A;  4LB5 A;  3SZT A;  3JSO A;  4GXO A;  2EV5 A;  2DPU A;  3MFK A;  2ZNZ A;  3AAF A;  3JAM Z;  1DDN A;  1H9G A;  4IVN A;  2H6C A;  1SFU A;  4RS8 A;  1H9T A;  3G73 A;  2QQ9 A;  1TW2 A;  1OPC A;  2EWN A;  2VBW A;  4A2U A;  2X0L A;  2HTJ A;  1J5Y A;  3MAJ A;  2P4W A;  4BHC A;  2OD5 A;  5FGM A;  1G6N A;  2DI3 A;  2FML A;  3MZH A;  4RAZ A;  1IN8 A;  3ZPL A;  3I53 A;  3RI4 A;  4N0B A;  1XGM A;  4G8X A;  3WE3 A;  2QM3 A;  2P7C B;  3M9A A;  2HDC A;  2M8E A;  4EGZ A;  2FBI A;  3HTU A;  3MQ0 A;  5HS8 A;  1UHW A;  2KIU A;  5L3F A;  1TQI A;  1W7P D;  4A0Y A;  2M5W A;  1EH8 A;  2PEX A;  4XLN F;  5FLX K;  1R58 A;  5J6X A;  5HDN A;  2EV6 A;  4Z2Y A;  4ZH4 F;  2JT1 A;  3E3V A;  1BI1 A;  3DPT A;  5ICG A;  1UST A;  3CUQ C;  4ON0 A;  3F8N A;  2P6S A;  3DPL C;  4KN4 X;  2HTS A;  2ZJ2 A;  1ZHF A;  3RKY A;  2F5E A;  4E70 A;  2H94 A;  5LHG A;  4G7H F;  1ZGJ A;  1S3J A;  1BC8 C;  2QQB A;  3GW2 A;  3BPX A;  5KK1 A;  1XSD A;  4WF2 A;  5JHU A;  4BHP A;  2RNJ A;  4FHT A;  1KQ8 A;  2V1U A;  4LLL A;  3B02 A;  2H6B A;  1KQ0 A;  3GF2 A;  2W84 A;  5JR3 A;  4N9H A;  3V8L A;  5ILV A;  1R22 A;  3J80 K;  2H09 A;  3DKW A;  4RAY A;  1LVA A;  1MJA A;  3BJA A;  1R5G A;  2ZO4 A;  4WWC A;  4TV7 A;  3J81 K;  2E7W A;  4ESF A;  5BPD A;  5K5R A;  1TQM A;  2K4B A;  1HW2 A;  3SQN A;  3TO7 A;  1OYI A;  1X3U A;  2OZU A;  2HFH A;  4R79 A;  2G7U A;  2GA2 A;  3P9K A;  4AD9 A;  2YR2 A;  2A6E F;  2B0L A;  1QGP A;  4WCG A;  2XRO A;  5A2Q Z;  3QAH A;  4G7O F;  3IL2 A;  4WX9 A;  1DUX C;  3J81 Z;  5AON A;  1B9M A;  2EFN A;  4M6Y A;  4HZF A;  2BGC A;  3KEQ A;  4MEY F;  3L09 A;  3KP7 A;  4O3M A;  1BIB A;  3TOA A;  1B6A A;  2DFI A;  3RTR A;  2R7D A;  5D8K B;  5LEK A;  1WQ2 A;  3BP8 A;  3T8T A;  3K1P A;  2NAZ A;  3KLO A;  1J9I A;  3D0S A;  4L9J A;  4FX0 A;  3LST A;  3JTG A;  2JTV A;  1RZ4 A;  5D5V B;  1E17 A;  3GFL A;  2J5P A;  3ECO A;  2RGV A;  1HKT A;  2ZFW A;  3LAP A;  3GZ5 A;  4CYD A;  5CYV A;  4LK0 F;  3WE2 A;  1P6R A;  4LB6 B;  2CGP A;  1IN6 A;  2IJL A;  4YFX F;  1XCB A;  3QU3 A;  1EH6 A;  1IAW A;  3LWF A;  2V6C A;  5HS7 A;  3VFZ A;  3ML6 A;  1YO5 C;  2V1D A;  2FF4 A;  5F6F A;  4RB1 A;  5J8C A;  3LA7 A;  3GXO A;  3V7C A;  3KZZ A;  4I0A A;  4XSZ F;  4LG0 B;  5HLI A;  1G3S A;  5LBQ A;  3CO7 C;  1RI7 A;  1P4X A;  1W4M A;  4MHG A;  2O61 A;  3TO9 A;  5L3B A;  3CLO A;  4NHJ A;  3P7N A;  1BI3 A;  1IZ1 A;  2XAG A;  1RUN A;  1AWC A;  2IP2 A;  3ZN1 A;  2EB7 A;  1KU2 A;  4LMY A;  3U2R A;  2J5O A;  5LGN A;  1S7O A;  3VOE A;  2NS0 A;  4QWQ A;  4AWX B;  2FXA A;  1UFM A;  1KU9 A;  3FMQ A;  2HR3 A;  1OMI A;  3DV8 A;  2G7H A;  1LQ1 A;  5FD5 A;  4ENJ A;  4GYG A;  2QYO A;  1O57 A;  1T2K A;  5ICE A;  1ZLK A;  3CTA A;  3K0L A;  3HSE A;  1CF7 A;  2KIM A;  1USS A;  1HXD A;  1XB4 A;  3KP6 A;  3ECH A;  5A2Q K;  1JXS A;  3CUQ B;  3QRF F;  5K5Q A;  3KEO A;  3F3X A;  1FP1 D;  5KVR A;  2JZY A;  4I02 A;  2HQR A;  2XHK A;  2BE5 F;  3KZY A;  4XRF A;  4ETS A;  4LG0 A;  1BBY A;  1YIO A;  1XD7 A;  2KJC A;  3IKT A;  1UHM A;  1SFX A;  2WWY A;  3M8F A;  3O2P E;  2P6T A;  1GXP A;  5ERI A;  4HOB A;  3L2C A;  1FX7 A;  3C7J A;  1FC3 A;  1MDM A;  3WTV C;  4A6E A;  4ENN A;  2JPB A;  4GCV A;  3R4K A;  4OIQ F;  1JE8 A;  5H20 A;  4HX7 A;  1EV7 A;  2QZ8 A;  3GLX A;  3SHF A;  3GX4 X;  1PDN C;  5D5U B;  3BWG A;  1XGS A;  1C0W A;  3KP5 A;  2PFB A;  2WC2 A;  2D45 A;  3QP6 A;  4OIR F;  4RB3 C;  1XMA A;  3O6B B;  1HKS A;  1U5T A;  3OOP A;  5LRR A;  1F4K A;  4OIP F;  5DV5 A;  4IJA A;  3J7A O;  1ZH5 A;  3GFJ A;  5E20 A;  1P2F A;  4LD5 A;  5E1Z B;  2DU9 A;  3HSF A;  1U5T B;  3LQR A;  2IA0 A;  2WTE A;  2Z99 A;  1SD5 A;  4EMS A;  1ULY A;  3KP3 A;  4EGY A;  2RVC A;  4F7Z A;  3IWF A;  2GXG A;  4BHB A;  3EYI A;  2VE9 A;  3N4M A;  2V1X A;  4IF4 A;  3I59 A;  2EFO A;  3GVA A;  4L18 B;  4QLC U;  1J0R A;  2Q8K A;  3E5U A;  1ON1 A;  1XGN A;  3BOQ A;  3CDH A;  4O6J A;  3Q5F A;  3I64 A;  3HRM A;  5FFX A;  3CO6 C;  3H3U A;  3GWZ A;  5CLS A;  5E8G A;  1ZRE A;  4H0E A;  1G4D A;  3F22 A;  1FYL A;  2DK8 A;  4WK8 F;  1CF7 B;  1OR7 A;  1KQ9 A;  3C18 A;  2GA1 A;  1TNS A;  2VC0 A;  1Y0U A;  1G3T A;  4MEX F;  4XBF A;  4U0W A;  2NRA C;  4OIN F;  4CDG A;  5FLX Z;  1K7A A;  2IA2 A;  2IPQ X;  1TNT A;  3TO6 A;  4EM1 A;  4U7D A;  4OIO F;  4RGU A;  2OA4 A;  3BJ6 A;  4MTE A;  3V8K A;  2HKX A;  1BI0 A;  3COA C;  1LNW A;  1IN5 A;  2MD5 A;  2PMU A;  1ONV A;  2AXL A;  4UVC A;  3KET A;  2ZXJ A;  2EA4 A;  3DEU A;  1P92 A;  2ZNY A;  3T8R A;  1U2W A;  3RYR A;  4HDU A;  4HLY A;  2BEO A;  2P5L C;  4LK1 F;  4G94 A;  4YIF A;  3QP5 A;  1G3W A;  1QZZ A;  4EJT A;  4AVP A;  2DT5 A;  4HA8 A;  3GYH X;  3K2Z A;  1U5T C;  4O5V A;  3FM3 A;  3WGH A;  2STT A;  4UV8 A;  2AS5 F;  2MA3 A;  3R0A A;  1Z1D A;  2COM A;  1SAX A;  5FD6 A;  2A6H F;  2LKP A;  1O3Q A;  1SMY F;  3QPT A;  1ZG1 A;  2QLZ A;  2EV0 A;  5DCM A;  3IWZ A;  3LAJ A;  3E5Q A;  1QNT A;  3ERE D;  2A07 F;  5IT9 K;  1F9N A;  3LA2 A;  1VTN C;  4KYW A;  5BMZ A;  2HOE A;  4EJV A;  2E1N A;  5DYM A;  4KNY A;  3MEX A;  5ILU A;  3V7S A;  4HYE A;  3P9I A;  4XSX F;  2QQA A;  2IVM A;  4DNC A;  3KFW X;  2DLL A;  3ZMV A;  4CZZ A;  1R7J A;  4ESB A;  2DPD A;  4KIG A;  4UVB A;  3ZMS A;  2A5Y B;  3HYI A;  1YFH A;  1ZRF A;  2F5D A;  2JPC A;  3ZQ7 A;  3DXJ F;  1V4R A;  1MKM A;  2W25 A;  1LDJ A;  2ISZ A;  5CVR A;  2XAS A;  3D5L A;  4AIK A;  3GO5 A;  4YFN F;  4PGH A;  3FXR A;  2YU3 A;  4CGZ A;  4JK1 X;  3W6J B;  2P5K A;  3T1B A;  2VBX A;  3BPV A;  3R60 A;  1WRJ A;  1YW9 A;  1S8N A;  4GGG A;  1ZLJ A;  1TW3 A;  4MTD A;  1FYM A;  2L01 A;  1HQC A;  3W6K B;  2JRT A;  4HAM A;  1D8J A;  3ZN0 A;  3RYP A;  4M73 A;  2KIF A;  4EQQ A;  1R5H A;  3HSR A;  3HHH A;  4ZYH A;  1QZY A;  1PP8 F;  2IRF G;  2R7F A;  2H27 A;  2XAQ A;  2OU2 A;  2E1C A;  1G3Y A;  4RGS A;  4GO1 A;  2EA2 A;  2ELH A;  3RDI A;  2A69 F;  5D5W B;  5IT3 A;  4BH9 A;  1XDS A;  2LNB A;  3E6M A;  5ICF A;  4LFU A;  5ICC A;  3WTY C;  4KUM A;  4R1H A;  1Z05 A;  5JVT A;  2MH9 A;  2OZ6 A;  3KE2 A;  2D2W A;  2XIG A;  2XAJ A;  2KKO A;  4L0Z B;  1MZB A;  2V9V A;  4WXH A;  1FBU A;  3R0J A;  4HW0 A;  4YG2 F;  1Z7U A;  3BJO A;  1ON2 A;  1R1T A;  5DCM B;  3GFI A;  2V79 A;  3F6V A;  1XSX A;  2ESN A;  1Z91 A;  4OMZ A;  2EK5 A;  2VN2 A;  2F5C A;  2ZKZ A;  3ABT A;  3O3K A;  4OU0 A;  4JBA A;  5LEJ A;  1FNN A;  4EJU A;  1K6O A;  4RGX A;  2XRN A;  4EVI A;  4G7Z F;  1EH7 A;  2OAZ A;  3MCZ A;  1IN4 A;  2Z33 A;  4D0P A;  2HGC A;  2Y48 A;  3I4P A;  5FO5 A;  1LB2 A;  4UUV A;  3FWE A;  2UXX A;  2DAO A;  2PMH A;  4G6Q A;  1YW7 A;  2O8X A;  1J7K A;  1ZRC A;  4OMY A;  4HBL A;  3K1N A;  4ASN A;  3F8F A;  3H3Z A;  1K79 A;  1U78 A;  4NQW A;  4HF2 A;  3EYY A;  2KRF A;  2PG4 A;  2HQN A;  1V3F A;  2Z3Y A;  1JGS A;  1B1B A;  3PQK A;  3KCC A;  1U6G A;  3HOT A;  1SFE A;  1D3Y A;  2TDX A;  1WI9 A;  5E1W A;  3KP2 A;  3PFI A;  2XKP A;  5HDG A;  2PLY A;  1IF1 A;  2K02 A;  2DK5 A;  2QBY A;  1K78 B;  4B8X A;  3ELK A;  3HRU A;  5BQT A;  4IRI A;  3MWM A;  4N9I A;  1BOA A;  2C6Y A;  1ZN2 A;  3NQO A;  2XV4 S;  4XLP F;  1U8R A;  1J59 A;  3MZY A;  2Q2E A;  4MQ9 F;  2QEN A;  2DTR A;  4EM2 A;  3EQL F;  3IRR A;  4PDK A;  1E2X A;  2VBY A;  2LDU A;  4ESJ A;  3M1E A;  2STW A;  4P5O A;  3BZ6 A;  3WTZ A;  3T0Y A;  5DUI A;  1PP7 U;  2F5F A;  1IXC A;  5L3G A;  2L54 A;  2CG4 A;  5L3E A;  4IHS A;  1LDK B;  2QWW A;  4LLG F;  5DD8 A;  2Q0O A;  1HBX G;  3C1D A;  4Y13 A;  4HF1 A;  3WOD F;  1HKQ A;  4FX4 A;  2ESH A;  2RV8 A;  1A04 A;  2YSR A;  2PN6 A;  4HX4 A;  4M74 A;  2Z5U A;  4L0Y B;  4OOI A;  1KYW A;  4M9X A;  3TOB A;  1I1S A;  2FQ3 A;  3QU6 A;  1O3S A;  1FP2 A;  4LGW A;  5D5X B;  3R61 A;  2JSC A;  4M71 A;  3CJN A;  1PUE E;  5D4S A;  2VC1 A;  4CIC A;  2IT0 A;  2FOK A;  5TRD A;  2PI0 A;  3JTH A;  3F23 A;  4BXU A;  3F21 A;  4KFC A;  3IKV A;  3N97 A;  4A5N A;  1HW1 A;  4BYY A;  2W85 A;  1GXQ A;  1YW8 A;  4LLN A;  1TQP A;  2A61 A;  4HDV A;  2PQ8 A;  5F64 A;  3HRS A;  1GVJ A;  4FT8 A;  4L5I A;  3L00 A;  3RJP A;  2O6G E;  5D8L B;  5CVU A;  1IW7 F;  3ZMU A;  2CW0 F;  4L5J A;  2NYX A;  3E5X A;  1Q1H A;  5L3D A;  3FHZ A;  2OQR A;  4P9U A;  1SD7 A;  5DUK A;  2RQP A;  4L9N A;  4Q47 A;  4Q5S F;  3WU1 B;  2DQR A;  3BRO A;  1IN7 A;  3BY6 A;  5EEH A;  2A68 F;  4IXA A;  4ZYG A;  5FFZ A;  4ZYD A;  2VOO A;  2XUB A;  2YX4 A;  3SFZ A;  2CO5 A;  1GHC A;  4P96 A;  2EFW A;  3WGG A;  2XAH A;  2UWM A;  4BAY A;  1R00 A;  2MLG A;  1UB9 A;  1XGO A;  2DW4 A;  2GWR A;  1YYV A;  2Y75 A;  3DFG A;  3SZP A;  4KIB A;  1KA8 A;  3TKY A;  5K5O A;  2VT2 A;  3I71 A;  1FSH A;  2D1H A;  1NHA A;  1WKM A;  4Y15 A;  4A6D A;  3EUH A;  1T38 A;  4KN7 X;  4KT5 C;  3ZMD A;  3LFK A;  3FX3 A;  3K9T A;  1OKR A;  4CO8 A;  2MLK A;  3F8M A;  4DQ2 A;  3F72 A;  2F2E A;  3HOS A;  3EET A;  1MJ9 A;  4M6X A;  3U9G A;  3FF5 A;  5LHI A;  3VOD A;  1BN5 A;  4UV9 A;  3JAM K;  2EFP A;  2RKH A;  2BBY A;  3FM5 A;  4ZZD A;  4IPA A;  1ZGA A;  3Q9S A;  5D6F A;  4I2O A;  1TLH B;  5CJ9 A;  2VON A;  3P9C A;  4KMU X;  2IW5 A;  1STZ A;  2YX7 A;  4EJO A;  4G9Y A;  2DO7 A;  3QOP A;  4M72 A;  3NEU A;  4MGR A;  3L7W A;  1OYY A;  3HIF A;  2G9W A;  4M9S A;  5ED4 A;  1ODD A;  4UXN A;  1TTY A;  5HVQ C;  1AOY A;  4B09 A;  1O3T A;  1W5T A;  2P8T A;  4U7B A;  2HZT A;  2FNA A;  3EDP A;  3JSP A;  5E18 F;  1B4A A;  3OV8 A;  1SD6 A;  2ADU A;  4UVA A;  1ZAO A;  3VEP A;  1LJ9 A;  3HUG A;  3RPU A;  3I5U A;  2ZME A;  1F5T A;  2VBZ A;  2OBP A;  5LLQ A;  2RDP A;  3HTS B;  1R1U A;  1FY7 A;  2K4J A;  5HS9 A;  3DF8 A;  3PQJ A;  3E6C C;  3V7R A;  1XMK A;  1DPR A;  1KYZ A;  2GZW A;  4I09 A;  3S2W A;  5HOO A;  5F1R A;  1IXS B;  1J75 A;  1K78 A;  3L9F A;  3M8E A;  5JI6 A;  2HYF A;  3ABU A;  2W24 A;  5CVV A;  5JFR A;  1I27 A;  2CWE A;  3F8C A;  3TQN A;  2UZK A;  2L4M A;  2CQK A;  1FLI A;  2M1B A;  3I59 B;  2FMY A;  1BIA A;  2M30 A;  2BV6 A;  4I98 B;  5CVI A;  5EEG A;  3FXU A;  4BNC A;  4HV6 A;  1TBX A;  1Z6R A;  1O3R A;  1T98 A;  1SD4 A;  5E1X A;  5D6E A;  1FZP B;  3TDU C;  3WTS C;  1R36 A;  4LJZ F;  1BC7 C;  4KIC A;  4IHT A; 
#chains in the Genus database with same CATH topology
 1WJB A;  2DBB A;  4HRI A;  5J40 A;  2ME6 A;  1G59 A;  2VT3 A;  2IEK A;  4HF0 A;  1S5L C;  5GAG J;  1IRG A;  4UUT A;  1S29 A;  4E7H A;  3WGI A;  1FBS A;  1YTY A;  1DP7 P;  1REP C;  2RC4 A;  4PCQ A;  1MD0 A;  5JLX A;  1YS7 A;  2LK2 A;  4JQF A;  2O3F A;  4PK4 A;  1HLV A;  3RIR A;  2XGE A;  3J7Z I;  4FAS D;  4QTR A;  4U0Y A;  3WTW C;  5J8F A;  3GTQ J;  2FQ4 A;  3FXQ A;  1RES A;  4ENK A;  2KZV A;  2LSO A;  2KT0 A;  3GEZ A;  4J00 A;  1MSE C;  3U1D A;  1MBH A;  5ILS A;  3RKX A;  4IQ4 A;  1OCC H;  1P4A A;  1SVL A;  2VPL A;  3BG5 A;  2QBY B;  2F48 A;  2KFD A;  4Y17 A;  1H88 C;  4AVZ A;  2R3S A;  5LHH A;  2KIQ A;  4HQE A;  4RM3 A;  3L1P A;  4C3I J;  5DCF A;  1VQL I;  4XN0 A;  2M0C A;  2PBI A;  1O7F A;  2X4H A;  3EUA A;  2R4G A;  3QWL A;  4BQA A;  3EUH C;  4KDP A;  4EV0 A;  6PAX A;  2L4A A;  1MJB A;  4QPO A;  4F91 B;  3ZMT A;  5L3C A;  2DFE A;  3QPH A;  2FA5 A;  3HM5 A;  5H6R A;  1HDP A;  3TDZ C;  2ID3 A;  4MNU A;  2GXA A;  1BJZ A;  2L5Q A;  4S04 A;  3FIS A;  1T0F A;  1MBG A;  3HBL A;  4M3D A;  2VB6 A;  3ROU A;  3ULQ B;  4LG3 A;  1YQA A;  2HS5 A;  4YFK F;  2GLO A;  4KMF A;  1MNE A;  3ZMZ A;  1Z6T A;  2JQ7 A;  5JLW A;  1T39 A;  2A5W A;  1NK2 P;  3KLN A;  2NNY A;  2MSY A;  1ZYR F;  2QUF A;  2ID6 A;  5IT9 Z;  2ZFU A;  4AIJ A;  3JRG A;  1ZG5 A;  2M45 A;  3DQV C;  1W7P B;  1VQK I;  4GYI A;  4BL0 B;  3SYT A;  1NTC A;  2E7X A;  1HW5 A;  1E3O C;  5AIQ A;  1FYK A;  1UEL B;  1O7L A;  1JHF A;  2PJR B;  2JUC A;  2GAU A;  1SC7 A;  1B59 A;  5FLM J;  2FSW A;  4CCM A;  3H0G J;  5FKN A;  4HNV A;  1WGX A;  1FWZ A;  2NXN B;  2MH2 A;  2COB A;  2HYG D;  4E7L A;  4QIW N;  4HQM A;  2K86 A;  4IRG A;  2ME0 A;  3BCA A;  1J2X A;  1XDU A;  5BOX A;  4XLE A;  2KZG A;  1QPM A;  2DA4 A;  1VZ0 A;  3HKZ N;  2HQA A;  1VQM I;  4U88 A;  3JW4 A;  1BI2 A;  2XKO A;  3AG3 H;  4HX8 A;  4P55 A;  2E1O A;  4RGR A;  1XTA A;  2HZD A;  2L3D A;  1P4W A;  2Y9Z A;  2FE3 A;  3E6D A;  3X2Q H;  5B5E C;  1D5V A;  3KP4 A;  2M7B A;  1VQ9 I;  2HVQ A;  5EG0 B;  4WXD A;  4HNU A;  3LA3 A;  1F1Z A;  2V9P A;  1LEB A;  3CUQ A;  5DD4 A;  2L7M P;  3K1M A;  2KJB A;  2VKE A;  3IAM 2;  4Q48 A;  1F43 A;  3HL2 A;  3BQZ A;  2VJ4 A;  3OYF A;  2CSO A;  2GXB A;  2YPR A;  1ZGW A;  3CC2 I;  2MBF A;  4P9F A;  5K1Y A;  5GTH C;  5K7Z A;  3F8B A;  3HOZ J;  3J80 Z;  4XLF A;  3GUD A;  1DU6 A;  3I0T A;  1FPQ A;  4HLX A;  5F0C A;  3JRF A;  3G71 I;  2D1V A;  2EZH A;  4I6Z A;  2HU9 A;  4HPQ A;  1VND A;  4EM0 B;  3NRV A;  3GZ6 A;  3G3Z A;  2HXO A;  5LGU A;  1OYW A;  2LBF A;  2ZME B;  4XIC A;  1L3L A;  2Z9O A;  2OUM A;  2XAF A;  5KNL A;  4UUS B;  4ZZL A;  3ZQF A;  1FMV A;  2NNN A;  5AIP A;  3GTG J;  4A0Z A;  4X1E A;  1MBJ A;  3K69 A;  3I58 A;  4C9Y A;  3WTU C;  2CQN A;  3DKX A;  4A3D J;  3FZV A;  2TRT A;  2K27 A;  2XVC A;  5H6Q A;  3IH3 A;  2X6O A;  1FOK A;  1LEA A;  2OV7 A;  1S72 I;  4NQW B;  4EJW A;  4CXF A;  3WTT C;  1OQY A;  3W2V A;  2OF7 A;  3Q0U A;  4A0X A;  1JT0 A;  4CH7 A;  1E3H A;  1BJA A;  1JHH A;  1W7P A;  1IUY A;  3V4G A;  4B3A A;  2CU7 A;  4M9Z A;  1WH5 A;  1X1B A;  1BM9 A;  2DYS H;  5GAH J;  3H5N A;  3DTI A;  5BS6 A;  3F9K A;  4CHU A;  4ZYE A;  1TWF J;  4LIT A;  3RPQ A;  1CGP A;  4L9V A;  3RQ4 A;  3T5X A;  2P7V B;  1B9N A;  1YLF A;  1Y1V J;  2E36 A;  2L7K A;  1IRF A;  5EJC A;  2MC3 A;  2XF5 A;  2KDZ A;  2IS2 A;  3WG9 A;  1MDM B;  3UR3 C;  3JRA A;  2Z1D A;  3PNT A;  1UZC A;  4DJA A;  3GFM A;  4D1Q A;  1RUO A;  3CUO A;  1T08 B;  3WTX C;  4ENM A;  4HG2 A;  4UNO A;  2ZCW A;  4PGG A;  4CYC A;  3Q9V A;  3BC8 A;  4BY7 J;  2NVT J;  2R7Q A;  2DQL A;  4XKC A;  1XCV A;  1WJF A;  1T0F C;  4A12 A;  3C3W A;  2CV0 A;  2IS1 A;  3VWB A;  1RNL A;  3LQQ A;  1X3Z B;  4L9T A;  2ECC A;  2EJR A;  4YII A;  2BVL A;  2PJP A;  1WSU A;  2YS9 A;  1X2M A;  5KCM A;  2JUG A;  3H36 A;  4DIQ A;  3WU0 A;  3TP0 A;  3OMY A;  1O4X A;  2BHZ A;  3SXY A;  4GDF A;  3IC7 A;  1D8K A;  3FK6 A;  3ABM H;  1TZL A;  3PUF A;  3ZCO A;  3OYC A;  1N25 A;  4KA4 A;  2FRH A;  1U3E M;  1ETY A;  5FB2 A;  2VOP A;  2HYJ A;  5LGT A;  2GIV A;  4YRV A;  1TL8 A;  2KQR A;  2LF7 A;  2X48 A;  3ABL H;  3ASN H;  4D9J A;  1SMT A;  2OQG A;  3A01 A;  4MQV A;  1I5Z A;  4RDU A;  3OS1 A;  1DPU A;  2MG4 A;  1MMS A;  1ZG3 A;  3CCS I;  2R5Y A;  4LIV A;  2X9D A;  2XGX A;  3ZQG A;  2R7T A;  3DP7 A;  3GTM J;  4UHT A;  1YE9 A;  2FU4 A;  3FXK A;  4PZJ A;  2IA1 A;  3V8J A;  4CUG A;  3H92 A;  3OSF A;  1W5S A;  4I0B A;  1WI3 A;  1S7A A;  1P7J A;  2P0W A;  1FT9 A;  1MGT A;  3I54 A;  5LRS A;  5BPI A;  1WJC A;  3HRT A;  4I7H A;  4WXC A;  5C4X J;  1PVE A;  2O0Y A;  1U0J A;  5M3M J;  4JX4 A;  1G2H A;  3OYD A;  2ETH A;  3CMY A;  5DM7 F;  1T56 A;  1T6S A;  5CVJ A;  1LE8 B;  2QF7 A;  2DN0 A;  2E34 A;  3KYD B;  4EEF G;  3REO A;  3FMR A;  1CQT A;  5D4R A;  4G6D A;  1WH7 A;  1POG A;  2P5V A;  4KIF A;  5TJJ A;  3IRQ A;  3RKW A;  4I01 A;  1HST A;  3H9G A;  4HV5 A;  2EIL H;  2XPU A;  5IY5 H;  2ACJ A;  4AIH A;  1P7I A;  1GV5 A;  3RKQ A;  2H1K A;  1VQN I;  3OYB A;  2CYY A;  3K6G A;  1RKT A;  2QVO A;  2ZBK A;  2BYV E;  4JX5 A;  4NNJ A;  1R1V A;  1BW5 A;  3HXL A;  3PFY A;  5HDK A;  3ZP5 A;  1WZ2 A;  1XN7 A;  3GZN B;  3ZGK A;  2LF8 A;  1VFC A;  4M6V A;  3W2W A;  1FSE A;  2WV0 A;  2V6E A;  1QA6 A;  2O03 A;  3S1N J;  5EG0 A;  5E17 F;  3B73 A;  3BLY A;  4M3B A;  1FIP A;  3M7G A;  1KU3 A;  3DEE A;  1UCR A;  2L7F P;  4A5M A;  2L02 A;  4AU7 A;  3KZI C;  2HEO A;  4A69 C;  4J19 A;  2R7O A;  2HKO A;  4Q4Z F;  1H0M A;  3H3V K;  3HHG A;  2FNP A;  2CQX A;  2JA6 J;  3WU2 C;  1Z9C A;  2VOD A;  2X1C A;  1WFX A;  2V9K A;  3M1C A;  3CCJ I;  2DA2 A;  3OYK A;  1DGW Y;  3SDG A;  2GQQ A;  1K4T A;  1RPW A;  2FEZ A;  2Y0M A;  1YG2 A;  1XSV A;  4F3Q A;  4FCY A;  3BG6 A;  1MMN A;  3E6B A;  2VE8 A;  1ZKG A;  1I1G A;  1KGS A;  1OCT C;  4S05 A;  4DYC A;  4YIR X;  1IG7 A;  1FTT A;  1ENH A;  3I3L A;  1AHD P;  3LSH A;  1ZRD A;  2ISY A;  5DEQ A;  2L0K A;  4K2E A;  4B3X A;  1BR2 A;  3OYN A;  2DMU A;  4BEH A;  1IDY A;  4P1W A;  3K4B A;  4U0V A;  4BS9 A;  2M87 A;  2OTL I;  3PJR A;  2HWV A;  2CQ7 A;  2X1E A;  1H8A C;  4RB2 C;  3CP2 A;  3MD2 A;  1LDD A;  1JUM A;  4NB5 A;  1ZAR A;  1L0O C;  4EAT A;  1IXR C;  3PSF A;  2ZJP F;  5B66 C;  4E7J A;  3ISP A;  1WWX A;  3S93 A;  4OWR B;  1FBQ A;  5C4J J;  3PIO F;  4IQJ A;  1LUJ B;  1X1A A;  2FBK A;  2VXZ A;  1S6L A;  4X6A J;  3CMM A;  3RCO A;  3ZOB A;  2EIJ H;  1RIO H;  3J7A Y;  1DGR M;  1HSJ A;  3DBL B;  1KU7 A;  5E8I A;  3H35 A;  1QO0 D;  3OYE A;  3A0B C;  4F52 A;  1D0X A;  3E97 A;  4BQQ A;  2CV2 A;  3SDB A;  4KIT B;  2RN7 A;  3KYL A;  2EFQ A;  3F6O A;  2VQC A;  2AO9 A;  1R9T J;  2FBH A;  1EKE A;  3FMS A;  2X6Y A;  1Z21 A;  3BDD A;  3R6S A;  4R8H A;  2UXN A;  1EA3 A;  2X1D A;  5GAD J;  2K7L A;  4RB0 A;  5HLG A;  1VQ6 I;  1EJ9 A;  1GUU A;  3IHU A;  4BKX A;  1I6X A;  3OYI A;  2A3S A;  1QBJ A;  2CFX A;  5DDG A;  2KHM A;  3FXO A;  3TGN A;  4IRH A;  1R23 A;  1YS6 A;  2R0Q C;  1QQI A;  3VB2 A;  3CC7 I;  5GP9 A;  2Y9Y A;  5HLH A;  2W57 A;  4LB5 A;  3QQA A;  1ACI A;  3SZT A;  3JSO A;  3C2B A;  3JRC A;  2V26 A;  4GXO A;  2R7W A;  2B63 J;  2EV5 A;  3ZQC A;  2DPU A;  3MFK A;  2ZNZ A;  3AAF A;  3JAM Z;  1DDN A;  4A3B J;  1H9G A;  1UJ8 A;  4IVN A;  2H6C A;  4I76 A;  1YJW I;  1SFU A;  4RS8 A;  1H9T A;  3G73 A;  3AL0 C;  4MFE A;  1YJN I;  2QEX I;  2QQ9 A;  1TW2 A;  3VYR B;  4JOM A;  1OPC A;  2EWN A;  2VBW A;  4A2U A;  1A35 A;  1ZQ3 P;  1K83 J;  3GME A;  4XR6 A;  3CDL A;  2X0L A;  2HTJ A;  1J5Y A;  3L2R A;  5HOD A;  1Q1V A;  3MAJ A;  1MNM C;  2P4W A;  4BHC A;  2OD5 A;  2A05 A;  1WPK A;  5FGM A;  1G6N A;  2DI3 A;  2FML A;  4A3F J;  3U1K A;  1K61 A;  3G1L A;  3MZH A;  5EDN A;  4RAZ A;  2IAI A;  4PSW A;  1IN8 A;  1FOW A;  3BR5 A;  3DLA A;  2OTJ I;  2EBI A;  2IGO A;  1DQU A;  1FJL A;  3ZPL A;  1ZTR A;  4PUS A;  3I53 A;  3CJQ B;  3RI4 A;  4N0B A;  3CCE I;  1XGM A;  4G8X A;  3WE3 A;  5F04 A;  3NWS A;  2QM3 A;  3CCV I;  5EZH A;  2P7C B;  2VAS A;  3M9A A;  1JKO C;  3H1C A;  5GTI C;  2HDC A;  2WAE A;  2M8E A;  4A3K J;  4EGZ A;  2FBI A;  3HTU A;  3QYF A;  3VYS B;  3MQ0 A;  5EF6 A;  1D0Z A;  2VIX A;  5HS8 A;  3JRH A;  1HDD C;  1UHW A;  2KIU A;  3OL4 A;  4ZDO A;  5L3F A;  2DJN A;  1VF9 A;  1TQI A;  3SZG A;  2BY2 A;  1W7P D;  4CCO A;  3VPR A;  4A0Y A;  2M5W A;  1V5G A;  2CW7 A;  1EH8 A;  2PEX A;  4XLN F;  5FLX K;  3MKY B;  1R58 A;  5J6X A;  3MVP A;  2NVY J;  5HDN A;  2EV6 A;  4Z2Y A;  1RRJ A;  4ZH4 F;  2JT1 A;  3LOC A;  4BE0 A;  3E3V A;  2NS8 A;  1BI1 A;  2K85 A;  3DPT A;  5ICG A;  2LTP A;  1UST A;  3CUQ C;  2VI6 A;  1R4N B;  2QSF X;  4ON0 A;  1LKX A;  4Y52 J;  3F8N A;  2P6S A;  5KAF C;  3DPL C;  2DA6 A;  4PJL A;  2X6W A;  4KN4 X;  2PMZ N;  2E5N A;  2E2I J;  2HTS A;  2QSH X;  2ZJ2 A;  4I99 C;  4RBO A;  1ZHF A;  3B6C A;  3RKY A;  2IBD A;  2F5E A;  4GRI A;  4CZC A;  3FBN B;  1Y56 A;  1FMW A;  2H94 A;  4E70 A;  3S17 J;  5B3S H;  2HOS A;  3ZQL A;  4ZTF A;  1KON A;  5LHG A;  4G7H F;  2XB0 X;  4B44 A;  1ZGJ A;  3UKG A;  1S3J A;  2E71 A;  5F08 A;  1BC8 C;  2QQB A;  3GW2 A;  3BPX A;  2VKV A;  2DMP A;  2NOG A;  5KK1 A;  1RR8 C;  3PSI A;  1XSD A;  2AHQ A;  3HGY A;  4WF2 A;  5M5W J;  1B72 B;  4DBR A;  4IEJ A;  3FKI J;  5JHU A;  2Y30 A;  2R5Z A;  4BHP A;  2RNJ A;  4S0H B;  4FHT A;  2K9L A;  1KQ8 A;  2V1U A;  4LLL A;  3B02 A;  2H6B A;  1KQ0 A;  3GF2 A;  2PJR A;  2W84 A;  5JR3 A;  4N9H A;  1QU3 A;  3GTK J;  1HA8 A;  3MKL A;  2R7V A;  3HGG A;  3C2G A;  4KT6 A;  3V8L A;  1T33 A;  5FKM A;  3OIO A;  4UUS A;  5ILV A;  1R22 A;  3J80 K;  5GAE J;  2LOO A;  2H09 A;  3DKW A;  3K10 A;  5J47 A;  4MIM A;  4RAY A;  1LVA A;  1MJA A;  2K9N A;  3BJA A;  4E6K G;  1R5G A;  2ZO4 A;  1NG6 A;  3CJR B;  3MKW B;  1FTZ A;  4FE7 A;  4WWC A;  4TV7 A;  1X58 A;  3QPS A;  4M3E A;  2E7W A;  3J81 K;  2NVU B;  4ESF A;  3S32 A;  5BPD A;  3FBI B;  5K5R A;  1TQM A;  2K4B A;  3FDY A;  2LY2 A;  1XMX A;  1HW2 A;  1HCR A;  3SQN A;  3TO7 A;  4A93 J;  4DYR A;  2HDD A;  3ERM A;  1OYI A;  1X3U A;  2OZU A;  1FOX A;  2HFH A;  3IUO A;  2ZSI B;  3CC4 I;  1IDZ A;  3Q3S A;  4R79 A;  3TL4 X;  2G7U A;  2GA2 A;  1Z0X A;  2LRD A;  2HOT A;  3DTE A;  3P9K A;  3HDD A;  3BR6 A;  4AD9 A;  1D5Y A;  2YR2 A;  2A6E F;  2B0L A;  1IV8 A;  1VQ5 I;  1QGP A;  1EF4 A;  4WCG A;  2RNG A;  2HNH A;  3ABK H;  2XRO A;  4BGD A;  5A2Q Z;  3QAH A;  2XSD C;  2KL4 A;  3MN2 A;  1P9Q C;  4G7O F;  3P5J A;  2DFH A;  3IL2 A;  1X1P A;  4WX9 A;  1DUX C;  2X51 A;  3CCU I;  3VYT B;  3BG9 A;  3J81 Z;  5AON A;  1B9M A;  2EFN A;  2K9Q A;  3WHC A;  2BY1 A;  4ABZ A;  4M6Y A;  4HZF A;  2BGC A;  2DA7 A;  3KEQ A;  4MEY F;  3VSL A;  3L09 A;  1IV6 A;  3KP7 A;  2DA1 A;  4O3M A;  1BIB A;  3TOA A;  1B6A A;  2DFI A;  3RTR A;  3AG4 H;  5F27 A;  2R7D A;  1DU0 A;  1T95 A;  2GOM A;  3GTO J;  5D8K B;  5LEK A;  3K4C A;  1JKR C;  1WQ2 A;  5HNF A;  3BP8 A;  3BTJ A;  3K4M A;  3T8T A;  3K1P A;  4XN3 A;  2NAZ A;  3KLO A;  1J9I A;  3D0S A;  2O7O A;  3HZJ A;  1R4M B;  3HOU J;  4L9J A;  2DMT A;  2VJ5 A;  4B47 A;  4FX0 A;  2ZB9 A;  3LST A;  5C3E J;  2LG4 A;  2E1M C;  5JVG F;  1OIS A;  3JTG A;  4A3J J;  5FLV A;  3VYU B;  2JTV A;  3IP4 B;  1RZ4 A;  5D5V B;  2JSP A;  1E17 A;  2AXT C;  3GFL A;  4CCJ A;  2JRM A;  3ZQQ A;  2J5P A;  3ECO A;  4BXX J;  3A02 A;  2RGV A;  2VL8 A;  1HKT A;  5E3L A;  2ZFW A;  3LAP A;  3OWT A;  5J1R A;  3GZ5 A;  1JT6 A;  3S2D J;  4CYD A;  2BY3 A;  5CYV A;  1A36 A;  2M3A A;  3OIQ A;  1D0Y A;  4LK0 F;  4N4O B;  3WE2 A;  1P6R A;  4LB6 B;  2CGP A;  2RRE A;  1IN6 A;  2IJL A;  3OYH A;  4YFX F;  1XCB A;  4XOR A;  2LC2 A;  1Z67 A;  2QSG X;  3QU3 A;  3GTJ J;  4QSH A;  2E35 A;  2JN6 A;  1EH6 A;  1IAW A;  1X4P A;  3LWF A;  2V6C A;  5HS7 A;  3VFZ A;  1B72 A;  3ML6 A;  1YO5 C;  2CMP A;  2V1D A;  2FF4 A;  4CSW A;  4BXF A;  5F6F A;  4RB1 A;  1AKH A;  5CKT A;  2DDA A;  5J8C A;  3LA7 A;  2R7U A;  5IOZ A;  3GXO A;  1GV2 A;  1AA7 A;  2PMZ A;  2XC7 A;  1LFU P;  3V7C A;  3KZZ A;  5CQE A;  4I0A A;  4XSZ F;  4LG0 B;  5HLI A;  1G3S A;  5LBQ A;  3CO7 C;  1RI7 A;  1Z77 A;  1P4X A;  1W4M A;  4MHG A;  2O61 A;  3OOU A;  1LVK A;  3TO9 A;  4A3L J;  5L3B A;  3CLO A;  3RSN A;  4C2U A;  2VUM J;  1A31 A;  5GPA A;  4UY8 I;  3CF2 A;  4NHJ A;  1OCO H;  3P7N A;  5J4Y A;  3BG7 A;  3M3Y J;  1BI3 A;  2Z16 A;  3TMO A;  1OR7 C;  1IZ1 A;  2XAG A;  1RUN A;  1AWC A;  3OYL A;  2IP2 A;  3ZN1 A;  2EB7 A;  1KU2 A;  4LMY A;  2V4J C;  3U2R A;  2DT6 A;  1D1B A;  2J5O A;  1S7O A;  2MGQ A;  5LGN A;  3OR1 C;  1ZR2 A;  3VOE A;  2NS0 A;  1Z3X A;  4QWQ A;  4AWX B;  2FXA A;  4XK4 A;  1UFM A;  1KU9 A;  2OCE A;  3FMQ A;  2DCE A;  3G1M A;  2KMU A;  2HR3 A;  1OMI A;  1R5I D;  1SAN A;  2W1O A;  3DV8 A;  1V55 H;  2G7H A;  1LQ1 A;  1IUF A;  5FD5 A;  4ENJ A;  4GYG A;  2QYO A;  1Y8R B;  1O57 A;  1T2K A;  1U8B A;  4AUX A;  5ICE A;  1ZLK A;  3CTA A;  3FHN A;  3OS2 A;  4KJZ A;  1TT5 B;  1TWC J;  3K0L A;  3HSE A;  5J4V A;  1VQO I;  2DT7 B;  1CF7 A;  2KIM A;  1USS A;  4XQF A;  1VQ4 I;  1HXD A;  1MMA A;  1XB4 A;  2H8W A;  3KP6 A;  3ECH A;  4D7N A;  5A2Q K;  1JXS A;  3LSR A;  2I5U A;  1BL0 A;  3CUQ B;  3QRF F;  4IHY A;  5K5Q A;  3KEO A;  5TIS C;  4IHX A;  3PNV A;  4ZYA A;  3F3X A;  1FP1 D;  1XC5 A;  5EZG A;  5KVR A;  2JZY A;  1X3W B;  2B9S A;  3VSK A;  4I02 A;  1I39 A;  2HQR A;  3W2A A;  2KDO A;  2K9M A;  2XF7 A;  2XHK A;  2BE5 F;  3KZY A;  1PUF B;  3PIP F;  4AID A;  2L7Z A;  3K4K A;  4L5E A;  4XRF A;  4DZP A;  2KP6 A;  4ETS A;  3FXL A;  2L9V A;  4LG0 A;  1S9H A;  1BBY A;  4NC8 A;  1YIO A;  1XD7 A;  3A2K A;  2VPR A;  2E60 A;  2KJC A;  3OYA A;  2XDV A;  1X1D A;  2CUZ A;  3IKT A;  1UHM A;  2K3F A;  1SFX A;  3CQZ J;  2WWY A;  3S3N A;  1IRZ A;  4IHW A;  2ZJR F;  3GTL J;  1K6Y A;  3CCY A;  3M8F A;  3O2P E;  1WVR A;  2P6T A;  5DTD A;  4CA0 A;  4B1R A;  1D1A A;  3Q0V A;  1XX5 A;  1GXP A;  5CQG A;  5ERI A;  4HOB A;  1OLT A;  3A03 A;  2HPI A;  3L2C A;  1FX7 A;  3C7J A;  3WG7 H;  1FC3 A;  3U21 A;  1MDM A;  1ERD A;  3WTV C;  1N77 A;  4A6E A;  3W6V A;  4IHV A;  2DYR H;  4ENN A;  3S3M A;  3HOY J;  2JPB A;  2DOF A;  1SVO A;  2LP0 A;  1RKW A;  4GCV A;  3R4K A;  2DMN A;  4OIQ F;  1JE8 A;  4A3C J;  2JA2 A;  5H20 A;  2AQE A;  4HX7 A;  3HOV J;  2FJ1 A;  3E7L A;  5FRO A;  3HB9 A;  1EV7 A;  2QZ8 A;  3GLX A;  3SHF A;  3ZR8 X;  3GX4 X;  1PDN C;  5D5U B;  3JRB A;  3BWG A;  1XGS A;  1C0W A;  3KP5 A;  2A6T A;  2OJE D;  2PFB A;  2WC2 A;  2D45 A;  3QP6 A;  4OIR F;  4RB3 C;  4ANJ A;  1XMA A;  3O6B B;  2O8K A;  3H0D A;  4XKB A;  1XS9 A;  1HKS A;  1U5T A;  3OOP A;  5LRR A;  1JKQ C;  1F4K A;  2IS6 A;  2XSJ C;  4OIP F;  5DV5 A;  5M5Y J;  4Y7N J;  4IJA A;  4E7Z A;  3J7A O;  1TWA J;  1ZH5 A;  3GFJ A;  4ZTJ A;  5E20 A;  5IYC J;  1P2F A;  4LD5 A;  1MMD A;  5E1Z B;  1AKH B;  2DU9 A;  3HSF A;  1J09 A;  1ITY A;  1U5T B;  3LQR A;  2IA0 A;  2WTE A;  2Z99 A;  2CUE A;  5EGO B;  2CV1 A;  4V19 K;  1SD5 A;  4EMS A;  3DWL E;  1ULY A;  3KP3 A;  1JUS A;  3HPG A;  1IGN A;  4EGY A;  2RVC A;  4HSR A;  4F7Z A;  3UNG C;  3IWF A;  2GXG A;  4XLH A;  1D1C A;  1R6R A;  4BHB A;  3EYI A;  2VE9 A;  3N4M A;  1SFK A;  2V1X A;  3JRI A;  4IF4 A;  3I59 A;  2L9S A;  1HC8 A;  2EFO A;  1WJ5 A;  3I56 I;  5H2F C;  5FJ8 J;  1X4O A;  2R5Y B;  4IO9 F;  1XPX A;  3KIO A;  4BUP A;  2E2J J;  3PM1 A;  4B43 A;  3GVA A;  1ETW A;  2DOE A;  2P81 A;  4L18 B;  4QLC U;  3A01 B;  3E0J B;  1SVM A;  1J0R A;  2Q8K A;  3E5U A;  4BJ5 C;  1ON1 A;  2BVM A;  1NG7 A;  3HKZ A;  3S14 J;  1IC8 A;  1W1W E;  1XGN A;  3BOQ A;  3CDH A;  4XLA A;  4O6J A;  2Q1Z B;  3Q5F A;  4BE2 A;  3PO2 J;  1HOM A;  3I64 A;  4C2T A;  3S15 J;  3HRM A;  2HQ5 A;  2F6C A;  5EEA A;  2KRH A;  2VQL A;  5FFX A;  3CO6 C;  5C44 J;  3H3U A;  3GWZ A;  4A3G J;  1ZK8 A;  5CLS A;  4BE1 A;  3Q0W A;  2VKD A;  5E8G A;  3D5S C;  1ZR4 A;  1ZRE A;  4H0E A;  2Y0S A;  1G4D A;  2CH0 A;  3F22 A;  2DK8 A;  4WK8 F;  1FYL A;  2MC4 A;  4QPQ A;  1CF7 B;  4XID A;  3PO3 J;  3AG2 H;  5IP6 A;  1OR7 A;  2BXZ A;  2VQH A;  3CZ6 A;  1KQ9 A;  3JCU C;  3C18 A;  2GA1 A;  4F92 B;  1TNS A;  2V7F A;  2VC0 A;  1Y0U A;  1JTY A;  1G3T A;  2FUG 2;  4BJT A;  3GCM A;  1PYV A;  4MEX F;  4XBF A;  1JTX A;  4U0W A;  3HOW J;  4A3I J;  1IJW C;  4OIN F;  4CDG A;  5FLX Z;  1K7A A;  2NRA C;  4XRM A;  3DTK A;  2IA2 A;  2IPQ X;  1TNT A;  3TO6 A;  4EM1 A;  1PUF A;  1B8I A;  4U7D A;  2EIK H;  3O8G A;  4H4K C;  1YHQ I;  4OIO F;  3LL7 A;  4RGU A;  3HC7 A;  2OA4 A;  5F0H A;  4IHT A;  4RLQ A;  3BJ6 A;  4YEL A;  2HVS A;  3BR0 A;  4MTE A;  3V8K A;  1MW7 A;  2HKX A;  1BI0 A;  2W00 A;  3OY9 A;  1LNW A;  3NWT A;  3COA C;  5J1Y A;  1IN5 A;  2MD5 A;  2PMU A;  4XMY A;  1ONV A;  2AXL A;  3TW6 A;  4UVC A;  3KET A;  2ZXJ A;  2EA4 A;  3DEU A;  1P92 A;  2ZNY A;  1YI2 I;  1M1E B;  3T8R A;  2DMQ A;  3DPU A;  4XOT A;  1U2W A;  3RYR A;  4HDU A;  2DDB A;  4HLY A;  2BEO A;  2P5L C;  5M5X J;  1JJ8 C;  4IX7 A;  4LK1 F;  4PSX A;  4G94 A;  3I55 I;  4YIF A;  2DOD A;  3QP5 A;  4XRS G;  3H9Q A;  3LSG A;  4PJ0 C;  1G3W A;  1QZZ A;  3B6A A;  2GOX B;  4EJT A;  3DCF A;  3O8H A;  4AVP A;  2DT5 A;  3CCR I;  3RZD J;  1AU7 A;  4HA8 A;  3GYH X;  3K2Z A;  1IO2 A;  1U5T C;  4O5V A;  3FM3 A;  3WGH A;  2STT A;  4UV8 A;  2AS5 F;  2MA3 A;  3R0A A;  2HI3 A;  1E0E A;  1Z1D A;  2COM A;  1SAX A;  1V5F A;  5FD6 A;  2XPW A;  2A6H F;  4XL9 A;  2LKP A;  2KPM A;  1O3Q A;  1SMY F;  2ZME C;  3QPT A;  1ZG1 A;  2R92 J;  2QLZ A;  2EV0 A;  3I4M J;  5DCM A;  1TWH J;  1LE8 A;  3IWZ A;  4ZDL A;  3LSJ A;  2Y0S N;  4LOC A;  2ZXW H;  4NC6 A;  3LAJ A;  1JUP A;  3E5Q A;  1QNT A;  4XRS A;  2M7A A;  3ERE D;  4J01 A;  3L2U A;  2A07 F;  4GFB A;  2ICW G;  2MYS A;  3K4N A;  2MAB A;  1OCR H;  3VDX A;  1ETO A;  5IT9 K;  1F9N A;  3LA2 A;  5J3L A;  3IAS 2;  1YX3 A;  1VTN C;  1OFC X;  4KYW A;  2V1N A;  5FKO A;  2HOE A;  5BMZ A;  4BDZ A;  4EJV A;  2E1N A;  3S3O A;  4KIS A;  2M0M A;  2LKS A;  5DYM A;  3D5R C;  2ZJQ F;  3TP3 A;  4KNY A;  3MEX A;  5ILU A;  3V7S A;  2Z2S B;  4HYE A;  3P9I A;  4XSX F;  4E7K A;  2QQA A;  4BJ6 C;  1HF0 A;  2DXI A;  4RA2 A;  2G0E A;  2QA4 I;  4G12 A;  2CJJ A;  2IVM A;  4DNC A;  4XKV A;  3KFW X;  3CMA I;  2DLL A;  4XKW A;  3ZMV A;  3BTL A;  1W0U A;  4CZZ A;  2JA7 J;  1R7J A;  1Y39 A;  4ESB A;  2DPD A;  4KIG A;  2XB5 A;  4UVB A;  2DA5 A;  3ZMS A;  2A5Y B;  2QKM B;  3HYI A;  2CS3 A;  1YFH A;  1ZRF A;  2F5D A;  2JPC A;  3ZQ7 A;  1V5E A;  3DXJ F;  1LFP A;  3A0H C;  1V4R A;  5B1A H;  2CW8 A;  1MKM A;  2W25 A;  3WHB A;  2Y69 H;  1X19 A;  1ZEL A;  2F4I A;  3TW7 A;  1LDJ A;  3S2H J;  1YRN B;  1MBF A;  5J1U A;  2ISZ A;  2OC6 A;  5CVR A;  2W82 A;  3OIP A;  2XAS A;  3D5L A;  4AIK A;  1QHH D;  5IP9 J;  2ZSH B;  3EUK L;  1SEU A;  3GO5 A;  1YJ9 I;  4YFN F;  4PGH A;  2BZT A;  3FXR A;  2YU3 A;  4CGZ A;  4JK1 X;  3W6J B;  2P5K A;  3M07 A;  2K40 A;  1VQ8 I;  3T1B A;  2VBX A;  2WAD A;  5E79 C;  3BPV A;  3R60 A;  1WRJ A;  1TWG J;  1WJA A;  4G6T B;  1YW9 A;  4V2G A;  1S8N A;  1QZE A;  3D1N I;  4GGG A;  1ZLJ A;  1TW3 A;  4MTD A;  2WY7 Q;  2L01 A;  1HQC A;  4XOP A;  1FYM A;  5FRN A;  3BR1 A;  3W6K B;  2JRT A;  4HAM A;  3CF5 F;  1D8J A;  3ZN0 A;  3RYP A;  1JGG A;  3ASO H;  4BU2 A;  2R7R A;  4M73 A;  2KIF A;  4EQQ A;  1VI0 A;  1R5H A;  3HSR A;  3CLQ A;  3HHH A;  4AYB N;  3M4O J;  4BY1 J;  4ZYH A;  1QZY A;  3DLL F;  1PP8 F;  2IRF G;  3DBR B;  2M9H A;  3JRD A;  5LD2 C;  1JKP C;  3JRE A;  5K7H A;  4FE4 A;  1YOV B;  1BA5 A;  2R7F A;  5GPC A;  2H27 A;  2XAQ A;  2OU2 A;  5HNH A;  1ETQ A;  1G3Y A;  2E1C A;  4HST A;  1ETV A;  2LLK A;  4D7M A;  2JJ7 A;  4RGS A;  2BOL A;  4GO1 A;  4BDY A;  4ZC3 A;  2EA2 A;  1ORK A;  2ELH A;  3RDI A;  2A69 F;  5D5W B;  5IT3 A;  3ZRG A;  2DJI A;  4BH9 A;  5KHD A;  1UG0 A;  4BBR J;  1XDS A;  2LNB A;  2OCC H;  3E6M A;  5ICF A;  4LFU A;  2BHY A;  5ICC A;  3WTY C;  2F4M B;  1N78 A;  4CCL A;  1MND A;  2W4S A;  1Z05 A;  2MH9 A;  3KE2 A;  4KUM A;  4R1H A;  2OZ6 A;  5JVT A;  2MFZ A;  2X85 A;  2FX0 A;  2D2W A;  2XAJ A;  2KKO A;  2XIG A;  1MZB A;  4L0Z B;  2V9V A;  4WXH A;  3G4S I;  1FBU A;  1XG1 A;  3R0J A;  4HW0 A;  4YG2 F;  3IV5 A;  1Z7U A;  2DTZ A;  1JI8 A;  3BJO A;  3CCQ I;  2B7E A;  3ESW B;  1ON2 A;  3AFH A;  1GDT A;  2MD0 A;  1R1T A;  2IGK A;  5DCM B;  3GFI A;  5M3F J;  2V79 A;  3F6V A;  3AL0 B;  3V42 A;  1XSX A;  3RPU D;  2ESN A;  1MBE A;  2VQG A;  1Z91 A;  3TBI A;  5FKL A;  4OMZ A;  2JK3 A;  2EK5 A;  2VN2 A;  5E3O A;  1X1C A;  2F5C A;  2ZKZ A;  3MKZ A;  4FET A;  3ABT A;  3O3K A;  4OU0 A;  4JBA A;  5LEJ A;  2NVQ J;  2Y31 A;  4E4H A;  1FNN A;  4EJU A;  1BW6 A;  1K6O A;  1WCM J;  4RGX A;  2LH9 A;  2XRN A;  4EVI A;  4G7Z F;  1Z7L A;  4UB8 C;  1EH7 A;  2OAZ A;  2XF6 A;  3MCZ A;  1IN4 A;  3H5R A;  2Z33 A;  1MMG A;  3BR2 A;  4D0P A;  2O5R A;  4PJN A;  1GT0 C;  2HGC A;  2Y48 A;  1LFB A;  3JR9 A;  2L9N A;  2VJJ A;  1A5J A;  3I4P A;  3LFU A;  5FO5 A;  4IKF A;  2IGN A;  1LB2 A;  1SAU A;  2R7S A;  4UUV A;  3FWE A;  2I8D A;  2UXX A;  2DAO A;  1UHS A;  5IYD J;  2R7X A;  2LVS A;  2PMH A;  4G6Q A;  1YW7 A;  2O8X A;  2BW3 A;  2F5V A;  2KRC A;  1J7K A;  3OL3 A;  1ZRC A;  4OMY A;  9ANT A;  4HBL A;  2H8R A;  2IGM A;  3K1N A;  3F8F A;  3LMM A;  4ASN A;  2LY1 A;  3RZO J;  1S7E A;  4YEJ A;  3SFI A;  3H3Z A;  2K3P A;  1K79 A;  1UG2 A;  3S8P A;  4IOC F;  1U78 A;  4NQW A;  1MIJ A;  4Y3O A;  3ONQ A;  3MMY B;  1PJR A;  3DU6 A;  3AG1 H;  3PL8 A;  5K7F A;  4HF2 A;  3RQI A;  1H89 C;  3EYY A;  2KRF A;  2PG4 A;  2HQN A;  1V3F A;  2Z3Y A;  2E1M B;  1JGS A;  1B1B A;  5EYR A;  3PQK A;  2QCO A;  3KCC A;  1U6G A;  3H9J A;  3K4J A;  4NUB A;  3HOT A;  4B4C A;  1SFE A;  4X0G A;  1D3Y A;  2TDX A;  1WI9 A;  5E1W A;  3KP2 A;  3PFI A;  3H5A A;  4PFO A;  2XKP A;  5HDG A;  2PLY A;  1IF1 A;  2K02 A;  3QOD A;  2DK5 A;  2QBY A;  4F93 B;  4MO7 A;  5IPA A;  1K78 B;  1MH3 A;  4FQG A;  4B8X A;  2LMD A;  4W1U A;  3ELK A;  1UMQ A;  3HRU A;  2LR8 A;  2WA0 A;  1SFO J;  5BQT A;  3A1Y A;  1QPI A;  4IOA F;  3G6E I;  2E5Z A;  4IRI A;  1Z3Y A;  3MWM A;  2HOA A;  2L9R A;  4N9I A;  1TT0 A;  1BOA A;  2C6Y A;  1ZN2 A;  3E1S A;  3NQO A;  3OR2 C;  3NAU A;  3AKZ A;  2XV4 S;  1FOY A;  4XLP F;  1A6I A;  2NS7 A;  1U8R A;  1J59 A;  3KPH A;  2RQQ A;  3MZY A;  2Q2E A;  1QHG A;  4MQ9 F;  2QEN A;  1OCZ H;  2DTR A;  1V54 H;  4EM2 A;  3L2V A;  1ETX A;  2QGU A;  5E3M A;  3EQL F;  3IRR A;  4Y33 A;  2LFB A;  4MLO A;  4PDK A;  1E2X A;  2M2E A;  1RR7 A;  2VBY A;  3IH4 A;  5IOY A;  2LDU A;  4ESJ A;  3M1E A;  1MBK A;  3FKJ A;  2STW A;  1BR4 A;  2L2O A;  4P5O A;  1W36 C;  3LNQ A;  2WBM A;  1YIJ I;  2JA5 J;  3BZ6 A;  2CFO A;  3WTZ A;  3T0Y A;  5DUI A;  2WV1 A;  2CUF A;  1PP7 U;  2F5F A;  1LPQ A;  4II3 A;  3OYJ A;  1TP4 A;  1IXC A;  2XRL A;  5L3G A;  2L54 A;  4BBS J;  3EPZ A;  2CG4 A;  2JA8 J;  5L3E A;  1LDK B;  1MH4 A;  2QWW A;  4IHS A;  4LLG F;  1WJD A;  4BQN A;  5DD8 A;  3BZC A;  2Q0O A;  3DKY A;  4II2 A;  1HBX G;  2W7N A;  2UV1 A;  3C1D A;  4Y13 A;  2HPM A;  2KLO A;  2LYC A;  1K4S A;  4DOZ A;  4HF1 A;  3HPH A;  1I3A A;  2R5Z B;  1YIT I;  3WOD F;  2M4G A;  2VXD A;  1HKQ A;  3G1O A;  4FX4 A;  1YRN A;  2JVG A;  2ESH A;  2RV8 A;  1FEX A;  3BZK A;  1A04 A;  4F55 A;  2YSR A;  2GBY A;  2PN6 A;  3BT9 A;  3HOX J;  4HX4 A;  3CP8 A;  4JX6 A;  4CCN A;  1Y1W J;  3KX2 A;  2Z5U A;  4M74 A;  4L0Y B;  4OOI A;  1KYW A;  4M9X A;  3TOB A;  2OPT A;  1I1S A;  2FQ3 A;  3QU6 A;  1O3S A;  1FP2 A;  3HEF A;  3PUB A;  1IRX A;  4LGW A;  2LKX A;  5D5X B;  3R61 A;  2JVH A;  4CCK A;  2JSC A;  5CPR B;  1Y8Q B;  3HG9 A;  4M71 A;  3L2W A;  2EZK A;  1A6Q A;  2H1L A;  3CJN A;  3TED A;  4B48 A;  4E7S A;  1PUE E;  1E3P A;  5D4S A;  2VC1 A;  3FK7 A;  2LRE A;  4CIC A;  4RAF A;  3K70 C;  2X6X A;  2IT0 A;  2R7Z J;  2FOK A;  4IZZ A;  5TRD A;  2PI0 A;  3JTH A;  3F23 A;  3KYC B;  3SEZ A;  4BXU A;  2K5C A;  3F21 A;  4KFC A;  3IKV A;  2AQF A;  3N97 A;  2EIM H;  4A5N A;  1HW1 A;  4LIU A;  4V2F A;  2N8G A;  2PX9 A;  2UUZ A;  3PNY A;  2W85 A;  1GXQ A;  1YW8 A;  4BYY A;  2BY0 A;  4LLN A;  1KZH A;  2M4K A;  5B1B H;  1TQP A;  3GTP J;  3MZ8 A;  2A61 A;  4HDV A;  2PQ8 A;  5F64 A;  2YUS A;  3HRS A;  1GVJ A;  1B8I B;  4FT8 A;  4L5I A;  5F1J A;  4W97 A;  1I6H J;  5LFA A;  4HNT A;  3L00 A;  2QQ8 A;  3L2Q A;  3KEY A;  3RJP A;  2XGC A;  1T8I A;  2WB1 A;  3BTI A;  1G8X A;  2O6G E;  5D8L B;  5CVU A;  1IW7 F;  3ZMU A;  1R71 A;  1Y6I A;  3BTC A;  3ZQI A;  2EZI A;  1DP3 A;  2CW0 F;  2TCT A;  1QVU A;  4L5J A;  3CCL I;  3OS0 A;  3NAR A;  4IL6 C;  2NOJ B;  2NYX A;  3E5X A;  3SEQ A;  1Q1H A;  4U87 A;  5L3D A;  3FHZ A;  2OQR A;  1BOB A;  1RC9 A;  4P9U A;  1SD7 A;  2QKL B;  5DUK A;  1WJE A;  3S1R J;  1W0T A;  3SJM A;  1MSF C;  3LSM A;  2RQP A;  4L9N A;  4Q47 A;  4Q5S F;  5FRM A;  3WU1 B;  2DQR A;  2EH3 A;  3BRO A;  4AYB A;  3QYB A;  4M3F A;  1IN7 A;  3DEW A;  3BY6 A;  5EEH A;  4UB6 C;  1ETK A;  2A68 F;  4IXA A;  2CQQ A;  4ZYG A;  5FFZ A;  4ZYD A;  3BR3 A;  4Z6Y A;  2VOO A;  2XUB A;  2YX4 A;  3SFZ A;  2LY9 A;  2RAE A;  3IH2 A;  2WAF A;  2CO5 A;  1YX5 A;  3DBH B;  4NBQ A;  1GHC A;  2LBF B;  2VJI A;  4P96 A;  3N05 A;  2EFW A;  4ZDP A;  3WGG A;  2XAH A;  2UWM A;  4BAY A;  3ZQH A;  2WY8 Q;  1R00 A;  3I9V 2;  2MLG A;  1I3Q J;  2HDW A;  2FOW A;  4BQO A;  1UB9 A;  3S1Q J;  4AM3 A;  3FXM A;  1XGO A;  2DW4 A;  2GWR A;  5F0F A;  4NDL A;  2ECB A;  1YYV A;  4XNF A;  1QVT A;  4OAZ A;  2K9S A;  2Y75 A;  3DFG A;  3SZP A;  2I10 A;  4KIB A;  5EGO A;  5FKK A;  2EIN H;  1KA8 A;  4D5F A;  2BW3 B;  3TKY A;  3A4C A;  2NVX J;  5K5O A;  2VT2 A;  3I71 A;  4RM2 A;  4DZJ A;  1OJL A;  1FSH A;  2D1H A;  2XGD A;  1NHA A;  1N75 A;  3CES A;  1WKM A;  4Y15 A;  4A6D A;  3EUH A;  4XLC A;  2HXI A;  3K4L A;  5HLT A;  1T38 A;  3K70 D;  1NH3 A;  1Y0N A;  3CJT B;  4KN7 X;  1OCP A;  4KT5 C;  3ZMD A;  3LFK A;  3FX3 A;  3K9T A;  1NK3 P;  1OKR A;  4PJM A;  4CO8 A;  2MLK A;  3F8M A;  4DQ2 A;  3F72 A;  2F2E A;  4PJJ A;  3HOS A;  4BAC A;  4DGW B;  1R49 A;  2CUJ A;  2EZL A;  3EET A;  2HVR A;  1MJ9 A;  4M6X A;  3U9G A;  3FF5 A;  5LHI A;  3VOD A;  2IXS A;  2O9L A;  4C2M J;  1GVD A;  2DOA A;  1BN5 A;  1X2N A;  4UV9 A;  2EFP A;  2XAU A;  3JAM K;  2RKH A;  2M34 A;  4A3E J;  2R93 J;  3BCB A;  4AC0 A;  2BBY A;  1FIA A;  4CYC B;  3FM5 A;  4XON A;  4IPA A;  4ZZD A;  1ZGA A;  3Q9S A;  5D6F A;  4I2O A;  1TLH B;  4DYQ A;  3QYE A;  1RET A;  4ITV A;  1WHU A;  5CJ9 A;  2VON A;  3I4N J;  3P9C A;  4E7I A;  2DA3 A;  4KMU X;  3GBG A;  2IW5 A;  1STZ A;  2YX7 A;  4EJO A;  3HUG B;  1BR1 A;  3CCM I;  4G9Y A;  2YU9 J;  2DO7 A;  3QOP A;  4M72 A;  3NEU A;  4MGR A;  2VLA A;  3L7W A;  1OYY A;  3HIF A;  5DS9 A;  2G9W A;  4M9S A;  5ED4 A;  1ODD A;  3M8J A;  4UXN A;  5KAI C;  1GLN A;  1TTY A;  3CDI A;  5E3N A;  5HVQ C;  3CD6 I;  3G2B A;  2KIS A;  4C3H J;  2ZXH A;  4N4N B;  3W3C A;  5TGT A;  4B09 A;  1AOY A;  1O3T A;  5IP7 J;  1W5T A;  1W36 D;  5DM6 F;  1APL C;  2P8T A;  4U7B A;  2JMW A;  1TC3 C;  2HZT A;  2W48 A;  4HEA 2;  2FNA A;  3EDP A;  3JSP A;  2IS4 A;  3K2A A;  5E18 F;  4A3M J;  2EPF A;  1B4A A;  2E2H J;  3OV8 A;  1SD6 A;  1VQP I;  3F0C A;  4BEH B;  2ADU A;  3OYG A;  3HJE A;  4UVA A;  1ZAO A;  4DBQ A;  4C30 A;  3VEP A;  3ZXS A;  1LJ9 A;  3HUG A;  3RPU A;  3I5U A;  3S16 J;  5IYB J;  2ZME A;  2WB1 N;  2EQR A;  1F5T A;  4FIS A;  2VBZ A;  2GM4 A;  2WAQ N;  2CRG A;  2OBP A;  1JJ6 C;  5LLQ A;  2RDP A;  2FD5 A;  2F4O B;  3HTS B;  2ELJ A;  1R1U A;  1FY7 A;  1UAA A;  2ZXI A;  2DFF A;  2K4J A;  5HS9 A;  3DF8 A;  3PQJ A;  3E6C C;  1VQ7 I;  3V7R A;  1XMK A;  4RLF A;  4ZJZ A;  1DPR A;  1KYZ A;  3C2H A;  2GZW A;  4I09 A;  3S2W A;  4RMN A;  5BNG A;  5HOO A;  1U9O A;  4C3J J;  5F1R A;  1IXS B;  2LD5 A;  1J75 A;  2GIZ A;  2XPV A;  2ZC2 A;  3L9F A;  3OYM A;  1K78 A;  2BXY A;  2Y2Z A;  3M8E A;  2JWT A;  3S1M J;  4XM3 A;  5JI6 A;  2HYF A;  1I50 J;  3LSK A;  3ABU A;  3OSG A;  2Q2E B;  2W24 A;  4RAG A;  5CVV A;  4M3G A;  5JFR A;  1I27 A;  2CWE A;  3F8C A;  2VKH A;  3LSP A;  2MW8 A;  3TQN A;  4JYK A;  4MFD A;  2UZK A;  2L4M A;  3BG3 A;  4D5C A;  2CQK A;  1FLI A;  2M1B A;  3I59 B;  4PFP A;  3QPL A;  2FMY A;  1BIA A;  4FTH A;  2M30 A;  3FIW A;  1QRY A;  2BV6 A;  2M8G X;  2E19 A;  4I98 B;  5CVI A;  1F36 A;  5EEG A;  3FXU A;  4BNC A;  1W5C C;  4HV6 A;  1TBX A;  3DU5 A;  1U9N A;  3GLL A;  3LSI A;  3QOE A;  4DW6 A;  3J7Y J;  1Z6R A;  3K7A J;  4OAY A;  1T98 A;  1O3R A;  2ELK A;  1SD4 A;  3BQY A;  2WAQ A;  5E1X A;  5D6E A;  1FZP B;  2D5V A;  3TDU C;  3CME I;  5JHF A;  3WTS C;  4JP0 A;  4Y4R A;  1R36 A;  3FXJ A;  4LJZ F;  1BC7 C;  4KIC A;  4NC7 A; 
#chains in the Genus database with same CATH homology
 2DBB A;  2VT3 A;  4HF0 A;  1IRG A;  1S29 A;  3WGI A;  1FBS A;  1YTY A;  1DP7 P;  1REP C;  2RC4 A;  4PCQ A;  1MD0 A;  1YS7 A;  4JQF A;  2O3F A;  3RIR A;  4U0Y A;  3WTW C;  5J8F A;  3FXQ A;  4ENK A;  2LSO A;  3GEZ A;  3U1D A;  5ILS A;  3RKX A;  1P4A A;  2QBY B;  4Y17 A;  2R3S A;  5LHH A;  4HQE A;  5DCF A;  2PBI A;  4BQA A;  1O7F A;  2X4H A;  4KDP A;  4EV0 A;  6PAX A;  2L4A A;  1MJB A;  3ZMT A;  5L3C A;  3QPH A;  2FA5 A;  5H6R A;  3TDZ C;  4MNU A;  4S04 A;  1T0F A;  3ROU A;  3ULQ B;  4KMF A;  1YQA A;  2HS5 A;  4YFK F;  3ZMZ A;  1Z6T A;  1T39 A;  3KLN A;  2NNY A;  1ZYR F;  2QUF A;  5IT9 Z;  4AIJ A;  1ZG5 A;  2M45 A;  3DQV C;  1W7P B;  4GYI A;  2E7X A;  1HW5 A;  5AIQ A;  1FYK A;  1O7L A;  1JHF A;  2GAU A;  1B59 A;  2FSW A;  1FWZ A;  2MH2 A;  2HYG D;  4HQM A;  2K86 A;  4IRG A;  1J2X A;  1XDU A;  5BOX A;  1QPM A;  4U88 A;  3JW4 A;  1BI2 A;  2XKO A;  4HX8 A;  4P55 A;  4RGR A;  2L3D A;  1P4W A;  2FE3 A;  3E6D A;  1D5V A;  3KP4 A;  4WXD A;  3LA3 A;  1F1Z A;  1LEB A;  3CUQ A;  5DD4 A;  3K1M A;  2KJB A;  4Q48 A;  2CSO A;  2GXB A;  2YPR A;  2MBF A;  4P9F A;  5K1Y A;  3F8B A;  3J80 Z;  3GUD A;  3I0T A;  1FPQ A;  4HLX A;  2D1V A;  4EM0 B;  3NRV A;  3GZ6 A;  3G3Z A;  5LGU A;  1OYW A;  2ZME B;  1L3L A;  2Z9O A;  2XAF A;  4ZZL A;  5AIP A;  2NNN A;  4A0Z A;  3K69 A;  3I58 A;  3WTU C;  3FZV A;  2K27 A;  2XVC A;  5H6Q A;  1FOK A;  1LEA A;  4EJW A;  4CXF A;  3WTT C;  4A0X A;  1BJA A;  1JHH A;  1W7P A;  1IUY A;  3V4G A;  4M9Z A;  1BM9 A;  5BS6 A;  4CHU A;  4ZYE A;  3RPQ A;  1CGP A;  4L9V A;  3T5X A;  2P7V B;  1B9N A;  1YLF A;  1IRF A;  2MC3 A;  3WG9 A;  1MDM B;  3GFM A;  1RUO A;  3CUO A;  3WTX C;  4ENM A;  4UNO A;  2ZCW A;  4PGG A;  3Q9V A;  2DQL A;  1XCV A;  4A12 A;  3C3W A;  1RNL A;  3LQQ A;  4L9T A;  2EJR A;  4YII A;  2PJP A;  1WSU A;  3WU0 A;  3SXY A;  3IC7 A;  1D8K A;  4KA4 A;  2FRH A;  1U3E M;  5FB2 A;  2VOP A;  5LGT A;  2GIV A;  2LF7 A;  1SMT A;  2OQG A;  4MQV A;  1I5Z A;  1DPU A;  1ZG3 A;  2XGX A;  3DP7 A;  4UHT A;  2FU4 A;  4PZJ A;  2IA1 A;  3V8J A;  3H92 A;  1W5S A;  4I0B A;  1S7A A;  1FT9 A;  1MGT A;  3I54 A;  5LRS A;  5BPI A;  3HRT A;  4I7H A;  4WXC A;  2O0Y A;  2ETH A;  1T6S A;  5CVJ A;  3REO A;  3FMR A;  5D4R A;  4G6D A;  2P5V A;  4KIF A;  5TJJ A;  3IRQ A;  3RKW A;  4I01 A;  1HST A;  4HV5 A;  2ACJ A;  4AIH A;  2CYY A;  2QVO A;  2ZBK A;  2BYV E;  1R1V A;  5HDK A;  3ZP5 A;  1XN7 A;  2LF8 A;  1FSE A;  2WV0 A;  2O03 A;  5E17 F;  3B73 A;  3M7G A;  1KU3 A;  1UCR A;  4A5M A;  2L02 A;  2HEO A;  1H0M A;  2HKO A;  4Q4Z F;  3HHG A;  2FNP A;  1Z9C A;  2VOD A;  2GQQ A;  2FEZ A;  2Y0M A;  1YG2 A;  1XSV A;  3E6B A;  2VE8 A;  1I1G A;  1KGS A;  4S05 A;  1ZRD A;  2ISY A;  5DEQ A;  4K2E A;  4U0V A;  2M87 A;  2HWV A;  4RB2 C;  4NB5 A;  1LDD A;  1ZAR A;  1L0O C;  1IXR C;  3ISP A;  1WWX A;  1FBQ A;  2FBK A;  2VXZ A;  1S6L A;  1RIO H;  1HSJ A;  1KU7 A;  5E8I A;  1QO0 D;  3E97 A;  2RN7 A;  2EFQ A;  3F6O A;  2FBH A;  3FMS A;  3BDD A;  3R6S A;  4R8H A;  2UXN A;  2K7L A;  4RB0 A;  5HLG A;  3IHU A;  1I6X A;  2A3S A;  1QBJ A;  2CFX A;  5DDG A;  3TGN A;  4IRH A;  1R23 A;  1YS6 A;  1QQI A;  3VB2 A;  5HLH A;  2W57 A;  4LB5 A;  3SZT A;  3JSO A;  4GXO A;  2EV5 A;  2DPU A;  3MFK A;  2ZNZ A;  3AAF A;  3JAM Z;  1DDN A;  1H9G A;  4IVN A;  2H6C A;  1SFU A;  4RS8 A;  1H9T A;  3G73 A;  2QQ9 A;  1TW2 A;  1OPC A;  2EWN A;  2VBW A;  4A2U A;  2X0L A;  2HTJ A;  1J5Y A;  3MAJ A;  2P4W A;  4BHC A;  2OD5 A;  5FGM A;  1G6N A;  2DI3 A;  2FML A;  3MZH A;  4RAZ A;  1IN8 A;  3ZPL A;  3I53 A;  3RI4 A;  4N0B A;  1XGM A;  4G8X A;  3WE3 A;  2QM3 A;  2P7C B;  3M9A A;  2HDC A;  2M8E A;  4EGZ A;  2FBI A;  3HTU A;  3MQ0 A;  5HS8 A;  1UHW A;  2KIU A;  5L3F A;  1TQI A;  1W7P D;  4A0Y A;  2M5W A;  1EH8 A;  2PEX A;  4XLN F;  5FLX K;  1R58 A;  5J6X A;  5HDN A;  2EV6 A;  4Z2Y A;  4ZH4 F;  2JT1 A;  3E3V A;  1BI1 A;  3DPT A;  5ICG A;  1UST A;  3CUQ C;  4ON0 A;  3F8N A;  2P6S A;  3DPL C;  4KN4 X;  2HTS A;  2ZJ2 A;  1ZHF A;  3RKY A;  2F5E A;  4E70 A;  2H94 A;  5LHG A;  4G7H F;  1ZGJ A;  1S3J A;  1BC8 C;  2QQB A;  3GW2 A;  3BPX A;  5KK1 A;  1XSD A;  4WF2 A;  5JHU A;  4BHP A;  2RNJ A;  4FHT A;  1KQ8 A;  2V1U A;  4LLL A;  3B02 A;  2H6B A;  1KQ0 A;  3GF2 A;  2W84 A;  5JR3 A;  4N9H A;  3V8L A;  5ILV A;  1R22 A;  3J80 K;  2H09 A;  3DKW A;  4RAY A;  1LVA A;  1MJA A;  3BJA A;  1R5G A;  2ZO4 A;  4WWC A;  4TV7 A;  3J81 K;  2E7W A;  4ESF A;  5BPD A;  5K5R A;  1TQM A;  2K4B A;  1HW2 A;  3SQN A;  3TO7 A;  1OYI A;  1X3U A;  2OZU A;  2HFH A;  4R79 A;  2G7U A;  2GA2 A;  3P9K A;  4AD9 A;  2YR2 A;  2A6E F;  2B0L A;  1QGP A;  4WCG A;  2XRO A;  5A2Q Z;  3QAH A;  4G7O F;  3IL2 A;  4WX9 A;  1DUX C;  3J81 Z;  5AON A;  1B9M A;  2EFN A;  4M6Y A;  4HZF A;  2BGC A;  3KEQ A;  4MEY F;  3L09 A;  3KP7 A;  4O3M A;  1BIB A;  3TOA A;  1B6A A;  2DFI A;  3RTR A;  2R7D A;  5D8K B;  5LEK A;  1WQ2 A;  3BP8 A;  3T8T A;  3K1P A;  2NAZ A;  3KLO A;  1J9I A;  3D0S A;  4L9J A;  4FX0 A;  3LST A;  3JTG A;  2JTV A;  1RZ4 A;  5D5V B;  1E17 A;  3GFL A;  2J5P A;  3ECO A;  2RGV A;  1HKT A;  2ZFW A;  3LAP A;  3GZ5 A;  4CYD A;  5CYV A;  4LK0 F;  3WE2 A;  1P6R A;  4LB6 B;  2CGP A;  1IN6 A;  2IJL A;  4YFX F;  1XCB A;  3QU3 A;  1EH6 A;  1IAW A;  3LWF A;  2V6C A;  5HS7 A;  3VFZ A;  3ML6 A;  1YO5 C;  2V1D A;  2FF4 A;  5F6F A;  4RB1 A;  5J8C A;  3LA7 A;  3GXO A;  3V7C A;  3KZZ A;  4I0A A;  4XSZ F;  4LG0 B;  5HLI A;  1G3S A;  5LBQ A;  3CO7 C;  1RI7 A;  1P4X A;  1W4M A;  4MHG A;  2O61 A;  3TO9 A;  5L3B A;  3CLO A;  4NHJ A;  3P7N A;  1BI3 A;  1IZ1 A;  2XAG A;  1RUN A;  1AWC A;  2IP2 A;  3ZN1 A;  2EB7 A;  1KU2 A;  4LMY A;  3U2R A;  2J5O A;  5LGN A;  1S7O A;  3VOE A;  2NS0 A;  4QWQ A;  4AWX B;  2FXA A;  1UFM A;  1KU9 A;  3FMQ A;  2HR3 A;  1OMI A;  3DV8 A;  2G7H A;  1LQ1 A;  5FD5 A;  4ENJ A;  4GYG A;  2QYO A;  1O57 A;  1T2K A;  5ICE A;  1ZLK A;  3CTA A;  3K0L A;  3HSE A;  1CF7 A;  2KIM A;  1USS A;  1HXD A;  1XB4 A;  3KP6 A;  3ECH A;  5A2Q K;  1JXS A;  3CUQ B;  3QRF F;  5K5Q A;  3KEO A;  3F3X A;  1FP1 D;  5KVR A;  2JZY A;  4I02 A;  2HQR A;  2XHK A;  2BE5 F;  3KZY A;  4XRF A;  4ETS A;  4LG0 A;  1BBY A;  1YIO A;  1XD7 A;  2KJC A;  3IKT A;  1UHM A;  1SFX A;  2WWY A;  3M8F A;  3O2P E;  2P6T A;  1GXP A;  5ERI A;  4HOB A;  3L2C A;  1FX7 A;  3C7J A;  1FC3 A;  1MDM A;  3WTV C;  4A6E A;  4ENN A;  2JPB A;  4GCV A;  3R4K A;  4OIQ F;  1JE8 A;  5H20 A;  4HX7 A;  1EV7 A;  2QZ8 A;  3GLX A;  3SHF A;  3GX4 X;  1PDN C;  5D5U B;  3BWG A;  1XGS A;  1C0W A;  3KP5 A;  2PFB A;  2WC2 A;  2D45 A;  3QP6 A;  4OIR F;  4RB3 C;  1XMA A;  3O6B B;  1HKS A;  1U5T A;  3OOP A;  5LRR A;  1F4K A;  4OIP F;  5DV5 A;  4IJA A;  3J7A O;  1ZH5 A;  3GFJ A;  5E20 A;  1P2F A;  4LD5 A;  5E1Z B;  2DU9 A;  3HSF A;  1U5T B;  3LQR A;  2IA0 A;  2WTE A;  2Z99 A;  1SD5 A;  4EMS A;  1ULY A;  3KP3 A;  4EGY A;  2RVC A;  4F7Z A;  3IWF A;  2GXG A;  4BHB A;  3EYI A;  2VE9 A;  3N4M A;  2V1X A;  4IF4 A;  3I59 A;  2EFO A;  3GVA A;  4L18 B;  4QLC U;  1J0R A;  2Q8K A;  3E5U A;  1ON1 A;  1XGN A;  3BOQ A;  3CDH A;  4O6J A;  3Q5F A;  3I64 A;  3HRM A;  5FFX A;  3CO6 C;  3H3U A;  3GWZ A;  5CLS A;  5E8G A;  1ZRE A;  4H0E A;  1G4D A;  3F22 A;  1FYL A;  2DK8 A;  4WK8 F;  1CF7 B;  1OR7 A;  1KQ9 A;  3C18 A;  2GA1 A;  1TNS A;  2VC0 A;  1Y0U A;  1G3T A;  4MEX F;  4XBF A;  4U0W A;  2NRA C;  4OIN F;  4CDG A;  5FLX Z;  1K7A A;  2IA2 A;  2IPQ X;  1TNT A;  3TO6 A;  4EM1 A;  4U7D A;  4OIO F;  4RGU A;  2OA4 A;  3BJ6 A;  4MTE A;  3V8K A;  2HKX A;  1BI0 A;  3COA C;  1LNW A;  1IN5 A;  2MD5 A;  2PMU A;  1ONV A;  2AXL A;  4UVC A;  3KET A;  2ZXJ A;  2EA4 A;  3DEU A;  1P92 A;  2ZNY A;  3T8R A;  1U2W A;  3RYR A;  4HDU A;  4HLY A;  2BEO A;  2P5L C;  4LK1 F;  4G94 A;  4YIF A;  3QP5 A;  1G3W A;  1QZZ A;  4EJT A;  4AVP A;  2DT5 A;  4HA8 A;  3GYH X;  3K2Z A;  1U5T C;  4O5V A;  3FM3 A;  3WGH A;  2STT A;  4UV8 A;  2AS5 F;  2MA3 A;  3R0A A;  1Z1D A;  2COM A;  1SAX A;  5FD6 A;  2A6H F;  2LKP A;  1O3Q A;  1SMY F;  3QPT A;  1ZG1 A;  2QLZ A;  2EV0 A;  5DCM A;  3IWZ A;  3LAJ A;  3E5Q A;  1QNT A;  3ERE D;  2A07 F;  5IT9 K;  1F9N A;  3LA2 A;  1VTN C;  4KYW A;  5BMZ A;  2HOE A;  4EJV A;  2E1N A;  5DYM A;  4KNY A;  3MEX A;  5ILU A;  3V7S A;  4HYE A;  3P9I A;  4XSX F;  2QQA A;  2IVM A;  4DNC A;  3KFW X;  2DLL A;  3ZMV A;  4CZZ A;  1R7J A;  4ESB A;  2DPD A;  4KIG A;  4UVB A;  3ZMS A;  2A5Y B;  3HYI A;  1YFH A;  1ZRF A;  2F5D A;  2JPC A;  3ZQ7 A;  3DXJ F;  1V4R A;  1MKM A;  2W25 A;  1LDJ A;  2ISZ A;  5CVR A;  2XAS A;  3D5L A;  4AIK A;  3GO5 A;  4YFN F;  4PGH A;  3FXR A;  2YU3 A;  4CGZ A;  4JK1 X;  3W6J B;  2P5K A;  3T1B A;  2VBX A;  3BPV A;  3R60 A;  1WRJ A;  1YW9 A;  1S8N A;  4GGG A;  1ZLJ A;  1TW3 A;  4MTD A;  1FYM A;  2L01 A;  1HQC A;  3W6K B;  2JRT A;  4HAM A;  1D8J A;  3ZN0 A;  3RYP A;  4M73 A;  2KIF A;  4EQQ A;  1R5H A;  3HSR A;  3HHH A;  4ZYH A;  1QZY A;  1PP8 F;  2IRF G;  2R7F A;  2H27 A;  2XAQ A;  2OU2 A;  2E1C A;  1G3Y A;  4RGS A;  4GO1 A;  2EA2 A;  2ELH A;  3RDI A;  2A69 F;  5D5W B;  5IT3 A;  4BH9 A;  1XDS A;  2LNB A;  3E6M A;  5ICF A;  4LFU A;  5ICC A;  3WTY C;  4KUM A;  4R1H A;  1Z05 A;  5JVT A;  2MH9 A;  2OZ6 A;  3KE2 A;  2D2W A;  2XIG A;  2XAJ A;  2KKO A;  4L0Z B;  1MZB A;  2V9V A;  4WXH A;  1FBU A;  3R0J A;  4HW0 A;  4YG2 F;  1Z7U A;  3BJO A;  1ON2 A;  1R1T A;  5DCM B;  3GFI A;  2V79 A;  3F6V A;  1XSX A;  2ESN A;  1Z91 A;  4OMZ A;  2EK5 A;  2VN2 A;  2F5C A;  2ZKZ A;  3ABT A;  3O3K A;  4OU0 A;  4JBA A;  5LEJ A;  1FNN A;  4EJU A;  1K6O A;  4RGX A;  2XRN A;  4EVI A;  4G7Z F;  1EH7 A;  2OAZ A;  3MCZ A;  1IN4 A;  2Z33 A;  4D0P A;  2HGC A;  2Y48 A;  3I4P A;  5FO5 A;  1LB2 A;  4UUV A;  3FWE A;  2UXX A;  2DAO A;  2PMH A;  4G6Q A;  1YW7 A;  2O8X A;  1J7K A;  1ZRC A;  4OMY A;  4HBL A;  3K1N A;  4ASN A;  3F8F A;  3H3Z A;  1K79 A;  1U78 A;  4NQW A;  4HF2 A;  3EYY A;  2KRF A;  2PG4 A;  2HQN A;  1V3F A;  2Z3Y A;  1JGS A;  1B1B A;  3PQK A;  3KCC A;  1U6G A;  3HOT A;  1SFE A;  1D3Y A;  2TDX A;  1WI9 A;  5E1W A;  3KP2 A;  3PFI A;  2XKP A;  5HDG A;  2PLY A;  1IF1 A;  2K02 A;  2DK5 A;  2QBY A;  1K78 B;  4B8X A;  3ELK A;  3HRU A;  5BQT A;  4IRI A;  3MWM A;  4N9I A;  1BOA A;  2C6Y A;  1ZN2 A;  3NQO A;  2XV4 S;  4XLP F;  1U8R A;  1J59 A;  3MZY A;  2Q2E A;  4MQ9 F;  2QEN A;  2DTR A;  4EM2 A;  3EQL F;  3IRR A;  4PDK A;  1E2X A;  2VBY A;  2LDU A;  4ESJ A;  3M1E A;  2STW A;  4P5O A;  3BZ6 A;  3WTZ A;  3T0Y A;  5DUI A;  1PP7 U;  2F5F A;  1IXC A;  5L3G A;  2L54 A;  2CG4 A;  5L3E A;  4IHS A;  1LDK B;  2QWW A;  4LLG F;  5DD8 A;  2Q0O A;  1HBX G;  3C1D A;  4Y13 A;  4HF1 A;  3WOD F;  1HKQ A;  4FX4 A;  2ESH A;  2RV8 A;  1A04 A;  2YSR A;  2PN6 A;  4HX4 A;  4M74 A;  2Z5U A;  4L0Y B;  4OOI A;  1KYW A;  4M9X A;  3TOB A;  1I1S A;  2FQ3 A;  3QU6 A;  1O3S A;  1FP2 A;  4LGW A;  5D5X B;  3R61 A;  2JSC A;  4M71 A;  3CJN A;  1PUE E;  5D4S A;  2VC1 A;  4CIC A;  2IT0 A;  2FOK A;  5TRD A;  2PI0 A;  3JTH A;  3F23 A;  4BXU A;  3F21 A;  4KFC A;  3IKV A;  3N97 A;  4A5N A;  1HW1 A;  4BYY A;  2W85 A;  1GXQ A;  1YW8 A;  4LLN A;  1TQP A;  2A61 A;  4HDV A;  2PQ8 A;  5F64 A;  3HRS A;  1GVJ A;  4FT8 A;  4L5I A;  3L00 A;  3RJP A;  2O6G E;  5D8L B;  5CVU A;  1IW7 F;  3ZMU A;  2CW0 F;  4L5J A;  2NYX A;  3E5X A;  1Q1H A;  5L3D A;  3FHZ A;  2OQR A;  4P9U A;  1SD7 A;  5DUK A;  2RQP A;  4L9N A;  4Q47 A;  4Q5S F;  3WU1 B;  2DQR A;  3BRO A;  1IN7 A;  3BY6 A;  5EEH A;  2A68 F;  4IXA A;  4ZYG A;  5FFZ A;  4ZYD A;  2VOO A;  2XUB A;  2YX4 A;  3SFZ A;  2CO5 A;  1GHC A;  4P96 A;  2EFW A;  3WGG A;  2XAH A;  2UWM A;  4BAY A;  1R00 A;  2MLG A;  1UB9 A;  1XGO A;  2DW4 A;  2GWR A;  1YYV A;  2Y75 A;  3DFG A;  3SZP A;  4KIB A;  1KA8 A;  3TKY A;  5K5O A;  2VT2 A;  3I71 A;  1FSH A;  2D1H A;  1NHA A;  1WKM A;  4Y15 A;  4A6D A;  3EUH A;  1T38 A;  4KN7 X;  4KT5 C;  3ZMD A;  3LFK A;  3FX3 A;  3K9T A;  1OKR A;  4CO8 A;  2MLK A;  3F8M A;  4DQ2 A;  3F72 A;  2F2E A;  3HOS A;  3EET A;  1MJ9 A;  4M6X A;  3U9G A;  3FF5 A;  5LHI A;  3VOD A;  1BN5 A;  4UV9 A;  3JAM K;  2EFP A;  2RKH A;  2BBY A;  3FM5 A;  4ZZD A;  4IPA A;  1ZGA A;  3Q9S A;  5D6F A;  4I2O A;  1TLH B;  5CJ9 A;  2VON A;  3P9C A;  4KMU X;  2IW5 A;  1STZ A;  2YX7 A;  4EJO A;  4G9Y A;  2DO7 A;  3QOP A;  4M72 A;  3NEU A;  4MGR A;  3L7W A;  1OYY A;  3HIF A;  2G9W A;  4M9S A;  5ED4 A;  1ODD A;  4UXN A;  1TTY A;  5HVQ C;  1AOY A;  4B09 A;  1O3T A;  1W5T A;  2P8T A;  4U7B A;  2HZT A;  2FNA A;  3EDP A;  3JSP A;  5E18 F;  1B4A A;  3OV8 A;  1SD6 A;  2ADU A;  4UVA A;  1ZAO A;  3VEP A;  1LJ9 A;  3HUG A;  3RPU A;  3I5U A;  2ZME A;  1F5T A;  2VBZ A;  2OBP A;  5LLQ A;  2RDP A;  3HTS B;  1R1U A;  1FY7 A;  2K4J A;  5HS9 A;  3DF8 A;  3PQJ A;  3E6C C;  3V7R A;  1XMK A;  1DPR A;  1KYZ A;  2GZW A;  4I09 A;  3S2W A;  5HOO A;  5F1R A;  1IXS B;  1J75 A;  1K78 A;  3L9F A;  3M8E A;  5JI6 A;  2HYF A;  3ABU A;  2W24 A;  5CVV A;  5JFR A;  1I27 A;  2CWE A;  3F8C A;  3TQN A;  2UZK A;  2L4M A;  2CQK A;  1FLI A;  2M1B A;  3I59 B;  2FMY A;  1BIA A;  2M30 A;  2BV6 A;  4I98 B;  5CVI A;  5EEG A;  3FXU A;  4BNC A;  4HV6 A;  1TBX A;  1Z6R A;  1O3R A;  1T98 A;  1SD4 A;  5E1X A;  5D6E A;  1FZP B;  3TDU C;  3WTS C;  1R36 A;  4LJZ F;  1BC7 C;  4KIC A;  4IHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...