4EK9A

Crystal structure of dot1l in complex with epz000004
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
328
structure length
325
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Conformational adaptation drives potent, selective and durable inhibition of the human protein methyltransferase DOT1L.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 99
structure length 325
sequence length 328
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4ek9A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ek9A02
1H1DA 2BH2A 3HCAA 1YZHA 1DL5A 1NBIA 3O31A 5ERGB 5K0FA 3M6XA 1L9KA 3TM4A 4LECA 5EMKA 2GLUA 2AVDA 3ELWA 3KQTA 3SX0A 3HCFA 3KQOA 4LWPA 5F2OA 2HMYB 3P8ZA 1XCLA 3FPFA 2BR3A 2YUIA 3HM2A 2HTEA 3EEYA 3PFGA 1P1CA 1I1NA 2AOUA 5EMMA 1JR4A 5JR3A 4F84A 4AZVA 5IKMA 2ZBPA 3ER9A 3BGIA 1EG2A 1YUBA 1UIRA 3ER8A 4C06A 10MHA 1NE2A 1KPHA 5K0CA 5FUBA 4CTKA 2G8NA 1XDZA 1G38A 3TQSA 5DM1A 3O4FA 4FS8A 4GBED 5C1IA 5DT2A 3THRA 5K8VA 1RJFA 2ZULA 3FRHA 2QE6A 4V0QA 3BKXA 2CMGA 3ORHA 4DKJA 2OY0A 4HSGA 3GRVA 5EIFA 5BXYA 4PYNA 3M4XA 5DSXA 1O9GA 3GWZA 2ZFUA 1ZHFA 2P41A 4HC4A 1TW3A 2CL5A 3KU1A 4LWOA 3A7DA 3DLIA 5BP7A 5K0NA 3C0KA 4DQ0A 3HA7A 2AVNA 2HNKA 3B3FA 4RVHA 2PX5A 3KPWA 1G8AA 3P71T 3LCVB 1KHHA 3ME5A 3NWEA 1O9HA 3E05A 3KPYA 1BHJA 4IV8A 5EKXA 5MHTA 3FTEA 3V97A 3OZTA 2ZIEA 3P9CA 2PXXA 4KDRA 4C03A 1N7IA 2Z6QA 4KDCA 2AOWA 4PIMA 5K0JA 3Q7EA 3G8BA 2QYOA 4GC9A 3C6MA 5EVJA 3OE4A 2DULA 5DTQA 2PX2A 3EVZA 3NMUF 1ORIA 3LKZA 5EEGA 4BP1A 1D2GA 5LQCA 3TKYA 1AV6A 4P7JA 2FRXA 1F3LA 4ER7A 2NXNA 3OU7A 1L1EA 1NW8A 4RTNA 3IYLW 3BWMA 3G5TA 2P35A 3A4TA 2OXTA 2GAFA 3P2EA 4FP9A 1XXLA 4QVKA 4E31A 4IV0A 5E8RA 5FTWA 4PCLA 5K09A 4M7RA 4QPNA 1XDSA 3EMBA 5BW4A 1I9GA 3B3JA 2O07A 3UA3A 2C7PA 4QPPA 3KQVA 1X1DA 3HNRA 4C08A 3DOUA 5M5BA 5EMLA 1AQJA 3DULA 1DCTA 1VL5A 2ZTHA 2ESRA 3OFJA 1KPGA 4FSDA 3A27A 3HCCA 4V0RA 3RODA 5HIKA 3LKDA 3UJCA 5KQSA 3LPMA 5CIYA 3GDHA 3FUXA 1G8SA 2Q41A 2AOVA 3GRZA 4YUYA 2E5WA 4RX1A 3C6KA 1KP9A 2R6ZA 3LX6A 1SVUA 5K05A 5EZSA 3I9FA 2P3OA 3IHTA 3LGAA 1IY9A 3KPVA 3FYCA 3G2QA 3GRYA 3EVEA 5G02A 3BKWA 3RW9A 5K01A 3DP7A 3G7UA 4E33A 5LR6A 4XUEA 5KYGA 3PB3A 2BR5A 1WXWA 2AOTA 4PYQA 4PYMA 1QYRA 2CWWA 3G2OA 3MAGA 1VBFA 2PY6A 4FZVA 5CVDA 5EPEA 3CGGA 5FADA 3CCFA 3KR2A 4XCXA 2BR4A 4FSXA 3VSEA 2XVMA 3JWJA 4HGZA 1XTPA 5CVJA 4IKPA 5FHRA 3SXJA 5EEHA 1YZ3A 2AR0A 3GIWA 2ZZMA 1N2XA 4QDJA 4PYJA 2LD4A 5E9QA 1R6AA 5DXAA 3OU2A 1SQFA 4X1OA 2PX8A 2FHPA 5GOZA 5ICCA 3FPGA 5D1HA 3O7WA 3A25A 3UJ6A 4AUKA 2O0LA 3UZUA 3NVMB 2HWKA 3EVDA 3LCUA 3NWBA 2VDVE 2ADMA 5C9ZA 1RI3A 4QVGA 2UYQA 3I53A 2PVCA 1TW2A 3MCZA 1I4WA 3FPHA 4MTLA 3SSMA 1R74A 4OA8A 1YF3A 3M6VA 4KVZA 2NP6A 2O05A 5CUQA 1QAQA 7MHTA 4YUVA 2NXCA 5LQNA 5T67A 4GOMD 3HVIA 2Z6UA 1UWVA 2P40A 1JG3A 1O54A 3KR9A 4E2YA 4QQNA 3LCCA 5F2KA 4ER3A 4R6XA 3C3PA 4RTPA 3CJTA 3TOSA 2ZCJA 3PX2A 3P9IA 3FPEA 2JH9A 3FUWA 3A7EA 5FULA 5DTMA 4DCMA 5E1OA 1NW5A 3B3GA 1YFJA 3R9XB 2B2CA 3DMHA 2FK7A 2PSSA 4QDKA 3BUSA 3NDJA 3CVOA 5ICEA 5CVVA 4H0NA 3G2PA 5EHIA 4MIKA 4M38A 4YV2A 1P39A 4YV0A 1KXZA 3EVFA 3KPUA 1T43A 1AF7A 4KWCA 2C7QA 5H02A 3BZBA 2AOXA 4X63A 3BWCA 2H00A 1SKMA 3E7PA 3GGDA 5DPMA 5FA8A 5FWAA 2VS1A 3SVZA 4CKEA 3GJYA 3SSNA 3DXYA 1NW3A 4K6MA 4HH4A 4X60A 2ORED 5GM1A 3SM3A 3H2BA 1JTFA 2G71A 3A26A 4GOND 5F2NA 4PWYA 2V74B 2IIPA 3P9NA 4DCGA 1RJGA 1JQDA 5GWXA 3MGGA 3KQMA 4OQDA 1JSZA 2ONZA 3Q87B 3G2MA 3I5UA 3R3HA 4HTFA 4IWNA 4LG1A 4M36A 5DLYA 5LQJA 3GO4A 3G8AA 1G6Q1 2JHPA 1FPQA 5GP1A 2G1PA 3P2KA 1L3CA 1RI1A 1M0EA 3SSOA 2G70A 1EQAA 4RV9A 5HEKA 3OE5A 5CCBA 2GPYA 2B25A 3LDGA 1NW7A 2R3SA 4HRAA 3FUUA 3MCTA 1X19A 1SUIA 2ZIGA 4L7VA 1QAOA 4HGYA 4YV1A 1D2HA 5DTRA 2N47A 2OBFA 3BGDA 3TPZA 1RJEA 2ZLBA 5K0LA 3MERA 3FRIA 3HEMA 5HZMA 3V8VA 1SQGA 4YUXA 3L8DA 3BWYA 2NYUA 2I9KA 3QV2A 4ISCA 4DA4A 4XUDA 2ZW9A 3PFHA 2ZVJA 3I64A 2QRVB 3DTNA 1VLMA 4FT4A 4RWZA 4A6DA 5ICGA 5CM2Z 4MHTA 5ICFA 4AX8A 3UBTA 2IFTA 3BGVA 3EVCA 1XVAA 1IM8A 5DX1A 3T7TA 4ER5A 4YMGA 1MJFA 2P1DA 3JWGA 3KQWA 2FYTA 5E2BA 5K03A 5GINE 3PT9A 5E9JA 1JQEA 4RVDA 4C07A 2PBFA 2PJDA 3HCBA 4CKCA 4POOA 3FPJA 3SGLA 1BC5A 3HCDA 3HCEA 1VIDA 3FUVA 2EX4A 3PVCA 2A14A 4PNEA 4FT2A 1WXXA 2IP2A 5EKUA 4CXMA 3EEOA 3KQPA 2UYOA 2VP3A 3NDIA 3M70A 2IBTA 5E2AA 2YQZA 1JQ3A 4GQBA 3T7SA 1F38A 2ZZKA 2P7IA 2NP7A 5HIIA 1XCJA 5LSAA 1G55A 2YX1A 4U7TB 3EVAA 4GC5A 2YXLA 4YUWA 1FP2A 1VP9A 5FA5A 2AOUB 3FYDA 1L3BA 3JWHA 4KRGA 1Z3CA 3KQQA 5B1SA 3EPPA 3CC8A 3AY0A 3HP7A 4PYKA 5DX8A 1MHTA 1XDUA 1NV8A 2UZ4A 5EIWA 2UYCA 5C0OE 2P8JA 5KVAA 1EAMA 2P3LA 2PXAA 4Y2HA 2GH1A 3E23A 2ZWAA 2YTZA 4ZTBA 3OFKA 3S68A 5DWQA 2XYVA 3CKKA 2BZGA 2PKWA 3TMAA 2ZIFA 2ONYA 3UJBA 5HFJA 4ATNA 4BP3A 4KIFA 3DUWA 1JSXA 3E8SA 1VPTA 1ORHA 4QTTB 4R8SA 3PX3A 4KW7A 2PX4A 5P8WA 4E30A 3C3YA 3PLAE 5KQRA 1ZQ9A 3WSTA 5EGSA 3VC1A 2I62A 4MWZA 4AZTA 1BOOA 5E1BA 2GA9A 4EK9A 1R18A 9MHTA 3AJDA 2EFJA 1RJDA 3JWIA 3MTIA 3FTCA 3FUTA 3LDUA 4EVIA 5GIPE 2C7OA 2IGTA 4PGHA 3CJQA 2F8LA 4PINA 4AZWA 3MQ2A 1YB2A 2AS0A 3EGIA 2XBMA 4E2ZA 2YVLA 3IEIA 4F85A 3TFWA 3UJAA 3HA5A 4C04A 2PWPA 1RI2A 1QAMA 3ELDA 2IPXA 3LBYA 4HG2A 1ZGAA 5EMJA 2AN5A 1NW6A 3DMGA 1U2ZA 1VP3A 2P3QA 4EQZA 3KHKA 5EQJB 1DUSA 4X61A 1KYWA 3F4KA 3VC2A 4OA5A 4GF5A 4NECA 3R6TA 2JHCA 2QY6A 3UJ7A 4OQEA 5CVEA 2WA2A 1X1BA 5KS2A 3DR5A 3G5LA 2OO3A 1Q0SA 2CKDA 2ZBQA 5EHGA 5FQNA 5K0GA 8MHTA 2ERCA 1EJ6A 5LQAA 4RTRA 2BM8A 3AXSA 2FK8A 4FGZA 2I6GA 2HR1A 4RVGA 3LBFA 3EGVA 1B42A 4OBWA 2ZBRA 2HV9A 3T7RA 1KPIA 2AN3A 2GB4A 3M6WA 3P9KA 2IH5A 2KW5A 1ZGJA 5DM2A 5GM2A 2OB2A 1OR8A 3KR1A 3SMQA 4BLUA 1HMYA 4P58A 3M33A 3OZSA 5HIJA 3NTVA 2YXEA 5DM0A 5CVUA 3QOXA 2K4MA 4PONA 4ER0A 2YXDA 3UA4A 4YMHA 3EMDA 5LQUA 1TPYA 3BWBA 4UOEA 2CMHA 3KQYA 3B5IA 4GOOD 3I58A 5FWDA 3OPNA 5FCDA 3RIEA 3THSA 3UJ9A 4CTJA 3PS9A 4CWAA 4DMGA 3UJ8A 3GRRA 2B9EA 1AQIA 2GS9A 3UJDA 4DM3A 2BM9A 2AOTB 4QQKA 4BLVA 1UFKA 4G56A 4RTMA 3M6UA 1HNNA 1PJZA 3HA3A 5DM4A 5GIOE 3DLCA 1ZG3A 3EGEA 1VQ1A 4YUZA 1XJ5A 2VZ9A 5D1NA 4FR0A 4C4AA 1INLA 1QANA 1RI4A 4Y30A 1WS6A 3X0DA 2JJQA 2FPOA 3FZGA 5U4XA 5E1DA 4E32A 5DXJA 1SG9A 3HVHA 2B78A 2PT6A 5JUWA 3MB5A 1JG4A 5EC8A 5HOQA 2Y1WA 3P97A 1JTEA 4OX9Y 2VDUE 2B3TA 3KPJA 5K0EA 3BT7A 1Q0TA 2H11A 1QZZA 3P2IA 5LQKA 3BXOA 1FP1D 5CCXA 5DRTA 3LECA 4RTJA 2G72A 2PLWA 4P7FA 3GU3A 3ID6C 1P1BA 4RVFA 4ER6A 5LQRA 4RTKA 4RYLA 3NVKI 2IH4A 1KYZA 1JG2A 2FCAA 3G88A 3SR4A 4GEKA 4MQ4A 4O29A 4Z2YA 4C05A 4PYOA 1WG8A 3GRUA 1WY7A 2OZVA 3OZRA 3TR6A 3CBGA 2WK1A 2YR0A 3MHTA 5E8JA 2Y1XA 5E9WA 3IV6A 3D2LA 5EZQA 5IH3A 4RTLA 4P7KA 2O57A 1V39A 1R8YA 2IDKA 2XYQA 4DF3A 4P7GA 3R24A 3QOWA 3LHDA 4GUAA 2P7HA 1IXKA 1FBNA 2PV0A 3DMFA 4EKGA 4WXHA 2ZZNA 3ERCA 3HTXA 1NBHA 3KKZA 1P91A 2OKCA 1NV9A 3LDFA 4M37A 4RTOA 3KR0A 2IDJA 4GOLD 1KIAA 3FTDA 3GXOA 5FQOA 1ZKDA 4E70A 2OYRA 1RI5A 1VE3A 3ANXA 3TRKA 2VDWA 2DPMA 2IBSA 2JG3A 2V7EA 3DH0A 2EG5A 4PCAA 5DRYA 1D2CA 3TKAA 2PT9A 5K0BA 1M6EX 5DX0A 3U81A 4A6EA 4QTUB 4R6WA 5HILA 2PGXA 1YFLA 1R00A 2UYHA 4PYIA 3AXTA 5T6BA 3LL7A 3ELUA 3UFBA 3PTAA 1G60A 4RSRA 5CD1A 4PYLA 4CKBA 4X41A 4BLWA 3NJRA 2IH2A 2ZWVA 1X1AA 2OB1A 3R0QA 1M6YA 1NKVA 1SUSA 3UWPA 2EJTA 3ELYA 2JH8A 5DSTA 2C7RA 4KIGA 5T64A 4RTSA 3REOA 4EKIA 1R8XA 3OCJA 3OU6A 3TM5A 4B17A 3HVJA 4RTQA 5BW5A 2ZSUA 1KR5A 3K0BA 1NT2A 4E2WA 1WZNA 5EOVA 2O06A 1EIZA 2QM3A 3FTFA 2I7CA 4PGGA 2PWYA 2QRVA 1PRYA 4OBXA 4HTFB 3EVBA 2Z6AA 3AWIA 3G89A 2PXCA 3DXXA 3B89A 3CJRA 1L3IA 3LSTA 1N7JA 2EJUA 3K6RA 5EG5A 5HIMA 4AZSA 3EVGA 2NXJA 3GNLA 3DXZA 4R05A 1EJ0A 2NNWB 4R8RA 3T0IA 4E2XA 1BKYA 2XYRA 3B7PA 3HVKA 5E1MA 4WVLA 3GCZA 3TLJA 2WA1A 3MTEA 4EMSA 2AZTA 2XVAA 4JXJA 4BY9E 4XUCA 2H1RA 3NW9A 5FHQA 2NXEA 2OPBA 3KQSA 4DZRA 1JG1A 1FJXA 1X1CA 4F86A 4PIPA 2JHAA 4U7PB 3VYWA 2AN4A 1Y8CA
chains in the Genus database with same CATH superfamily
2ZKLA 3CUEF 4KFTA 3WKEA 1BHO1 2PXKA 1M5RA 3M6XA 3KTOA 5B3KA 1HSZA 1D3AA 4ZQBA 3IGFA 1L5FA 2BT4A 5MF6A 1EZ4A 2HMYB 2NN3C 1HDCA 1SPBS 1UJ4A 3FPFA 1GUAA 3HM2A 2YFKA 3G5MA 3KAQA 4HNQA 4R5MA 3FLBA 4WKNA 4X85A 4YAJA 1P1CA 1K4KA 3AX6A 1HNXB 3DYBA 1OI7A 4HRVA 4HFNA 4K6GA 5EMMA 5KU7A 4MPTA 1Q1NA 5LU9A 1Y3CE 3ER8A 3II6X 5FPQA 3PEFA 5BSWA 1FTGA 3R4CA 2IXDA 2OHXA 3K8OE 2ZIZA 1VMKA 3DM5A 1XNGA 4MH0R 5JVDA 1S9DA 3F8WA 4JU8A 4ZCPA 4QBHA 1QMGA 2E5FA 3CLRD 1KMQA 2HQSA 4JQCA 3V32A 1VKRA 5ICSA 2IS6A 2G6TA 4V1CA 4Z9XA 1SU7A 3GELA 2VJQA 4NJEA 5A6SA 4D79A 2ZRMA 2PUDA 4FN5A 2J3JA 5DI9A 1JEJA 5IZ4A 5I9MA 1NBMA 4BVAA 1F4PA 4G8BA 3O1LA 3U4HA 3HA7A 4LWZA 3WP0A 1B1AA 2JFUA 2Z2IA 3LCVB 4I4TF 4W4TA 4ZOCA 4P80A 1XB2A 2D13A 2C94A 2MDTA 4NPCA 1P1HA 1QF9A 3E0QA 2ZIEA 4JLUA 3V97A 1VM6A 4HQ6A 2X3YA 5K0JA 1NX9A 2X1HA 1PW7A 2VXCA 3ECCA 2RHCA 4EFMA 4P6VF 5EIOA 4DR1B 1A7UA 1JMKC 1VGQA 2I6FA 2GPSA 2VHUA 5KKAA 1RT9A 3TKYA 5GZ1A 3SQWA 3O74A 3HY3A 4RKWA 1SXHA 2EFHB 3K9HA 2BGUA 1HF0A 4LV5B 1SCDA 2I7TA 2BGLA 1L1EA 2ZE5A 1PQWA 1YL5A 4ZEWA 3VWSA 4OB6A 5C51B 3T7DA 4XWWA 4DR5B 1I3CA 5JZMA 2R87A 3QI2A 4FP9A 1JHZA 2GXSA 2YQ4A 3NWJA 2JANA 4EKYA 1WE2A 3KJIA 3BFXA 2BBTA 3EW9A 2DKFA 4GKKB 1VJTA 4RULA 1KY2A 5CA0F 3UA3A 4HJXA 3IKLA 4G5OA 4EHDA 3CLCA 3HXKA 1I3KA 3DDHA 1P2DA 3JQQA 3DTVB 1C0LA 2XCRB 3A04A 4FWTA 2VH5R 3CUTA 1TE2A 2J9GA 4QFBA 4C20A 3TTUA 3AHGA 5HG0A 5JQGF 3T1HB 4TTVA 2FDCA 1D5CA 3ZJVA 3CEPB 3DE2X 2IP1A 4I1RA 4RIHA 3RRJA 3T1QA 4WZBB 3W4KA 1X94A 1EVEA 2HFJA 3GLQA 4BOYA 2Q46A 1FP7A 1M1YE 1IB6A 4RA6B 2IIVA 3QEAZ 2IVZA 2PXBA 1LI4A 5HTOA 1IY9A 2M6KA 1BE6A 2I3GA 2BN4A 3MINB 2ZTUA 4M54A 1B1CA 3G7UA 3PXUA 3ZCVA 5LR6A 1IJEA 2Y05A 5KYGA 1X14A 1O94D 2AOTA 5ESDA 3DWGA 2HNBA 4O1MA 1RPTA 2ZCVA 3H99A 1WH8A 2X0JA 3VDRA 1N92A 5A5DA 3IQIX 1D03A 1JEQA 2PV7A 1TMOA 3BZWA 4REMA 5B4TA 4O2AA 4B1FA 4NBLA 3WV4A 3LQKA 1NUUA 3LQ4A 1U7PA 4MVJP 3SHOA 5GV8A 3K1AB 4UOZA 1CCWA 5BR1A 2GI4A 1A27A 3VDNB 1I6LA 3I6QA 4W9RA 4PG8A 3L6CA 1EWKA 1NG9A 1E4EA 3T41A 4CIXA 2WABA 4X94A 4RD6A 2V0CA 2HSZA 4UU8A 1MC8A 1S1MA 3I2JA 1RYNA 4OY3A 2XVZA 4W5HA 1CRWG 2INGX 1PZEA 2O2HA 2ZYHA 3CN7A 5EGNA 5KNBH 1KHTA 3IDQA 2J5KA 3MAJA 1WQ1R 3TB6A 2NO0A 1UZUA 3U7HB 3BSWA 3UMJA 1I4WA 1SH7A 2Q2WA 2WP8J 4YCJA 1UOEA 1R74A 1HNZB 4KXYA 2BV3A 1RNLA 3WKBA 3AHDA 1JKXA 5CUQA 4F5ZA 3IKTA 1QQ7A 4Q03A 4JIGA 3L40A 1P73A 4OB4A 1K5PA 3ZWYA 4CL3A 1QG0A 3ZWBA 2BEUB 2POQX 1GQYA 3JYLA 1Z2CA 3JQ7A 2O1EA 1KJWA 1JH8A 3V48A 4DNFA 2WTUA 1CY6A 4ZJYA 1N5JA 3RQSA 3Q7SA 2ZSJA 2FP4A 3DNMA 3TZKA 4DBZA 1GUBA 3AW9A 1GGKA 1LCCA 4MVYA 2WHRA 2JJMA 3LQYA 4DCMA 2O8DB 2O7SA 1CZKA 5B2ZA 3BL8A 3R9XB 1D8AA 1TL7C 1UBMS 4CV2A 4ZYZA 4E5SA 5DBHX 1U80A 2J3MA 2O8NA 3G2PA 3I9LA 1P3DA 4JLMA 3M3DA 5KYKA 1IXYA 1P3Y1 1Q19A 4YV2A 2CDRA 1DAEA 1JQAA 1KZGB 1NG1A 1P39A 2W6MA 2Y1CA 4I55A 5DWDA 3MUOA 3EUSA 3O26A 1OCTC 3HO1A 1O87A 1MQSA 4DDVA 5LMZA 5H02A 1SHKA 1DFIA 2PE5A 2GRAA 4H4CA 2Q07A 4O2BA 1QNLA 5FWAA 3T9CA 4XWKA 3T1TA 4YAWA 3KSZO 4C4XA 1TMGE 4K6MA 1P7ZA 2QPAA 4CTOA 2NACA 2VT7A 1SQ0A 1U3UA 2C2OA 2CZCA 1YFKA 2IY7A 1TKAA 4JNKA 1N2BA 3AO0B 4M9ZA 2D1RA 2KSQA 4EZEA 3EQ2A 2VHXA 2BFPA 3WLQA 2N0SA 3ONEA 1R0ZA 4FPXA 3EPKA 3OIUA 1DJNA 1F14A 4NNOA 2JIDA 4F11A 4M1YA 3U3XA 3HGQA 1J2RA 3I3OA 4LDJA 4LG1A 3R3HA 4S2EA 4BC0A 1A2OA 2FEKA 2C0PA 3ESBA 3FJ1A 1C1DA 4GVPA 3KP1A 4M36A 2I1VB 3G8AA 2PWAA 3NKLA 2HAEA 4WDQA 3AL0C 5KWJA 1UP6A 2Q2NA 1W5TA 3HDYA 2A4MA 3NGMA 3D1NI 2HA4A 2R2GA 3H5NA 4I50B 2XI8A 3AG6A 3HV2A 2JGAA 1R8SA 1JYEA 2R3SA 1OLXA 1YQEA 2CSUA 1QV6A 2EERA 3AGQA 3CISA 4FK8A 4LVOA 4UU1A 3ZY4A 2HGZA 2GZDA 2P77A 4ZOQI 2VWHA 4DCCA 1D1TA 3A31A 1X1SA 1BROA 2R8ZA 1QNFA 3L0CA 1W4BA 2P9BA 3FRIA 4O4LB 4LNUA 1DU4A 1JHXA 3TSOA 4E21A 4HMOA 3TUZC 4J0KA 4RMNA 1YUNA 3GAMA 1C30B 3BWYA 1CP3A 4C0BA 1KDOA 5A7GA 4QBGB 3UK7A 4CU5A 2OQ2A 4BLSA 5AW5A 1MGPA 1T13A 2D2FA 2WWHA 1U6KA 2ZI4A 4UNQA 1VLMA 1H1LA 5EIBC 2CBGA 4A6DA 4LVNA 2K7ZA 1SCUA 3GGSA 5JSUA 3U44B 1NSFA 1E5DA 3MWDB 4UFOA 3U7IA 4BLOA 4F1WA 5I4BA 4FJ2A 5EP1A 1U4SA 2R1ZA 3PFIA 1K97A 5KSOA 1DARA 1JU4A 4ER5A 3BG5A 3AUJB 2V3VA 2FYTA 3BE8A 1UADA 2YMLA 4KX5A 2HSEA 4HX5A 1R4AA 1YTLA 4HNUA 1UPFA 2FX3A 2HM7A 4QNNA 5C46F 5KTOA 3KQKA 2GRLA 3JQ9C 1GZ7A 1XE3A 5CAEA 4IKEA 3T34A 2WMYA 1GNLA 1M7GA 2DGDA 4K9MA 3TINA 5E9AA 2LLWA 1BXZA 4ZODA 4EJFA 3GP5A 4UFPA 3VGPA 2H9AA 3ITNA 1XZKA 2FOXA 1S3SA 2QI9F 2FZGA 2EX4A 2P9EA 5BMOA 2EZ8A 5CD9A 3P9ZA 3AR6A 4WTOA 3QEJA 5JMPA 2DBQA 5LOVB 2QVGA 1M2WA 4NFHA 4LOHA 2X0EA 3DVAB 3RYHA 4BO3A 4EJSA 2HY7A 2X4IA 2ZZKA 3HBJA 3SJCA 1OT5A 3KBOA 2AJ8A 4DT1B 1QO0D 1XA4A 4I46A 4URFA 3BIJA 4AD8A 4KRGA 2I3ZA 3EPPA 2CBXA 1QYWA 1VPWA 3GZNB 4WKPA 1CUUA 1R63A 5TNXA 2W22A 3V4OA 5JS6A 5C0OE 4AL4A 4EPVA 2H07A 3IUEA 5KVAA 1EFTA 4QXRA 4DBVO 3ZWDA 1GADO 3E23A 2JLUA 1Z0JA 3HYCA 1CUXA 1I5OA 3PC4A 2RBEA 1CF2O 1G17A 3GL9A 3A4MA 1WV1A 3LUBA 3K4QA 1HLDA 2E49A 3DUWA 4LYAA 4MIEA 1ORHA 4XEHA 4C7XA 2XUJA 3NIFB 2YIDA 3AI1A 4ASUD 2J6CA 2PX4A 3D5QA 3H87A 3R3JA 4RE6A 3IB6A 2MEZA 1JKJB 2A1IA 3DV9A 1V6AA 2EZ4A 2Y0EA 3I83A 4I4CA 2UZAA 3BMXA 4L8YA 3PLAE 2DU8A 2W83A 3EJ6A 1ZL0A 2D8MA 3EDMA 1VLLA 2DKOA 4II3A 1OHHA 4DRZA 1KKLA 2CJXA 1W8IA 2CNNA 4EKNB 1C0PA 5LC1A 5L3SA 4LYYA 2F7SA 3G2KA 1HOXA 4XD2A 3C3DA 5HRAA 1QZXA 2IYPA 3FOBA 2TS1A 2PSEA 3B38A 3OIGA 3R7SA 4UAGA 1ELOA 2H4JA 1XZFA 1PR4A 1SK9A 4DLRA 1Q1ZA 4TV9B 4F85A 4BNIA 2JAQA 1FUIA 2X4DA 1SG6A 1ZI9A 3H86A 3ELDA 1P62B 4KWIA 1OZFA 4ESEA 1AXRA 3REQB 3AIIA 3UQZA 4C2AA 1NVGA 4DYHA 3Q3IA 4YT8A 3TVTA 3U56A 4IQGA 3KHKA 4XQGA 3V1MA 4JEUA 3K35A 3JATB 2I0FA 4DNXA 1G8HA 2QY6A 3CLKA 2GYWA 4NOLA 4WUTA 2DERA 1YCGA 3NNSA 4Y6PA 1IY1A 1MOQA 5AVVA 2RAPA 4MPJA 1R4ZA 2FK8A 2XT9A 4IEFB 5IAOA 3IB3A 3KKQA 2JLVA 1ZK0A 1FFEA 3HZIB 2AN3A 3M1AA 1ZGJA 2UZIR 2OSBA 3GNSA 3VUFA 3H9JA 1SQSA 2E4AA 5BN4A 2VSFA 1UMDA 5LZ7A 4R71A 3IEMA 3QOXA 3WXBA 2C4NA 1I32A 2DQKA 4L5IA 4NI5A 3CECA 1HEYA 2CKMA 2JBWA 5FCDA 4B45A 2Q1TA 3U09A 2I6QA 3F5DA 3CNBA 3UJ8A 2P6OA 3EC1A 3GRRA 3ZHZA 3DM9B 5CDGA 1PFWA 4PLCA 2BTEA 3EN0A 2JEOA 4RKEA 4ERXA 5CBPB 4EO7A 3EMKA 3DLCA 1A5SB 4PX5A 4JDUA 3H1TA 2B37A 3ED5A 5E4FA 2QMEA 4HB4A 4PCUA 2C97A 3RSLA 4KJZA 3IT2A 4W6ZA 4Y30A 2EBYA 3QFRA 4GPBA 4LGCA 5DV9A 1THZA 5DWVA 4PU3C 2BRUC 1U7UA 4IY1A 1SVMA 5DXJA 1N2CA 5M5BA 1SBIA 1IHOA 4ZGBA 2YCLA 1V2GA 3PGLA 3YASA 1O7JA 2FN3A 2G9NA 4HN9A 4YDSA 3TLCA 1LSJA 4BGEA 2DPGA 3BH6A 3NB0A 2ZI3A 4Q9HA 5CCXA 3NHFA 1T9BA 1H3NA 4JNCA 1KJNA 2G72A 1U3DA 1GTRA 3B6MA 1U1EA 3RTDA 1QGUB 1LU9A 3BN3A 1P1BA 4R1MA 3BAZA 2QJOA 3IUJA 4KO1S 4TMTA 2QPLA 3LTEA 5GY7A 3RPEA 3W3AH 4DQKA 3LUKA 4LQ4A 2ZBGA 1A8SA 4L07A 4CMIA 5LDHA 4M88A 1KJ8A 2N42A 4LDZA 2HXYA 1CNMA 3GLFE 3LXMA 3FNRA 1P1JA 4TTPA 3T3NA 4ND6A 4BAGA 3C16C 2BUCA 1KL7A 1T9GS 4B4KA 1PT7A 3L07A 2IHJA 4D98A 3CW2A 3L18A 1K8YB 1T3SA 2PV0A 4FLMA 5BRAA 1RBYA 4ZCMA 3R7AA 1U2DA 1QPGA 1B3BA 3QVXA 4DN6A 1N5LA 4MWCA 4C0WA 3O38A 3P4XA 3MNFA 3IJRA 4CM5A 2H59A 4IILA 2ZSHA 1NBOA 3EYAA 1D4FA 2G0NA 4FUTA 4XR4A 5IM4F 2WTMA 1QHFA 1JR3E 3IHKA 1JEYA 4IMPA 5HJ5A 1I2MA 4KCGA 4QTUB 2GN0A 2QIPA 3WRYC 2JHFA 1YFLA 1W19A 5F7XA 4PYIA 1O0CA 4UQPA 2I2DA 1J7JA 3TRIA 2FX5A 4Q16A 4DEYA 3H11B 3OI7A 3KB6A 4WBXC 5FBZA 5FPTA 3HUDA 5JJIA 1DC8A 2HSDA 2R5FA 5FOTA 1ECFA 2A94A 4H4EA 3H1GA 4H9GA 4WV3A 2YVQA 5G0WA 3W1WA 2OENG 2B2XA 5AQEA 1I2AA 3M1YA 4X7PA 4RTQA 4RTSA 3SYLA 2OVBA 3G9UA 4NS1A 4WL0A 1V3UA 2ZSUA 3TZQA 4F5WA 4A2QA 3VU9B 4ZVPA 1BYIA 2B7BA 2WM3A 3C3CA 2G1KA 5DSZA 2LRHA 2QMZA 3HRHA 1GN8A 2OORC 4FX2A 4QOEA 5JZVA 4GP7A 4HPJB 1ZR4A 1KO4A 1Z8FA 1EM8A 2XV1A 5J3JA 5B1YA 2PUVA 2HK6A 3B89A 5HIMA 3U13A 4Q3OA 1U9JA 3K6RA 3I8OA 4DLXA 1KJZA 5I48A 3GLHE 3ROTA 1N2SA 4UTPA 4O2LA 1PL8A 1E9VA 4MEBA 1BKYA 2ZJ8A 1WU7A 1SXJC 3D4PA 4M8SA 4EGQA 3OPVA 1E3MA 2PJUA 4RKRA 3B82A 3N8DA 3PYXA 1XTQA 1W4ZA 2WAYA 1GCOA 3O03A 3LO5A 4LBWA 4OBMA 2IEYA 3ESYA 2XNKA 1EEXB 2YHSA 1Y5NA 3MCUA 2CLEB 2QM8A 5CH8A 3W5IA 5IYZB 5A0FA 3FVTA 5AIAA 4II2A 3MK31 2C8JA 3QX9A 4FFMA 1G9XA 1SC6A 3OCUA 4OLJA 3ZKWB 4WZAB 2ZQ5A 1JIKA 3AJ9A 1YZLA 3B6IA 3FPAA 5DHQA 5ERGB 1QVZA 4FC6A 1HG1A 2FEOA 2Z1MA 2W8BB 4IEEA 5A4KA 5TMBA 3KYBA 3O4VA 2YNMC 4LWPA 1HYEA 1LBTA 4I19A 4YNBA 3TLMA 2XDQA 1FMCA 3WLSA 1RAGA 2QX9A 4CNBA 3H18A 4YCMA 3UMMA 2WAOA 2YWCA 2C5AA 4EQ6A 3W6UA 2AOUA 2JAPA 4FGSA 3LC7O 3Q3GE 1XZQA 3CR8A 4XIJA 3STYA 3ZJYA 3DWIA 3S2GA 4H1HA 4XOUA 1KPHA 1X9GA 3OT5A 3ROGA 3HB5X 5JNWA 3CHYA 3L7YA 1H6DA 5C8YA 3RH0A 5DM1A 3O4FA 3QTTA 1UPUA 3KZNA 2EP5A 3N86A 4GMKA 4UTVA 1NDHA 3Q7PA 2OHGA 4W1RA 1XJCA 3AP1A 5JO9A 1T34A 5C5CA 3M4XA 4TXHA 1E7SA 3ZLTA 5BP7A 4PO8A 3A7DA 1QZUA 3ZH2A 2IYQA 3R7FA 4P3XA 4KQ6A 2AVNA 1ZH8A 3IT0A 2Y66A 1G8AA 3KYDB 3UIEA 4ZYTA 2IYUA 4DE9A 1JALA 1I4DD 2RSLA 3G82C 2GCIA 1P5HA 1N4AA 3H8VA 4R9RA 1E1KA 3VPSA 3V4ZA 3KQHA 4LOJA 2DULA 1BHSA 3CVYA 1A82A 1YD7A 3RM3A 1O3YA 4B32A 3QPVA 5DGHA 1OKKA 2TRSB 3LX5A 4YXFA 4UEWA 3QSYA 1AV6A 1FMTA 2FRXA 4ER7A 1E5XA 3INRA 2OXCA 2WIUB 5KNBD 3RFVA 4D80A 1YJCA 2XHZA 1I1HA 4DSUA 3A4TA 4V3CA 2PLAA 4UEQA 5JAHA 4QOJA 1C3VA 3NZLA 1IEQA 1NP6A 1AU7A 4LRQA 2ZRFA 4F56A 3B78A 2O0KA 3EEFA 3F7NA 4LSZA 3V6LA 2WHQA 4YARA 3G49A 1ES9A 5BYBA 4F2PA 1KO8A 3OQIA 1CJSA 1EP3B 1XNHA 1JJBA 4YAEA 3CVXA 2CD9A 3DULA 4D3YA 1CR4A 4NONA 1HNWB 4FCVA 5BNZA 4HGOA 1KJYA 1RRMA 3OFJA 2NZUG 3HXPA 1Z12A 4G07A 3NUQA 4ZU6X 1XU7A 1M1UA 4ZO7A 1UDXA 5J2UB 2I34A 3B1KA 3D0QA 4M0DA 2W6ZA 3GDHA 4DUYB 2FMUA 3NHJA 3DD1A 2QQGA 2RH5A 3FHLA 4LUCA 4RX1A 1GWNA 4V0KA 3IBSA 3O92A 1H23A 3S44A 3DT8A 4Q9KA 3AVOA 2P5SA 1YTUA 4MS4A 2AJBA 1DAGA 5FWYB 5IKPA 3G2QA 3BB4A 2V7XA 1TKRA 1ADGA 2IXTA 2KPJA 4BJ3A 5BOSA 3L6UA 4PC6A 2P79A 1Z82A 2Q3MA 5IF3A 2VTBA 4G9GA 4IAOA 2AC4A 1QYRA 1K3TA 5AI6A 1GFZA 4K9KA 1FFCA 5REQB 4DV6B 3W5HA 4DIUA 2VSQA 2XVMA 2DP4E 3L0YA 5C7LO 1YC5A 3NVAA 1LSUA 5AM3A 2BPOA 1MFZA 1U5CA 2LDXA 4UU7A 4XVRA 3L05A 2WG1A 3U40A 4M0CA 4ARIA 3QPCA 4TYWA 4GGPA 4FMCF 4UM7A 2ZTLA 3MJVA 5EERA 4ZI5A 4MWSA 1EINA 5D1HA 2CJPA 3C5CA 4A0QA 3BOSA 3T9FA 1ZRSA 1BA2A 1YULA 2SCUB 1YRLA 2GXAA 3OJEA 4WLNA 3K9QO 1U04A 2VDVE 4OVKA 5H0IA 4JX8A 2FZ5A 4BMCA 1N6LA 3DMRA 4MTLA 5DKFA 5JG7A 3RBZA 4BCBA 2DLDA 4LE2A 5CM8B 2HFZA 3U7RA 5L95A 1X9IA 2ETVA 2OV8A 3O91A 1CTQA 3DDSA 1ZH4A 1PT6A 1TM3E 2VJMA 3BRWA 3EQ7A 4A16A 4AMYA 4KBYA 2CROA 3DMTC 1RLJA 4QQNA 4MRPA 1AVTA 1M1ZA 4N7BA 2HH9A 2ZUWA 3COVA 3KALA 3RHSA 1EGMB 3PX2A 2I6SA 1KTVA 1FFHA 5CHEA 2CFCA 4DNOA 1ZS9A 1NOKA 3UXYA 1YJ5A 4JD5A 3PIIA 3DMHA 4KSCA 2Q21A 4QDKA 2IYNA 3T7KA 5BVHA 1A7AA 1E0DA 1VIVA 3M5CA 5LA6A 1P6QA 3WNBA 5J40A 5JEEA 4W8GA 2B3DA 1XRJA 1FTSA 2X58A 4HZIA 3VTAA 7MDHA 3UHJA 2ILTA 2IEIA 3PA8A 1N5IA 3WTCA 1E4VA 3A3YA 4E3ZA 2WD8A 4KWCA 2XKKA 2HMWA 2C4MA 1FLNA 2ZREA 4C29A 2VVTA 5IJXA 1IHDA 3EQZA 5COBA 2HMTA 3GVXA 3GJYA 3AHEA 3MGKA 1D2NA 1NW3A 1JL3A 3G0CA 1GA1A 3CPJB 3D2BA 1YBAA 1OIVA 1W93A 1ESMA 1IZYA 4NG5A 2ZRJA 2CCJA 4XQ9A 5EXEA 3TSWA 3NRBA 1L1FA 1ITZA 5DE3A 2WRZA 3OP4A 3MLFA 1NU6A 1SB9A 4MVWA 2FZEA 5BXQC 1VL0A 4ZU3A 3UWDA 3LBIA 4B6FA 3UWOA 3ZK7A 4ZOAA 3I5UA 3S28A 3EBOA 4IOKA 4LJ8A 4M87A 1Q84A 3L49A 1EK1A 4TTTS 3AF6A 2FUG1 1U8AA 1VMDA 1FFWA 4HEA1 2CLMB 1MOPA 5ALPA 4CTMA 1TUIA 5KOHA 1FX1A 1ONNA 3ZLVA 2RD2A 2B25A 2DFTA 3AUYA 1K6JA 4PZZA 2XNDA 3P2YA 4M1ZA 3L79A 4OHVA 2PZKA 3KOMA 1SVSA 1HQDA 3TTWA 4CLDA 1V16B 2ZRDA 3FPLA 4Q02A 3ZXSA 3PFBA 4M8LA 5J59A 1TIKA 1UQRA 1ZCJA 3CR3C 3T9BA 3TR5A 4KK3A 4IZ6A 5EJGA 2JIBA 3MTQA 3EK2A 2OUKA 3UJ3X 5EP4A 3TRBA 1OC2A 2GKSA 3KKLA 4AU1A 4FHGA 2ZVJA 3I64A 2QRVB 3K53A 3OFSA 4HUQB 2M2IA 4RHYA 3ZGZA 1Y9DA 5U1PA 5ICGA 1GCIA 4AK9A 2QRMA 3C4VA 5FX2A 1MO6A 4R5HA 1GAJA 4G1VA 1E1MA 5AVYA 2AE2A 3DPIA 1CE8B 2IFTA 5TF0A 5D8DA 1UXJA 3E9QA 4BGDA 4J49A 2O1XA 1JDZA 1A1SA 3GN5A 3QF3A 2LPMA 4CMHA 2VG8A 3SC2B 1LK0A 3WHIA 1YZQA 4CMJA 2XGGA 2GSDA 1JFLA 4QNRA 4N76A 4J0GA 1B8NA 4QC2A 1GTMA 3MELA 4MAFA 1JZQA 2JKZA 2QF7A 3HKDA 3KLOA 2VLBA 2YWBA 4GUDA 4O5AA 3RC7A 3RK0A 3M2PA 3PYLA 3ZV6A 4DSTA 1UCFA 2A0YA 1E6EA 1TD9A 4DIBA 3AHJA 1BVYF 1JDSA 1DSSG 2A14A 5BV1A 2ZIXA 2DTDA 4EJSC 1WKCA 3PG5A 1M34A 4K3UA 4MWDA 1FYFA 1P4HA 2OR3A 2YDXA 4Z86A 4UW9A 1N3BA 2AEEA 3EULA 3IPLA 3BF7A 1PVVA 5CTAA 2I80A 1G9SA 2JAOA 3ZJ4A 3EVAA 3D0OA 2QD2A 1Z0ZA 2CDNA 2HIAA 2Q9UA 4MKRA 3I1FA 3BX1A 5KKNB 3SI7A 1NUHA 3MM4A 4MRAA 4UEJA 8ADHA 2C78A 2PBLA 4JI8B 4US1R 2BKUA 3RRZA 5DCUA 2BMAA 3AIKA 1E6WA 1RKUA 1FY2A 1NSTA 3ADBA 3ZWKA 1I7SB 3HZHA 1SBCA 1I0IA 5ERXA 5ENVA 2WKWA 4L6CA 2W2KA 3GV0A 4U3JB 4PCVA 1T6XA 4DEVA 5I7OA 2EEPA 5J1SB 3TMAA 1E8MA 2F1KA 4QQRA 5K0TA 4YLGA 2D0DA 2X9LA 2CVQA 4ZAXA 1HDIA 1LVGA 1N9GB 3HJHA 4NCKA 3L9XA 4ATNA 3ZW8A 1HDGO 1JH9A 3GLTA 4JR2A 1T9ZA 2HMUA 3FNQA 4UHFA 3NHZA 2H1VA 3C7CB 1YQTA 1IEWA 3PQ5A 3GQBA 1M9NA 4ALIA 3WIBA 1EWYA 1XBTA 3F6SA 1XNQB 2AMFA 2QTVA 4P4SA 3PR2B 4WI1A 5AMXA 4EH1A 1HEUA 1VL8A 2PR2A 2A9VA 3AKYA 4EK9A 3L82B 4IXTA 4TKLA 4TROA 5WRFA 4BFCA 3WAJA 2QPTA 3H8SA 3GH3A 4JJKA 1R0BA 2ZJ7A 3FUTA 3A05A 3EPJA 3T99A 5KJEA 2IGTA 4WNAB 4E5YA 2V3WA 4EDFA 4PHHA 3IELA 1ICEA 3F96A 4YRJA 1XZJA 1ZN2A 1P2GA 3IAM1 1P6UA 1OX4B 2R8OA 1C4WA 1JDBB 1YB2A 5DGIA 4Q4HB 1VE7A 3UJAA 1OB5A 1UKVY 4ZK6A 2P75A 5E6RA 3RUPA 1ZGAA 5GVRA 2MYUA 4G0OA 3RAJA 1XZMA 1G41A 5JROA 9ATCA 3DV0A 3HABA 1A98A 1MU0A 2QGZA 3TZ6A 4B6EA 4ESOA 1NUSA 5T4HA 3UJ7A 2EF1A 2JHCA 5D3MA 3U9TA 3GCGA 1WLYA 1A9SA 5J5VA 4AT1A 2AFHE 4K6HA 3GJ3A 3ZYCA 2PMCA 2ERCA 2OGTA 1VKJA 4QGBA 3DBHA 4NZYA 2I6GA 1T3GA 2YHUA 3LBFA 4H7IA 2QE7D 3GDWA 1Z3IX 3GBPA 1GL3A 3NC4A 3T7RA 1P9LA 5EZYA 3M6WA 1O6ZA 3V2HA 3SMQA 1H0RA 3K6SA 2ZUUA 2A6PA 2B20A 2Q9BA 3QV1A 4Q5IA 1OFUX 5H7XA 3VO9A 3EWSA 4PSAA 3OAAA 2DHRA 4EG5A 3TIFA 1ZPQA 4Z5HA 5BORA 1E6UA 4Y0VA 4G8CA 4XB1A 1ZRHA 2GRUA 4IIHA 3U3WA 4CWAA 1PLKA 2O5CA 4D3SA 4HAIA 3K70D 1GUZA 2XKAA 1CB7A 3N2NA 4EARA 4BX2A 2IZZA 3W5SA 1PSDA 3SWWA 1OA0A 3ZGXA 1HRDA 3UJHA 2XMZA 1VQ1A 2WPDD 1PQYA 3G8CA 2A58A 2VZ9A 3AZQA 3MJ4A 3F9RA 2UVDA 1SUAA 2F59A 3OLYA 4TKVA 1V43A 2AFIB 1FS4A 4ARZA 2JJQA 3LO8A 2Y1LA 4UMFA 2CF5A 3D4BA 4I9GA 1FJGB 4C30A 1ZNWA 4RZUA 4UZFA 1ZVQA 1OLUA 2ZBFA 3NORA 2EJVA 3VZSA 3ZIAA 3R44A 1EVKA 3WKAA 1D1PA 2QTLA 3OQHA 3PQDA 4PHCA 4PO3X 1R12A 3CZ5A 3BT7A 3TDMA 5TJ9A 3BXOA 3N2GA 2QKYA 4DCSA 2F4NA 3AETB 2B35A 1TJ5A 1U28A 3E9EA 3EUEA 3L41A 3LECA 3O1IC 3P94A 4P7FA 4RVFA 1L8OA 4B2PA 4D3XA 3JQDA 3H5OA 5C3UA 4EVQA 3N8IA 1ZXBA 2PS9A 1JG2A 3N2EA 4JLAA 4ND8A 4JT2A 4RV4A 5LYJA 2JA1A 3OLZA 3GRUA 3O1HB 3RJTA 3NHRA 3D8NA 4S1VA 3WQSB 4YYZA 4JA2A 5KKCA 1E8NA 1C9MA 1SIOA 2J0UA 5HF5A 5AUNB 3TZBA 1HFEL 1S96A 1U1DA 1WH6A 2HO5A 2QWXA 3OCYA 4P7GA 2IXEA 1RC1A 4K8OA 1L5ZA 1AN9A 1X7GA 5LQMA 4EKGA 5KNDD 3OY2A 3DHEA 3X2EA 4YRDA 1G3QA 1L5YA 1Z15A 2PKEA 4O59O 3WLLA 5BWCA 5JRJA 1WHTB 2XHEA 4HCJA 2M32A 1HE3A 2G9QA 4X6XA 3RRBA 2WJVA 2EG5A 4YXWD 1RWQA 1FDWA 4KQKA 1L5LA 1HT0A 1TYZA 5KJ6A 2XMGA 4C3ZA 1XMOB 5ADHA 1AHHA 2FZVA 3HADA 3NTRA 1DG1G 1RYFA 2ZWPA 5G4KB 4ZI7A 3HXMA 1Y1TA 4CKEB 4F97A 5FWXA 1P1FA 2I7DA 3C3WA 1FVHA 1GKUB 4H0CA 5A2GA 3ZU4A 3N2LA 4PNZA 5TX7A 5M7EA 1VBNA 4R1SA 3EXFA 2NU6A 3K0BA 1W85A 2IE8A 1EVIA 2XX3A 1WZNA 1HE2A 1T5LA 1YA4A 2WBLC 2Q3FA 3S8QA 2M6LA 4NLLA 1VDZA 3MOGA 3LBNA 4BE4A 2KJQA 1LPAB 3KC2A 5AIBA 4BMDA 1I2DA 4Y6GB 1RZSA 3EVBA 2OV6A 3G89A 3PJDA 1FDOA 3DXXA 5EWMA 2C8LA 4C1NA 1WJGA 1RWKA 3OEEA 3QP9A 1SXPA 3SQDA 4QUKA 1OAOA 5IBPA 3ZXUB 3W9BA 1CY7A 4B7XA 5ER9A 2PCLA 3TNFA 2H85A 2PGIA 2D06A 5G0UA 3SCGA 1YKSA 2B36A 1L5KA 4J3NA 4ED9A 1LC0A 1J39A 3MJSA 1QIJA 5FTLA 3KLNA 3GLIA 5A3VA 2JFXA 2QZPA 3OKPA 5ARBA 1JG1A 3E70C 3AZPA 2PH7A 4U7PB 5G0VA 3K92A 1NF2A 2LCFA 2PLNA 3HFGA 4MV8A 1EE1A 4B6PA 4LHWA 5C5DA 3VPCA 3DGFC 4CUKA 4HNSA 4ENTA 1HUQA 4S0XA 3FYUA 4HWTA 3VR5D 1L8XA 1SVOA 1IBLB 5ED4A 3DEZA 1UPTA 4FN3A 1M2VB 1D8TA 1TFUA 3SP1A 5KOIA 3AKEA 1E77A 5L3ZA 4YMSA 1KI1A 1WSWA 3A9VA 4B47A 2XB2A 5CPFA 1SNYA 1TUEA 3VOBA 4BXOB 3KUDA 5HOEA 4JVNA 1IAQA 4P5DA 4QSMA 1AGPA 1DOHA 4DLBA 3ZTTA 1CSEE 1R66A 2PSHA 5EJ7A 1C1HA 2JI9A 5CXXA 3P2JA 3EUFA 1FL9A 5LJLA 1YR8A 5C1IA 1R0XA 2J9RA 3PJGA 3V8BA 2ISCA 1JXAA 4F8YA 1XO1A 4DY6A 3B53X 1S02A 4ZT3A 3U7FB 3M5DA 5BSRA 4PU7A 1V1MB 1YC2A 1ZOSA 1O9GA 1AA9A 1CVIA 1C7EA 1IJBA 1ETHA 1OBVA 2FN7A 2DMRA 4FYJA 4X0EA 3RTAA 3ZE2B 5LVAA 3C0KA 3RSSA 4DMHA 4MV0A 1IEVA 1C7JA 4Z5DA 3GY0A 4EG4A 4HZUA 5EJFA 1XRLA 3ME5A 1KHHA 2YRXA 1JN0A 3OM0A 1OWOA 5CFQA 1QFSA 5EFOA 1YGPA 3RAGA 1NT4A 3OF2A 4YB8A 5LZ5A 3PXGA 4N3NA 1NC3A 1N7IA 3H4TA 4FHEA 4FE3A 4HLDA 1KAHA 1I6KA 1N0UA 3FX2A 4KR9A 1T1SA 1Z2EA 1ZU4A 3DBLB 1ORIA 1PBTA 1V5IA 3C41J 2CXPA 1TADA 2Q1SA 2OZLA 5ESWA 5DEOA 3PUXA 1XZCA 4YLEA 5LZ9A 3PTLA 2NXNA 4IMIB 4KPGA 1Z26A 4GGMX 2Q8NA 4Z3KA 4WKOA 2JLXA 4CM7A 3R8XA 3OUUA 1QE0A 1KEPA 2GVNA 2XCLA 3EZLA 3MJTA 2HT1A 3E3AA 2IYAA 3O8QB 4DDKA 5HKAA 4KPUA 1S6YA 2P9FA 3IEKA 5JECA 3N53A 2B8EA 4G97A 2J85A 2Q27A 1RXYA 2ATIA 1Y7LA 1YAHA 2HQOA 1XKQA 1KEEB 2PYZA 3KOWA 1PWEA 3NXHA 1Z7GA 3GGCA 3PRYA 3PKIA 4P84A 2C7PA 2ZUEA 1QIKA 1TVKA 4LHVA 3VHXB 4YAGA 4HDSB 1I0ZA 1C3OA 3EOZA 2IUTA 1XZDA 2RH9B 4GE0A 4GM4A 3A1DA 2O8CB 4XI9A 1T9HA 3DL2A 3VOTA 4AWBA 2PAFA 3UJCA 5AW6A 4L16A 3ZLUA 2W37A 2Q6IA 2Z43A 1DC6A 4L8GA 4FFSA 4KPYA 1VL1A 2XXPA 2NZXA 3H2GA 1GY8A 4F3TA 1SVUA 2C04A 1VGVA 3CRRA 4KOAA 3LGAA 2BFEB 4R4JA 4HDNA 3WFZA 2HIGA 4GRIA 4X20B 4MICA 3N0RA 3TNJA 4RO0A 2HC9A 5GMOA 1F8XA 1HLFA 3F78A 1R9JA 5JFOA 3UC9A 1OXXK 4M0FA 3D8SA 1ATIA 3VDMA 3W2IA 5L3QB 1U8YA 1M54A 3CGGA 1FSZA 2REQB 2BR4A 5E6SB 3Q85A 3SYNA 1LLDA 3E4CA 4HTAA 2QQEA 4TN5A 4Q3KA 1Q14A 1V1RB 2CT8A 2EF0A 3COWA 1Z0IA 4MLPA 4RD4A 4AYXA 4QU0A 1ISPA 2EHDA 2ZZMA 4QXMA 1PRAA 2RK6A 3IAS6 4WKCA 5KHOC 3RSOA 3MMZA 4QM7A 4NAUA 4DFDA 3CLHA 3NGLA 3TLBA 3GJ8A 1NP3A 4L4ZA 4MHSA 3S2ZA 4HNVA 3DHVA 3HH8A 4M99A 3QEMA 1IHXA 2HWKA 4C6TB 1OCEA 1RCFA 2VJOA 5C9ZA 1YI1A 2QD5A 1TW2A 1PFUA 5LL6P 2CJYA 1YRAA 1GA6A 3PENA 3UKOA 3V46A 4C3UA 5GAGi 2IVQA 1QKJA 1QOPB 7MHTA 1UTXA 1GQQA 3O0DA 4RABA 1M1YB 1R64A 2P6UA 4MVJI 1QR6A 2VOEA 5EYPA 4AF8A 4OP1A 1JMYA 4GR4A 3P5BA 3ROMA 1OPXA 3D59A 4JBIA 4MKFA 1PP4A 1IQPA 1NOJA 2ZBVA 1NLZA 4RC9A 4YCBA 4XIYA 3ZV4A 4LX0A 4IFIA 3KQUA 4HDMA 3BHNA 3FE2A 3PV0A 4JYZA 1HZJA 2AQHA 1ESDA 4H6VA 1FMJA 1VRCA 3PVZA 4MCAA 4WN9A 5F9HA 2Q6OA 1Y5LA 1O08A 3HXLA 2XZDA 1NDUA 1H5QA 4CKWA 2ZRGA 1W73A 2C2YA 2EATA 3AERB 4FOSA 3VKGA 3FVRA 3RLIA 1ZZCA 1PK7A 2PG3A 4XCVA 2C4HA 3ZS8A 3KE8A 4J1QA 1EBUA 4G0PA 3ZHSA 1W4AA 5CK4A 2YFQA 1QKIA 1PZFA 3PWZA 5LB4A 2OMEA 1JLHA 1O6GA 4L8LA 3CNHA 1X6VA 3PF8A 4NJMA 2MR5A 5AJWA 1NQVA 5FBWB 4DCNA 2QXYA 3C74A 3HBAA 3LQQA 3PUVA 3LIPA 4WXEA 2YJTD 3UT5A 4EB6B 4HH4A 1I7LA 3U62A 3KKPA 3I23A 3H2BA 3OZEA 3PEWA 5DN6D 4GOND 1J2JA 1GZ6A 2VDKB 2ZROA 3AEXA 5LBUA 4Q4LA 2V74B 5BV7A 3A2MA 4DCGA 5HQTA 1N1GA 2H92A 5I9TA 2OBMA 2VH2A 3ND9A 2EFCB 1KWGA 2QN1A 2E37A 3BDNA 3MLEA 2JHPA 3HL0A 1A7KA 1URPA 3VVLA 3GJ6A 3JQEA 2IZ1A 1MB4A 3VR2D 4MVJH 3BE6A 4E1AA 4F71A 2Z4TA 2RGWA 3DAGA 2GPYA 5CCBA 3JTMA 1NW7A 4FKMA 4HRAA 4P08A 4R2LA 3CF2A 1O94A 1SUIA 3KWLA 3TRFA 2RGNA 2JLSA 1UM9A 4NICA 5AYVA 4EJMA 2O3RA 4R8MA 5JMTA 2L1PA 4FFWA 4P83A 5DVZA 4MOWA 1SIUA 4O4IB 3L8DA 1BDMA 1DS6A 4JN6B 5LXTF 3TX2A 1KJJA 4ISCA 4XUDA 5AQ1A 1DZIA 4Y8VA 3DLAA 4O33A 5F21A 5K6RA 4MWTA 1GRQA 1QHYA 2RH4A 4XLTA 1EXMA 4IHQA 1M6VA 2ERXA 2OAQ1 1DPGA 2Y92A 2Y6UA 3NHLA 2YYZA 3O2NA 3OBBA 1CQIB 5CYPA 4UM9D 4MQMA 4DMMA 3BGVA 4CKZA 5D7BA 5FR2A 1IM8A 1C3XA 4RLFA 4EI2A 2AW3A 2HRDA 1PG2A 1FX0B 1ZIYA 2GHRA 4XW2A 4CM9D 2JGDB 3DVLA 5G2OA 1MB3A 3QPDA 1SBQA 5MDHA 1L6RA 2CL0X 4IL5A 5KTRA 1SR8A 3VZDA 1CIPA 4BGVA 5AVZA 1XIVA 2GN8A 2Y0PA 2OVFA 1AM4D 1T5TA 1G8JA 3B5EA 1EZ1A 2LYJA 5TQJA 3BMOB 3ZV5A 2PA0A 3DAOA 3ULKA 1BWQA 3HKEA 3NT5A 5EQFA 2G5CA 1B4DA 3SOPA 3FUVA 3OP1A 5JWRA 4EY3A 2XTAA 4BQEA 5JAUA 1F48A 4QUGA 1DKUA 3TEMA 2B94A 2IBTA 4YI5A 3OJLA 1RXUA 4LGVA 3TCNA 4F2DA 5AW3A 4FYHA 3FVVA 2R4TA 4IS2A 1O9BA 2WZDA 5J5CA 3PGJA 4ILKA 4J07A 5DF1A 3OP9A 1GNSA 4FOTA 1Y82A 1ZD5A 4OGLA 4PQFA 5ITVA 2DQYA 1BJKA 2D00A 4BVJA 3A1SA 4LRTB 4U2DA 1SO8A 2V8BA 4EPXA 1QK3A 1LX6A 5DYIA 1N33B 1XD2B 2K87A 3B48A 4PEVA 2UZ4A 3AHCA 1NEQA 3OQPA 4WBNB 4PPGA 3GMSA 2GNOA 2JEZA 2WTXA 2PXAA 3MPUA 4JKYA 4LS3A 4NOMA 5K3CA 3H65A 1FXWF 3W8DA 4K9LA 5ISMA 2BZGA 2NU7B 3F6RA 3A4YA 3F6EX 1FYXA 3S2UA 3WWZA 3ZJUA 4JHLA 2YWEA 2IU4A 5JV5A 3LOQA 2VSXA 2NZ2A 2Z98A 3OLCX 4L73A 4NAHA 1WNFA 2WUGA 3PUJA 4NMHA 1LWNA 3BXPA 1L1MA 1TEVA 2FR8A 3E5RA 1WVGA 4DQDA 4E07A 4LEIA 5CITA 3M5PA 2JZOA 4CIWA 2ZAIA 2A9PA 1XMVA 2R5WA 1WEKA 3G2HA 4OEHA 5E4TA 1QFYA 3OCZA 1Y98A 2EW2A 2P27A 4LZOA 4TRNA 4U8GA 4KPEC 1X13A 1RLUA 4ODIA 4MAAA 3K1TA 3QF4B 1YBMA 4PGHA 5AO9A 5HGXA 1MGOA 2QQ0A 1IDN1 4P7BA 5AP9A 2ZB2A 3ZDZB 4CM3A 3X2FA 3F9CA 1G7RA 3N8NA 3IR6A 5EXDA 2DY0A 1HT3A 4GD3Q 2R8PA 2H1HA 5GONB 5IVPA 1QU3A 2Q5HA 4FMPA 3M81A 7ABPA 2GPJA 4LJRA 4QGFA 1YU9A 1NLYA 1Y8QA 2IZOA 3OCXA 1Y1LA 3ZDAA 1J23A 1W87A 1U5BB 2GZSA 4NDWA 3DWFA 4AJHA 4W5OA 1E64A 4NIMA 1FRZA 1DINA 1LBHA 1Q0SA 4BEWA 5BO5A 1JHUA 2IC5A 3BYZA 3TKLA 1OLSA 1M76A 4FMDB 3TS1A 3VA7A 3EZFA 2VHWA 2XB8A 2QUAA 2V9CA 1Q95A 1V6CA 3W6NA 2FF7A 3BRQA 4A03A 4JS0A 4AF6A 1QUEA 3IERA 1KPIA 5DNUA 1U3CA 2FN4A 5GM2A 3CYFA 4EW1A 1SAYA 3M33A 1VI5A 1R37A 1J33A 5A9RA 1UC8A 3ONFA 3TSCA 2YWHA 2WILA 1ZCAA 1PX2A 5DLEA 5KTNA 4IVQA 4OKSA 1T4BA 2FWAA 1SHTX 4LC9A 4PZLA 2PZMA 4TV8F 4YJ3F 3RC2A 3B1VA 1C0IA 2JQEA 1FRQA 2C2GA 3K9LA 3LC0A 3MS2A 3AR4A 1ZUNA 1MZVA 4QE3A 5GOTA 2IUUA 3UJDA 2G7MC 4MKIA 5I8ZA 5JNLA 3PJFA 4N9WA 3K9WA 1UFKA 4L5AA 4DILA 2R7MA 4KUEA 4MUXA 5AM0A 1PJZA 1G8PA 3IVGA 2ZI7A 1AE1A 3PBKA 4KDFA 5CNJA 5AWFC 3RF7A 1NFRA 1XA3A 3ABZA 1QO0A 4J0HA 5BNWA 2QSJA 4BVEA 1O96A 2X8LA 4BDSA 1AHNA 4LJYA 4I81A 4S12A 3VBEA 4G1BA 4DV0B 3RADC 3ZHOA 5FA6A 2VP2A 3IHWA 3KHUA 4XR9A 4IXNA 4KZKA 2PT6A 3HR4A 1WULS 1KETA 5LP6A 3FDIA 5C8ZA 7AT1A 1U28C 2FLVA 4N0PA 2WIKA 3H4MA 3P5SA 3UM9A 5C1DA 1NIJA 1E1RD 2HQ1A 3PE6A 4NTZA 2JIZD 3A4VA 4CTJA 4Q7KA 3TELA 3LHSA 1HTTA 4BECA 3UWKA 3U44A 2QVXX 4DRXB 4KIUA 1QOZA 2QG4A 2NTVA 4GEKA 2QUKA 3O3CA 5KTTA 1R4MA 3DPUA 1Z9BA 4I55F 1CUBA 4YHHB 3I6ZA 2QZZA 3OZRA 4US0R 3W90A 4ASUA 1EH5A 4G4SP 1W36D 4JEMA 4PLZA 5F7OA 1K6MA 4O2BF 2R6AA 2YMMA 4I0WB 1A7JA 1GG8A 3AUTA 3ENZA 3VC3A 4D8TA 2KWIA 2WLSA 3U9LA 1F3OA 1Y1PA 3ESXA 3OIWA 4MR8B 5DYNA 1TU4A 4F9TA 1WQ4A 1VG9B 2W4QA 2MT9A 3WK4A 3ZDEA 1L5GB 1KORA 4X4IA 3DV2A 4R8LA 3GXOA 3U2QA 1ZKMA 4E70A 4NMMA 1N5KA 1IK4A 2AGVA 3ANXA 1SPXA 2HQRA 4ZDIA 3O2QB 2JF0A 1PNRA 3DH0A 5KSWB 1JLLB 3L0DA 3PQEA 5I51A 2P5UA 3FKQA 3JRNA 3MLBA 2O8EB 1C80A 4K28A 2IHKA 4YAUA 2WSBA 2NMVA 1IY2A 3V7NA 3U81A 2OCKA 5A06A 5FBLB 3B1XA 1GTVA 4QSHA 1DGQA 2EP7A 3AB8A 3HUFA 3D3WA 3S3TA 1LPMA 3T5CA 4M6WA 5ALKA 4CR6A 2IH2A 1Q92A 4DE8A 3WMFA 1GVNB 1R8QA 2IELA 2ZVPX 3GC6A 4QRDA 3RFCA 4AY5A 2PGOA 4RY9A 1KK1A 2NTJA 5KAPA 4YR7A 4ID9A 4D56A 3OU6A 2ID4A 5IWCA 4B9AA 4IZOA 3VZPA 3VZCA 1MX3A 4MS3A 3GLFB 1Z6ZA 1N36B 2BY4A 3O8LA 4OJNA 5F4ZA 4YQFA 5KJCA 1B73A 4YFVA 1E0JA 3BRCA 4EG1A 3DW3X 3ITDA 1K68A 5CG2A 4X4EA 1E3LA 2EF8A 3VK0A 3MA0A 4HNAB 4AN4A 5EN4A 4KFSA 4NATA 3RK4A 3EXAA 4TTJA 4WWHA 3VV2A 2BCGY 2EJUA 4GZMA 1XC7A 1PEYA 3CROL 4HKTA 4NAVA 4AZSA 2NXJA 1DBVO 4LMAA 3SYKA 4B8WA 1AGYA 3U4DA 1UMBB 4DB4A 4Z6KA 3JPYA 3B7PA 4UHDA 2IWRA 1RIIA 1FW8A 4MJXA 2GJ9A 3A32A 5CR9A 1NI5A 5KYVA 4CT0A 3EGDB 4XUCA 1ESNA 3FRJA 4HNGA 5EA2A 4BZQA 2GPAA 2YQ5A 5FYQA 3KQSA 1SQ6A 1SD2A 2OOSA 4ROSA 3RARA 1R2QA 3L7BA 4X92A 1EUDB 3NNNA 2JHAA 1SU6A 2VK1A 1I36A 1P9WA 1GPMA 2PBZA 3FYSA 3M82A 2MWMA 2QQFA 4LMPA 4N0MA 2FSHA 4BQRA 4EFNA 1RZUA 3HCAA 1ZITA 1JNYA 2GAJA 2EYUA 1QH1A 3KFVA 4D9GA 4IA8A 2QUIA 5DBIA 2K2QB 1YDHA 4C7KA 5JSHA 4FLFA 2V0NA 4HDKA 5IANA 1G291 2V59A 1OXTA 1BTOA 4QGHA 1ADJA 4X7MA 1BJTA 2H31A 5HE9A 2PXQA 5DXFA 4XVQA 4K6CA 3ECSA 5FBRB 2XF2A 4D26A 5C8DA 2ANCA 2HFKA 3RGWS 5JE8A 4YLYA 5ALOA 3BGIA 2E4UA 2B6HA 3PHJA 3A9RA 2F3PA 4GVLA 2C9MA 2VHQA 2BEWA 2RHMA 4QGAA 2NVUA 4BLQA 1I4TD 3R3ZA 3A9YA 1Y6QA 3DYIA 2QR2A 3FNGA 3BIWA 2IEZA 1JIUA 3GLHB 1M8KA 3ZD6A 4GBED 1S7CA 1ND6A 1SIBE 1XLWA 4JL6A 1NP7A 5AKZA 3KE9A 4EA6A 2LIVA 4ENWA 3RTEA 1OBOA 1DX9A 2QE6A 2ZUVA 621PA 3PZBA 4XX0B 1GR1A 2HLDD 1ZH2A 3K20A 4L8FA 4CM4B 4PN7A 4CIVA 1ARZA 4HC4A 5FAKA 3SVLA 4I1IA 2WW8A 1WUJS 2II6A 4OD0A 5A05A 4BB0A 2JGFA 4OXRA 3U7JA 5JIBA 3K0KA 4XM0A 2IIBA 3B5JA 3DD5A 4CR7A 1R27A 3LLMA 3FOAA 3OKFA 3WIVA 5JNRA 3CINA 3ANSA 4TYPA 4IRMA 1Q0PA 2R96A 3FAKA 4FLEA 2NIPA 2PXXA 5TB5A 4I8DA 1U99A 2OCPA 4D4MA 3FNIA 5JYEA 2W7TA 1U6JA 2HCSA 3UUGA 1CEXA 4V0OA 2NTEA 3C6MA 3ROEA 1FUUA 5DTQA 2JBAB 2TSYB 1PR5A 3EVZA 4FGJA 4Q1FA 1K08A 1GIAA 3G79A 1OZHA 3CRVA 1E6MA 3KDSE 4G0XA 4CF6A 1A88A 1RPEL 3K2BA 1L5SA 1P81A 4RTNA 2KS6A 4GLOA 3HI4A 4R7TA 5L51A 3RHFA 1IYZA 4B2LA 1YQXA 2RAFA 3KJNA 2J46A 4V2UA 1X7YB 3VNBA 4ENQA 5FTWA 2WNHA 4QPNA 5CB4B 4JSRA 3NO4A 4L0DA 3UGQA 4I4TB 1JW9B 3LBHA 1ODJA 3KLPX 2OILA 2XB9A 4JJGA 4RLQA 4CEHB 3CBQA 1DBRA 2BELA 2ESRA 4ZN6A 4FTWA 1YRHA 2QT1A 1P5ZB 2MSNA 1ZIDA 5KQSA 1M2HA 4A27A 3QFSA 4YUYA 1MAWA 3RVOA 1XZBA 2VJKA 1UDRA 4OCZA 1QHGA 2ZIUB 1FDTA 5F7ZA 1XTZA 2Q6VA 4TVSA 4B7UA 5K3FB 4D6YA 4EG6A 1FNNA 1ZMBA 4TMFA 1T8WA 3GFGA 4IIEA 4ARCA 3A0RB 3PEYA 3QUAA 4ZAGA 1PGPA 4MINA 1PJBA 3NBAA 3V00A 2CWWA 1ESZA 3LVFO 5CA0B 2QD1A 1CUEA 4KC0A 1W94A 3GT0A 3NV9A 2GK3A 2R6HA 2VJDA 3LFPA 5IS2A 5CVJA 1L7BA 1RDFA 3L7AA 2P6NA 3F52A 2X0FA 1KY3A 3M2TA 4MCHA 5JQGB 1DVRA 3PHGA 1L7NA 3MTGA 4RKFA 4F2WA 5BR4A 1I3MA 5AHRA 3FXAA 4GX5A 4IDQA 1IN7A 2GETA 3AOGA 3CLRC 421PA 1UEXC 1ULTA 4QOIA 1LZKA 4AUKA 4M46A 1LPNA 1HV8A 3OPYA 3NWBA 1GSAA 1DBIA 3PUZA 4H27A 5AJUA 3JAWA 2QVYX 3L8ZA 2W6QA 4P0TA 1KE1A 2ZKIA 1BE0A 2MSKA 1GZ4A 1IHUA 4II7A 4C0LA 3G7DA 2YS6A 3OMWA 1YF3A 2LZ0A 2XGOA 3SBOA 2BMWA 4J76A 3HDVA 4TMYA 2IDMA 3I3SR 2I3DA 3HYNA 1KMHA 1UWVA 1JJ7A 4B8ZA 1HDEA 4E2YA 1ZM2A 3Q3VA 4YWJA 3LCCA 1ETUA 1FYWA 1TUBB 1T4GA 4BKOA 2BF4A 3CJTA 3PVSA 1S3FA 5A71A 4QARA 3IP5A 1G8MA 2BFDB 4OQYA 3LK6A 4Z4FA 4J0CA 4DABA 1P74A 3B3GA 2WICA 4OM8A 1PJ2A 5TPWA 3MXTA 1QQTA 4TOIA 1YCDA 1VCNA 3AY3A 4B6OA 5ICEA 4U7DA 1XPOA 1XX6A 1CLUA 1WP9A 4TTSA 3SOZA 5KNBA 2J3EA 4LRSB 4BO7A 3VNQA 2GUWA 4PQYA 1NASA 4QPZA 3ZWOA 1XZLA 4CMCA 1TU0A 1XTBA 2DTEA 3LC1O 4IOLA 3U80A 3WTBA 1RPNA 1QVRA 3R7NA 2AOXA 3WQHA 5IJ0B 3RKRA 4E6PA 3G23A 1YZVA 5L4SA 2HT6A 3DBRB 3S2FA 3VTKA 2NYRA 2YJNA 3B36A 3L4KA 4Z8YA 2ZM6B 2P9YA 1T29A 4J9VA 4AZ0A 1MVLA 4BN4A 1E2IA 1PUIA 4Z1MD 5C4MA 4BWGA 2F4VB 2CEAA 2C20A 3ZWMA 1SXJE 2R6JA 1Q0QA 3AONB 3PSAA 4BASA 3A1UA 2I3AA 4MVJM 4GFDA 2XB6A 2YH2A 4O8ZA 4TSRA 1ISRA 1FPQA 3JZIA 5GP1A 4F4IA 2DPYA 4A1OA 3WICA 1NWCA 2G1PA 1O94C 1YJAA 2GLTA 4XJTA 2W0SA 2RGNC 4LYGA 3EF0A 4ZCIA 4V24A 4P4UA 3RU7A 1B41A 1D6JA 2ASEA 4IQ0A 4WADA 4ZOLA 4F4CA 9LDBA 2R84A 2ZIGA 3LKVA 4YV1A 1OI3A 3A6ZA 3QLTA 2IBMA 4RK6A 2C3OA 3ZZ1A 4A0HA 4EYGA 3EVNA 5IT9A 1V7QA 1F7VA 2DUUA 1VL2A 4PFJA 2CV2A 1VE1A 1EVYA 2G0AA 3FW1A 3OM1A 2ZYSA 4G1CA 4RK5A 4FGKA 3WOVA 1C41A 5EY5B 4DR7B 2PX6A 1U5AA 4K9SA 1PLJA 3DW1X 4YRPA 2QN7A 1YB6A 2FKNA 2HCTA 3SZLA 3PFHA 1GEEA 2E85A 1XFAA 2ARKA 1U9IA 1I14A 2FZWA 5HKBA 3NONA 3L0IB 1AO0A 3UBTA 4IHJB 4WCFA 4KG7A 3ZX4A 4MJ3A 3T7TA 3X2SA 3GEDA 1HTBA 1KS9A 1NW4A 1TJYA 1OJ7A 1QP8A 1J0AA 2DBRA 2PX0A 2UZ0A 3ETCA 4Y18A 2MR6A 1Z5ZA 1ZY2A 2XE8A 4ZV7A 5GINE 1GTJ1 1WEHA 1IBCA 1NBME 2GKGA 4DB2A 3QWIA 1G16A 1OF1A 3A3OA 4MWOA 4PO1A 4CKCA 2ZT7A 5KYYA 4UZSA 3WLEA 1MEJA 1SC3A 4AY4A 1BC5A 4OI4A 4QPJC 3UHPA 5HCIA 5A62A 3FCCA 1XG5A 3JZAA 4Q00A 4PNEA 1WXXA 3W06A 1TXGA 1Y5MA 4F3NA 2ZEJA 3MMPA 3QE0A 1ZD8A 4ENRA 4LXQA 2O6LA 3DKVA 3H16A 4NCJA 1K7SN 2QSYA 3TFQA 2EQ5A 1G55A 4U7TB 4OHYA 1JIXA 2JAUA 1OBFO 1CDDA 3UH1A 5A4AA 4A2WA 5AI4A 3UQYS 1Z3CA 3CF6R 5IMBA 1YFZA 2Y0DA 1J1IA 1E9AA 4E4RA 1QRUA 4R81A 1F4LA 3AW8A 2GSWA 3L6EA 4PAWA 2QP4A 3LYHA 2J7PD 3SKVA 1W1WA 4RCZA 5KJFA 3S70A 1OLOA 1TCUA 2ZWAA 4FDUA 5JXWA 1U2QA 3S68A 3WWDA 3VPAA 2OBYA 3TUJC 3WGQA 4FUQA 3KOYA 4DDWA 4DQUA 5AFSA 1L6IA 3CT6A 1CPYA 5CA1A 1KP2A 2FR8C 2OP0A 3FA2A 3L4JA 5IBQA 1JA0A 1HX7A 4ZVQA 1JZTA 2D4HA 3DG9A 4EFKA 3NAZA 5ES4B 4BQNA 1WUIS 4J4HA 1TJ4A 4V0SA 5HA5A 3M34A 3VNRA 3H5VA 2DE0X 4BQQA 3DDCA 4N5IX 4KGZA 1B00A 1AKMA 1K89A 2VAWA 3RYFB 4OX9B 2DM6A 1JXQA 3CZQA 2PXTA 1FDVA 4EYSA 2FQYA 5IJ9B 4FGLA 1LA2A 5TQ2B 4F1KA 1U8CB 1V5WA 2I78A 3JX9A 3EGIA 2KPOA 4UE6A 2NV6A 2A1UA 4CG2A 1NURA 3C5VA 3WQBA 3PNSA 4PZUA 2OD9A 1KYQA 2PWPA 3NDRA 2QTCA 4ZCTA 1XT6A 2FV8A 3Q72A 1E2KA 5BWMA 4BNDA 3FZYA 3FWYA 2R751 2C2MA 1DNPA 2AHOA 4Y1RA 2Q3LA 2EARA 1E9SA 3AV0B 8LDHA 3F4KA 2RI1A 3VC2A 5JR3A 3CH4B 3HR8A 1F2VA 4LAFA 1X1BA 5DGDA 4ZT2A 5BYJA 4EYOA 3TW6A 1P17A 2BKVA 4F2HA 2ASVA 3VGJA 3HJCA 2CKDA 3BPSA 3BD7A 4OHPA 5EXPA 5FOXA 5G0SA 2OFFA 1AZWA 4IJ5A 2AJLI 4ABYA 4Z7QB 1TCBA 2ZDHA 1RVDA 3INNA 1BYUA 3GLVA 3JALA 2VAPA 4JUAA 3AF1A 2O20A 4EY6A 4E5DA 4UUOA 5DB4A 1GXSA 1ANKA 3IBFA 1POWA 1USGA 3KU4A 3P9KA 4IWYA 3RIXA 4XDGA 3WK7A 3RIYA 2Q1XA 4I66A 1NY5A 1SKAA 3P32A 3UB2A 3OZSA 1XP8A 1IWPB 1Z38A 1SHZA 4G0VA 1WR8A 2K4MA 4GWKA 4YMHA 4PLYA 2PXHA 1TPYA 4OHCA 2V8OA 5DNDA 4C5AA 1Y8RA 4KR7A 4N6OA 4Q12A 3HKBB 1WDMA 1X2LA 1TF5A 3PDWA 3RU9A 3P52A 2BZSA 3G2JA 5FUWA 4HRXA 1OREA 3V7FA 3OM9A 2PRJA 1MH1A 3KXDA 4EIWA 4EVRA 2BFAA 4NE2A 2XZPA 3SQLA 4WOPA 2VJPA 1DADA 2XTNA 4WEQA 3O4IA 2PVSA 4L6IA 4O6VA 1ORVA 2PKCA 3IP1A 3SXPA 1QLHA 1UQUA 1WS6A 5FTNA 5DW3A 4EGSA 5KNCH 2FPOA 2OHVA 3A6JA 2J1LA 2IOFK 5LP6C 3BXHA 2IF2A 2WQ6A 2C9CA 2XTZA 3AI3A 4RY0A 2BNMA 2BZ0A 2OGWA 2QTMA 3HWRA 3OKAA 4GMDA 4ZVOA 2AFHB 4EPTA 1JDBC 4PNPA 5TY0A 4G26A 1HO3A 1NN3A 1FBTA 2R86A 2IQIA 1NLUA 3GCDA 3M4NA 3NKFA 3IIIA 3ILXA 2VDNB 3ADPA 2ID8A 2YWRA 3C3KA 3P2IA 3QLUA 4K6FA 3IPXA 3SDBA 2JFHA 4I3FA 1RJWA 3BRSA 1AKNA 3CCBA 3FWZA 1ZNZA 4URZR 5LA6F 3WS7A 3IMEA 1U0EA 3WNCA 2FE1A 3LPDA 3QEKA 1RXWA 3G88A 3IAFA 4HH3C 4NU5A 4R16A 3QYJA 4C05A 2GWRA 1AU9A 1WF6A 3QU7A 2XMDA 4X6YA 1WUTA 4COKA 5CT6A 3D3QA 1NQOA 1E1LA 5SYNA 4EELA 3M8KA 2AUWA 2OD7A 1EWQA 1FOEB 1E2DA 3GB9A 2HDOA 2A5LA 5EE9A 4L0MA 1II8A 4PC2A 5EJMA 4TZTA 1G98A 4A92A 1XDBA 1ZPDA 1LDEA 1J97A 1P4RA 3BULA 3SD7A 3SIXA 2IRWA 2XOXA 2HWXA 2QAGB 2SHKA 5TC4A 3WL5A 1RIOA 1P91A 4L2IB 5IM5A 4BEJA 1MEEA 4M37A 5D86A 3K0HA 3AF4A 3KTDA 4GQMA 1RI5A 2JG3A 1LLQA 1USKA 1X3LA 3RK1A 2J9ZB 1N2HA 5KU1A 4WJLA 5JH7B 3RJZA 4LF9B 4D9KA 4LHYA 5J4HA 1M6EX 2CSXA 1H2XA 2JFBA 3P0EA 5KTPA 4YH1A 5C31A 4DR3B 5CVTA 1DE0A 3UHAA 4BN5A 2JGMA 4JVMA 5TIIA 3LL7A 4X93A 1WUYA 5FJIA 2DLCX 2IJGX 1KOJA 1GUYA 2AD5A 1NN1A 1DAKA 1IBRA 2B5VA 1W7AA 2ZYDA 5CIWA 1I7DA 1IULA 2YWXA 4PLHA 2G6BA 7REQB 2OSVA 1Y1RA 3B3QA 4L3VA 5DSTA 2CZQA 4H2DA 5JSQA 3UOWA 5BW5A 1LI5A 1QHHA 3F6PA 1FNDA 2QE7A 1R6DA 2HDHA 4LF8B 2VHEA 1RLIA 3O90A 4OBBA 5JAQA 4WCVA 1CJMA 1H22A 1LLFA 2VAVA 1YGYA 2WKRA 1I24A 4FEGA 2OAGA 2M1ZA 1DULA 4MWEA 2VRWA 3ETHA 5ECWA 2BAGA 2ECFA 3MSCA 3CJRA 4GI2A 3FTNA 4JGBA 3DFUA 3DKPA 4R0VA 4E09A 2XJ3A 4ERNA 5EWLB 5IVKA 2VPWA 4LJLA 3AJEA 4Y2PA 3SF8A 1PEAA 1TK9A 4ZYVA 4PWZA 4JLKA 4CEIA 5B3LA 4C9BA 2QT9A 3PJEA 2QOEA 1G8KA 1NIPA 2FSUA 2WA1A 3ETDA 3MTEA 3MUEA 4I36A 4KZPA 4MS1A 1CERA 4YFYA 4BY9E 2O9JA 1Y6JA 1GLNA 5FUYA 2AZ4A 1K4YA 1W2WB 1DWOA 2QDXA 3UHFA 2WPDA 4KX3A 1XDWA 3BSYA 3JVDA 1XMIA 2IPOA 4BNVA 3H42B 3T9EA 1IRIA 2G08A 2WUWE 4H7JA 4DV2B 5DLQC 4Y3UA 2CNKA 5JBIA 3HB4X 3KB1A 3QNWA 2OFWA 2A0FA 3HCOA 1Y1QA 4BVLA 3FF4A 1RLTA 4LA4A 2CYCA 3A37A 5EMKA 2BTOA 2W48A 1NVUQ 1T2UA 1XCLA 1JG7A 3UGJA 3WB1A 3G68A 3K32A 2J41A 2EBUA 4B3MB 4ZYYA 2CLFB 4IZIA 1Z28A 1ZD9A 1IE3A 3N75A 5IDVA 1IMJA 3PCXA 3W2HA 5K4HA 1A9RA 4X1YB 2V5VA 2PZLA 4CTKA 2JKVA 1P77A 4B85A 1XZEA 3OCWA 1E7WA 5DT2A 1O95D 4LPKA 2WVAA 4JT8A 1XLUA 2HSJA 3CKMA 3L1KA 2X8JA 3FRHA 4V0QA 3CWQA 2Y2VA 1CY1A 1E2GA 1WKVA 3H7IA 2CB9A 4HSGA 1WXFA 3FWHA 4ETIA 3OTQA 4YJGB 5KNDA 1YQWA 3CPEA 5D00A 4QEZA 3G9XA 3ASVA 1GKLA 5EINA 4F06A 5I45A 3N8HA 4KLNA 4ZVLA 1CEEA 3PHLA 3O2SB 3NEJA 1YSCA 4YONB 2GF9A 2HPHA 3KKKA 3EZ6A 3OMTA 2N1MA 1SCIA 3CMCO 3IP8A 4WZ6A 2I4IA 3E81A 4HWKA 2VUTA 4IIUA 4LXGA 4YXWA 3CEHA 3D6NB 2M4HA 4WK4B 3UV7A 3ZQ4A 2FUEA 4BBJA 5IF9A 2JLZA 1LDYA 3GBVA 4EY7A 4QKQA 1Z4IA 4LJSA 2BGIA 4N49A 2P4EA 1DTWB 3RIMA 1Q3HA 2QYOA 4KH0A 4Q7LA 2P2ZA 3OFVA 3TAXA 3NMUF 1T4DA 2PHZA 4KWTA 1BCRA 1D2GA 3X43A 4BUZA 3ZNPA 1K6EA 1YOVB 3Q7RA 1NMQA 2OV2A 4EHKA 3OU7A 1XVIA 3LC2O 4L6AA 4UCFA 1T5SA 4A73A 3L1IA 3ZVNA 1UPAA 3VX4A 3KYCA 1GNRA 1ECBA 5BWLA 2QEQA 5E8RA 5SY6A 3QI7A 3CLTD 3DCNA 5KDLA 4DQLA 2JIRA 2M6SA 3ADDA 2OCXA 3E3NA 4LXUA 4NBTA 2IV3A 1ZW6A 1FK8A 4R9SA 1CFJA 1IIBA 3LVBA 4ZT5A 3SLRA 2PUWA 3C85A 3AEKA 4HBGA 1DCTA 2AX3A 4XYGA 1FFSA 3V80A 1TA0A 1PG5A 1OTXA 2ABWA 1O1YA 3LHKA 1LH0A 2W6CX 1CUJA 1GCGA 2WZCA 3F73A 5TSDA 1CNFA 3LKDA 1Q1GA 1ZMRA 2KHZA 3MLAA 3R3UA 4J4BA 5BQXA 4JJ8A 2ZIAA 2B30A 3C6KA 5KYXB 3T3MB 3M3HA 1W5EA 2J5BA 4G0YA 3NATA 3HJFA 4H7FA 3LAWA 1FQKA 3A10A 3DPSA 1L5VA 2ODPA 1M6WA 3K1YA 3IJPA 3KPVA 5CW1A 2GFHA 1TMKA 2XCIA 4PZYA 1T8YA 2WWVD 3R8FA 2F8TA 3DP7A 3DB1A 3W05A 4XUEA 2BFBA 2NPIA 1BGXT 1N2CE 2ACVA 2G4VA 2Q62A 4M0UA 2OZPA 1LX7A 1QLWA 1WXWA 1VHWA 1Y9AA 3UAXA 5FADA 2HK9A 3MAGA 1DAFA 2QD3A 3VR5A 2QDKA 3KO8A 1S01A 1DCFA 3RJ9A 3G0DA 2NU9A 2O48X 2OGUA 2JRLA 1EWRA 1I01A 1Y7PA 4P38A 2CMDA 3BD6A 2V6MA 1A9OA 3PQFA 2DBVO 3IOCA 4MQLA 4K9OA 4YCSA 1CF9A 4FJ1A 2DWPA 4AP6A 2R68A 4JJEA 1RXIA 4X1OA 2B83A 2VK2A 4CLRA 2GRJA 3D8BA 2G82A 3PKZA 4E5PA 1XNJA 2WYWA 3O7WA 3ODPA 3UJ6A 1MZPA 2OC4A 3BJEA 2ZAOA 3BBPA 2QXTA 4CT5A 3FLEA 3KZVA 4FZRA 4QRHA 3J81k 3CUWA 1HQYE 1A9YA 5CEJA 1RI3A 4LISA 5G41A 2RGRA 2H1IA 3MCZA 2OG2A 1LNQA 3WGVA 3I2HA 1JIVA