4EK9A

Crystal structure of dot1l in complex with epz000004
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
328
structure length
325
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Conformational adaptation drives potent, selective and durable inhibition of the human protein methyltransferase DOT1L.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 99
structure length 325
sequence length 328
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4ek9A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ek9A02
3LPMA 2GLUA 4GUAA 1MJFA 2IPXA 4PWYA 4B17A 2ZZNA 3FUTA 3BXOA 2P3OA 2XBMA 5JR3A 3B3FA 2PXXA 4ISCA 2UYOA 2AVNA 2ESRA 2YVLA 3I5UA 4C05A 5CD1A 3FRHA 3SVZA 4HG2A 5E1OA 4AZSA 5MHTA 3MTEA 4X41A 4U7TB 4GC9A 4H0NA 4X1OA 5E2BA 5K0FA 3LCUA 2NYUA 4QVKA 4LECA 3GDHA 3HA3A 3L8DA 3DMHA 3HVIA 4KRGA 4XUDA 3TLJA 4DQ0A 3ELUA 1HMYA 5FHQA 3TM5A 4E2ZA 2B78A 5EZSA 4BLVA 3FUVA 1WG8A 5DTRA 3P9IA 2A14A 4HH4A 5K09A 2ZZKA 4QDKA 1FPQA 1Z3CA 2IIPA 3BWYA 5F2NA 5LQRA 1JG1A 4BY9E 4YUWA 4X63A 5K0EA 1SQGA 1EIZA 1ZG3A 3BGDA 2ADMA 1KHHA 2PWPA 3CBGA 1ORIA 1EAMA 2CL5A 3GRRA 3SSMA 3R0QA 2R6ZA 1WXXA 4HRAA 3B3JA 1INLA 1ORHA 2EX4A 4R6WA 2YXEA 1QANA 3PX3A 9MHTA 1QAOA 2P1DA 1VLMA 4EKIA 1JR4A 2O06A 5DPMA 1JTFA 1AQIA 2GAFA 4RX1A 3C3PA 3UJ9A 3G8AA 3OPNA 3UZUA 4AZTA 3DR5A 4DA4A 4HTFB 2ZZMA 2Z6AA 3CC8A 3GCZA 3BT7A 3BZBA 4EK9A 1R8XA 1KP9A 2K4MA 2VS1A 2G72A 3BKXA 2HTEA 1MHTA 4CTKA 1AV6A 7MHTA 3AXTA 5P8WA 4K6MA 5EG5A 4CKCA 3EVBA 4NECA 5DSTA 5E9JA 3TKYA 5GIPE 2ZTHA 3UJBA 3PS9A 1RI1A 1X1AA 2CKDA 3ELWA 3R24A 2IH2A 3NVMB 4YUZA 2HV9A 3ERCA 2BR4A 1NW5A 3BGVA 3FPGA 3GRZA 4OBWA 2V74B 4R6XA 3EEOA 1BOOA 3C3YA 3KPVA 3VYWA 2C7PA 3UJ7A 2OBFA 4HGYA 2YX1A 1B42A 3HVJA 4RVGA 4RYLA 5EOVA 4CXMA 3OZTA 1WZNA 1UFKA 2Y1XA 2WK1A 3EMBA 5KVAA 1TW3A 3KQPA 3GO4A 5DX8A 4A6EA 3D2LA 5HIKA 3BKWA 3UA3A 4QQKA 3HVHA 3JWJA 5DTQA 2AS0A 4PGHA 1D2GA 5BXYA 4HTFA 2FHPA 2ONYA 4FZVA 2ONZA 2B25A 2UYQA 1DCTA 4KW7A 1R00A 2OKCA 3ANXA 5ICCA 2PY6A 3UJ6A 2N47A 4EQZA 3O4FA 1JG2A 4GOLD 2ZSUA 3G2QA 3P8ZA 4PIPA 3V8VA 2CWWA 2P3LA 1PRYA 3GNLA 3UFBA 3P71T 3C6MA 4DKJA 5KYGA 2B2CA 4BP3A 2OPBA 3EMDA 4POOA 2AOTB 2IGTA 3FUXA 5FA5A 2XVMA 3KR2A 5DWQA 5EHGA 5HEKA 5ERGB 1QAQA 4DZRA 1Y8CA 4ER6A 3HCAA 3OZSA 2NP7A 1BHJA 3UJAA 2HR1A 1KPGA 2YUIA 1JQ3A 3WSTA 1ZQ9A 3FTCA 5FADA 2YXLA 2H1RA 2NXJA 1ZKDA 2GS9A 4YUXA 5CVJA 3CCFA 3MERA 3BUSA 2AOUB 4V0QA 4EVIA 3HCBA 4QTUB 3HTXA 3REOA 1VL5A 3FRIA 5EMJA 3UBTA 3NVKI 3B3GA 3GRYA 3KR0A 3TPZA 5DXAA 1YFJA 1BKYA 2UZ4A 1VQ1A 3KQOA 4PYMA 2IBTA 1R6AA 5DRTA 5F2OA 4XUEA 5FA8A 1KPIA 1R18A 3KQYA 2PT6A 4E31A 3A27A 5EEGA 3ME5A 2BZGA 2OYRA 4KWCA 4LG1A 2BR3A 4M37A 5EHIA 4C08A 2AOTA 2ZULA 4BLWA 3FUUA 5E1BA 5GINE 2IH5A 3AY0A 4RVFA 4O29A 2EG5A 2NXEA 2I9KA 4QPNA 1X19A 5EKXA 1OR8A 2FCAA 2FK7A 1L3CA 1XDSA 1ZGJA 2PLWA 2PT9A 3DTNA 2FYTA 2ZW9A 3I64A 4FSXA 4DMGA 5LQKA 3R3HA 2AOUA 3FPFA 4QTTB 4X60A 4C04A 2JH9A 4RTRA 4RTJA 3A7DA 3C6KA 3KQQA 3MGGA 2PSSA 2PX5A 2H11A 2ZCJA 3I58A 2IP2A 4PNEA 4RTLA 4ER0A 4E30A 2JG3A 4EMSA 3CKKA 3DOUA 3EVEA 5E1DA 3G5TA 3T7TA 3SMQA 3V97A 4AZVA 4PYJA 4P7GA 4BLUA 4OBXA 5LQCA 1P39A 2PX2A 3IHTA 2QRVB 2IDJA 3LECA 3A7EA 3LGAA 1G55A 4ER3A 3KQTA 1P1CA 5FCDA 1EQAA 5EKUA 2AR0A 3M33A 1YZHA 5HIJA 4E33A 3IEIA 3CVOA 1SVUA 5DLYA 2C7OA 3M6VA 4AZWA 4DM3A 1JQDA 2G8NA 5CCXA 2BH2A 2QE6A 4QPPA 2GPYA 5GWXA 3EGIA 1G60A 2F8LA 4MHTA 2WA1A 3GJYA 4CKBA 1N7JA 2IH4A 3FTDA 1NV9A 3EVZA 1VE3A 1XDUA 4RTKA 1RJDA 2OO3A 2P3QA 5K0BA 5CM2Z 5K0LA 2Z6UA 3GWZA 3HA7A 3SGLA 2BM9A 2EJUA 1O9GA 5K01A 2PWYA 3TM4A 2AOXA 3QV2A 1N2XA 2OXTA 1EJ6A 1XDZA 2O05A 4R8SA 3K0BA 3VSEA 4EKGA 2AOWA 2PBFA 4Z2YA 3FPEA 5FHRA 2VP3A 4KDCA 1QZZA 4V0RA 4GQBA 3M6XA 3PVCA 2QRVA 3R6TA 1O54A 2QYOA 3KPWA 3A4TA 2AN3A 3NW9A 2NXCA 4XUCA 1L3IA 3UA4A 4F84A 5LQJA 3FZGA 2GB4A 2P7IA 5DXJA 2JHAA 3THRA 1RI4A 3G8BA 4E32A 4GBED 4PCLA 3DP7A 3F4KA 1JSXA 5E1MA 1SKMA 4X61A 1G38A 2I7CA 5BP7A 5FQNA 1RJEA 1P91A 3KR1A 1RI2A 1VP3A 4RVHA 1YF3A 5GOZA 1Q0TA 5K0NA 2PX8A 3PLAE 3CGGA 2YTZA 5E9QA 3G89A 1Q0SA 1VBFA 1X1BA 2BR5A 5LQUA 3P2KA 3FTEA 4MWZA 2VDWA 1R8YA 2O0LA 3EVFA 2YR0A 3BWBA 1D2CA 2ZBRA 3LDGA 4PYLA 2ZVJA 3T7SA 4LWOA 3HCDA 1JQEA 2ZWVA 1X1DA 4IWNA 1NBHA 3DH0A 1I9GA 2AVDA 5DT2A 1XXLA 2EFJA 3KPJA 3M6UA 2ZIFA 1NV8A 3EGVA 3MAGA 4G56A 2PXCA 2XYQA 3LBYA 3LKDA 4Y2HA 4YV0A 3SX0A 1AF7A 2VZ9A 3TKAA 5FWAA 3AXSA 3LCVB 4OA5A 5IH3A 4BP1A 2JH8A 2ZFUA 1XJ5A 4GF5A 3BGIA 3P9NA 4FT2A 4MQ4A 1NW8A 3O7WA 4E70A 2Q41A 5E8JA 3AJDA 3EVDA 4RTMA 1WY7A 3PFHA 1XCJA 3B5IA 5HFJA 3FPHA 4RV9A 1YUBA 5B1SA 3SR4A 1TW2A 2LD4A 2P40A 2YXDA 2FK8A 1JTEA 1PJZA 5D1NA 1VPTA 3LDUA 5E8RA 3DMFA 5ICGA 2IDKA 4C07A 5KS2A 3IYLW 4ATNA 4CKEA 4C03A 4CTJA 1V39A 1FP2A 5JUWA 3KHKA 4RVDA 5EPEA 4HSGA 4AX8A 4RTPA 1M6YA 3LCCA 3VC1A 4ER5A 1RJFA 3RW9A 2ZLBA 2FPOA 2PGXA 3OFJA 5EVJA 3OU2A 4RWZA 1NW6A 3EVCA 5EGSA 1SUIA 5M5BA 1EJ0A 1SQFA 3M4XA 1U2ZA 3OE5A 2PJDA 1YB2A 3G2OA 3P2IA 3UWPA 5FQOA 1G6Q1 4HGZA 2ZBPA 4QVGA 4DCMA 4FGZA 3DUWA 1DL5A 2G71A 4MIKA 1UWVA 3DXZA 4GOND 4PYNA 4XCXA 5EIFA 5LR6A 1KPHA 4OA8A 3HCEA 3GRUA 4RTOA 3LX6A 5EQJB 4F86A 2HWKA 3KPYA 4WVLA 1I4WA 5EMKA 2PKWA 5DSXA 2ERCA 5FULA 5GIOE 3HCFA 3KQVA 2WA2A 3P2EA 2JHPA 2QY6A 3TQSA 4YV1A 4MTLA 4AUKA 3A25A 4OQEA 3E7PA 2C7RA 2XYVA 4PYQA 5K0JA 2BM8A 2I6GA 3EVGA 3C0KA 3I9FA 3KU1A 2UYCA 3OE4A 1IM8A 3NWBA 5LQAA 3PB3A 4IV8A 2FRXA 3I53A 3PTAA 2YQZA 1H1DA 1T43A 4ER7A 3OU6A 3TRKA 3NTVA 3UJDA 5CCBA 1O9HA 3R9XB 2ORED 2P35A 2PV0A 5C1IA 2Y1WA 5HOQA 3IV6A 4PYKA 3MCZA 5EZQA 3E8SA 4YUYA 3G2PA 3LKZA 1RI5A 1VP9A 5D1HA 1IXKA 1R74A 1RJGA 4P7FA 4YMHA 1N7IA 2G1PA 1ZGAA 3GGDA 1IY9A 2OB2A 4FP9A 5EEHA 5HIIA 2C7QA 2HMYB 1NE2A 2I62A 4PIMA 5H02A 5HIMA 3ER9A 3H2BA 1FJXA 3GXOA 1FBNA 5DM0A 1L1EA 3FYDA 3M70A 1SG9A 5K0GA 3U81A 3ELDA 3CJQA 4PYIA 3JWHA 2KW5A 5T6BA 4L7VA 3S68A 2HNKA 3P9CA 2AN5A 3M6WA 1JG4A 2VDUE 5ICFA 2PXAA 4PONA 5G02A 2CMHA 3TMAA 2B3TA 4QDJA 2IFTA 2DULA 2DPMA 3TOSA 4FS8A 5DM2A 1NKVA 3ELYA 2O57A 3DMGA 3DULA 4P7JA 5E9WA 3MHTA 5FTWA 4QQNA 4YUVA 4E2YA 3ID6C 2NNWB 4M38A 3AWIA 1EG2A 3X0DA 3HM2A 2P8JA 1KR5A 2VDVE 3DLIA 3MQ2A 4PINA 3SSNA 1G8SA 2PVCA 4DCGA 1F3LA 5K0CA 3LSTA 3MB5A 2NXNA 4GC5A 1SUSA 3NDIA 3TFWA 3EVAA 1ZHFA 5C9ZA 4DF3A 3HCCA 3O31A 5DM4A 2JJQA 3RIEA 4RTNA 5F2KA 8MHTA 2V7EA 4GEKA 4Y30A 3FUWA 4KDRA 3T0IA 3K6RA 5T64A 4UOEA 5LQNA 1JG3A 1KYZA 5FWDA 4C4AA 3BWCA 4FSDA 1M6EX 2OZVA 3DXXA 2Z6QA 3OU7A 1DUSA 5DX0A 3DLCA 2NP6A 3GU3A 3FTFA 4F85A 3PFGA 3G88A 3KQWA 2XYRA 3RODA 4OX9Y 4GOMD 2GA9A 1AQJA 5DTMA 3B89A 3QOWA 3LBFA 3NWEA 3NMUF 2AOVA 3HVKA 2XVAA 4P58A 5KQRA 2H00A 2OY0A 5EC8A 5ICEA 2ZIGA 3ORHA 3G7UA 2ZWAA 4YV2A 2GH1A 2P7HA 5KQSA 1YFLA 2QM3A 1NBIA 5DM1A 5EIWA 1NT2A 4JXJA 4E2XA 1I1NA 3SM3A 5CIYA 1M0EA 3E23A 2JHCA 3OZRA 3G2MA 4PGGA 3BWMA 3Q87B 5HZMA 5LSAA 3JWGA 5GP1A 4KVZA 2EJTA 3LHDA 4M7RA 2AN4A 4FT4A 3QOXA 5CUQA 3LDFA 2OB1A 2G70A 3OFKA 5CVUA 5K8VA 5K05A 1RI3A 4IV0A 1FP1D 4PCAA 2O07A 4KIGA 2CMGA 3PT9A 1WXWA 3CJTA 4YMGA 5BW4A 3A26A 3T7RA 3SXJA 3UJCA 3VC2A 4RTSA 4P7KA 3P9KA 4R05A 4RTQA 1F38A 3EEYA 3THSA 5CVEA 1L3BA 4ZTBA 3HP7A 1X1CA 3PX2A 5E2AA 4GOOD 10MHA 1JSZA 2ZIEA 1VIDA 5T67A 5IKMA 3ER8A 3G5LA 4A6DA 4IKPA 1NW7A 1UIRA 4U7PB 1G8AA 1P1BA 3NJRA 5DX1A 5GM1A 3SSOA 1KIAA 3NDJA 4WXHA 1XTPA 5HILA 5K03A 2PX4A 2E5WA 3E05A 2P41A 3Q7EA 5EMMA 4C06A 2IBSA 5FUBA 1L9KA 3P97A 3EGEA 3UJ8A 1XVAA 1QYRA 5BW5A 1BC5A 5GM2A 2B9EA 1QAMA 3CJRA 3HNRA 3KPUA 4M36A 4OQDA 1KYWA 3KQSA 4PYOA 5CVDA 3MCTA 4FR0A 3HA5A 3KKZA 3EPPA 3GRVA 4R8RA 1KXZA 3KQMA 1WS6A 4LWPA 3JWIA 3HEMA 2UYHA 2ZBQA 3TR6A 3KR9A 3OCJA 1HNNA 1NW3A 1D2HA 1XCLA 3FPJA 5U4XA 4KIFA 3DXYA 5EMLA 3MTIA 4E2WA 3LL7A 5C0OE 1TPYA 1YZ3A 2AZTA 3B7PA 3FYCA 5DRYA 4HC4A 4RSRA 2R3SA 3GIWA 4CWAA 5CVVA
chains in the Genus database with same CATH superfamily
2JANA 1SZPA 1GFIA 4B7ZA 3D9QX 3FUTA 2G4VA 3TS1A 2DH5A 1VHDA 2HU8A 1AGYA 3SYMA 3QPVA 4RYDA 3SZRA 3KZKA 1E60A 4M1TA 2XIJA 1K5GA 4X1OA 5CNKA 5NLLA 1UANA 4GKAA 3WK4A 2IEBA 3TQHA 4DJTA 3UGKA 3TLJA 4DBLC 2VYFA 2YV1A 1UKEA 3EOAI 3ELUA 3DDSA 4V2IA 5ALJA 1EVZA 2ZSIA 3IR7A 4ZYYA 3GLTA 3FUVA 1CYDA 3DC7A 4MVJE 3IAS6 2WYUA 4MJ3A 4BO8A 4J1TC 4QDKA 1Z3CA 3CR7A 1NEQA 1K7CA 3D7SA 2AFIE 4CNQA 3FVWA 4UXJA 1A88A 1UQRA 3HEBA 1TTTA 5C2JB 3ZX5A 3SM9A 4XJXA 4BJ3A 1S9HA 4NAHA 3DBOB 2IHTA 4YQYA 1YV9A 4HRAA 3PDWA 2OTCA 2D00A 3WSVA 3PIRA 3AHDA 3HR8A 1QAOA 2WSBA 1TQ8A 5TPWB 3KKPA 1POUA 2VP5A 4PCUA 4KHZA 3RZZA 2VWHA 1YU6A 4OB7A 3I04M 3UZUA 4DA4A 5B3AA 3W04A 3NT5A 3DFIA 3IR6A 3TW0A 4CGYA 3DVAA 4AKHA 4FD3A 5IXJA 1LJ8A 2W6OA 4H6PA 5CK5A 4D6XA 1AZSC 4WZBB 1EZ1A 3GJ4A 1SUAA 2UZ0A 3AXTA 4YDHB 4D42A 3CR8A 5JS6A 5F9MA 3RV4A 1EFRA 4RELA 4ASUD 1T9GS 1EGVB 1CZUA 3FOBA 4L4YA 4RK1A 5E9JA 3WWDA 4R2WA 5KKCA 1KI6A 2WMNB 3QBJA 1O94D 4CMAA 3GRZA 4TL6A 1MAUA 4ETMA 2OD7A 2W2TA 3IO5A 4JBGA 1CVIA 3PXCX 1IUOA 2ZYWX 4DNQA 1JB1A 2BH9A 3JPWA 2NMVA 4BXOB 3W9YA 4EQ6A 3LDAA 2ASEA 4DR6B 4Y6LA 3PXXA 5C80A 3LZCA 3WGZA 3NOVA 5CYOA 2N0SA 1C3OB 2WY2D 2G63A 3BKWA 5HMMA 5DTQA 3ICCA 4UEKA 4EIWA 1H9BA 1HOXA 4UVGA 1F5NA 4YCJA 3P19A 3L8FA 1T5BA 3OJ0A 1YO6A 3JQFC 1NXVA 1ECJA 4N0EA 1CQIB 3JVDA 1PT9A 5IN5A 1ZUD1 1Y9ZA 2E4YA 1IBRA 1S0UA 2HNBA 2LIPA 3ANXA 5CGQB 2O2YA 3WGHA 4UBIA 4EUSA 1TM2A 1WWKA 4QHSA 1BEZA 4UM9B 4BO2A 3FMYA 1RYHA 2RC5A 4CQLB 5IG2A 3Q88A 3JQ9C 3QELB 3HUUA 2DLCX 3FTQA 4IO1A 1X80B 3SI7A 4P5DA 2WLTA 4NENB 1XRSB 4FX5A 1DQZA 2R00A 1DIGA 3PTLA 4DDVA 4NQRA 4ARIA 3W06A 3UT5A 1J9ZA 1YGPA 3A1CA 4Z8YA 5G4LA 3IB6A 3DKIA 4KITB 5CEJA 4OHYA 2HSDA 2ZP1A 3A1SA 3S7TA 2AEJA 3NNNA 1XC7A 2GARA 2ID8A 3IDFA 4RS3A 4B32A 3QEOA 1U1CA 4IOLA 1WUIS 3N8HA 2HI0A 3BB4A 4BRWA 3V9PA 5DN6D 1O2DA 1PTJC 3QXHA 5HFNA 2FUG1 1VL5A 2RG7A 4MKFA 3AZOA 4X92A 3R5JA 1PSZA 5BVGB 1BKYA 2GX6A 4RL6A 1GFWA 5FOQA 2QVCA 4OHVA 2QL6A 3A70A 4X7BA 4OYYA 4XUEA 3VC3A 2GLXA 3KZXA 2C2ZA 2VWQA 5IHPA 1Q11A 2AX3A 4LQDA 1GAJA 4NATA 5BSEA 3F6RA 4JT8A 4OKIA 2Q46A 4ILEA 3GL9A 3DMTA 4XDZA 3ND7A 3D3WB 4DIDA 5I7OA 4Z0TA 1G3UA 4MVJG 1ZOSA 5LCXA 3W4IA 2O59A 1GAQA 2CBXA 3ONWA 3SPXA 1JALA 2BAGA 4WFIA 5EKXA 3WDSA 1MENA 1Z5PA 1EWYA 2JQEA 2O0KA 1V5WA 1SQ6A 2PLWA 3I64A 5I9TA 2AOUA 2L82A 3CN7A 4H2DA 1H93A 1T0HB 1GJRA 1U3GA 3OF2A 3PTZA 4UE6A 5GAJA 4AICA 4F46A 4PQRA 1CJKC 3QKUA 1KF0A 4JUAA 1M8GA 4K2HA 4DRXB 1ZM7A 1HE5A 2XPCA 1GG2A 4G89A 5B3JA 3N5KA 5FF9A 3DOUA 1URPA 2GT1A 1I6LA 4J16A 2VN8A 3O38A 2HF9A 4K40A 1SQ0A 4KYTA 5L3ZA 5AESA 2V8OA 1NQWA 4OBXA 3WL3A 1FFDA 1MX5A 1RZVA 1LA2A 2P4QA 4PY2A 4XOIA 1T2AA 2VTVA 1VPLA 3Q15C 1A76A 1WUYA 5SYMA 4QUHA 4CETA 4G0UA 3U3XA 2TRSB 3BXHA 3DD1A 3IP7A 2UXCB 3AEQA 3WG9A 2RJOA 1KYQA 4F12A 4F2PA 5IDXA 2EHJA 4JX9A 4KBYA 2VTBA 2BH2A 4ZYVA 5FI3A 4URVR 2XQIA 4R0NA 1ABFA 3CLUD 3VPAA 4JI4B 1G60A 4JI8B 1D07A 4OYHA 4MV5A 4O4JA 4GR9A 1YRYE 1MFQC 3GOQA 5CH8A 1P4RA 2Q3MA 4WLNA 1IVSA 3F6YA 3KV3O 3L8CA 2P6RA 2AG5A 4TWIA 1M3SA 1LNQA 4C21A 5HE9A 3U4CA 4X1YB 3QHPA 7GPBA 4RESA 2C4WA 2XMSA 3QVTA 2XMDA 3L8GA 4K8RB 1U0OC 4YV7A 2X8WA 1OFIA 3O1HB 2WM9B 2GF2A 2R11A 3BE5A 5G0VA 4BS9A 4HX9A 3F74A 3PCXA 4LKRA 4C7MA 4KRYA 5LFAA 4H7KA 1GSIA 4LHYA 3ZNPA 2IS1A 4BVGA 3TQIA 3ET5A 3L8MA 4EMTA 1YH3A 2YWGA 4IFIA 4RPJA 4KUEA 3ZJYA 4AF7A 1S4QA 4I4TF 3PTAA 3KLPX 4LFBB 2Z5LA 3H8SA 3AOEC 2B2XA 3N6VA 5JS7A 2DUNA 2YUTA 2DFNA 1DWKA 1JJVA 1LPNA 1OB2A 1QO9A 4W99A 2PRKA 3HKDB 4PF1A 4AZ0A 5HG0A 1C4XA 5CDFA 4ZMSA 4M1MA 5ALZA 5HF9A 4NNOA 2QRLA 1C3VA 1KRHA 1W48A 3GLSA 4QXRA 1I2MA 3GUHA 3HXMA 2XEDA 2LKDA 2QXUA 2TMDA 1XDBA 2G9VA 3AJ9A 1QZ3A 2IHNA 4D9MA 3FFTA 3DZBA 3N0RA 1S2MA 4JI5B 3EDQA 2V7UA 4G0NA 3V4RA 4OKNA 2QMEA 5LN1A 1WXIA 1E1MA 1N8TA 2H18A 1FQWA 4UD2A 4BLTA 2M6KA 3LC1O 5FUWA 4QDZA 2Y66A 5ECYA 3GEIA 4RORA 4U2GA 2XB9A 2ZE7A 3NAMA 1RR6A 3EDCA 2EV9A 1S2NA 2B1RA 3H1TA 3HMKA 3A04A 3LPDA 2NU8B 4EHKA 1Q74A 2BSQA 3W8DA 2VHVA 3WISA 1JR6A 4OK3A 5JSUA 3UAOA 1XCPA 1RE0A 2G1AA 4WV3A 5L51A 2I8LA 1Z8DA 1EGMB 1OD6A 1D6NA 3QNUA 2MEZA 2R68A 3VV2A 1LBHA 3RRJA 1QYVA 3A2LA 3GCWA 3UATA 3VZCA 4O8CA 1KARA 3RT9A 1HKHA 4DHWA 3DAOA 5A9SB 4RTMA 1N9GB 2I6XA 4MKIA 5HFJA 2JJ2A 3BL6A 2DFKB 1FDSA 2NUTB 1X8KA 4JBLA 5AKIA 4CMIB 4C0KA 3HPRA 4PICA 3TZLA 2WE7A 3U0VA 2CXNA 2CF5A 3MUOA 3R77A 2AWIA 2D2VA 3PKZA 1VL2A 1RQ7A 4KQ9A 1AN0A 4ENWA 1RBZA 4CF7A 1P0IA 5JH7A 1SXJE 3ZDCA 3K09C 2VKTA 4X90A 4H7EA 4LW8A 1U2ZA 1XMXA 2ZDHA 3HL0A 4PX3A 5HS4A 2Q8QA 3H42B 4CMEC 3PDIB 4KTTE 3V6LA 4TLBA 4D3XA 5LOVA 4E22A 4QXPA 3QSGA 5GGXA 4QVGA 4IIJA 1NJFA 1K6XA 1KAOA 4M1ZA 1OVGA 2G5TA 4PYNA 4F60A 1FDRA 2BCEA 3BIOA 5LR6A 1BS9A 4OA8A 3LHIA 4U6SA 3R7NA 3GV0A 1K7YA 2P8SA 4AN1A 4Z1MD 4RTOA 2CMDA 4UAUA 2BIFA 2C07A 2H4JA 2W22A 4GQIA 5CM8B 1TU4A 3F2VA 5A4DA 4OH7A 2Z8XA 3FSGA 4MVWA 5LQMA 1OLUA 2ECOA 3LM8A 4PU0A 2XMZA 2JZNA 2ICTA 2HA6A 2YXPX 3I9FA 5EKDA 5KSWB 3CNOA 4DMMA 1M73E 2AF4C 1Z4KA 4D26A 3H9BA 3WK7A 1T3ZA 2AUMA 3IAHA 4YRTA 4QUAA 2HXYA 4IV8A 1K8RA 4M60A 5G0UA 2YQZA 5D7BA 2QTTA 2QM8A 1RAHA 4KDEA 5JXJA 4YHHB 3KLNA 3UJDA 4UAJA 4CIDA 3K9WA 2WJJA 1AN9A 1G8GA 1N8SA 3OFVA 3TB4A 3WXBA 3HGQA 2Q4OA 3G8DA 4MS1B 3ZDQA 5GVRA 3B2QA 4EF4A 1T3HA 3B78A 4X91A 1FRNA 1KR2A 1Z25A 3OJLA 2E4VA 1JIXA 1MC8A 3AL2A 3HB4X 1N2IA 1JPJA 5FJIA 3VFDA 3RADC 1GU7A 3ER9A 2EFHB 3GT4A 1CJBA 2X0IA 5KVCA 2GZSA 2ZSAA 4NY1A 1BXGA 1S2DA 2ZKLA 3M4ZA 3PF8A 4ZK6A 4IJKA 4K1LA 1KFEB 1JHOA 3IDOA 5KX5B 3JZMA 4LC9A 1MRNA 2FEKA 3P9CA 1Q1AA 2AUNA 5FYDA 4XYBA 1EPUA 1QE5A 2JBAB 3LOQA 2CMHA 1QORA 1EDBA 1MAVA 4JP2A 1LCIA 2E1PA 5H68A 2IYXA 2VNJA 3MWFA 5AVTA 3QXJA 2WJIA 4B2YA 1NUAA 3BHNA 2IJGX 1N5KA 2CDNA 2PMWB 3JRWA 4GG1A 1I2AA 1A7KA 5E6UB 2CXSA 4PPFA 2Q0HA 2P8JA 2VDVE 4DIEA 1EINA 3SSNA 4D8TA 3NETA 2B30A 1WH8A 3WGTA 1GZSA 2AK2A 1TD9A 3AGQA 3PRYA 5K7SA 3B1XA 2ZAIA 2YHIB 4R16A 4DMKA 1WCIB 1IJFA 2JLCA 3BF8A 4P83A 4XYGA 3RC9A 1HURA 4GMGA 5FI5A 1E8MA 1HWYA 1K5PA 1R69A 3IP5A 4TV8F 4EFMA 1V5IA 3AVPA 4YBZA 3TOCA 2P68A 2AWNA 3F6BX 3R41A 5B1HA 4MKRA 3LAWA 4MOWA 4FVTA 3LUBA 1KFKB 1KMNA 4K86A 4Z51A 4UBJA 1L5WA 4LZZA 2O7RA 1NVVQ 5REQA 2GZMA 3C70A 3E3MA 4X3PA 2JVIA 3ENKA 1NPDA 1LI4A 1XVTA 3LA6A 1RWOA 3AZQA 2CXXA 3PFGA 1Y98A 3PJFA 4N0QA 4EY5A 3U7FB 1B3RA 2XYRA 5LBTA 1Q6YA 3SS9X 5B64A 3M9LA 1GPLA 2W2NA 3QYFA 2X19A 1EUZA 4G1MB 5JMOA 4W5QA 3TYXA 1SXPA 4Q6BA 1CHDA 2NVOA 1J23A 4OXKA 2J3QA 2XZLA 4HGOA 1UAYA 4P08A 1GR1A 5C5IA 3MMXA 4Q4AA 2JHCA 4FGLA 4XI9A 3LX4A 2QI9F 3KJHA 3KOZA 1ST2A 3EA4A 3R5HA 2XA9A 5ALDA 1S3IA 4G9EA 4ZJZA 5BV1A 1ZR4A 4YQZA 1FRZA 5TGDA 3VKFA 2VH5R 2AE1A 4NJEA 1N2HA 1SGWA 4H7PA 3H5WA 4YMGA 4FU0A 3T5CA 3CJTA 4IS2A 1L8AA 1RFLA 4I9FA 3UJCA 4C29A 1FDWA 2A0FA 2PWAA 3OJCA 1F6WA 4IH1A 1ZUGA 4YP7A 3P5BA 1JYEA 4S05A 3GRFA 5JI3E 4IXNA 1WTCA 2QTVA 4HQRA 1Z4NA 4INOA 2VRBA 1ABEA 4O4IB 5FOVA 4A6DA 4REQB 2X1LA 3UJ3X 4HCJA 3LQQA 1A72A 1KU6A 2CNBA 3B6IA 3Q11A 1QG0A 4C0JA 3HBAA 3NDJA 4B5KA 1G8YA 3GAAA 2PX4A 2XUGA 1W6RA 3JQAB 3NS7A 4B1FA 1ANKA 3KRTA 1PJLA 4MGKR 2WYVA 2HXGA 2XUAA 4IXTA 2YWDA 4MRAA 5KNLA 1R9NA 4PGFA 4E11A 3DEIA 2A9QA 3BRQA 3WNBA 4K88A 1CR1A 3E9YA 1XZKA 3BMXA 1X57A 1ZLYA 3C7KA 3D6HA 4G4JA 2V7BA 3WBJA 3VYUB 1U81A 1PQYA 1EUCB 3IA7A 4NZMA 4CQMA 1YXMA 3W2GA 1E3IA 3OQJA 5AH0A 3H16A 5T41A 1W0CA 4KXWA 5H4GA 1UXHA 1CEEA 1TL7C 1HNNA 3D6JA 1NW3A 3OEHD 4LXQA 4EGCB 5HUHA 1G4UR 4EYGA 4R3NA 2IK8A 4LV6A 3LL7A 4RD1A 5FL7D 3PC7A 4H4CA 3VRHA 4B80A 5ABPA 4G1BA 4JP3A 2OQIA 4P81A 1OA0A 1LSSA 2EWMA 3GYBA 1CR6A 3LPMA 1KORA 4KAJA 3K4HA 4ZU3A 1U28A 4F45A 3RYIB 2O8DB 1FP4A 2ECFA 4OUDB 1W5SA 2XNJA 3IUJA 1DAHA 2J32A 6PFKA 4UM8B 2IC5A 3OP9A 3KJZA 4OIMA 3IUQA 5CIQA 1U2GA 3FRHA 1AKNA 1CQTA 3KJIA 4I2VA 1CUIA 3HSSA 3ESAA 4QEDA 1O4VA 2O4AA 1XVIA 4H0NA 2O8BA 1U65A 1PT7A 4RY8A 1RQLA 2CLFB 3LD9A 4PGAA 5JAUA 2RB5A 1Z0DA 3JQCA 3PZBA 4IMIB 4JQZA 2IBMA 4MKGA 1K1EA 2IOQA 1QBKC 3CRMA 3KAKA 4L3VA 2ZJ4A 3KX2A 1NQ5A 4XQ9A 2VUHB 5AKHA 3RUAA 3SC4A 4BLVA 3U48A 3HB9A 4XGIA 1I32A 1UMKA 1RMQA 2IU6A 1JG1A 1M2VA 3QF4B 3GF4A 3GYGA 1SQGA 1IONA 1VJ1A 2BMDA 4CQJA 1YQUA 2FJPA 1ZUHA 1ORIA 2V55B 3T3EA 4PC6A 1QM5A 2H07A 4N47A 1YGYA 3RIGA 1I3MA 3BAFA 1INLA 1XZHA 2WV7A 2ZBVA 2XUZA 1P2GA 4MRNA 3WC4A 2YJZA 4TWRA 2NPFA 5JAHA 3QU4A 1UQTA 1VLMA 4WXMA 4CEIB 2Z1NA 2Q5HA 5ELXA 2WYIA 4LTDA 4U9HS 2HQSA 2ZZMA 2C4HA 3RUHA 3SJ7A 2Z6AA 3SYNA 5KYUB 1NYLA 4PC3A 3HJCA 4UTXA 2BFMA 1JYFA 4MV8A 5EG5A 1IDN1 3D2CA 1DBPA 2ZB8A 4PHTA 3KALA 2ZJBA 4R81A 4Y8VA 2ZR8A 5EQDA 5EQFA 2A9FA 3N3BC 4MK4A 4WXRA 3MILA 3TKYA 5T5QA 3VNUA 4ESEA 1G2QA 4I1YA 2NU7B 4EZBA 3GJ3A 4M7PA 3C3YA 4BX2A 3EEOA 2AFHB 1OWLA 2HPHA 2AJLI 2HUNA 3IIMA 3JYNA 3TINA 4D9GA 2A35A 2AZ4A 3BXXA 5MGNA 4XUGB 2X5OA 4I66A 2Y27A 1AS3A 1OZ0A 4PIVA 3TRBA 1QLHA 2BSAA 2XWBF 4TV9A 5HIKA 1G9XA 3A06A 1QF6A 1SVNA 3GFRA 3LPNA 5TARA 1E69A 1IBSA 2FP4A 3GPDG 4G67A 4RK6A 3QF3A 4YPVA 4L8YA 3RWMB 1GUZA 3HEAA 2LNDA 3JV7A 1I94B 5KTYA 1DEAA 3K3PA 1SOVA 3DBVO 4QBKA 4XA8A 4RDCA 1HG1A 4RLHA 2HDOA 3NIWA 3P8ZA 1ZOPA 1P9NA 4NDAA 5EIOA 2HCRA 2R8BA 4A6PA 8ATCA 3UKDA 3S1AB 1FIUA 5SY4A 1M33A 1E1CA 1NJ6A 3I9MA 1BMDA 4ZICA 1NC3A 2FVXA 1QZTA 4GMHA 2PD4A 3L5OA 3SQOA 2G17A 1IHDA 4ID3A 3T7KA 3UB4A 3SZOA 3UHJA 1BHJA 1XQ1A 1ZGBA 2X3UA 3RG8A 5FOUA 3ZKWB 1RYBA 5FADA 1AU7A 1T25A 1A5TA 1ZKDA 4YUXA 4JC8A 4LYFA 5CVJA 2VNSA 3IAM6 4CQMD 2FZWA 1U2RA 2GFHA 2W8BA 1JHZA 3EEQA 4MPDA 4FFSA 1DFIA 3OLVA 3QOFA 3EGDB 2P9CA 2FZVA 3OOSA 1WB5A 3LXRA 4ILKA 1DKNA 2IU4A 5HZHA 1TEZA 1E61A 4CMJA 3TECE 4Z0PA 4J1TA 3GGPA 4US2R 1R6AA 1NP6A 1CUCA 1U3VA 4YRSA 3SEQA 4YAKA 5KEIA 3MWDB 1D2MA 1YQEA 4Y9RA 5AXDA 5KTMA 3H8WA 2IYZA 2EKDA 3W5DA 1GZDA 2WOJA 2R7KA 4BWYA 1XQVA 4YA6A 2LYKA 1C9EA 4H6VA 4PLWA 5E1BA 1PW7A 3NAZA 4CV2A 2EZTA 4HDQB 5KNCH 2ATEA 5A6VA 2UVQA 1T9HA 3IUSA 5BMOA 3PC4A 4DMFA 1TIBA 1E9VA 2QROA 1MIOA 3FMVA 1DT3A 3K2EA 3CW2A 4EG1A 1Y81A 1WXGA 3PWZA 1IY2A 1KMHA 5ISMA 4XWKA 2JH9A 4JCYA 4TUYA 1XPRA 4RZIA 1VIVA 3O2SB 4FJ2A 3L7KA 3N2IA 4WBNB 2IP2A 5BMVB 2CFSA 1Y4ZA 3H3XA 2G0TA 1DV2A 1SUDA 2D5IA 1UDWA 2CSUA 1PAUA 4I19A 1N75A 4WT7A 5C31A 3E5NA 5I7EA 4L6IA 3A9CA 1XEWY 4DWWA 1V41E 3IHTA 4P22A 1C7RA 1E2NA 3A7EA 1U2SA 3C45A 2CEAA 1VDZA 4Y0VA 3VPDA 3DYVA 5ES4B 1YZHA 4WESA 2RI6A 1JEYA 2BUCA 1L7PA 1SVUA 1Z6AA 4XTCS 3DLAA 4BNMA 4UNRA 4LYAA 4YXWD 3STYA 3K2QA 2PXFA 1X92A 2WYWA 1WZ2A 3O4VA 3TZQA 1FS5A 2SCUB 1E3SA 3NTRA 3Q3CA 5KX5F 4OCZA 3GJYA 5IFKA 4O33A 3C6BA 1H69A 1Q44A 1N5RA 4N82A 1VE3A 1F5SA 1H05A 4TYWA 2BMWA 3JQFA 3R7AA 3DM5A 4N03A 4QG7A 2Z6UA 3S2IA 4UBNA 3S7ZA 3EW7A 2IUFA 3FHOA 2O3UA 4CIWA 2OZPA 2PWZA 3TM4A 4DE9A 1A2BA 2Q2QA 3HKBB 2Q45A 3PRHA 1ZIXA 2ETXA 3FLAA 4DEXA 4I1PA 1XDZA 2YV3A 1NHWA 3VSEA 1D6JA 4LOJA 5AKLA 1PT6A 1Y6RA 3LFUA 2ZCVA 1TYEB 1YB6A 1M2OA 3QYPA 4KQFA 2HBRA 4AYTA 1ENZA 1T6YA 2QMHA 3IR5A 4R2LA 4YY3B 3ZQJA 4FR5A 4F5DA 2NIPA 3PT5A 5FBZA 3LUCA 3FNEA 1Z7EA 2PEZA 2XWQA 3HHPA 4OD0A 3TLCA 5LQJA 2MIIA 1N34B 5JSFA 5TB5A 2JHAA 5B3LA 2DETA 5TS3A 4HVAA 4N3NA 2DX7A 3AP2A 1JR3A 1W6UA 2M32A 3GAMA 5CFRA 1RHJA 2Y0EA 4MWTA 1OTHA 2R4QA 4RH3A 5C3MA 1U3DA 2LVBA 3Q4GA 5LLSA 1DKUA 1PTJA 2AJBA 2HQRA 2I7CA 2VHZA 3CLTC 3QVWA 1YA8A 3ZJ5A 1WXQA 3A1FA 4NH4A 3RV3A 1ZEMA 5KNCA 4M21A 1E2QA 1JLMA 3M5PA 4RXTA 4IYRA 2YVQA 1GTVA 5E9QA 3NXSA 1Q7CA 3UEOA 3NBAA 3OKZA 4JX8A 1IXRC 5TPWA 5LZ4A 1BGVA 1PNTA 5TVKA 1I36A 1VHLA 3IBGA 3O2JA 4BNYA 3WXMA 5B7GA 4KVFA 4YG4A 4NCKA 4L16A 5EA2A 3HUDA 3Q10A 2L1PA 3REFA 1QHSA 3LCJA 1ZLXA 4WZBA 5K8JB 4G25A 4JQYA 2HSJA 3ZK7A 1E5TA 1W5AA 1YKSA 3GJ7A 3M1YA 5DVZA 1P5HA 1THGA 3PKJA 4ZU1X 5C7LO 4AWBA 3U44A 1AF7A 1JF8A 2VZ9A 1XAJA 2C9ZA 3GIDA 4RPLA 1ZHHA 5FV7A 1U3UA 5UKDA 3PJGA 3K32A 4BP1A 1PWXA 1HT1E 1U1IA 2PRJA 2ZFUA 3HSYA 3PGKA 2Y0CA 5ENDA 4DLAA 3O7WA 4GLBA 3LDHA 1NXXA 2WM3A 4AB1A 4BXOA 4AMUA 4X4EA 2ON6A 4NF2A 1BG6A 1E59A 1M54A 5KTRA 3IOCA 1QGYA 5EZYB 4HXYA 4CM9D 5DH9A 2VK1A 4AZ3B 1LNZA 1K63A 1ELOA 4MQLA 5LA6B 3NV7A 4KB5A 1W88B 3I01A 1U7HA 2AA3A 2F9LA 3KDPA 4RFSB 5DK4A 1U1GA 3ICOA 3WIDA 4C03A 4D9BA 1H2FA 1PQUA 4PZ0A 3H2JA 4DIUA 2QN6A 4ME6A 3BORA 3SAJA 4EPVA 1M6YA 2A57A 2C4VA 1VYTA 4GICA 2QAIA 1UMBA 1GRNA 3EZXA 2WFAA 2FFBA 4OXYA 4V0ME 2TS1A 4B4OA 2DQKA 4BFWA 3Q3EA 1DARA 2ZXUA 2H65A 4DIOA 1EP1B 4N39A 4PHCA 3HZIB 3EHDA 3H3JA 2P4HX 3TNYA 3UYLA 3C3AA 4F97A 2C99A 5EVCA 1NUTA 4YVFA 1XZJA 2I6UA 4JELA 1I3LA 5H16A 1AMOA 1EWQA 5TE9A 1TD1A 2G9NA 1XEXB 5I7VA 2W6NA 1IN8A 3FYUB 1Z4LA 4F2HA 1LK5A 3OZXA 5F78A 3ZHOA 1ICEA 2GJSA 2ENUA 2FEPA 4RKRA 1IBKB 1E2IA 2O2SA 4PFJA 3KPYA 1I4WA 2IHJA 4R2KA 4FTWA 4UEQA 4I5GA 4UDYX 5EMKA 4C01A 1TAGA 2LTAA 3HCFA 3MK31 5D3MB 3DM9B 2WIFA 5DBOA 3T52A 3DHNA 1NBMA 1U80A 2G82A 2GM9A 3AOEA 2XYVA 1AK1A 1AQYA 4DEVA 2WE8A 2OWDA 4GKBA 3LE8A 3WK9A 2UU9B 2D6FA 2WKWA 4EPRA 1XP5A 3DFFA 4KO1S 1KEUA 3F0TA 4C2AA 2RE8A 1B6RA 3MUNA 2XNDA 1DAEA 1QDUA 5B6IA 4IPTA 3CNEA 3PHBE 1PFVA 2ZBUA 4YT4A 3U2QA 1Z6QA 4A0HA 1ZK3A 4FXOA 4WA8A 2DCMA 3VO2A 4CL2A 2BKEA 2ATVA 4W9RA 3T38A 4DY4A 3ZE7A 1NWHA 5EP4A 5AHWA 2HF7A 2VNIA 3G2PA 3LKZA 4XX1A 3KL2A 1AQUA 4FM9A 1Z0FA 4YMHA 1NUQA 4UTNA 3NDBB 4IZOA 4L72A 4QYXA 2XITA 3OC6A 4RZSA 3STHA 1H94A 2RGYA 4YDSA 4BE4A 3TQTA 1XZAA 4ICIA 3REQA 3S2EA 1JR3D 1U7DA 3G13A 1K5HA 3ELDA 4KQMA 5K0GA 4TS9A 1FMLA 3CJQA 4WNAA 3IVMA 3O93A 5LXTF 4JN6B 4QPCA 4O02B 5HRUA 4HDNB 4IY1A 1YK0A 4KFSA 4I8TA 3N1UA 3RTGA 1D4AA 3V4OA 5KNCD 2PXAA 3UMJA 4BC0A 1Y9AA 4UHJA 1HNWB 3ZHCA 2QN1A 3O1IC 2FXIA 2I2CA 2NTNA 2XT9A 4CTMA 1TQHA 3EEFA 4JP8A 1QCDA 5KOYA 1MOZA 2APJA 2MXDA 1HQKA 1QC5B 1MXFA 2JH3A 1YC5A 2QJWA 3CO0S 4MR7B 4TM7A 1FP6A 1W29A 2LRHA 1XVLA 2P2DA 2F1IA 4JA2A 4PX5A 2OK8A 2FQWA 2J9ZB 2QRUA 5IJ9B 2WYHA 3UK7A 3AB8A 4I1VA 3TL6A 4PINA 4MDEA 4QNNA 4RMIA 2DVMA 4LBVA 4IP0A 4TXHA 3TUIC 4QG3A 2PJZA 1IE3A 1SKBA 2HCJB 2FSUA 1CBUA 3T7JA 1UXGA 2V6GA 5DOVA 3T3HA 3QU2A 1RDFA 3TXYA 4LJRA 3IAUA 1N6IA 4M22A 5KAMA 4R7ZA 2FMIA 2JK0A 2X9QA 1RC8A 1B0NA 1W1IA 2H2AA 4M8IA 5F2EA 3FYUC 2VQSA 4G86A 1VL6A 4QNRA 3CLVA 1ULTA 3N2GB 1PT8A 2J3MA 2PXUA 1BA3A 5E38A 4X8LA 2NUPA 1JG3A 5HA5A 4DHEA 2HA3A 4FSDA 2BHSA 4BEWA 4E6PA 1JLHA 3MELA 4BVEA 4KR3A 3T9AA 4DUYB 4RMNA 1YVPA 2V9CA 4EG0A 2B8WA 1C4WA 1I0IA 5ALYA 4BO4A 4RZ2A 1JJAA 2CHGA 2J7KA 4GOKA 3OWOA 3GR6A 4GOMD 1N8NA 3BIXA 1S01A 4XLZA 1O6ZA 1UT6A 2QJRA 3HKDA 4JI0B 4P58A 1SY7A 2WYOA 1E64A 1ONBA 3MRTA 4NI5A 4RK7A 5ED0A 3WTBA 4AG3A 1X77A 4J76A 1C4OA 5ALTA 1FJHA 4HI0E 2PXBA 1GP2A 3IQZA 4QD3A 4UM9D 1U4SA 3GN1A 5JZMA 1B73A 1NUPA 4FX2A 4G65A 5MFPA 1M0EA 3ZJVA 3QX8A 4KSBA 1DLJA 2I29A 1BVYF 3G2MA 3GHHA 4R1PA 3S2FA 3VMMA 4BNHA 3AKZA 4RGVA 3IPCA 5EXSA 2QLLA 1SU8A 1FTQA 4D7AA 2RH5A 2CFIA 1YRHA 2X7XA 1QFSA 2CK3D 1NVMB 3JQEA 5JNTA 4H1VA 2Q29A 3CH7A 3SHOA 3MRVA 1NM5A 2EFGA 5IJZA 3N2KB 1MW9X 4KIGA 4NOJA 2WWVD 5LUBA 4RGQA 5JJIA 3WIEA 3GT3A 4MVXA 5GOZA 1UKAA 3MBKA 2JLSA 1Z18A 3R9IA 4XWOA 1CUWA 2AYXA 3MJSA 1ESEA 1DEXA 2ZKIA 1NBMD 3HCPA 1MKYA 4L9WA 2FQ1A 3OIVA 4OIFA 3UY4A 5AM2A 3H0CA 3AEYA 1T5HX 3LFPA 1TAQA 4YJGA 2SKEA 4ZAVA 3VU0A 4F2GA 2PN1A 3TOZA 2XNDD 4RK0A 4B6PA 5A9SA 1GADO 1GRVA 5J2UB 1WP9A 3RS2A 5IRCD 2QMZA 3WGMA 1H9AA 1C1XA 2FAXA 4WAUA 1ZL2A 3OM8A 1SCQA 3OQHA 4KO4S 2V1UA 1M72A 3EGEA 1IZ0A 3PEYA 1R4MB 1U2EA 1X3LA 3JVUA 4Y6GB 1O8BA 2HF2A 3VSAA 4CLOB 1JHPA 5CFLA 2R4UA 3MGBA 1MO2A 1XF1A 1W1WA 1DKOA 1J1IA 1R27A 2ET6A 2O0HA 1PF7E 1R0BA 3C3EA 4FR0A 4FXPA 3FPCA 3TIGA 5JD5A 3SBOA 4I5EA 3DQQA 1H6BA 1MX1A 1M8FA 1O7JA 2Z5VA 4H1WA 3M5DA 4HMOA 2ODEA 4DWVA 3WFJA 3NCTA 2FUCA 2WU4A 3MJCA 4HFRA 1KGSA 1E4YA 2BGJA 3V4PB 1JE1A 4YJHA 5JSYA 1QH1A 1DG3A 1HEYA 3PQFA 2BJVA 2IIQA 4JLKA 1NSTA 4U2DA 1GNLA 3FI9A 1WJGA 3WQBA 3BXOA 2F7SA 1EVIA 2Q62A 4LE1A 3V33A 4BO6A 2Z08A 1UBGA 3GJ5A 2RC6A 2P2ZA 2QNBA 2YC2C 2JKVA 1E1QA 3DV2A 4DDHA 4C30A 4ZT5A 4YONB 4G8JA 3VISA 2QZPA 2EBFX 5AM3A 3QUCA 4W5OA 3UJHA 1KY2A 2VK2A 3R0VA 1SIUA 2GD1O 1C7FA 1Z33A 2C20A 2FDXA 4AVYA 5AW1A 4TPKA 2G76A 1R6VA 2QRQA 3FSEA 2F1KA 1NNSA 3K8ZA 4GX0A 4DV0B 3IUNA 2HFKA 3OTQA 2VHXA 5DWDA 1MT3A 4CG3A 2B83A 5KWJA 3ED1A 5F7ZA 1J2EA 3OUUA 4KK3A 4QM7A 4LK2A 1YMQA 2B6HA 5BR8B 5FPYA 3RABA 1GHTA 2QHXA 3ZE1B 5HKKD 1CY6A 4MS1A 5BV8A 2G7ZA 1KETA 2V8BA 3OZFA 1ORHA 2JLWA 4GXNA 1C2TA 3K0FA 2PGAA 3OTGA 2GUWA 4MDYA 2IEDA 5IJWA 1EVQA 5ALRA 5LL6P 4UZEA 3ITEA 4ZVPA 5LZ5A 2Q1WA 1Z82A 4YB8A 1GKYA 3NHYA 4IINA 1G8PA 2R5WA 2YC4C 3MA0A 3RAGA 4JT9A 3OMTA 2PQ0A 3DE2X 5C1OA 4LRUA 1VPEA 7ABPA 4CV0A 2OLKA 2RHHA 1AMUA 4DB4A 2ZB3A 2FWAA 4WRRA 1H6AA 3GFPA 2GK4A 1PZHA 3Q12A 5JYDA 2JBAA 4GPD1 5EWMB 3UHFA 5SZIA 3L4JA 4AP9A 1A96A 2WP0A 1FMJA 4PLYA 4CI0B 5LD2B 2Q9AA 3TNFA 1J5PA 3NALA 2JI6A 4OBWA 2AHRA 2BHLA 3MUEA 1NOKA 3FUCA 4Z9AA 1ORRA 4S3MA 3ZE9A 1PR2A 2DKFA 2R7LA 1EEXB 1QPZA 4MGIR 2OZLB 4Z5XA 3NXKA 3MOGA 4U02A 5ESXA 1MMFB 4EG7A 1NKTA 3E9EA 5HK9A 2J4FA 4AUNA 3I9JA 1O57A 1TW3A 5KVAA 16PKA 4ESHA 3HXOA 1WIZA 3GO4A 1EX1A 3QP9A 3OQIB 3E3LA 2GZRA 4P3XA 4P7BA 3F71A 3WOVA 4F7DA 3ZS8A 3WYDA 1ZCZA 2D62A 4ZI7B 2HU5A 4PGHA 4P54A 3A36A 2QBYB 4JJFA 1PBTA 4XIJA 3KT0A 3P9RA 2IEAA 1BU8A 4MLCA 1U0BB 1PEDA 5KDLA 2UYQA 4Y9UA 4EF5A 5A1TA 1G17A 1KJNA 5FLYA 3PUJA 3UM9A 5IC4A 2P3LA 4O1IA 3S8MA 5KTKA 3HYNA 4DKJA 2HBZA 1P6UA 5ESDA 4KIUA 3EIHA 2AOTB 2LGJA 1YS1X 5KB3A 2P9BA 1DXQA 5HCNA 2V7QD 2ZAYA 5LMCA 3CXRA 2B8EA 2NTJA 4MWDA 3ZLUA 2ATCA 4QNMA 4EYEA 2J08A 3FDZB 4L22A 2I2DA 3ADOA 4UNNA 2CCGA 2C29D 4BFXA 3HXTA 3OFSA 4L50A 5LP6C 3RVOA 1KEKA 2EBHX 3KIPA 1GTL1 1UKBA 4Q9DA 5GOTA 4A2CA 3V1UA 3PPXA 3E0QA 1QGUA 1FFWA 4NCNA 3LBNA 4ZHSA 4C7OB 3B6ZA 4GSKA 5FOSA 1Z5UA 1PVOA 1WQ3A 2GVZC 3ZHSA 1GPUA 5CITA 2DXIA 5TMPA 3NIGB 1R18A 1N2JA 3RFFA 1S96A 1ISFA 3UV3A 1EI9A 1WV0A 3TNLA 2DJIA 3VU1A 1C8BA 1RWQA 2D1YA 4D6YA 4BAUA 5KNBD 3L93A 2NT4A 2FJRA 3AH8A 5J5AA 2IV7A 4GZMA 3U62A 5KO2A 5DN9A 2ZRBA 1SD2A 2LIVA 1E1QD 1Q6ZA 3H9GA 1EE2A 5EY5B 3LLCA 2QE7D 1XB2A 4O29A 3U13A 3U7QA 1XD8A 3SQNA 4BFYA 2A3NA 1D4OA 2JLZA 4EJFA 5JQGB 2IHBA 4M6WA 3TZBA 4GOND 1OU4A 3KEFA 4FSXA 5LD2C 5D6NA 3QVGB 2X6RA 1N0WA 2ZRHA 4QREA 1PNRA 1TCCA 1FUKA 3NHLA 1SUEA 1YVDA 4RH0A 4HUTA 2B7BA 3IKJA 3LS2A 1HQDA 3TIXB 2GD6A 3M1IA 2R5FA 3JQAA 5EXXA 4PNEA 5CDYA 5D6OA 4XWTA 1CVLA 3U9SA 3ITKA 4H7HA 3CKKA 3ZWNA 3PWSA 2X4DA 2CUKA 1J25A 3H3FA 2YHUA 4UHHA 3C7AA 4UU7A 5D87A 3OCYA 4UVHA 3HCWA 1R10A 4E4YA 2JW5A 2PX2A 1B6TA 2FMFA 4DWOA 4YC7A 3LWZA 5KMGB 4OTZA 3ZHXA 1EUCA 3DWFA 4K6FA 1EQAA 3M33A 3O3MB 4E33A 2C3OA 1D09A 2YRFA 4FYYA 3ROPA 5IKXA 2IDMA 4B4WA 1JQDA 2P2NA 2HYDA 3QBEA 1IZ8A 4Z4GA 2PKQP 4RZUA 1DW9A 2XXBA 4JLWA 4PHFA 4EECA 2YMPA 4IUYA 4DCOA 2N1MA 1FA9A 2WHEA 4NOMA 1OQAA 3RVNA 4KU4A 1WQ1R 5CM2Z 2X3FA 4QARA 5BVHB 4F4FA 2BM9A 4XLTA 3M4YA 3O91A 1DKQA 2GEUA 4JMPA 2EQBA 4IKEA 2ZANA 3H2GA 2RK4A 3C97A 1HT3A 1U0SY 2VP9A 2FFJA 2OXTA 4RNDB 4AXXA 4LGYA 2RARA 2ZR0A 3FPEA 1YZQA 2X2EA 5IT0A 1CR2A 1ZMTA 3N8NA 2Z3WA 3QY9A 4IGKA 4R2IA 2B5WA 1XRRA 2Y05A 3RRZA 1QCCA 1ZZ7A 4RPCA 3HFRA 4HDOB 4J3NA 2GB4A 2IYRA 3PD1A 5IX8A 1I33A 3VOTA 1GQ2A 1RI4A 1SC9A 4FEGA 4GQAA 5EUCA 2D1FA 2JJ1D 1UM9A 3QF4A 3NWOA 3TQFA 5E1MA 4QPDA 2I1VB 1G38A 1Q95A 3FLEA 2GAJA 4HMPA 5IUNC 1Q0TA 1ZH6A 3RASA 2A92A 1L7DA 2HA5A 3PGXA 2ZRJA 2D2FA 1UJBA 1UADA 2ODBA 3DE7X 2BFBA 4DV3B 1E2EA 3ZD6A 5KWEA 1MPTA 1SUPA 2Z0MA 4JJZA 2IIVA 4GYYA 4EMUA 1LLQA 2WZDA 4CEIA 4RHCA 1EQUA 2WICA 4JODA 4URZR 3TX6A 5KZMB 2PJRA 2WWRA 1UJMA 1W4ZA 3IIIA 3W3AA 1R12A 2I6QA 2RGNC 5KYUA 3P0RA 1V3UA 1VYVA 4N3BA 2JFVA 5A5VA 4MUGA 3EFEA 1TYZA 2AC7A 3WGKA 3EZ7A 3NOXA 4IWNA 1X1SA 1VXRA 2LBPA 4FHZA 3OTHA 4QJIA 4FYHA 2ZJZA 1F6BA 4TMVA 1PSWA 2ERYA 3INGA 4RD2A 5BWBA 2HSGA 2JLBA 1F12A 4DARA 3WJAA 3GLFE 5EJIA 3QIVA 1RYYA 2ORYA 1ZO8A 2P4SA 4LI0A 4MICA 5DXFA 4CTNA 3BE8A 5AICA 1NC1A 1Q1GA 3SFTA 3D0KA 2ZETA 3AJDA 3IVAA 2ISSD 1PUJA 2J7WA 1RVV1 3E9RA 2Q2OA 2BE9A 4Q48A 1II8A 2C2BA 4WUVA 4PRKA 4B3TB 3LDUA 5KS2A 1L5HB 4KNVA 3ICPA 2AG8A 3OLXA 4ATNA 1BFKA 2H85A 2NO6A 4MW7A 3ZE0B 1YOBA 4CKEA 5K6AC 2ODRD 3DO5A 3LRPA 1U0LA 1L7QA 4G4SP 1K9VF 2OQVA 1XTIA 2J87A 4HXEB 2O23A 2FW9A 3OU2A 1DEKA 4UZSA 1Y3DE 3QMVA 1PSDA 4S35A 5EGSA 3URMA 5IJ0B 3Q8MA 1SUIA 2IPLA 2JBHA 4L8WB 4DTIA 1LKZA 1SQFA 1EEHA 4JXKA 5A4FS 4B2LA 3JQ8B 1YB2A 5AW6A 3JQAD 4JCCA 5IDWA 2Q0SA 4ZQFA 1TYDE 5F12A 3W1EA 3THXA 1XO1A 3D3KA 4MUYA 1H2BA 4DM7A 1QDEA 2UYGA 1E0SA 1PD1A 4RM3A 3ZKWA 4I8IA 4ENRA 3C15C 1PG5A 4AF6A 2I9PA 4F86A 2Z3VA 2QTWB 5J40A 4M9XA 4YAUA 4HB2A 2P9QA 3IDZA 4JGIA 1U5BA 3ZLBA 3AOGA 1G5TA 3E03A 3WV4A 2CLLB 1XTZA 3CNLA 4V24A 4ZODA 1AHIA 2VDNB 2BM8A 3L82B 1BH2A 1X38A 2R8EA 4NBNA 1ECGA 2C5BA 4GS5A 5ALFA 1IZ7A 1RQNA 2OCPA 4I9NA 1MB2A 3OU6A 3AEKA 4TKUB 2QGFA 3L41A 4YAOA 2J41A 1G9SA 1W85A 2WTXA 3DO6A 1VLJA 3EB9A 3KHUA 3L92A 2BL4A 1SZCA 3THWB 2W7TA 2VP4A 4M46A 3SEAA 5D3KA 1VECA 2W83A 1IEVA 3IPRA 1SM4A 3QKTA 4B3CA 4R68A 3UV6A 1Q21A 3H11B 3FW1A 1CUBA 2UZ1A 1UDAA 2GBIA 5ILOA 2X86A 3KVRA 1BJTA 3F52A 1XHEA 2J3EA 2XYHA 4ZOBA 2CL6X 4LZOA 3WICA 3EH2A 2BNOA 1LK7A 1V96A 2F1HA 2BMEA 3D31A 1FBNA 1IN6A 1TYAE 1DMSA 2BM1A 2VCEA 2F55A 4B45A 1OSNA 3PWTA 3R7WA 4IDOA 4OHKA 3WA6A 4W82A 1VRVA 2O1SA 2KW5A 3RYFA 2ZROA 4PG7A 4PN7A 1Y3CE 1ZA1A 2NLOA 3IQGX 2DECA 4QDJA 2X3YA 1V47A 1DC5A 1JHMA 2BJWA 2NO9A 1JQLB 4FS8A 4UUOA 1UOOA 1KL7A 1NKVA 2XCUA 3ZK8A 1Z2CA 1A82A 1KKUA 1R0LA 1P8JA 2H7CA 4RGBA 4Q05A 4ZQEA 1DCKA 1RXCA 4JYMA 4Q1CA 1T4GA 4HLQB 4YAGA 3VAAA 2H9YA 3S2ZA 1GG5A 3X0DA 2BTQB 4FI3C 1QGED 4EPWA 3MMPA 3NORA 3ESYA 4Q16A 3WS7A 2PUBA 1QVRA 1ZM2A 2H63A 1U8ZA 4AWAA 4CODB 3MB5A 2NXNA 1YZYA 2ZYTX 2DR0A 3WK5A 1CQWA 1J06A 5IARA 2PRIA 4IIXA 3EVAA 3M0EA 4ZHQF 1UC9A 3R3YA 2LCVA 2JJQA 4RTNA 3HKBA 4JL5A 2OXIA 3FOEC 2JK1A 1Y37A 1U8EA 4KLRA 4L4UA 4MAMA 2XTMA 3G02A 2W4MA 1A04A 1YQDA 1T8RA 4FLFA 5AOBA 5D85A 3OF5A 3RFTA 3ROXA 3Q8WA 1QIJA 4LMAA 1L2TA 2BV3A 4Q21A 3RS7A 2WOOA 5CA1B 1SXQA 1X8XA 3LKBA 4GVPA 2VSXA 2QTGA 3WYBA 1PWEA 4PU7A 4OFBA 4CKWA 2AJCA 1RZRA 1OIWA 3B6KA 1Y9EA 4ZQIA 3VH3A 3FTFA 1Q7EA 2XMPA 3OUZA 5DSZA 3KEOA 3GLHA 3KKNA 4FHGA 4OX9Y 3R0XA 3ETGA 5DHFA 5BUSA 3QQ6A 5JHGB 5A4AA 3UB3A 2X0KA 1N92A 1YZFA 1UZUA 3MWGA 5HSGA 1NZJA 2O3JA 4KK4A 1LDYA 4PS1A 1RQGA 2VAMA 3DL4A 3S99A 2QG4A 4QLBA 2XGOA 1MTOA 1Q0HA 4O5AA 5ECWA 2GEKA 4C6SA 3K9FC 3DVLA 1NIJA 1XLTA 3JR7A 3OIYA 3U7JA 3WLSA 3UK1A 1XLUA 3K94A 2ZRKA 3IODA 4PGGA 3BWMA 2AD1A 5JZVA 1IXSB 1RADA 5E3HA 4TZ0A 3I5MA 3E7DA 2GN1A 3ODGA 4LXIA 5BR4A 1N8KA 5CA0F 3UMYA 2DJ5A 2MR6A 2WT4A 5FA6A 1FLNA 1W5BA 1H2WA 4MO2A 5IH7A 4UM7A 1JIUA 1I14A 3LPCA 1QK3A 3PT9A 3QE3A 3A26A 2Q3BA 3S29A 3KQKA 4D3ZA 1G63A 3SE7A 1B23P 1Y6FA 2WPDD 2RHDA 5E3JA 1YBFA 4G24A 5KC8A 4KHPB 1R5JA 1QPBA 4DLLA 4QQRA 1PD0A 1CE8B 1TZ2A 1ONNA 2OPHA 4CW7A 1B1CA 1NLMA 2VDOB 2Q5IA 1QV9A 1NI5A 3K8QA 1DC8A 2YHBA 3HKEB 1Z34A 5CJPA 5AKKA 6REQA 2OLJA 3PUKA 4L9SA 4ERXA 1JDVA 2GYUA 3LH5A 4G84A 4P34A 4R0VA 1U0EA 2JFBA 1XZFA 1K88A 4LHWA 4YJFA 3CLTD 4XYEA 3FFXA 5FPKA 1DPGA 3LXUX 4BV9A 1M8PA 2L0XA 3QOYA 5HK8A 1Q7GA 1L9KA 1GGJA 4HQ0A 3W5HA 4RFSA 1YJQA 2ILVA 1QP7A 1GL7A 2J1LA 1DRUA 1OX4B 2IUOA 2F43B 4RW0A 4CIXA 5JXIA 1W9MA 2XUJA 1FTGA 4HNUA 4M1EA 3T1HB 5JAQA 2W43A 2X8BA 3JYHA 4FB5A 5EINA 1SHZA 4FDVA 4BNZA 4C76A 4R2MA 1DIRA 2ZJ8A 1OXSC 3HO8A 3O4HA 1CX9B 1WS6A 3SZ3A 1V4BA 2F62A 4I81A 4Y1GA 3LQKA 1QJ4A 4UM5A 1QPGA 1VLVA 1WDLA 3ED5A 3MAJA 4PXYA 3ZUGA 3HNOA 2J5QA 5JBIA 1WZIA 3QY0A 1EFHA 1X3SA 4OQFA 3A4IA 3MJRA 3GIWA 3FBTA 1NY6A 3A6HA 1FY2A 4U3JB 1WEKA 2IPXA 2QW1A 3O94A 1Z8HA 2VJDA 4PWYA 2PH7A 1TMGE 4EUFA 1DDIA 3DAGA 3FSRA 4PNZA 4D4IA 1RMYA 3G9XA 3JZFA 2ZRAA 4C1NA 4YRDA 4LZWA 3FMIA 4O63O 4FQ7A 4LFCB 3TG8A 2B99A 4J07A 5D3MA 5K0FA 1GL9B 1XN4A 2NYUA 3OLZA 4HBGA 3INRA 2IHYA 4TTAA 5BNFA 1DWQA 3JQGB 4LOLA 3PJEA 2B78A 2G36A 2IYFA 4P80A 5DTRA 5DGHA 5EIAA 2GJ9A 1UXJA 4CF6A 4JI7B 4CU2A 3FLMA 1R88A 1O5IA 2IIPA 3UH1A 4X62B 1UOQA 4WNYA 4BY9E 1SULA 4GBGA 4X63A 4KPFC 1OIXA 4ARZB 3BGDA 4PRYA 1JXQA 3HK2A 2GN0A 3RQIA 1X74A 1GPAA 3CBGA 5AW9A 4EX7A 1E0AA 2PVPA 1AHNA 1L7MA 3OHPA 2NSHA 4QULA 2JFWA 4LRWA 4B6GA 1QTNA 5JCJA 4DANA 5CXSA 1R6TA 1UPUA 4US0R 3NHBA 3BEOA 2WUWE 4WCVA 4JDPA 3CZ9A 4B3SB 1C7JA 4MHOA 4KR7A 5CDFE 2PZBA 3EDRA 1KNXA 1LQ2A 3C41J 3W4JA 3ESZA 4J0JA 4CFZA 4J7UA 1XLVA 2ACVA 1EVLA 3WJ1A 4CKCA 1TTQB 4GO1A 3LP5A 4IDAA 4KFTA 1KC3A 4PZAA 3F73A 1AUVA 2NZXA 3EIXA 4BECA 1C80A 1F60A 4MMXB 2WC1A 1FX0A 4GKKB 3LYLA 3GZDA 1QC5A 1IB0A 2E6KA 4HGYA 1XQXA 1UQUA 4IG9A 3RPEA 1WZNA 2AB0A 4K5QA 5I47A 1A2KC 1FS4A 1PFKA 1XNJA 1TYCA 1G7TA 1U2DA 4JGBA 5IWAB 1Z6PA 2FPSA 3KQPA 3DDCA 2AXUA 2OG1A 1YMUA 3O03A 1JWBB 3HNPA 1NLFA 2I4IA 3PENA 3TB6A 3ZBQA 4TS1A 4CCWA 4DV5B 1E9DA 3DNMA 5DYYA 2EBUA 1T6ZA 2IYNA 4B8YA 1WLSA 3JXEA 1I7QB 5K4HA 3PIIA 5BWLA 1EBFA 2NVUB 3UICA 4BV8A 3PR1A 4C6HA 3EARA 1E5VA 4E09A 2B25A 3H97A 3IT2A 1L5FA 2B21A 2JGAA 3CH6A 4IJ6A 4ND6A 2O1XA 2E4UA 3KT8A 3OSUA 1P4GA 1XFDA 1H5QA 2DQYA 4UASA 3BD7A 3WBFA 5THXA 4BNDA 5A3RA 4DV4B 4MW1A 3AERA 3G5UA 3IQWA 4D9KA 3BT7A 3J7TA 1T2FA 1GPWB 3U61B 1QYDA 3AG5A 3SR0A 3KOMA 4AL4A 2YINC 2CVPA 1D1QA 1Y82A 2AD5A 4RIEA 2OV8A 2A9VA 4CE6A 1OA1A 2BELA 3FHCB 3BPSA 4WNCA 3JAWB 8ADHA 2O2GA 2RAVA 2YXLA 3GJTA 4WN9B 4KQHA 4AJ9A 2D3WA 2UZAA 3UGQA 3V8QA 1Z62A 3QBVA 3LNCA 3WAGA 4OG2A 2OGZA 3RTEA 3BTSA 1VCHA 4JEUA 3SLRA 3QVXA 5AJTA 5TQ0A 4BZQA 2GLTA 3GLIE 2GDZA 1YJAA 5DXAA 2BTOA 3UGJA 1Y8RB 3LRXA 4V2UA 4CM5A 2Z30A 3T9CA 2VPZA 4PYMA 1CUJA 5I5EA 2O2EA 5KWVA 3KSZO 4XCVA 3GAZA 4F8YA 3U40A 1UDBA 4RC9A 1P0QA 3KV1A 1T0PA 2A9OA 5ER6A 2VBCA 3C6ZA 1E58A 4G6ZA 4NBSA 5EHIA 2OYRA 4A8JA 4KQXA 4ZIRB 2ZULA 2DZDA 3NH6A 2QX4A 3O0TA 3VMFA 4B6JA 1DLIA 2OBXA 4LJKA 3VJRA 1CQJA 2WIJA 5TV2A 1G8KA 2QSUA 3LP6A 2UUPA 3SYLA 4EI8A 1PR4A 3B7HA 5DHSA 5JDIA 2ONJA 2I9KA 3RNOA 2EKBA 2BUAA 4GWKA 3ZS9A 3AM3A 4H0FA 4E5PA 3W5CA 2PT9A 3CEPB 1UBKS 2OO5C 2QTLA 4DT1B 4RTJA 3IILA 4D9FA 1P45A 3D4IA 1XNQB 5AJZA 5CDHA 3RU9A 3DG9A 3FVRA 3GUVA 3TCXB 4JB3A 3RF6A 1Z07A 4D3FA 4Z5CA 4HGNA 3CVYA 1Q5PA 3GRCA 4QELA 3QE0A 5FWYA 5AK5A 3EULA 4WXEA 2GBGA 4ED9A 3EA0A 1ZY2A 2RJ3A 4I6JA 1JEQA 1PFQA 1R4MA 2PYZA 3FDJA 5HBGA 3RUCA 4YT2A 5JARA 4CLOA 3T5TA 2JAPA 3E1SA 1IM2A 3MRSA 2J46A 4BMZA 3TGLA 2H06A 3A1DA 2JB9A 1AKYA 3LUGA 5FCDA 2ZUWA 1K4KA 1SBYA 3JXDL 2DUUA 5EKUA 4AMGA 3QU9A 5DF1A 3KCNA 2XAUA 5LZ2A 3CVOA 1X6VA 1SU7A 1BCSA 3ZC3A 2EZ4A 5CYFA 4EEKA 3V3TA 1PN3A 3G1WA 4RHUA 3CROL 2WB2A 4HB3A 5DZSA 3GG2A 2F8LA 3I6YA 3IQXA 3MIZA 4B75A 4BE9A 2IH4A 4MHTA 2FWNA 4BNVA 3U56A 2RBEA 2V3VA 1COWA 5J1SB 5SY6A 4HAOA 5K0LA 3OAAA 2JPDA 1P5FA 1Y5RA 2NO5A 4KKXB 2VDQB 621PA 3CCBA 3A9YA 3ETCA 3JWEA 3O83A 5CH5A 4ZAFA 5AI0A 3SHVA 1GGNA 4ZI3A 4BKQA 2ZSBA 4B44A 3KXKA 4R8SA 5KJ6A 2AXEA 3L7NA 3TEPA 2ZREA 4TLEA 4ZTZB 2A78A 5FUMA 2YIMA 4NPAA 5JSKA 4DLNA 2GQ0A 4QKQA 3DWEX 3LT1A 4MI3A 3TJMA 1YRWA 2OD9A 1NF9A 1RZ3A 5FI1B 1PVVA 4XUCA 1ADRA 1FU7A 1OPRA 1VZ2A 2JLAA 3AHHA 3DUFA 3UN1A 2IOYA 4ZYXA 1Y6JA 4IOMA 3TQOA 1LBTA 3IPLA 3CINA 1N5IA 4QT0A 1T0UA 3O3CA 1U0TA 1FNSA 1RLMA 4FQ5A 2DBZA 3TK1A 5LP6A 1U1FA 2JFQA 3A6LA 3RSGA 1ZGCA 2FPGB 4EEZA 5C1DA 4Y2VA 3RUFA 2W00A 4RF4A 5JRZA 5C81A 3OPMA 4JSRA 1IY1A 5HUQA 4IWXA 1JU3A 2IHKA 3AHJA 2FUKA 3I6ZA 1PZGA 2E0IA 1R8YA 3L4BC 1JJFA 1H0RA 2H5JA 4KXXA 4DW8A 3ZDZB 3PGLA 1L7EA 4EARA 4HDKB 5HZGA 1WB9A 4FIDA 3CWCA 1I6KA 4YALA 1N4DA 3H19A 2PBLA 2F8SA 2XIUA 5DE3A 1VMKA 3NHSA 4TKZA 5AK0A 2ZWVA 1SKYE 3MYRA 3LVQE 4B3FX 2J0EA 3NEYA 2W4QA 4QYSA 5EWMA 2F8TA 2IYUA 4NS4A 1NT4A 4PQFA 4UFOA 3R9KA 5ADHA 1BZYA 2QTRA 3H5NA 2HEGA 4LHZA 3BVPA 4V02A 4ACBA 4A6XA 3ADBA 3BMCB 3I1IA 4FYKA 4KLNA 3OHSX 3AVOA 1MJGM 3P9NA 1GPDG 4FT2A 3MWJA 1CFJA 3M3DA 3GRPA 1QIHA 2KZ8A 3AY6A 1PGQA 4H7IA 1ZCBA 4LN1A 3TEFA 3FPHA 4AG5A 1OIVA 3RJZA 1MRSA 3ACCA 5BSVA 1TUIA 3SR4A 3SCZA 5JO9A 1G9TA 4BQIA 5K0TA 1LNSA 1DRWA 2RAFA 4KIWA 5EI5A 1FNDA 1A9ZA 4RIFA 3QEKA 4RVDA 5EWJA 1TI7A 3KEQA 4NMMA 3Q9UA 4PE5B 5E95A 5HGXA 4JKYA 3LCCA 1NFRA 5CM9C 5L3RA 4DE8A 4IKOA 5FTJA 1KOLA 3V34A 2XJ9A 1Q83A 2ZLBA 1USUA 3AF2A 3OZAA 2PKXA 1DQNA 1NI4B 3EVCA 5A6SB 4L76A 1HYEA 2VVTA 2Z58A 1SOAA 5AMXA 2PJDA 4L07A 2J3DA 1NMEA 3PNVA 1VIMA 2JLUA 4RJ2A 3CTPA 5EP3A 2WQZA 4CLEA 2IZ1A 2RGEA 3M3HA 4C2UA 5IM4F 1H4TA 1U6KA 1YUNA 2FA9A 2VFAA 4IUDS 1KEEB 2BHTA 3E9DA 4O6VA 5B1IA 3RB8A 4D45A 4JL8A 2FKAA 5BW8A 1C0PA 3CLKA 3R8FA 4E1VA 5CP8A 2OAEA 1QWOA 1K9SA 1IM5A 1PK9A 3RYCB 1U9JA 1ISRA 4BFLA 1Q50A 1IUPA 2CHVA 4NHOA 5DNEA 4AUKA 5EJ8A 2PIAA 1TOAA 4OFWA 2XTZA 2I2WA 5FPSA 4EELA 4C7OA 2F4NA 2PRYA 3B6MA 3OT1A 3AINA 4HWKA 2RH9B 3NGXA 4NMHA 1LF0A 2D5LA 5CFPA 2NO0A 4YMVA 4FILA 3PB3A 4XVQA 1Z47A 3D1LA 3V7FA 2D54A 2Y1FA 1SVSA 1SXIA 1Z16A 3OD1A 4KWIA 1OILA 4U7GA 2FSVA 1JI3A 3NP9A 2J0QA 3W78A 2NV0A 1P62B 3TZCA 3EMVA 5AHRA 5AI8A 4QSHA 3W7BA 3RC7A 3V2HA 4XR4A 1IRXA 5DGCA 3KT3A 2GJAA 3LYHA 5J4KA 4GI5A 3PX7A 1PS0A 3ASUA 4D8VA 2O9JA 3AP1A 3VNSA 2RHWA 4P7FA 3R75A 3H6HA 1RD4A 2X76A 3EF0A 3OE7D 5HIIA 1ENYA 1Y1SA 2AT1A 5HIMA 3AY7A 2R6FA 2DSNA 3QVGA 4N5DA 2ZXEA 4BWGA 1LDGA 1RWWA 3H99A 3M70A 3MWEB 3MS2A 4ZYUA 5CXQA 2FP3A 1BFUA 3GEEA 3M4JA 4MVJI 5E0KB 1JA1A 1OE0A 2FWPA 1EB9A 4RWEA 3H9QA 4XWYA 4D4MA 3F6CA 4X6UA 5AWFC 2I6FA 4PONA 5CTAA 2PU7A 2FSGA 1Z75A 2GKOA 2IFTA 3ZWAA 2L2QA 3W5VA 1XWWA 3N7TA 3MHTA 1IN5A 2CBGA 1BW9A 2IL1A 4JC5A 2A33A 1E2GA 4QQNA 4DYVA 2EF8A 2BWJA 1N3YA 1EH5A 2Q1YA 2OOKA 3H83A 2HLNA 2NNWB 4N7BA 3AWIA 1ZQ1A 3KLOA 5BSMA 3SJCA 4B9AA 2CV0A 1BVHA 4HDMA 4D4GA 2F3QA 2FG7C 2Z9CA 4P4GA 5IT4A 2B2NA 4UQOA 5IVIA 2P0EA 5DEOA 5DDIP 2NADA 3SQDA 4CFYA 4EYKA 1PJ3A 1AO0A 1XP8A 4QOHA 4AKTA 2GM3A 4NMLA 4KO3S 4MRVA 3IFSA 1XL1A 2AW3A 5BN5B 5KYWB 2O19A 2XDQA 4YPOA 2GRAA 3LXXA 4RJJA 3EXFA 5D5HA 1MW8X 4LMPA 4J94A 5C9ZA 4FHEA 3HM9A 3LBIA 3N59A 2QB5A 3RVJA 3EG9A 3CUSA 2VDKB 4HK4A 3QKIA 1LC0A 3ZWVA 1P74A 2ZUFA 1NBWB 4KR0A 1Q0ZA 3OETA 3RRBA 3HLTA 4Y67A 4YMUA 4XFJA 5GMOA 5HMLA 1R9MA 5FUQA 3NBXX 3ZDAA 1U98A 4Y1RA 5JMWA 1U63A 4M0CA 3D3JA 1FVHA 4REMA 2AKEA 3GZJA 1GTJ1 4TVOA 3WRYA 4ZI2A 4BB9A 4TZKA 3MTQA 4Y9SA 3DJYA 4IF4A 1JNXX 5IDYA 3UPTA 3VPSA 1LPPA 3ZBPA 3RODA 4FB4A 5CNIA 4DLRA 3NWEA 4UNSA 3NNSA 2AI1A 4ZTUB 2AOVA 3TRDA 3F78A 4ID9A 1Q77A 4M83A 3NM5A 4CF5A 3M34A 2VC2B 4LY9A 2BFWA 3RAFC 1TCAA 2GHIA 2OOSA 1H2YA 4L78A 3WYFA 3HWWA 3S1LA 2P2YA 2F64A 4A0RA 1R4AA 2ZYDA 3AFOA 2DEUA 2KEIA 3DDOA 1HE3A 2LW7A 3R5TA 4LHXA 2REQA 4KL8S 1B0PA 5EHXA 2FX2A 2JLQA 2N42A 5FIUA 2BFFA 1SNYA 1WD5A 3GT7A 2C8JA 1XKTA 2OV2A 3LDFA 4QXOA 5HUJA 1G21A 4P0TA 3LIIA 4NOKA 1OAOC 4HVCA 1TVEA 1EP2B 3TL3A 1NY5A 3TTYA 5K3OA 1J07A 2NGRA 3HKCB 4NTZA 1C9MA 2NO1A 1DMRA 2ODQA 4WSOA 5G0TA 4RTQA 2X0DA 2JAHA 4YBAA 4DCTA 5LLTA 2IPOA 1ZISA 3I05A 3ISTA 2PNFA 4M4SA 4R1UA 4D4KA 2PYDA 2VJKA 1DBQA 2Q3EA 3O92A 3PDHA 4PRZA 3BQ9A 4RABA 3T9EA 2IYQA 5DBEX 2I3AA 1SRQA 1QE3A 1OREA 2A1TR 4M8KA 3GDFA 3VAYA 1E3WA 3KEGA 1NBAA 3AYXB 1M2WA 1QIDA 4RV5A 5DX1A 3ASZA 1SHJA 2FEWB 2GHQA 2BRUA 2O3RA 1NQOA 2B36A 1XMIA 1TO2E 5JHHB 4GZ5A 4RVNA 4IVQA 5EE3A 2ZB4A 4IH4A 4YRRA 3MFYA 4MCIA 4ZWNA 2EL7A 3CVXA 2EKPA 1OT5A 3KYDA 2XUPA 3CZQA 4G1UC 4O4IF 4OHXA 4WLUA 4F0JA 5K8UA 1TA9A 2N75A 3ZR4B 3I04A 1IQ0A 1A9OA 3HNRA 2GKGA 3L02A 1IWPB 2Q3HA 3ZKCA 4GZ6A 2DMRA 3MTDA 4U5QA 1YQQA 2YVUA 4HXFB 2FR8A 4FW9A 5JLAA 1WB4A 2OENG 2QPLA 1A1SA 4LPSA 4XJTA 4JBIA 3TEMA 5HF5A 3DZDA 4EHDA 3IT0A 5TQJA 1LC3A 5IJ0A 2V6BA 5KYXB 1YASA 2GCOB 2SNIE 2FPLA 2W9XA 4NCHA 2XB4A 3JQ8A 1KZ1A 5AR1A 1N2ZA 1CNFA 2GN4A 1FXWF 1TPYA 1LLUA 1ZMXA 5I7SA 3QLTA 2AZTA 3FYCA 5F7XA 2HM7A 4J0GA 4Q3NA 3KDSE 4WZAB 4B17A 4I6EA 2Y99A 2ZZNA 3E22B 1FFYA 3WWOA 4J75A 3ORSA 2DPXA 1HLDA 1MGOA 2VF2A 3BK1A 5C5CA 1GSOA 3H5RA 3DONA 3SVZA 3ULKA 4EJMA 1JEDA 3NANA 4HG2A 1H3NA 4AZSA 3QPUA 3W6ZA 1ZRMA 4GC9A 2XOEA 5J43A 5CX1B 4NJMB 2W98A 1GXSB 2P91A 3EBLA 1E62A 2B5OA 4ALKA 1BYIA 2A5JA 1UCFA 3FE2A 4CT4B 3T61A 5D5PA 1TDJA 4O2BA 5CXUA 3D59A 4B3MB 1PWYE 4A0SA 4B6OA 2Z2YA 3H7IA 1NONA 4B6QA 5I7FA 2BY4A 5DLEA 5K0EA 4B3HA 3THWA 5E6RA 2VJAA 3KUKA 1EAMA 4YAWA 1R0RE 2FW6A 3DEZA 3ADDA 1I7LA 3DXFA 4LS3A 4XYLA 4A03A 4JBXA 3VR2D 3H11A 3HRHA 1W44A 4FNMA 5BUZA 3D7NA 4HLCA 1TGVA 1YB5A 3ECSA 3OPXA 4X94A 1L1FA 1JR4A 3V48A 3FNRA 5T8KC 3CX7A 1YJ8A 1ZKMA 3PGVA 4LTMA 1QRSA 1F9EA 3BA6A 1JR3E 3MM4A 2I65A 2R84A 3DR5A 1PGNA 4GBJA 1WCV1 4L08A 4CYMA 4DMRA 1SO8A 4ENUA 4CDNA 4OBEA 1K6IA 5DP1A 3F51A 4MP3A 1MHTA 4WY5A 4LC0A 1J8DA 4IHQA 4YDQA 3GA7A 1N6RA 1KJ8A 1N57A 1GGEA 2VBGA 4RCVA 4DJEC 5JFOA 2PSHA 1T24A 2ZTHA 3PS9A 1SKAA 2MMCA 2QAGB 2OYSA 1BMFD 1NW5A 4R2HA 4MYHA 1UZLA 1NVBA 1ZOIA 3PXUA 4XPIA 1WUHS 3FKQA 3FFBA 3LCRA 4H77A 3HYRA 3UWDA 1NDUA 2P2CA 1DSSG 1XLWA 2PFSA 3H6GA 4QC2A 3K0SA 3GDOA 4WZBE 6AT1A 2WK1A 4K6CA 1GCAA 1OFUA 2BTQA 5TQ2A 4F2WA 3ZY3A 5PNTA 3FBWA 1C30B 2O48X 3MINA 3OQ6A 5FWXA 3RM3A 821PA 1AZTA 4UKDA 2O5RA 3GP3A 4BGVA 3CR3C 1NQAO 2C42A 3JWJA 5LQSA 1J7KA 3ZUPA 1D2GA 4E4TA 2H1WA 4HFNA 4MWCA 4ZAXA 2DSTA 4ZOLF 1HDOA 5FLEX 4V1CI 5K2OA 1JGTA 1SUBA 1I5OA 2AC2A 3IELA 4M89A 4X8HA 3RBXA 4HUQB 4TQAA 5JPIA 1UMDB 1EDOA 2HY7A 4BC1A 2C1ZA 4JJGA 5BOSB 1MFPA 2EARA 1TK9A 3DZCA 3LC0A 4EG5A 3E5RA 4II7A 3OM1A 3V8VA 2ZSUA 1ISHA 3ZDFA 3GGGA 5TT1A 3DA8A 3P71T 4RL4A 4EG3A 4ZZ3A 4L2IB 1KZ9A 2K7ZA 2CDAA 3IOBA 4ZVMA 2Q4BA 1BWPA 1KBZA 1VOTA 2IYLD 1SPXA 3A1UA 5F1KA 4ZZ1A 1XEFA 1HZJA 4MWSA 2FWJA 5LYJA 4EPXA 1YWGO 1GCOA 4U7JA 1LSUA 3QFIA 4RM2A 1QLWA 3P2MA 4FEAA 2X0EA 4DKXA 3VBCA 3U7HB 3U7RA 3IMKA 1UIMA 3K0EA 5BR1A 1E92A 3GI1A 1BVRA 1C0EA 4O0MA 4R9UC 4EVIA 4TT3A 5ARDA 4C6TB 4TT8A 5MF6A 3FRIA 4MR9B 5JRJA 1U6JA 5JYEA 3B3GA 3RUDA 2Q9BA 4GI7A 4RXMA 3TBHA 1J8YF 2XRFA 1J0XO 2QTCA 5JAMA 4B9EA 2VWPA 3BMOA 3IUMA