4EK9A

Crystal structure of dot1l in complex with epz000004
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
328
structure length
325
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational adaptation drives potent, selective and durable inhibition of the human protein methyltransferase DOT1L.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
total genus 99
structure length 325
sequence length 328
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4ek9A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ek9A02
3M6UA 1Q0SA 3MCTA 4QPPA 2C7OA 2AVNA 2EJTA 3LCUA 4C06A 1BKYA 2OPBA 4M37A 3O4FA 5K0BA 2PX8A 5M5BA 3PS9A 2G70A 3THRA 2NXEA 2G71A 5DPMA 2ONZA 3P2KA 3DH0A 3UA4A 5LQUA 4AZTA 3OE5A 2IDJA 2ZBQA 4BLUA 2Z6UA 5EKXA 5GWXA 1MHTA 2XYRA 2FYTA 4P7JA 2O57A 1BHJA 5CD1A 3PFHA 1G8SA 3ID6C 2OKCA 2PV0A 2PXAA 5E1MA 4HTFB 5K0FA 1Q0TA 3HP7A 3QOXA 3KU1A 5K0EA 3KHKA 4FSXA 4CKEA 5K09A 1G55A 5E9JA 3REOA 1ZGJA 1YZHA 1O9HA 1NE2A 3GIWA 4V0QA 1KPIA 3G2OA 4L7VA 4C04A 3GCZA 2NXNA 2B9EA 3AXSA 5CIYA 1SVUA 2ZZKA 4Y2HA 4PYMA 2PT9A 4PYJA 3JWHA 1L3BA 3UJ9A 2PX4A 1AV6A 5DX0A 4YMHA 3TKAA 1EIZA 4H0NA 4PYOA 1F3LA 1L3IA 4XUEA 4DA4A 3GU3A 4JXJA 3NJRA 2AOTA 2OO3A 2P40A 1KPHA 2CMHA 3NW9A 5BXYA 3P9NA 3LBYA 3IHTA 3S68A 2UYOA 5FADA 4GOMD 3R0QA 3UFBA 2QRVA 1ZGAA 4U7TB 3DUWA 5LQAA 4ATNA 4XUCA 2GAFA 2HMYB 2XVMA 4MIKA 2CL5A 9MHTA 3KQPA 1YUBA 2PWYA 5K0NA 2QY6A 4QTUB 3MHTA 3P8ZA 5KS2A 3GNLA 2NP7A 4CKBA 2P3QA 3HM2A 4QQKA 4PGHA 1ZG3A 1NKVA 2GH1A 3NDIA 3QV2A 2P7HA 4HSGA 4KWCA 5FQOA 4C08A 1NW8A 5GIOE 1FJXA 2ZZMA 1DUSA 3BXOA 3CVOA 3GXOA 3KKZA 3NVKI 5EVJA 1Z3CA 2FPOA 4HTFA 1M6YA 3F4KA 4MQ4A 5EEGA 4DQ0A 3DXXA 5T64A 2H11A 3BWCA 5K03A 2VP3A 3FUTA 5GIPE 3DULA 4P7KA 2PVCA 4YUWA 3LSTA 5FTWA 2HV9A 2VS1A 1JG1A 2ZCJA 1RJEA 5CVDA 4Y30A 1JQDA 5HIMA 3ORHA 1JTEA 4HGYA 2PSSA 3FPHA 3B3FA 7MHTA 4OA5A 3UBTA 4RYLA 3UJAA 1T43A 3TM4A 5FQNA 3GJYA 2GLUA 4M7RA 3LL7A 3V8VA 3GDHA 1RJDA 2O06A 3KQQA 5E2AA 4E2XA 3PX2A 2ADMA 3G8AA 4M38A 5CVJA 1RI3A 3KQTA 3DR5A 4CTJA 2YQZA 1XDUA 4OQEA 3OZTA 4AZWA 2G1PA 3G8BA 3NTVA 5LQKA 3SM3A 3OCJA 2WA2A 1WZNA 4YUZA 1EQAA 4EKGA 1L9KA 3HVJA 3OU7A 4R6WA 2FCAA 4BLVA 3A4TA 4E70A 5FULA 5KQSA 2IH2A 2AOXA 1WG8A 4EK9A 2Q41A 5EG5A 3LKDA 4X61A 1VIDA 2XBMA 3A27A 1U2ZA 3CJRA 3UZUA 5E1BA 1QAQA 3PFGA 3DOUA 4YV1A 1SUSA 2A14A 3BKXA 3G2PA 2JHPA 1VP9A 4KVZA 2IIPA 4RVFA 2C7RA 1R74A 3JWIA 5KQRA 4MHTA 3ELDA 3ELYA 3NVMB 2OZVA 2I6GA 4HH4A 5EPEA 3D2LA 5E8RA 2PKWA 5T67A 3O7WA 2B3TA 2AOWA 1O54A 1KR5A 3HCFA 4O29A 1R8YA 3TM5A 2FK7A 3DMHA 2C7QA 3NDJA 3R9XB 3OZRA 4PIMA 2FRXA 3G5LA 1VL5A 4DKJA 1R6AA 2AOUB 2ZIFA 3RODA 3KQMA 3EGIA 4PYNA 4AZSA 3KPVA 4R05A 5ERGB 3B5IA 4PNEA 2O0LA 4YV0A 4HGZA 5HFJA 3TRKA 3EVBA 5DTQA 4RV9A 1JSZA 5FHQA 3SSMA 1ZQ9A 5DRTA 2ZVJA 3I64A 3H2BA 4E2YA 3TPZA 1VPTA 5GM1A 5HIIA 5EHGA 2ZSUA 4OX9Y 4X1OA 3PX3A 1NV9A 2QE6A 1TW3A 4KIFA 5EMLA 5EGSA 3ELWA 3UJBA 3X0DA 2KW5A 2OY0A 5G02A 3O31A 5DSTA 5BP7A 4RTRA 1AQJA 4QQNA 5BW5A 3IYLW 3T7TA 4AUKA 1VP3A 3HCCA 5DM2A 3G88A 3GO4A 5U4XA 4CTKA 4GC5A 2HR1A 4KW7A 3T7RA 4Z2YA 1KHHA 3HVIA 5E2BA 2P3OA 3SMQA 4POOA 4X41A 1EJ6A 3DMGA 4FT4A 3BWBA 4R8RA 3T0IA 3MGGA 4LWOA 5DXJA 3KR9A 4FZVA 1B42A 1SQFA 4PGGA 5EQJB 3G89A 2I7CA 3FUUA 3EPPA 3FTEA 4E2ZA 1XJ5A 2DPMA 5K0LA 3HCAA 1I9GA 2ORED 2IFTA 2QM3A 4ER3A 3U81A 5C0OE 1DL5A 2BH2A 1VE3A 4RTQA 3FPFA 3BWMA 2Y1WA 5E8JA 3WSTA 4A6EA 3EGVA 2BR3A 3I5UA 3LHDA 2ZTHA 1JQEA 1L1EA 3P9CA 2DULA 3B3GA 2R6ZA 4IV8A 4MWZA 4RTJA 8MHTA 2FK8A 1RI1A 3EGEA 4RTSA 3VSEA 2E5WA 1VQ1A 3CC8A 4PYLA 3UJ7A 1TPYA 2Z6AA 2K4MA 2JG3A 3EVCA 1O9GA 5GM2A 3CCFA 3T7SA 2PY6A 3PT9A 1UFKA 2H00A 2YXLA 4PIPA 1UIRA 5MHTA 3MTIA 4RVGA 1KXZA 2ZIGA 3LDGA 3AXTA 2BM9A 4G56A 3R24A 3TOSA 1FP2A 4KIGA 1N7IA 5CVEA 2EG5A 5LQNA 4RTMA 3M6XA 1WXXA 3C6KA 5DX8A 1V39A 2ZBPA 2PXCA 4P7FA 1INLA 3BUSA 2CMGA 2ZIEA 5EKUA 4C07A 4DZRA 2VZ9A 5P8WA 3M4XA 3PLAE 1ORHA 2HWKA 1JG2A 3CJQA 2JJQA 1JTFA 1XDSA 4NECA 4A6DA 5F2KA 3FRHA 4KRGA 3LPMA 3TLJA 3DLIA 3EVDA 4XCXA 2PXXA 4GBED 5CUQA 1XCLA 5DRYA 2UYHA 2ESRA 3DTNA 3C3PA 2EFJA 1NW6A 4R6XA 5LR6A 3FPEA 4GQBA 2NP6A 3GGDA 3TFWA 4EQZA 2PLWA 4YV2A 3GRUA 3HCDA 4B17A 3ME5A 3OFJA 5LSAA 4YUXA 1R18A 5BW4A 2P3LA 1R8XA 1YZ3A 3OPNA 4U7PB 1QANA 1PRYA 5ICGA 2IH4A 2P8JA 3FUWA 4QPNA 4E33A 4RX1A 5CM2Z 3A7DA 2VDVE 1JG4A 3KR2A 3FUXA 4HC4A 5E9QA 5C1IA 3LECA 2C7PA 3KQYA 4QVGA 2NXCA 4YUVA 1YB2A 4BY9E 4IWNA 3FTFA 4DCMA 3E05A 1P1BA 4P7GA 5H02A 3MB5A 1NW7A 3M6VA 3AJDA 3JWJA 1IY9A 3M6WA 4LECA 2EX4A 3FZGA 5DM4A 3UJCA 3HA3A 4GEKA 3SX0A 5DWQA 2ONYA 4AZVA 5K0JA 4RTKA 3NWEA 3G7UA 1ZKDA 1XXLA 2PBFA 2Y1XA 4V0RA 4C03A 5KYGA 2AN5A 3OU6A 2HNKA 5DXAA 2JH9A 1R00A 1NBHA 1MJFA 3DXZA 4DF3A 3HNRA 1XTPA 3KR1A 5DM1A 3UWPA 3B3JA 3LDFA 1I1NA 1EJ0A 1L3CA 5FWDA 4DMGA 4BLWA 5DM0A 1RJFA 4PONA 3OU2A 1QYRA 3BGVA 5HILA 1KYWA 2BM8A 4LWPA 5HOQA 1G60A 4QTTB 3MAGA 1KIAA 4GF5A 1D2HA 1NW5A 1PJZA 2P7IA 5K8VA 2I62A 4RSRA 1X1DA 5LQRA 1OR8A 3SVZA 4P58A 3ERCA 2JHAA 3BGIA 4K6MA 4BP1A 3HVKA 5GP1A 4E30A 3FRIA 5D1NA 3TQSA 2GS9A 4DCGA 5K01A 3QOWA 3EVGA 1UWVA 5FHRA 4RVHA 5DLYA 1RI5A 2UYQA 2AN4A 3E7PA 1I4WA 4PINA 2NXJA 3LGAA 5KVAA 3FPGA 3BT7A 1QAMA 5E1OA 1P1CA 4C4AA 2O05A 3KR0A 2WK1A 3BWYA 4C05A 3KPYA 1JG3A 2IGTA 3OZSA 2F8LA 3E23A 3K6RA 3L8DA 3MQ2A 5C9ZA 3A26A 4RTPA 4ER0A 2PT6A 3EVAA 1WXWA 3KPUA 3OE4A 2B2CA 3EVZA 2GB4A 3LKZA 5EIWA 3A25A 3I53A 4RTLA 2V7EA 2IDKA 2YXEA 1X1BA 1XCJA 4FSDA 1BOOA 2CKDA 3FYCA 3SSNA 3AWIA 4WXHA 1VLMA 3P97A 4RTOA 3OFKA 4EVIA 4E2WA 4PWYA 1EG2A 2QRVB 3ELUA 3JWGA 3MERA 3E8SA 2XYVA 4IKPA 1G8AA 2OYRA 2JH8A 3P71T 4CKCA 4KDCA 3G2MA 3DLCA 3B7PA 3FUVA 3M33A 3B89A 5LQCA 3BZBA 3RW9A 2YR0A 1IXKA 2PWPA 3P9KA 3TR6A 2YUIA 3KPJA 1N2XA 4HG2A 5FCDA 1VBFA 4FS8A 3SSOA 2PGXA 3HCBA 1ZHFA 2CWWA 4EMSA 5DSXA 2FHPA 4UOEA 1AQIA 5ICCA 2WA1A 3BKWA 5IH3A 2AS0A 2P1DA 2UZ4A 3UJ8A 2B78A 3DP7A 3C3YA 3FTCA 3KQWA 4FGZA 4X63A 2V74B 1D2GA 2XYQA 1YFLA 3P2IA 5CCBA 1HNNA 5DX1A 3BGDA 3HA5A 4PYQA 3A7EA 2BR4A 3G2QA 4KDRA 5EMJA 3R3HA 3V97A 5ICEA 1KYZA 3HCEA 2OB1A 5HEKA 4HRAA 4OBWA 2YXDA 3SR4A 5EIFA 2IPXA 4QDKA 1X1CA 2GPYA 2IP2A 4BP3A 4ER6A 3EEOA 4OA8A 3P9IA 4RVDA 1BC5A 5B1SA 1M6EX 5EZQA 2H1RA 2OXTA 3THSA 1AF7A 5HIKA 1KPGA 3KQSA 4OBXA 3PTAA 5T6BA 2P41A 1NBIA 3EMBA 4F85A 4ER5A 5HIJA 3LCCA 5LQJA 1XVAA 1FBNA 2AOUA 3LBFA 3R6TA 5EOVA 5E9WA 4YMGA 2I9KA 1RI2A 2ZLBA 3FPJA 3ER8A 2EJUA 3DMFA 1NT2A 2R3SA 4ISCA 5F2NA 2AVDA 4E32A 5CCXA 4ER7A 1F38A 1WS6A 3VYWA 4DM3A 1QZZA 2GA9A 3HA7A 4PYKA 5EMKA 3MCZA 3I9FA 2IBSA 4FT2A 10MHA 4OQDA 5EHIA 3GRVA 3KQOA 3LCVB 3P2EA 2Z6QA 2G72A 4PCLA 4PYIA 4GOLD 1XDZA 3LDUA 3G5TA 1X19A 1NW3A 1N7JA 4X60A 5FA5A 2QYOA 1SKMA 5EMMA 1SG9A 5JR3A 2IBTA 4CWAA 4WVLA 2OB2A 2PJDA 3KQVA 5ICFA 3IEIA 3GWZA 2PX5A 3IV6A 4F84A 5K0GA 3CGGA 2AZTA 4GC9A 1YF3A 3TKYA 2UYCA 2N47A 3PB3A 1H1DA 3HEMA 1SUIA 5K05A 4FP9A 5CVVA 1FP1D 2BZGA 3PVCA 4RWZA 1Y8CA 3M70A 1D2CA 2ZBRA 2LD4A 3GRRA 2ERCA 2PX2A 2ZWVA 4FR0A 3Q87B 1TW2A 4LG1A 3I58A 2ZZNA 5EEHA 3EEYA 1JQ3A 2O07A 1M0EA 1FPQA 4GOOD 2IH5A 1ORIA 3VC2A 1EAMA 4PCAA 1G6Q1 3GRZA 3Q7EA 4IV0A 5DT2A 3CBGA 1JSXA 4E31A 5FUBA 2G8NA 2YX1A 1DCTA 3EVFA 4XUDA 2AR0A 4MTLA 3EVEA 2OBFA 4GUAA 3ANXA 5IKMA 3GRYA 2YVLA 5E1DA 4RTNA 1SQGA 1WY7A 5GINE 3FYDA 1KP9A 1RI4A 5D1HA 3DXYA 1NV8A 2ZW9A 2ZWAA 1P39A 3CKKA 5CVUA 3UA3A 3K0BA 4AX8A 4CXMA 3NWBA 1G38A 1QAOA 5JUWA 2AN3A 3FTDA 2BR5A 3C0KA 3CJTA 1IM8A 2AOVA 3SGLA 2VDWA 2NYUA 4EKIA 3SXJA 5FWAA 3UJDA 5GOZA 4M36A 3C6MA 3ER9A 2NNWB 4GOND 3RIEA 2XVAA 5EC8A 1X1AA 2ZFUA 2VDUE 3UJ6A 3HVHA 3MTEA 3AY0A 2YTZA 3LX6A 5DTRA 2ZULA 1YFJA 1JR4A 4F86A 5HZMA 2HTEA 5EZSA 3TMAA 1P91A 2JHCA 2P35A 3NMUF 4QVKA 2B25A 1HMYA 4YUYA 1RJGA 4R8SA 2AOTB 5DTMA 4QDJA 5FA8A 3HTXA 4ZTBA 3VC1A 3EMDA 3KPWA 5F2OA 5K0CA
chains in the Genus database with same CATH superfamily
1AM4D 1GTJ1 2OCDA 1PEKE 2Q5QA 4PLWA 1VCOA 3GGCA 5GZ6A 3NLLA 3V4LA 5BPHA 4YWJA 1R8SA 2GLXA 3BORA 5JJIA 1L9XA 4CF4A 2ORVA 2VLIA 2FPPA 5AHWA 2ZR7A 4TKUA 1PZEA 5FF9A 5SY9A 5J23A 3A6ZA 4ZPXA 5KHAA 4B79A 4KR7A 1T8RA 2ZSFA 2BJHA 3IQWA 3MLFA 5KWEA 5IULC 3MFYA 1Q17A 5F5XA 2IDJA 4MVJG 2WYOA 4IDBA 3U09A 5DBFA 2DERA 3ZU3A 3O8QB 3ZXSA 4AKTA 3QWGA 3PFHA 1UKVY 5AK3A 4M6WA 3AIKA 2OKCA 4JCOA 3PE3A 2JB9A 1M1YE 4DYHA 5DIZA 1KOLA 2BT4A 2G0TA 1G5TA 3JQ8A 1W5SA 4QXRA 4HNSA 2MR6A 4AY6A 2PT7A 3R0JA 1QB7A 4OMCA 5K3CA 5KKNB 1NM5A 3V1YA 3AB8A 4I8IA 3VOSA 2WNIA 5GONA 3U6BA 1SOAA 4LHSA 2BGRA 2VHTA 4WOKA 2J6HA 1ZK4A 2C4KA 1U0JA 1R4ZA 1JIJA 1CERA 1G18A 3AW9A 4AJHA 4F2HA 1AXRA 5DW0A 1Z29A 3N8HA 1TC2A 2I6QA 4KSYA 5I9TA 3RHSA 1AUPA 2WSSD 3DOHA 3G59A 4PYOA 4JXJA 2J9FA 2POCA 1QRAA 4EMBA 2PXDA 4AULA 2AHOA 4GGPA 4W4TA 2ZIXB 2QS9A 5KX5F 1T8PA 4B3GA 1OVGA 1DFHA 9MHTA 1MC1A 4WLOA 5HS6A 1P1IA 3IBSA 3KLPX 1P5JA 3MWEA 5CYOA 3V8QA 3E4DA 4KJZA 4PZCA 1RPNA 3HM2A 1J49A 4WTOA 3ZOZA 3VNVA 1HX7A 5C3UA 1ATIA 1Q7GA 2B4QA 3PEWA 3ITEA 3BULA 4JC4A 4DR7B 4H15A 2WP8J 3ZE7A 2HA5A 5EVJA 4V0NA 5NULA 621PA 3R41A 3D6MA 4G0QA 1K75A 3DMYA 5K0SA 4ZMBA 1XELA 4MQFA 3SBOA 5K03A 4B3BA 1KDRA 4D0LB 1K97A 3MJVA 4M9SA 1SK8A 1XZAA 5EESA 1IJEA 5KTSA 2PH3A 1NMXA 4G1MB 3CLUC 1FTQA 2M32A 2RAFA 1IATA 1N57A 3IJPA 4F2PA 1JTEA 5JISA 2ACKA 3EC1A 2N3ZA 5KHLB 3B3FA 2PPVA 4JOQA 3SHQA 7MHTA 1RZSA 3D0OA 1GPKA 4DLYA 1E94E 2QGNA 2MXDA 2PJUA 3N07A 4S04A 1FQKA 2ZR8A 2EFGA 3KAQA 5JJBA 1FFCA 1L5NA 5I8WA 4RKWA 1Z0IA 4FLMA 4EI9A 1W4ZA 2C9CA 3L1KA 3ORSA 2WJIA 3DMNA 3T7CA 1AMOA 1PNRA 1AQUA 3I4CA 4L5CA 3X1ZA 1TVMA 3LE8A 4NBWA 2BSXA 2F62A 2CLCX 2XMCA 3KZ1E 5FOQA 3BSWA 2ZJ3A 1SU6A 3WGIA 2GBLA 2QSUA 2YJZA 3D5EA 3Q8KA 4QGBA 1OYOA 3E18A 2NTEA 2LXNA 4QKQA 2XGSA 3HYLA 7MDHA 2GBPA 3EWAA 3NAGA 3HUEA 5JYCA 4ON9A 4XYBA 2IE8A 5CK5A 2OENG 2DLCX 1L1MA 1BW9B 3ZKCA 2VZLA 4MVJM 1U2TA 3IFSA 2PGDA 4DNPA 1E7RA 5EUCA 3ZYZA 4FS3A 1JQJC 1CYDA 1D4FA 3IL2A 1FLNA 5AVVA 1YDFA 3W5HA 3K6SB 3IR7A 5AKEA 4KVZA 1JLRA 4FGSA 2WG1A 2RJ3A 3C3DA 3PT5A 1A27A 1SZJG 3WXMA 4YQFA 3ELYA 2ZANA 1QDUA 4TMKA 4GO1A 2P4UA 2QTVA 3DBRB 5L8VA 2NQ2C 3SQMA 3R5JA 1GRQA 3MWGA 3T3HA 1HR0B 3D3KA 1YOVA 2QUKA 4TS9A 3DMHA 2C7QA 3EXAA 4AY5A 2C31A 1M2KA 4U2FA 5JH7A 3PPIA 3E1KA 2VCEA 3ZHSA 2ZS8A 4ACAA 1T4MA 3WFJA 3O4JA 3THYB 1ISFA 1G7CA 1SU4A 2F1IA 2I55A 3D81A 1YI8A 1C8LA 3PPVA 4G5RA 1L7QA 1SHTX 4KMSA 4KLNA 1ENZA 1AKMA 5HFJA 3A4LA 3VVLA 4RLFA 2VDQB 1JWBB 1AC5A 2YH2A 1ZMOA 2GETA 1AKUA 1VHDA 4RV9A 3E5RA 5FHQA 3WNZA 3OUTA 1LLQA 5BVHB 3QXCA 4OM8A 1E6CA 5ALZA 3LFHA 1SWWA 4EB6B 1AJEA 2JLAA 2QV0A 3PGMA 1Y6QA 3H8WA 5TE9A 4P80A 4ZV9A 4YA6A 1OB2A 2WT9A 4P81A 2WM8A 2JFBA 4IFEA 3IMCA 4QGFA 4BNJA 1C4WA 4D41A 2PBLA 2XCLA 3VSBA 3GDWA 4BLQA 1JHAA 2V7VA 3H4MA 2UVQA 4CM6A 2GI4A 3EZGA 3IQHX 1Z56C 2IY7A 5LD2C 1GYPA 4KW7A 1KP3A 1G20B 4Q39A 4WFJA 3KO8A 2JHFA 4FKMA 1D1TA 5HJ5A 3QXJA 5M29A 4G2NA 4O0LA 1CT9A 1U8TA 4JLDA 3WMGA 1F20A 4JQCA 3VPHA 3PHGA 3VJLA 1DKOA 4ALIA 3SCFA 3ITKA 1VHJA 2ID8A 4LWOA 5C32A 3C14C 1MLDA 3CRNA 1ND6A 2C78A 4A3SA 2BJCA 2HJGA 4JJAA 3NQ41 1G5PA 2PL1A 4X4DA 3C16C 3O9MA 5AICA 1JKFA 2LV8A 4RTQA 3KSAC 2QRLA 3ENZA 1TX4B 2XMDA 4TROA 4ZRMA 3THOA 4XX0B 3TZLA 4AKEA 1EUZA 3CZ5A 1JIQA 1KVTA 1FDIA 1LV8A 3U37A 1PW7A 1QDLB 3AHJA 4GPAA 3LA6A 3PXBA 2FRDA 2J6BA 3GUCA 4ZALA 3QVLA 5AJVB 4B6EA 1AXGA 4NCBA 1T9GR 2KSQA 4EHBA 3NDBB 3ULKA 2IQ5A 3N9IA 3W3AD 3LUCA 3T5BA 4X3CA 4G23A 2Q46A 4BP9A 3LJKA 1IJFA 1BEUB 5K20A 1GPAA 2YXLA 4LJ9A 4YVFA 1GSAA 1UMCB 2HADA 2ZIGA 1HPLA 3F5QA 3KFXA 2PTGA 3I4LA 1FX0A 4XR4A 3SZMA 2RHGB 1RKVA 2NO5A 3IKMB 5EUQB 5LQNA 4EB8A 2BJWA 1WXXA 4D96A 1QJCA 3JWEA 1J0DA 4H6WA 4MLPA 3QJ5A 3Q8LA 2GVZC 1OWLA 1AMNA 2CMGA 1E9RA 3GFRA 1C3OB 3KEQA 4LKOA 1SCKA 1SZDA 3C7DB 5EPOA 1L5LA 2AW3A 2JLBA 4O2RA 3GNTA 4IFTA 4LI0A 1ULTA 2HWKA 1JG2A 2O5EA 2L2QA 3THWB 3TQIA 1UC4B 3IAHA 1MHPA 3V00A 5FOWA 3TG8A 2WF6A 2ZITA 1M1NB 2G82A 5CUQA 2ZYRA 5LDGA 4RGQA 2GBLC 4I1OA 3W6NA 5GAGi 1BU8A 1VE7A 2A4KA 2PLRA 4DBVO 4OEHA 2ZUTA 2GRLA 1P5RA 1W52X 2AK2A 4LGVA 1QO9A 3RT1A 2GM4A 2W6QA 3F90A 4W5JA 3USZA 4BGEA 1CJKC 1CBUA 4F6RA 5SICE 1R18A 4ARSA 2D00A 3FW1A 1T5BA 4NV3A 4DQUA 4H9GA 3E2IA 3VV2A 3WI7A 4OLBA 3NDPA 3HI4A 3GAMA 3RROA 3RT9A 4YUVA 4IWNA 1AKTA 4KVFA 4EDHA 4NFYA 4EB0A 2D3WA 3REQA 3BTUA 3GGGA 1NJ2A 1NW7A 4UUNA 4BVJA 4JJ7A 4RKQA 4YMVA 1M1YB 4GEKA 3AK4A 4LJ8A 3AHDA 2HCNA 5C31A 3P2MA 4O5AA 5EWLA 4A0SA 2VK8A 5JFTA 5JSQA 3A6PC 4JBWA 3BF7A 3HBJA 4PFKA 3G8CA 4IRMA 2Q6KA 1OAOA 1XTPA 1Q20A 2J0UB 3BMOB 3GFPA 3K9CA 2G04A 4NICA 4W5OA 3LDFA 1G64A 1XCGB 2BGIA 1DC3A 2FTKE 2XZOA 2P9GA 4Q1FA 4UAGA 5C53B 1H6AA 2CV2A 2J3MA 3HDYA 2NM0A 5AQEA 4P33A 1H8EA 3W9BA 4MUYA 4GF5A 3CWCA 2P7IA 4I6RA 3WX0A 1K5PA 3JXCL 2JCYA 1KF0A 2DWPA 4N0DA 3EAGA 5JMTA 1RABA 1NBMD 2IU3A 3I0MA 1PQWA 3OCCA 2CDBA 4JFAA 4NZZA 1XMQB 2WINI 3NBQA 5DZSA 4GKJB 4HWPA 5FHRA 3IPXA 1DC5A 1XEFA 2EJVA 4O3MA 4F06A 1UJ6A 4ZYLA 3RS3A 4ZMRA 1PGQA 3ZU5A 4CMKA 5F23A 2WYUA 2QZZA 2YHBA 3RUCA 3I6QA 3THXB 1BROA 1ULBA 3DGEC 3QE0A 1JSRA 5C9ZA 2PXEA 3IDFA 5B37A 4IJWA 4GRIA 4YG7B 1C7EA 2EKBA 2R8PA 5DGCA 4Z3DA 4AKSA 5C18A 2CV1A 3OY7A 4OI0A 1ORWA 2JLQA 3C6QA 5CAEB 1P1JA 2NUBA 4YP6A 3WA6A 4BMNA 5IRCD 4F11A 1K98A 1IIBA 1BMTA 1QPGA 2EW8A 3ED5A 5ULLA 3FZNA 3G2LA 4YI5A 2DFLA 4RVOA 3SF8A 4DVGA 1TZCA 3X1KA 1CVIA 4C1NA 4FU0A 1FSSA 2C96A 2PKEA 3FSGD 2N42A 2VYCA 2C2BA 4R5MA 2JH3A 1JEEA 1T0PA 2A92A 3UOGA 3ZU4A 2JFNA 4CQMA 4EJ6A 1DRVA 1HE2A 2YIJA 3IAS1 4AWXA 4CCSA 4FHZA 3WGYA 4QFDA 1JYFA 1DWUA 4LGMA 1J24A 2QGFA 5AM3A 4UOEA 4Q3KA 1TK9A 3COPA 4PXSA 4ZO8A 5JAMA 2BKUA 3I45A 5DH9A 1JKJA 1X7WB 2V7PA 4K9KA 2IF0A 4I6JA 2RBEA 3DVLA 3FTCA 3KQWA 3G49A 5CB4B 1YL6A 4ILEA 5LMNB 3H9GA 1HDYA 2C84A 3LWBA 5CCBA 1DQZA 1OIVA 1XA3A 2W6CX 2LDBA 4PYQA 2BR4A 1NQOA 1XPJA 3NONA 4JL5A 4EI7A 1DT3A 3DQPA 3NIWA 2Q07A 3ED1A 1HEYA 4OUKX 5DHAA 4YJ2A 1EUCA 1SELA 2C0CA 2NVBA 1NA5A 4HUTA 2GZMA 2JEYA 2CEAA 2XYHA 3DL0A 4HFNA 4QOIA 2IS6A 4D44A 1W4CA 4FE7A 2QL6A 2C20A 2FZCA 4LV5B 2DM6A 2OGWA 4G1BA 4RLHA 4XQGA 2FUG1 1QFMA 1DZ3A 1JJBA 1RLUA 2WMOB 3M9WA 3NKLA 5C1BA 1KAHA 1UEIA 4D26A 2WYHA 3D4PA 4GVLA 2C77A 2EC5A 2HK6A 3MD0A 4NWIA 4IGFA 4R69A 3QU4A 2YUTA 5C5CA 1L5HB 3D7KA 1PZFA 4K6CA 3ZYCA 1MFPA 1XCMA 2GHTA 1Q11A 4Q18A 1H2FA 2LCQA 4HB4A 2P68A 5IJ9A 1FTWA 4M99A 1PT5A 3VC7A 1E4EB 3B2EA 1JBEA 4EHNA 1MOZA 1SHUX 2O2JA 2QSZA 4C0AC 2P11A 2XQVA 5IAOA 2PRIA 4LWQA 1AGPA 1BZYA 1RXYA 3C85A 2YHIB 4GZ3A 4FM9A 4OJQA 3I4FA 1N0HA 4MVJA 4UUMA 3L7KA 1GL3A 1Z8NA 2OEPA 5G41A 2XUGA 2C92A 4A9AA 4CG1A 2ZB8A 1RWVA 4Y18A 3S8YA 2GN8A 4DXDA 2MSKA 5HOEA 4KTTE 5G4LA 1RPZA 1C7ZA 4TSRA 4OXQA 4G0YA 3IAEA 4NMWA 1F48A 4PSKA 4U8HA 3ZQ4A 1KTVA 2W7TA 5JQGB 3CN7A 4YT8A 3VI4B 4D8TA 5LDDC 3Q3JB 3FTEA 1QU2A 5DEIA 3ZTYA 2HNAA 4EBFA 4X91A 1ZD4A 3JYHA 3KKPA 3DEIA 4M1EA 4REQA 2O2ZA 5T4FA 3DC7A 1PVVA 1R0SA 1TW2A 3FMPB 3JQPA 4PGMA 3D3QA 2BLLA 4RF5A 4X00A 1DEHA 1P3DA 2I3AA 2HHJA 4K3VA 4YRIA 3WS7A 1SJ9A 1ID8A 2I1WA 4D74A 3GY0A 1DE0A 5FBWB 3IE0A 3HDHA 1KIMA 4JDUA 5TS3A 4E6EA 4F0JA 3HNPA 4QBGB 4KE9A 4UCQA 5DIFA 2FFAA 2V3VA 4HLCA 5LMUB 4TM8A 5HFAA 1FVHA 1Z47A 1A76A 4UCWA 4NEHB 4YP5A 5DMHA 5L45A 4DUYB 2XI4A 3ASVA 4O4HB 5DN6D 1NRXA 2QT9A 1YB4A 2X40A 2DZDA 5ILOA 4XWWA 4UU0A 3B6KA 1KJYA 2AC4A 2BFFB 4KXMA 4U02A 5D86A 1KDVA 3STHA 4F92B 4J49A 5JZ9A 4C3VA 5AVJA 2VUSA 1ZRHA 4DV4B 2A2ZA 1C1XA 1EK1A 1FJ2A 1W25A 3LL4A 3RVKA 3CB4A 3W6PA 1Y3AA 3WBJA 2J7PD 1L5RA 4RADA 2RGYA 4Z3KA 1WM1A 4YAGA 3DLAA 4KX5A 4U9IS 2ILTA 4O2AF 3L7DA 5I9MA 4Z6KA 2WJ6A 1XP8A 4JLMA 1EFRD 2XVAA 4F21A 1HDRA 3K72B 3TRJA 1LBIA 3EVTA 4IIJB 3I6MA 4Z1MA 3MELA 2UU9B 1Y37A 3YASA 2Z1NA 5I47A 3PEYA 5LWQA 5KDOA 5LP6C 5HZHA 1V25A 1RSZA 1NR7A 1EFHA 1Z4JA 1IHYA 1IUKA 3DEZA 5KB3A 2HUPA 3ZD7A 3AM1A 2G9VA 4IWRA 5L3SA 5KTPA 2I66A 1GPDG 3X1XA 3B1VA 4EWLA 1UOOA 4PS0A 4WXPA 3RD5A 3D2AA 3ZNPA 1CJSA 3BH0A 2XE4A 3IILA 1KOGA 1JHQA 1SPBS 1EINA 1G21B 4IMRA 4UBNA 1GUAA 2PTHA 4U9HS 1O0BA 2D5CA 4X7BA 1B0NA 4BMPB 4BMVA 2IZ7A 5A71A 2QUAA 3IOMA 4C89A 4HDSA 2PUAA 2X76A 4DOMA 3PBKA 3EFOA 3OUZA 2H31A 4IQFA 4OK6A 4PLZA 5BQPA 3V1MA 4US0R 3VPFA 2AKYA 3TF5A 2YV1A 5DBGA 5FLKA 5FI3A 3MRTA 2HU8A 2R6AA 1YVDA 3P2JA 3VR4D 2BELA 3ESZA 2NV0A 3MTBA 3QVSA 2F1KA 2NXEA 3OT5A 5G0SA 1TMGE 4C0XA 4X4EA 3DH0A 4DIUA 2ZJ0A 4FTWA 1CP3A 4LVOA 5C4IA 2YVAA 1XVUA 2ZVDA 1CEQA 1R2QA 3OE5A 3P5SA 1HKUA 1UJ2A 4GZLA 4J8PA 3SFVA 3W1WA 5J4YA 2OHVA 2PK3A 1ZCJA 2AXQA 3AR9A 5DGTA 1A4RA 1ZO8A 4F71A 2LYJA 1DWOA 1GPMA 2FN3A 3AV0B 3BHMA 3FIUA 1N2OA 2FUG6 2VDWB 2VP2A 3MVEA 2AUTA 4GKBA 3NAZA 4H35A 4IGIA 1Q0TA 3OJLA 4RSMA 4RHCA 3VPGA 4CKEA 1UDRA 1PJLA 1WUJS 2V03A 1Y9AA 3QX8A 4FGKA 1DJOA 4P35A 5AVSA 4F7DA 4FQ8A 3HR8A 2OFOA 1I3NA 3KVVA 3W0LB 1UPTA 3T3GA 5FEUA 1NFFA 4M0DA 5CGQB 5L3SB 1B8VA 1CUFA 3ND8A 5BT9A 1M5TA 1TT5B 4PYJA 6REQB 4P5PA 3C1UA 2MIIA 4OXRA 1ABFA 3GBPA 1PNTA 2FEXA 1KEVA 1DXHA 1XTSA 3EVNA 3KEOA 3L7YA 4I5EA 4EUEA 5BSWA 5A4FS 1QTNA 2Z57A 5DDIP 2BKLA 5FPSA 1IPEA 1NURA 4RGYA 4PZUA 1NC3A 2F3TA 3DAOA 4CEJB 2O6HA 1A4IA 5IJXA 3K6KA 3TAUA 2DJ5A 5KOJB 1RWXA 2B8TA 1Q0HA 1OFGA 1TVCA 4MR8A 1Z0KA 4JMPA 3R2JA 2LNMA 1EKXA 1MDBA 3A1WA 4JR0A 5LLDA 3T1OA 2PXLA 2R6R1 5GIOE 5EIAA 1XCBA 3EDYA 4ARZA 1E9EA 1R9MA 3M1LA 3CW8X 2QTAA 4M1QA 1CZOA 4HDRB 4LX8A 5CP8A 4UXJA 3QU9A 4AN0A 5BPFA 1M6YA 5AMXA 5EEGA 5H3LA 1Z82A 3MMPA 4B75A 3ADPA 4JLPA 4I50A 2XCIA 2O48X 3DEHA 1UFRA 1YXMA 4QUHA 2EGGA 3BE4A 1MO3A 1NN0A 3OMXA 4UTPA 1SKQA 3P0FA 5CRIA 5AJTA 1NYLA 1S9DA 3R0ZA 4EUFA 2BUBA 2HINA 1WB9A 2G0AA 2Q8QA 2R751 3TO5A 2WYVA 2FCRA 1TF5A 1FTGA 2LW7A 3AP3A 3G85A 1PTJA 1XWWA 3LIIA 4R1PA 4TV8A 3UMVA 3ZCRA 3IQZA 5F9HA 3REGA 5IHPA 2OVBA 4FNOA 4XARA 1QIIA 3R9IA 3LL7A 3D8SA 4L8WB 4UBMA 5ETJA 5D84A 3OFND 1KAMA 3EHEA 4D99A 4DIKA 2H4HA 3NEJA 3FHCB 4F3KA 4TKZA 3V4ZA 1A72A 4KWIA 1SCBA 4H7KA 3DDZX 3V32A 3G8BA 3GGOA 4BFSA 2W58A 3I0ZA 3ACBA 2IW1A 5LZ5A 5IABA 4RSGA 4D4JA 1C9DB 3CVUA 1M1NA 3L84A 4WZBB 1HC7A 3I52A 3DVSX 1Q1EA 3RSFA 3F3YA 1N32B 1QYCA 1TRKA 4YAIA 2LCFA 3ZHQA 3QW2A 2R6HA 3O84A 4IXMA 1CUVA 1JGTA 1OPXA 1VRCA 1WL8A 4I4LA 3QUCA 4R3NA 3I2FA 4X7MA 5EE5B 1FX0B 5T4EA 4HRXA 2NO6A 3IPCA 1CXZA 1W9MA 2X2PA 2IHVA 3IAUA 3LUGA 3MG9A 3NRJA 1FY2A 1WETA 4WKCA 4B0PA 1VP9A 5AHOA 2AMJA 3ZW8A 1RQXA 4G63A 3ELDA 4ZZIA 1PLJA 2MSDB 2QN3A 4XPIB 3JASB 2CF6A 2PSJA 5JFOA 1GUZA 1NNSA 1H6CA 2H4JA 5AKXA 3RLFA 1O54A 4F5DA 4DV2B 4CI9A 3N2ZB 5AT1A 3H8JA 1PT8A 4UVGA 3L7LA 3U6KA 1QHXA 3G5LA 1D6JA 3QXSA 3H7IA 1F14A 4ZT5A 1X1RA 2X5NA 4UMFA 2Z4TA 2QNRA 5ERGB 1QIJA 1ZBDA 2H2WA 3HL4A 4UASA 1Q1ZA 4I3FA 2QIOA 4B3HA 1QK3A 2PU5A 3KKOA 2O38A 4KCGA 2CFSA 3PIRA 4JJIA 3WL4A 1HYEA 4RZSA 3CGWA 1DKNA 3NHZA 1LK5A 4NBUA 1OXUA 1ZQ9A 2XBUA 5BSUA 4K88A 3GN5B 3OZEA 1N5IA 4LPKA 3U3WA 1R66A 4IWYA 3DVAB 1JFLA 1NV9A 4KIFA 2YWGA 5DE3A 2DHDA 5ADVA 4EL5A 1X80B 1XQ6A 3BG5A 1H1TA 4BJ5A 4RTRA 2JVKA 4KQIA 3ZS9A 2QVCA 3IYLW 2WQ7A 4XIIA 3ESCA 2HBRA 1KMHA 4KOEC 5IUNC 2M6RA 4DQXA 1EESA 1SBZA 2Q3HA 1MOPA 3JZMA 3RTBA 4D97A 4F96A 1QH8A 3FI0A 3CUTA 5CHEA 1GJRA 4DNFA 2QI9C 4IO0A 3T0IA 3QBVA 1VA4A 4JLWA 3O3MB 2IJGX 3DDWA 4U8GA 1GPNA 3C74A 5KMGA 4BXOB 2I4NA 2XE6A 2C4WA 2P69A 3LUAA 5CPFA 3SHVA 4LXIA 1LWNA 4J91A 4RGVA 3TIFA 2VJOA 1THGA 4LZLA 2Y1WA 2KMLA 3Q7QA 5ITZB 2O4UX 3KU4A 1SVLA 2HRCA 4KN6A 2XWSA 4TMTA 4D9HA 4DSZA 4DPKA 1OT5A 4C7OB 4J16A 3CS3A 4LRQA 2R1VB 4EHKA 5B12A 1H94A 2DCMA 1I6LA 3DQQA 2D5IA 2E5WA 4HFMA 4R2WA 3VSEA 3SQXA 5GM2A 3LUKA 4E1BA 3IMKA 3V2GA 5FIUA 3UWMA 1BMDA 5KU1A 4FOPA 1VI6A 1G4HA 2AFIE 4PIPA 3D1JA 1DULA 2ZJOA 5FTLA 1XCOA 4DB2A 3QX7A 4NNJA 5IC5A 3RDPA 2ZVQX 3LI2A 3A1FA 1S96A 4ITVA 1N7IA 2GNPA 2EG5A 1V7QA 4WT7A 1M2WA 3D8BA 5CVEA 5KOIA 4OY3A 5DHTA 5WRFA 2ORYA 3U4IA 4RL4A 4B7ZA 2QBYB 1WJGA 1X7XA 2FUEA 4G0XA 2QG6A 3M4XA 2C8JA 1NUAA 3HXQA 1SFRA 4DRXB 1QVWA 1L7VC 1ORHA 3NBUA 4Z4GA 1LMB3 2O3SA 3FTNA 3GROA 1RM5A 4KRGA 2ZE8A 1JFSA 2OG2A 2OCYC 4TSKA 4UBKA 4GBED 3FWPA 5C4GB 2PXHA 3C3PA 1RYMA 4IJ5A 2J9YB 3R9XA 2RBKA 5H3CA 2I2DA 1QQAA 4IIYA 5TQVA 2PLWA 1JFFB 2KZ8A 4JKOA 3IO5A 3SI7A 3M6IA 2YMQA 5DFAA 3KOUA 4J0HA 1LH0A 3JXDL 4X45A 2XB6A 1S02A 2WILA 1BCRB 1KQOA 1NJ6A 2FSIA 1QQ6A 1U1EA 3KR2A 1ZWKA 4J1SA 1CS0A 1UBTS 1R63A 2GVNA 1WMSA 1JJ7A 3FUXA 3ZH2A 4J7UA 5GJWC 2VYQA 2Q7DA 1CJCA 2CDNA 1ZN2A 4NHEA 2O8BB 2EHDA 3FTFA 1W85A 2JAQA 4AN4A 3G2NA 4DCMA 1YQWA 1OB5A 4GUDA 3U49A 4O4JF 3OC0A 3RHFA 3ZHZA 1G16A 3KYCB 3UJCA 3QKRB 5TMBA 2ZYHA 4K03A 1QHHA 3ZGNA 1J8FA 5KSOA 2JCSA 3QVKA 3QXXA 4JR1A 1G19A 1L4KA 1VFPA 3BMQB 2XW6A 3GC6A 3UK1A 4C03A 2DHEA 3IEKA 4EARA 4U2KA 721PA 1KO4A 1KZ7B 3KNZA 3N3BC 3U60B 3DMPA 2OESA 2C4VA 2ZP1A 2G9ZA 3BE8A 2P0AA 3NOOA 4LC0A 3QF7A 1HYQA 1TZJA 2ZKIA 2O1WA 3E9NA 2OSVA 1MFZA 4RHUA 3VSAA 1XOIA 4FVTA 4JP2A 1RCFA 4QTTB 1KIAA 1NP7A 2HF8A 2JGIA 1G3UA 1YJAA 4I1SA 4DIDA 3OC6A 1NI3A 2KLBA 2HHCA 2OHGA 2IK8A 4JA0A 4A6XA 3ZBPA 3AF4A 4LJLA 2BGUA 1UBRS 4BP1A 1I36A 1ZN9A 3JQFC 4OMFG 2RK4A 3SZOA 1JAZA 3FRIA 4QU9A 3W5JA 1CIVA 1D5WA 1VE9A 1BHSA 1EFKA 1HZJA 1NUTA 3EVGA 3F8WA 4XYMA 5GONF 3MCUA 3FDZA 1CQJA 1RAFA 3N39C 5AVWA 1EEXB 2AN4A 2RDMA 5HXAA 3U5TA 5TPZA 4AFNA 3BT7A 3MWYW 1SY7A 4NBVA 1Q0LA 2GRMA 2Y66A 1O6BA 3KV1A 3TBKA 4CL8A 7AT1A 3GLIB 4YCAA 1FSZA 4BVGA 1QVRA 3KWFA 1WXIA 1XRQA 2G07A 2IHTA 2A7XA 2A86A 4L3VA 3PD1A 1K4YA 4CCAA 3DW3X 3EVZA 3OF3A 3FLAA 5FJJA 4DCPA 3VPSA 4WV3A 4RD4A 3D4BA 4IJMA 4G0UA 1XCJA 1PWZA 1QG4A 2AFVA 3LK7A 2OBLA 2QD5A 4WXHA 3P97A 5IM4F 3QSYA 1OFHA 1E7SA 1GRNA 1HDGO 2M6SA 5BOSA 3MYYA 3GPIA 4NENB 3ZLTA 4D9KA 1WU7A 2BLNA 2X1MA 1G8AA 1VMDA 1BWQA 2W4MA 3H5OA 1D04A 3JD1A 3N28A 5HPYB 3DLCA 2IYPA 3B7PA 3ICQB 3KLBA 3CNHA 4HX5A 1ISMA 1FYVA 5IDVA 1B8NA 1XRPA 2VOJA 3U7QA 5DGDA 1ZS9A 5H9VA 4WZBA 2CBGA 3PGXA 4HADA 4OYHA 1S5PA 4LHWA 4M8SA 4MDHA 3KYIB 5G40A 5ICCA 1AQIA 1L7RA 1NPTO 5GONB 3C3KA 2VZ8A 4H4EA 1TTPB 4U6SA 4DLTA 2ZXEA 2JGLA 4LOJA 4TLLB 3EQ6A 2AI1A 3LFUA 4K05A 3ST7A 2DPGA 1YQXA 1OX5A 2XYQA 2Q4OA 2ZB4A 3AFNA 4EDFA 4MCHA 1Q22A 4BYGA 1EFVA 5KYYB 3CX3A 5TR9A 4G41A 3ICEA 2VDNB 1PVOA 4KDRA 2YY6A 3PXDA 1QO0D 1A8SA 1G1MA 5FL7A 3D3EA 5IYZF 3UKJA 2KYRA 1G8GA 3A6FA 4D9NA 2JLSA 3QLVA 4ITUA 4K86A 1B43A 1ZA1A 5JNWA 4OKSA 2Y0BA 1XNHA 3LGXA 5BQXA 1AF7A 1XD2B 2W93A 3CYFA 4NP6A 5AUQA 3SDSA 1GFZA 2XCSB 4XD7A 4L2IB 1XLUA 4BUZA 2APJA 4PZEA 3GFBA 4CQLA 3K2BA 2XGGA 4K9QA 4PC7A 3FVVA 3M4YA 2EJUA 4TTJA 2FQQA 4FXPA 1YBVA 2I22A 3PPWA 4FFDA 4Y9UA 5F52A 5CFOA 4C29A 3J7AC 4B6QA 4QOGA 5KAMA 2GYYA 1EQUA 5U9CA 1EDDA 4ENRA 5TS2A 3STVA 5BR8B 2AKAB 5BN3B 4FFWA 1JEQA 4CV0A 5EZYF 3K35A 4QUIA 4HP8A 3ZNOA 5LQDA 4JYBA 4GXTA 5AM5A 1EH5A 1L4LA 1WR8A 2DGDA 2G72A 3K1ZA 2A57A 3HO8A 2D59A 4FFSA 2D2FA 2FSVC 2OLKA 4PS1A 4CTNA 5D5PA 4RVUA 5IHXA 3O8CA 1H2AS 1Q7RA 3P27A 5EMMA 3X43A 1J9ZA 2Y4OA 4IIDA 1OTHA 3EGCA 3U31A 1SVMA 2QTLA 2NSJA 4M4SA 2BEVB 5DU2A 2HTFA 5JCJD 5DWVA 5K0GA 3VR6A 4LDJA 1V4VA 4LISA 2L17A 3RBAA 1ABBA 1V7CA 5ALOA 5JXHA 2M1XA 1LQ2A 2PXFA 1XX6A 3EUEA 3GT3A 4F2WA 4KAJA 2FRDC 4A8JC 3EUSA 2YOHA 4GECA 2JKZA 3WB9A 2RCNA 5IASA 3D4IA 3WGZA 4YCLA 2C1EA 1E2LA 1EGQA 3Q87B 4E5VA 3BA6A 1O57A 1JZTA 5LOVA 2GZAA 3KDSE 1SHKA 4PXAA 1ZUD1 1FPQA 2IY8A 1GZHB 4J94A 4NCNA 3UQZA 2VPWA 4XM2A 3IPLA 1VMIA 1WB5A 1E8MA 3JQAB 3TZCA 3ZDBA 1N33B 2PZAA 4GBJA 1LLDA 2ZYAA 3SYKA 2V97A 3PX7A 3I01A 1SPXA 2VDKB 2XUDA 4HNGA 2FSFA 1XZBA 1II8B 5HKOA 1U4OA 1H66A 2AR0A 3I5MA 1MC8A 2VO1A 4YWHA 1NOKA 3DV0A 4HYQA 2GZRA 5IBRA 2JPDA 4OB4A 3VZDA 2GILA 4NBNA 2A9JA 1U81A 5GVSA 3UA3A 1X2BA 2P2DA 2XDYA 4UAVA 4D02A 4CXMA 5HGXA 2XUHA 4K9NA 2Z2IA 4BQFA 6GPBA 4HB3A 1RLOA 1DMRA 2BR5A 4D9FA 2IEAA 5DWDA 1B1AA 1JLLA 5FV4A 3HKDA 3TTSA 1PUXA 1XZIA 2ZI3A 2BTEA 3NWJA 5B1DA 4V38A 2O8DB 4K9RA 3KTOA 4X8HA 4MIYA 1U28C 3VGJA 2QTRA 1A8PA 2JZCA 3PNMA 5DV9A 1ZNZA 2E4ZA 4BX8A 3DAHA 1SXIA 3OEHD 3UG7A 4P7BA 4CVNA 3VM6A 2P35A 4KACA 1PK8A 3FY4A 5HKAA 5JDCA 4J6FA 4TSFD 2CXRA 2TMGA 5CFMA 5J5VA 4OXNA 1K3FA 2FR0A 1XTJA 4UTZA 3EXIB 2A59A 5K0CA 3EIQA 1L1RA 3NGMA 5EY5B 4Y9TA 1DC6A 2H6EA 3EXFB 3LT0A 2HREA 4ZWNA 3VX4A 5L7WA 2JLYA 3AR8A 3KQKA 3BCUA 1LD3A 1RYDA 4CM9A 1POXA 2GM3A 3PP8A 2O8FA 2PX8A 3AB3A 2BH9A 1SN7A 4TV8F 4Y2SA 2QM0A 4DARA 5KTMA 3AL3A 2WAMA 1O3YA 1P9RA 1ZM9A 1P9NA 3LVRE 4Y9SA 3QF3A 2FP4A 1ORDA 4LVNA 4YCNA 4ES6A 3PNVA 4JBNA 1MHTA 1FLDA 2XYRA 1GRRA 4D9IA 4WNIA 2IS2A 1YZVA 4P2GA 1RHUA 3ID6C 3UNXA 1FDOA 1S3SA 1TKAA 2Q0QA 1TCVA 2JGAA 1Z38A 4LJYA 1NJFA 5KJFA 2OXRA 1AN0A 4FSXA 4QUEA 4Z4IA 3VUFA 1G55A 1B26A 2HO5A 3HDJA 5BSEA 4R4JA 3ZNNA 1JG7A 2VWHA 1O9HA 4MLZA 3WYCA 1KMNA 2OR1L 1NVVQ 1JA9A 3A6EA 5DBOA 3M49A 3VKWA 4CLRA 2KQUA 1FFAA 5J2UF 1DBVO 2E4UA 5AW4A 3ROEA 1IUNA 3AOGA 1NQAO 2ZSDA 4QFCA 1V96A 2HYDA 3R9WA 2B7LA 3EQ7A 1ORRA 3ROQA 2J3QA 3OF2A 1D03A 1C4XA 1W35A 5BWMA 3ICOA 1PL6A 4FJ1A 4M8IA 2G77B 1EP2B 3JQ7A 2HW8A 1GTG1 3OX2A 3PTLA 1PGPA 4M1OA 1V5FA 3GVPA 2OKGA 4M1ZA 4TV9A 2NU9B 3UXMA 3NV9A 2JGRA 3GLIA 1TA4A 5FPHA 3VDQA 3U26A 4DT1A 4LF8B 1LFAA 4BCDA 4YMUA 1VIMA 4CTOA 4UHCA 1Q7BA 2VAWA 4EO4A 1O08A 3KUXA 2JEOA 1E96A 3PXXA 2CZCA 4OKNA 2ZIUB 1EWTA 2EW1A 1WMAA 3O4RA 4OQXA 1JB9A 2E6KA 2V1XA 4NSNA 4DMMA 1KYXA 3LLUA 4AY3A 3KKZA 5EZ5A 1T8UA 2V4UA 4E12A 3DDOA 2JFGA 3GPCA 1YSCA 4CT5A 4B80A 1HQ1A 1RTTA 5GOTA 1QG2A 3NPAA 1FRNA 1VLQA 2OHIA 1IMJA 3LLSA 1Y8QA 1A04A 1I2CA 1TKRA 1PX0A 1T3SA 3QYPA 4L4RA 3KJQA 4MLDA 4G0VA 3SFZA 4E2FA 4COOA 1ZZBA 4CM8B 2OFYA 1GEGA 3RVPA 2WOOA 3EDCA 4KO2S 3UC9A 1NN1A 2W71A 3LOUA 2BFNA 4Q3AA 4MHOA 1C7QA 5CW2A 2FZKA 1RJDA 4H27A 1DADA 3KUUA 2PZMA 4LDRA 4BKOA 1E2UA 1T8WA 2ZPUA 2ZWOA 3AY3A 1U28A 1UM9B 5JSKA 3SM3A 5CG2A 3ENNA 3SS8A 1IQRA 1LPPA 1F0NA 1GZSA 2R5FA 4PZPA 1K7YA 3SCZA 2YZ7A 4R6WA 3G7DA 2FCAA 4KYTA 5EMHA 5CITA 1CULC 5AM2A 1KTIA 4KHPB 3LWZA 3ZN2A 3DKVA 1PS8A 3BFKA 1R12A 2H2GA 3CO0S 4KGXA 5FBLB 4A0FA 4RETA 3Q12A 2GUWA 4AWBA 3FKSA 3KT0A 5CYGA 5I7UA 3WHPA 2YXNA 1LTKA 1JHZA 1J7JA 2Q99A 3HZOA 4YV1A 1C50A 2X19A 3UK7A 1E99A 1NJ5A 3LUJA 3A1UA 1XAJA 3SJCA 3RG2A 4NK5A 1BCSA 2ONJA 4UC0A 2OZVA 2NSLA 4E09A 2G67A 2H2AA 4GBGA 2Q9AA 1QONA 3IBYA 2FUKA 1E4YA 2JFHA 1WUTA 2RARA 2H29A 4RQBA 3RU9A 4MUAA 2WF8A 4J7AA 4LY6A 3FKSD 5CHYA 5H1YA 4D9BA 2ZTMA 1O1YA 5IAEA 1TRHA 4DBLC 4MMXB 3PSHA 4KFRA 2XJ4A 4GYKA 3L1VA 5HKLA 2LDXA 1OF1A 1HFKA 2C3MA 2IX3A 4DEXA 4L6CA 4JBGA 1F51E 1DTWA 2AN9A 4JXXA 2JGKA 4P2BA 4QPDA 4RGBA 4E08A 4GEGA 4HHEA 3EEIA 2G1KA 1DX9A 1JSZA 5A1JA 5LZ4A 2ZUCA 1UKAA 2P2NA 1GFSA 4DR1B 2HCFA 4BFVA 3LYLA 4P3OA 4PBSA 3V4FA 5ES4B 2W2TA 3AKEA 4NPAA 1YFZA 3T1VA 2QE6A 2AD1A 2PHZA 3H4IA 3LUPA 2PT5A 3PF9A 4FMPA 1EM8A 3H9QA 5EKDA 4QBTA 1QHHB 3ZW7A 5ESXA 1U3GA 3WDSA 4LCBA 1KL7A 4IHAA 5EIBC 2PGNA 3HCCA 3P0EA 2FOXA 3N2EA 3QRWA 3EIOA 3W3AH 1LBEA 4WOBA 4IFIA 1VHWA 3JXEA 3D8NA 2GNOA 5IKPA 2H1SA 2DB3A 4B4DA 4MJ3A 5E2BA 3GOQA 1GGFA 3TNYA 2O59A 3DT8A 5E95A 4PRKA 4ZJZA 1U8ZA 1JH8A 1UEXC 2VPPA 1EP3B 3NAQA 4C3ZA 2CXNA 1IONA 2QTFA 4QJIA 4CMHA 3SC2A 5BSKA 3LVBA 3FNFA 4ZCRA 2F55A 2ODNA 3HZRA 4OHVA 3G89A 2VZEA 3F6SA 3N58A 1XJ5A 1JLMA 1RAIA 1ZMRA 4J1WA 1QM5A 3RVQA 4AP5A 4F2GA 2H4ZA 2ZXFA 4G24A 1SB8A 3WNQA 5I45A 4LSWA 2GEJA 5E8JA 2XUOA 1XKTA 1NX6A 3AMVA 1KEWA 4K2AA 1R0LA 3A2MA 2ZTHA 3RTAA 2YWHA 2J0VA 2IZ5A 2ICAA 2QN6A 1DARA 1LTHR 1QF9A 3P9CA 4L3WA 3V1KA 4F4CA 4DTIA 2VZ0A 1WH8A 3TSCA 2W2PA 1AHIA 1OZHA 1XLTC 3KQHA 3BGWA 4KQXA 3AEZA 2YZGA 1D7OA 2HMSA 3I2GA 2O8FB 3DO6A 1PEDA 2B4AA 2AYXA 1SA0A 2AF4C 2UZ0A 2EATA 3G8YA 3UGTA 2BGKA 1KO7A 3VO9A 4E21A 3WHKA 1JPJA 1TZ2A 2NUPB 4D42A 2Y77A 5J2TA 1RAHA 4J0IA 4RC9A 2POQX 1KMQA 2BBWA 2QR2A 3INNA 4X97A 4Y1GA 5DX8A 2W2LD 3U3RA 5REQB 3A11A 5P8WA 4L16A 2XOKA 1C0LA 3URKA 4GPTA 2E5FA 2BP7A 1S8FA 2VAPA 3NTUA 8GPBA 1NBAA 1N2ZA 5EE1A 5J4KA 4HQNA 3M82A 1RBYA 2JFVA 4X8MA 4UEWA 2XTAA 3TPFA 5LKAA 2NP6A 1D4AA 3CWZA 3RRNA 2XMZA 4IINA 3ZC3A 2F8SA 2VP4A 1UJ5A 1WMFA 3LW8A 4BNVA 4F3CA 3DEKA 2R4UA 3GEIA 3OESA 1AU9A 5J9FA 1HL3A 1NUUA 3CLKA 3D8RA 2FZGA 3UXEA 3RYHB 4D6YA 2DX7A 4ZVPA 3F5FA 4B6JA 1NYRA 4GLOA 3QF4A 4EKYA 3H87A 1RVV1 1OAKA 3MMSA 3QXGA 4XB6B 3JAKA 2IVQA 1Q57A 4MVCA 4R1UA 5H02A 4DY6A 9LDTA 3L06A 4K9DA 1WKBA 4LECA 4AO6A 1BS1A 3L8HA 1CP2A 2CHVA 4FJ0A 4EGAA 2ONYA 1SIWA 1RWQA 2EYUA 4CM3A 3VDRA 3O4VA 4G5XA 1T0BA 3UGQA 1HRDA 3G2HA 2C9YA 3K0AB 1ZUHA 3HNRA 1CU1A 2FX5A 4OHUA 1LSSA 4LDAA 2OV6A 3HN7A 3LU1A 2Q3FA 2BTOA 2YYSA 4IWXA 1PV4A 2R48A 1DHRA 1W6UA 4TV9B 3PNPA 3RSGA 4BNKA 1OSNA 3OU2A 4KXFB 4DLAA 3TJRA 3EHDA 5HOQA 2R7AA 5JARA 1KYTA 1GT0C 1MR3F 1WDLA 4HEHA 5ALVA 1V5IA 3MGKA 5ALYA 4B3RB 1X1DA 4X62B 1DC7A 1UJBA 1P60A 3ZJ5A 1LBTA 3U2QA 4K6MA 3C97A 1QC5B 2GRAA 3DBOB 3IXLA 4WEOA 1JYSA 2HM7A 2LRHA 3BXFA 5B55A 3C39A 3LF1A 3F6EX 2C0QA 3PHHA 3QPUA 5DLYA 1XNGA 1R0ZA 4OHMA 1CHNA 1XQVA 2H2FA 3FJ1A 3P0HA 4PINA 5DHUA 3AUSA 1F0PA 3NT5A 1GGVA 1V8OA 4R9UC 1US8A 1NVFA 2A0XA 2X8WA 3WRVA 5JSHA 1Y4ZA 5KSPA 3JPYA 4OYYA 3V7NA 3N1UA 4E94A 2DSTA 1N8NA 2HC9A 2JBAB 3ZJTA 1LLIA 1JMYA 3AESA 1AS3A 3UBTA 1T2FA 2A1UA 4QO8A 3HBLA 3DLPX 1IYZA 1I7LA 3L40A 3GZDA 2ZTLA 4MRMA 4BZQA 2AW5A 1A96A 3TOVA 4X1YA 5ADUS 4V0LA 2QRMA 4BGUA 4HQRA 3R75A 4AN1A 5BT8A 5CA1B 3GDFA 4XE5A 1ODSA 2PGJA 1DUIA 3AWIA 4QXMA 3AYZB 3MJHA 2PSFA 2X1HA 3IIIA 2R8RA 1L4GA 3PUIA 2B69A 3ETJA 2C8KA 3AR2A 2IYSA 1DAFA 2EIHA 3FNHA 3KKMA 2QPAA 3OOEA 3B1XA 4NE2A 1PWHA 1JLKA 1VM6A 4S1PA 2EBUA 1QS0A 3QQ5A 4FZRA 4UHHA 5LQCA 2NU6B 1SBIA 3B89A 2RGRA 5K2OA 3AONB 1IXKA 5CT9A 4CKBB 2YUIA 1N2XA 1X15A 4LYDA 1VBFA 4MPPA 4MYTA 4Q3BA 4IXTA 3IUJA 4R84A 3QQPA 1Z7YA 1N2CA 2G5PA 1UF9A 3ZBTA 1OYVA 2YHUA 1C9MA 4NOLA 4S24A 2ENWA 1ISJA 1NL3A 3QQ6A 3ABIA 3G5MA 3KZOA 3L1JA 2IYZA 3IQFA 2JVLA 4BO5A 3GLTA 4C4SA 2R1ZA 2H16A 2AYYA 4PRZA 4X6XA 3JXBC 2C9MA 2QMQA 1RQ7A 3FYAA 1WVMA 4XDZA 5THXA 2KPJA 1Y8AA 4QRIA 4K0KB 3ZQJA 5HEKA 4Y2GA 4US1R 2O8DA 3HM9A 1Q83A 4UHFA 3SC3A 1W94A 2A1UB 2IXGA 2X14A 4OA8A 1GHTA 5L53A 1M34B 3KVYA 4BRZA 4B3IA 5EZQA 5ED4A 2J87A 3V1UA 3A36A 2PQ6A 2PXPA 1EGMB 3F9RA 3NP7A 3SJZA 4ER5A 1KS2A 1MV5A 1RZ3A 1Q0RA 1P18A 2ISQA 2AOUA 2FPIA 2Q2NA 3N8GA 1PU2A 1WZUA 2HWYA 1XZKA 2NN3C 2ZLBA 1GXSB 2ZBDA 4ZP1A 4AO8A 1KY4A 3AF0A 3PQ3A 4UZFA 1M1UA 4FOSA 5D5QA 1GDHA 3CIOA 4C2UA 3G23A 4L72A 4RVCA 4NJEA 5FTKA 4DM3A 1W7AA 2EFCB 6Q21A 3QJGA 4BVBA 2F4NA 4JJZA 3ZHUA 4XRRA 1ABEA 3EPLA 1KH1A 5CYPA 2ONCA 3P2EA 2RH4A 3S2IA 3I1FA 5K8JB 2Z8XA 1H4VB 2JGFA 4WK2B 4CG0A 1X19A 1N7JA 1A97A 4CT0A 1EUDB 4F4IA 2R7KA 2VTDA 1VZ2A 1G7RA 5DLDA 4FD2A 4QEZA 4WZAE 1CR0A 1N25A 2VRCD 5KDDA 3DJFA 4KQ6A 4U7FA 4WK6A 2VQ6A 4EMTA 2PS3A 3HV0A 2AX4A 4ICIA 4MZDA 1DQYA 4CM1A 5IDXA 5EXSA 3PB3A 3K9BA 1T36A 3E8XA 4JB0A 1UXKA 1SUIA 1WUKS 4HL6A 3O47A 4M9UA 1DAOA 1W0CA 3SDZA 1A77A 3LBNA 3E3MA 3V42A 4O8BA 1WD7A 4BVHA 1MZPA 3NIGB 3BBPA 1BO6A 1C0EA 1ADYA 5DO9A 1AZLA 2QAGC 1YBHA 2BGTA 4EKEA 1F6DA 4M87A 2G5CA 1ZLYA 1C41A 1ESDA 1FFGA 1C30B 2EDAA 2OP1A 3FE2A 2PZLA 3G5AA 1IY1A 1JSXA 2PZGA 2I7TA 3BSYA 3CSUA 3HABA 4QG7A 4C7VA 4LTMA 2G8NA 3IH5A 3N05A 3QFRA 4JLBA 4CFYA 1L8AA 3UC5A 4QTYA 1FFDA 4NKRA 5JXWA 3PHIA 3HADA 4NCIA 4PSUA 3K0FB 1Q1BA 4QDXA 1NMYA 1Q74A 1JE1A 3FYDA 2AD5A 3AEQA 4YMIA 5C8YA 4WINA 2PZ8A 4MWEA 3RUEA 2JAXA 1E6KA 1Y82A 4D6PA 2Q3JA 3OKAA 3AUAA 2EZ9A 1Z2PX 3OEWA 4HJRA 4QPZA 4GOND 3UW1A 4CKCB 1H22A 3P96A 1IB6A 3Q3CA 1MOQA 1W29A 2A78A 1H42A 3OPXA 4RNDB 3WL8A 1VKZA 3CISA 3NXHA 4GL4A 5DTRA 1BDBA 4DMFA 2ZULA 1FU7A 3OIVA 5LYJF 1LB1B 3IAS6 5JAQA 1G5QA 2CVHA 2XLBA 2HQRA 3CZ4A 3DV2A 3E7XA 2PGAA 1Z4IA 4KQMA 3T0FA 1JI0A 4CG2A 5LKRA 4BQIA 4EUNA 1B4DA 4BDSA 1BOFA 4LC1A 1ZCFA 3TR5A 1A9YA 2I29A 4LYGA 5A62A 1Z6TA 1GNLA 1V71A 1B23P 2KPOA 4X6YA 4BAZA 1N36B 3O4FA 3PXPA 2Q29A 1S2MA 2V5VA 3C4JA 3QFHA 1OFUA 5AKGA 1XKLA 3AVWA 1T26A 1D6NA 5AK0A 5EYPA 4Z4QA 1W30A 2D7JA 4H1UA 4JJ4A 3P9QA 2G70A 2VF4X 2VT6A 5DPMA 3THRA 5CFZA 3OZBA 2IYNA 2CK3A 2MYPA 1KAQA 4TTTS 3G3EA 3F5SA 5HE9A 1VGVA 3HCWA 5K4GA 3BFJA 4NJMA 5LQUA 2OQIA 1FXWF 1E1DA 2GBIA 3CF2A 4TSFA 1YE8A 3TECE 3RO7A 4U7GA 5BVGA 4QOFA 2RH8A 5CD1A 2JCGA 5IPFA 1PAUA 4OP1A 3ZGYA 4GD3Q 1CNEA 4JASB 4QJ4A 1ZVKA 2P9TA 1K9SA 3MAJA 4URZR 2ZRKA 3WDKA 4CNQA 3I12A 2AXNA 3AEUB 3ZJ4A 3KHKA 3WLHA 5KI6A 3LPAA 3A9SA 4W1PA 1VFNA 2NU8A 2I4OA 5CU7A 3V8MA 2R00C 3X44A 3ZE9A 4S05A 3ZLJA 4KC0A 4EG6A 1TTHA 3BBLA 3E84A 2UUPA 2WICA 2X0EA 2V55B 1DVRA 3F3MA 3QUAA 2OMKA 3NWOA 1E92A 3M6FA 4G5OA 4MITA 4TWAA 5HBRA 5HG0A 3WA7A 3SLGA 3FWYA 1FA9A 4UDYX 4OM7A 3WFZA 2QRQA 2BSAA 2CUZA 1E59A 3NKFA 4CQMD 4R1LA 3I2JA 5ADHA 4H0NA 3Q41A 1S7CA 4U3JB 1U98A 2WFLB 1BX3A 1XBTA 2O3UA 2ROQA 1GG8A 3BVPA 1OFUX 3VR0A 4PPYA 1P77A 1YDHA 3N8IA 1YHZA 4R0VA 4DM7A 2E4YA 3ONNA 4GOMD 2H1LA 2IHZA 3R0QA 5FADA 3W3AA 2PR7A 3RC7A 2JI6A 3BWEA 4G26A 5CGZA 4A0QA 4KEAA 4CV1A 4CIAA 2XE7A 3VPDA 2REXB 2CFIA 4BBJA 2FVXA 2ONKA 4TQ9A 2X7HA 2BM1A 3F2VA 4MO2A 5GGXA 3MHTA 3T7DA 2QSJA 4GMHA 4CKBA 2H3HA 2WABA 2Y1DA 3U4HA 5EXXA 1C0PA 2QN9A 3AIOA 3K96A 3RSZA 5G3YA 1NRIA 2I3BA 3FIJA 5JNTA 3Q5EA 1ZVJA 3GFQA 1Y33E 1P6XA 4WGFA 1A3CA 4HAZA 3OIWA 1Q0UA 3LF2A 4EPVA 5GZ3A 1LX7A 2VP9A 4ALKA 1EM8B 2QYSA 2C3PA 4Z9FA 2GBCA 1JA1A 3L4SO 3OICA 4KQCA 4C4YA 4G4SO 2XKBA 2OHJA 3JAWA 3ZIDA 2EKLA 4K0RA 4QOEA 2FPSA 3GLHA 1L2TA 4R0MA 1Y9EA 4UE2A 5AI9A 1GZ5A 1P2FA 1X7GA 3HZIB 1T13A 2H17A 3TFQA 2OO5A 4QT4A 1HQYE 1NU8A 5I5GA 3K9QO 2NVWA 1LSJA 2HPHA 1RIOA 2BONA 2FSSA 2JA2A 2NTVA 3EE6A 4RY0A 1ZNWA 2CL0X 2NVUA 4K28A 4N0QA 3EUWA 5DTIA 5MFZA 1E6EA 3BDAA 4OI1A 2R86A 1ODJA 3ZG6A 3GDHA 3Q0IA 3ETHA 1WW8A 4PO8A 4TKUB 1N7GA 2DTXA 2WWXA 2J9ZB 2HQOA 1QBGA 2QHXA 2CYAA 1FBTA 3GLFE 3A70A 3GA7A 4WSOA 1XO1A 1T9GS 3CSSA 1H8ED 1HKHA 1T2NA 4D9JA 4M0UA 2G1PA 1IRIA 2TECE 2X8AA 3H04A 1X3SA 4EKGA 2ODRD 1ZAKA 3SZUA 2Q49A 2NTNA 4TYQA 4X5OA 5LIRA 3FPBA 1VJCA 4N5IX 3MUFA 3MK31 4IX1A 1EFCA 2FMFA 1GCIA 1T5IA 3AOEC 4JBIA 4QUBA 3VPBA 3KZNA 3ZU6A 2FFBA 2E85A 3L49A 4Y6GB 5CLHA 1XN1A 3SHOA 5IX8A 1Z68A 3WMXA 2KE5A 2QX9A 3DOFA 1MBZA 3FVWA 1XN4A 2JJMA 3LX5A 1XKXA 4UAJA 2IXFA 3IOCA 3G2PA 2R6GA 4OP3A 1R7RA 1NWHA 2J7UA 4ZT6A 2HXGA 1YR9A 5E4YA 1T1SA 3V1NA 4P31A 1AK1A 5JXGA 2YOFA 1EG7A 2BEWA 3EJWA 3NVMB 4HWOA 3VYSB 2UZIR 3CKLA 1E89A 3B6JA 4G07A 3QKTA 4H3KB 2RIPA 1A0OA 1RBZA 3MN1A 2ZJ2A 5LXTA 3E15A 3JAKB 1YU6A 2QTHA 3IJ5A 2NV2B 1XNQB 1QRDA 1VJ5A 1XDWA 1XJCA 4KPYA 4ILKA 4ZEVA 4YLEA 3WWYA 1TM7E 5KWJA 4BQOA 2Q1YA 2PL3A 1JXAA 3C1TA 3U0BA 4B7XA 2WUSR 3I1YA 3AM5A 4MI3A 1A1VA 3Q3GE 4HB0A 2G4VA 3PC2A 5AWFC 3HWWA 3KT8A 3MBIA 4OGWA 2PMBA 4ZOEA 1OH6A 3AVUA 3PD7A 4UHDA 2OCXA 4OAPA 1MO5A 3LD9A 5U4QA 1VLJA 1WF6A 4YARA 1PR4A 5LZ2A 3C8UA 4M49A 2G40A 4B3MB 3UJHA 3QUTA 1VBKA 5DMXA 5SYMA 4NK4A 2IZ0A 4NIMA 3M83A 2JD1A 4QYMA 4RPJA 4DV5B 2BI4A 1AKVA 1IAQA 3L5KA 3LISA 5TARA 4H6VA 3ZHCA 2C7VA 1POUA 3DE2X 5HTOA 4X41A 2RG7A 5KNCA 4EYOA 2J6IA 1JLSA 3DBLB 3T35A 5F1KA 4ARUA 1W73A 3MGGA 4LOKA 2EEZA 1ZZ7A 1DP4A 4IXDA 5DXJA 3PC7A 5F4BA 2R1VA 3NATA 4BO2A 1I80A 1XWFA 9LDBA 5I7OA 3H97A 2YN2A 5G0TA 3ENWA 2OAGA 3B6EA 4KMOA 1K6IA 1PYOA 2ZUFA 1TAUA 4M9QA 3FOWA 1T5LA 4FZ3A 4GHWA 4PE5B 1QX4A 1RYBA 2WTXA 2F59A 5U1PA 4BC1A 1C1DA 1WBBA 3JZIA 4MWZA 1FUKA 1YD7A 5DYGA 3DO8A 4JI6B 3S7ZA 4BNUA 4DQDA 5KTNA 1U0LA 2O4CA 3MD9A 4HVAA 2PO7A 4PYLA 4GWLA 5HR5A 2B8JA 1MB3A 2J8ZA 4MH0R 1QGED 1J9EA 4W7IA 4CE6A 1RM4A 2I8CA 2WOJA 5K8TA 2B1JA 3S99A 4RVGA 2IHJA 1FLVA 3D02A 4PPNA 3JD2A 1JQ5A 3EIUA 5JPCA 2ZI6A 2KS6A 4ZKEA 2JZNA 2A1IA 1JHXA 4RMJA 5DNEA 1KZ1A 4Y6LA 5TJ9A 2A9QA 3RV3A 3VHXA 2D0DA 4IKOA 1W88A 2DFNA 1F6BA 5GGYA 1U3VA 4Y6OA 5KCMA 4MR8B 2ZETA 2HH9A 3RKSA 1PDOA 1SBCA 4EIWA 1CY1A 1MAUA 4KV9A 3UCEA 4W8OA 5FWXA 3ZH9B 1SRQA 2O23A 2PBRA 2N46A 1M76A 4R6XA 4DJFC 3A28A 5A7HA 1MVLA 2A94A 4GQBA 2PRSA 1I32A 1WMBA 2RHBA 3AGQA 2F8MA 4GZMA 4ND7A 4DJEC 4MYSA 1CDDA 3ME5A 3HY6A 4M86A 4HTAA 1NDUA 5ALXA 3RUPA 4FMCF 5KYKA 2YVKA 2XXAB 5FPKA 1PRYA 3BS4A 1V3QE 3QTBA 2OORA 3VR5A 4N8DA 1LJUA 3MMXA 3E9RA 3GL9A 4MGEA 4BKUA 2R2AA 1XVIA 1YNOA 2XAUA 5EJ5A 2I4TA 2K6GA 2A33A 1TIKA 1CB0A 2NXCA 1BH2A 5ENVA 4CMEC 1NWCA 2NO0A 4PANA 4BS9A 3OURA 4R81A 3GEDA 4UBJA 4RFVA 3QTTA 4EG1A 4B4UA 5I7HA 3RAJA 2AC7A 4TOIA 5EP3A 2BYTA 3RANA 3SX0A 3OIGA 4XQ0A 1BA3A 1YZTA 1Z0DA 2CCKA 4RMNA 1L8XA 1I2DA 2IPMA 2XNCA 3T38A 1IBMB 1MJFA 2C83A 4KGDA 2XTJA 1EUDA 1NVWQ 1YS2X 3IURA 1H5UA 2WD9A 4NYIR 4PBTA 2NZ8A 2A0UA 3INYA 1I5RA 3AEXA 3Q6NA 4KXLA 3KWLA 4FN4A 3DWFA 2XVYA 3JAWB 1RJFA 3WKBA 2YYAA 5CH5A 4PFQA 4K6FA 3VISA 2BM8A 2GZSA 4DCNA 4EPXA 5A06A 3ZZ0A 3MAGA 4X4FA 1ISIA 1NRWA 4Q9HA 1E2EA 3WYEA 2ZUBA 2O0KA 3K0HA 1JKJB 1X7WA 4P22A 2P3SA 3ESXA 2X9LA 4PTZA 4RSRA 5MGBA 1V5EA 2AI3A 5L6LB 2OOKA 4RW0A 2ZGVA 2H65A 1ZHHA 3ZWWA 1ZEJA 3ONFA 4J1TA 3GRKA 4M6WB 4YJKA 3F0TA 3GXBA 3HSYA 3CF4A 3OM0A 3V9PA 5A3JA 1EXWA 4NQZA 4DR4B 1PSDA 2UYQA 4B73A 2PGOA 3AI1A 2R25B 1RLJA 1V6CA 5CB8A 2FA9A 3KR0A 2XCTB 2VATA 1UMCA 4I5FA 1LSOA 4M88A 4LJRA 2IOFA 2VP5A 4B4OA 3VNSA 3C7CB 2LYRA 1OXKB 3SDBA 3RV4A 1E3SA 3HQ4O 3W4IA 5K3FB 3HFJA 3EVAA 3KPUA 2ICTA 2QTNA 1WHSB 1U2GA 4RABA 1WVIA 2WTBA 3K9GA 3M6LA 1L5HA 2LZ0A 4AS3A 4QJ3A 5BYKA 4QRDA 4EG3A 4FFVA 4O4IB 3ZHTA 1N77A 3ZE6A 2J07A 4KR9A 3NP9A 3Q0EA 2C03A 1GFIA 2D5AA 1CIPA 4CIXA 4E2WA 4JT8A 3RKRA 2WUDA 4HEA6 4IHKA 1SXGA 1XXHE 4OBEA 1VHQA 4JI2B 4CKCA 4ND8B 3RIHA 2QJOA 5TLSA 1IY8A 2XRYA 1HFEL 3E0XA 1SQSA 1J39A 2YR0A 1ODFA 3FUCA 3H7AA 3LUFA 3VYTB 5CDUA 4JOCA 3TQHA 2QAJA 5LXTF 1TZMA 5LYJB 1KYVA 1E60A 1ENYA 1ZHFA 2P90A 3LKVA 3OHSX 2EKZA 4CMIA 2FHPA 2Q6LA 4IDOA 1O2DA 3FOCA 4JXZA 3IT3A 3W9YA 1KMIY 2CD7A 2VLBA 4GLLA 2CJYA 3BWVA 5T3UA 2FPXA 4LDZA 1PNVA 2PS0A 5C35A 4P0TA 1GZ7A 1MV8A 2BUAA 1W19A 2BDUA 2Y1GA 3A1EA 3JD0A 4J9UE 2VP6A 4QBKA 5L51A 3ZHIA 3NC0C 1GT6A 3E03A 4CCYA 1SKBA 3W77A 4K6GA 2FN4A 4OBWA 2WJ4A 3NIDB 4BRSA 1LI5A 1H9AA 2DKNA 4KR6A 2D5VA 1VPDA 4W6ZA 2WSYB 1OGYA 3BD6A 1A7UA 1BW9A 5GJVC 5H16A 2ZYTX 2CXOA 3FRJA 3SVLA 1QFJA 1KPGA 4XEHA 4W1SA 4GR5A 3CROL 1MA0A 1E0SA 1TNDA 3QVJA 4CF6A 3CUWA 4OHOA 2UUBB 4PC2A 2PV7A 3DWIA 4PTLA 1A4UA 3R6TA 4GT1A 3MTJA 5FLEX 1Z0UA 5DNUA 3QPVA 2IU4A 4DY4A 3UUWA 4CBVA 1NYTA 4E32A 2BI7A 3WOHA 2EBHX 4MR9B 1KVRA 1YB1A 2DOKA 1AGXA 1JEYB 3TZKA 4B3TB 4PHTA 3C3CA 4ZCPA 1YOVB 4CLDA 1IVSA 2RHMA 2O7NA 3M81A 4UOZA 2FFJA 5ESWA 3VRHA 1C8KA 2GO1A 4BBAA 4LBWA 2YWFA 3VQTA 4G86A 4HXGA 4WLEA 5IVDA 3QITA 4E13A 5AVXA 3O8DA 1UPFA 1NW3A 4B32A 4MUHA 1J9GA 1R6BX 4ZVSA 1FFSA 5JR3A 2PRKA 2YWJA 4YP9A 3V4OA 2JLXA 2GVDC 5DK6A 4ZVOA 3IEIA 4M98A 4W9MC 4OIMA 3UB3A 3SIRA 4IS3A 3OTWA 2HT6A 2N1BA 1LVUA 3NASA 5DISB 4F45A 4EY7A 1DLIA 3RQIA 1I7DA 4X4CA 4B6OA 1U8CB 1J42A 3C8DA 5TNXA 4AW9A 5JXJA 1Y8CA 1N2CE 1SG0A 3UXHA 2J08A 1WPXA 2X6QA 2X9QA 1E1MA 1QZXA 2ZZNA 3ZD9A 1VYVA 1UFVA 1P4GA 4BATA 1RT9A 4L08A 4XGNA 4HMPA 4ZDJA 1VLHA 4B82A 1JTVA 4QD3A 2Z4SA 3C7AA 4HXYA 4L8FA 5THKA 4B5KA 4XW2A 2Q7XA 2PO5A 1TQ2A 3OHPA 5JATA 1PBNA 3W2EA 2H7CA 1RP1A 2YZKA 3KSRA 4IRUB 3TLGA 4D3YA 2DFKB 3A9TA 1HTBA 3JYOA 1DKMA 4PIVA 2C29D 4QQRA 1UTXA 1UPBA 5CNJA 5F12A 5K3BA 3UYLA 4NMMA 4PZ9A 3D43A 1JMKC 3AU9A 3TSWA 2OZKA 4BRUA 4FLEA 2B8WA 4G5GA 3TVDA 3NWBA 3GLGB 1Y3IA 5LCXA 3OQHA 1MC5A 3OQBA 3C0KA 2Q28A 1ZH6A 2IL1A 2PS1A 3TLMA 2NYUA 2Z6VA 3E3NA 5FWAA 4RIIA 3R7NA 4BO6A 3C6MA 4IJKA 4AICA 5E0KB 1SUWA 2B5VA 2VRCA 3DHWC 1DCFA 2QX4A 2RI6A 3MTEA 4HUJA 3E9DA 6CHYA 1ZPDA 2VPIA 1H69A 3C15C 5CDYA 1L5SA 4JB2A 1ZH0A 1S2NA 1IDN1 2ZT8A 1KAEA 3OP1A 3OZWA 1I3LA 4QGSA 4BB6A 1BXZA 3FDZB 1KC1A 4TN1A 1YK1A 4LV6A 4A16A 4CQNA 4KPUA 1P5FA 5EQTA 4FCVA 1FFBA 3RBXA 1O0SA 1KJJA 4OGFA 3HTXA 3M89A 4J0JA 3JVEA 1BJTA 4O02B 4UHEA 2Z2JA 1S8NA 3TCKA 2H9IA 2EJTA 2YWBA 3LCUA 5HF6A 4BNFA 1UIMA 1NG9A 3QEJA 4GX5A 1ZI8A 3UHPA 3WGUA 3A31A 2R4TA 5TT0A 3CO5A 1VJRA 2ZDGA 3ETCA 4UMVA 3AZPA 1ODLA 2J45A 4M9XA 4F5WA 1UBEA 1OXVA 2WMNB 4OQLA 2G1AA 5LWHA 3TTWA 1IXYA 1D8TA 5LMCA 1Q50A 4N47A 1KAGA 4L5IA 4K9MA 4KWHA 3R09A 5TMDA 2DBRA 3EBOA 4X4BA 4OQFA 3DLTA 4HATA 3NYWA 4V0KA 5KNBD 3FKQA 2IYYA 5K0FA 3K0SA 2YZMA 2DXIA 4LNUA 4F72A 4QREA 3CLCA 4BZXA 1CY7A 1BN6A 3IERA 1YRHA 1XP5A 2MJLA 3LZDA 1NE2A 1R4AA 2FJUA 1KPIA 3BRSA 1XZMA 3B48A 4I81A 4LF9B 4X44A 4WESA 3NUZA 4FOOA 4PYMA 4AYXA 5HA5A 4I6TA 2ID7A 2PLFA 5DX0A 3HEAA 2VOEA 3GJ3A 4UNQA 4D82A 1CZLA 4OXKA 1GAEO 4A0GA 4JCXA 2HF7A 3EC7A 3IDAA 1JFTA 3I42A 4JA2A 4G65A 1BDHA 2A5GA 1HWYA 2YMLA 4L4XA 2FW6A 2PH7A 2Q6OA 3N0WA 3H4TA 1B16A 3M9XA 5KNDH 3DKRA 2NZJA 3LQXA 3O1HB 4K81B 4CN9A 4UMDA 2D5BA 4F1JA 5B5SA 4LF7B 1P2BA 1WWKA 3ZTTA 2H06A 2GEVA 1UK8A 4JSTA 5B3AA 3KHUA 1DBWA 3OWQA 3B12A 2I2XB 1Z6QA 2H2HA 4PGHA 2ACWA 4MVWA 2QQ0A 3AHCA 5A6SB 3ZQUA 1B73A 3K5WA 2X5OA 1PRAA 8ABPA 2XVZA 3PVSA 4DCOA 1P73A 3JQQA 4E5DA 5AKKA 3ZDFA 2FZVA 4N40A 4PZ0A 2NZWA 2WU4A 2Y6UA 3U7RA 2WUGA 4XDYA 1SUDA 2FEPA 3HXLA 1AV7A 3BWCA 1GQSA 3DULA 1HDCA 2XQGA 4LOIA 3V7FA 2VKQA 4G0PA 4LK3A 4ZQCB 1P17A 3R6DA 5CFRA 3QVXA 5FUQA 1SXJA 1YZKA 2QV7A 3HACA 4DLWA 1IUPA 3FMYA 5AW3A 2G09A 4TTRA 5IFKA 2L8NA 1V1MA 5DP1A 2OGZA 1OC4A 2PYDA 3LOPA 3TS1A 4R7TA 3ZKWA 4ALJA 2FG6C 1DBIA 2PUEA 1T43A 4LFBB 1G6OA 1RZRA 1IVYA 1JU9A 2GN1A 2IEIA 2XPCA 1E3EA 2R8XA 3PEEA 4H7IA 3HLTA 3I76A 2WAAA 1ZJ4A 4IIJA 4YRCA 4AD8A 4I8DA 5HSGA 3R5KA 1Z4LA 4HQLA 5IZCA 4MIEA 1T91A 2EQ5A 2ZIXA 5KX5B 2IEBA 2JGEA 3EZYA 4IO1A 3A0UA 4LJ7A 2AB0A 4RORA 3QBEA 4D57A 4QQFA 4B3SB 2XZTA 2I5PO 3UUGA 1X80A 2OBNA 2EF1A 3BX1A 4PLGA 4L6AA 2IODA 2A9PA 2HDOA 2NADA 4IJQA 4IBOA 3OMTA 3RIXA 4AWAA 4PX5A 1JLHA 1K66A 4F9GA 4LC9A 1ST2A 1R6VA 3WWOA 2WVAA 2PSDA 4RM2A 4OFBA 4V0ME 3U3DA 4ADSG 4YCDA 4D80A 1GTL1 2EF8A 1TQ8A 4C4OA 1R74A 1NKSA 2HF2A 3G0TA 1D1QA 3CG4A 3JWIA 4OHWA 3RT7A 1E3OC 2DBVO