4EK9A

Crystal structure of dot1l in complex with epz000004
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
328
structure length
325
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational adaptation drives potent, selective and durable inhibition of the human protein methyltransferase DOT1L.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
total genus 99
structure length 325
sequence length 328
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4ek9A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ek9A02
3KU1A 3R9XB 3C3PA 3LCUA 3SSNA 3PVCA 5K01A 3FTFA 3LDFA 5KS2A 2GB4A 1WXXA 3E23A 3I64A 5IH3A 2ZIGA 4AUKA 5ERGB 2HWKA 1KIAA 2JJQA 1VQ1A 1YFJA 3HVKA 5DT2A 1ZHFA 4X63A 2PJDA 4R8SA 4Y30A 5LQAA 1N2XA 4GOND 3UWPA 3I58A 4RTMA 5DRTA 1JSZA 2ZIEA 5C1IA 3M6XA 3KQSA 1X1BA 4MQ4A 2AOTB 4QVGA 1NW6A 1WZNA 2GH1A 4GOLD 2BR5A 1IXKA 5E9QA 5FHQA 4DA4A 3B3JA 3HCBA 4KWCA 2PBFA 3ELYA 4R8RA 2FHPA 3GJYA 5DM1A 3GIWA 5F2OA 2ZBPA 3HCFA 1XTPA 3X0DA 1RI1A 3FYCA 4XUEA 1X19A 4DKJA 4DZRA 4FP9A 2OB2A 3G8BA 3S68A 2B25A 5K0LA 2BZGA 4HTFB 2YR0A 3TR6A 4YMGA 5ICEA 3SSOA 2ZVJA 2BH2A 3EEYA 1M6YA 4C05A 3OU6A 2QRVA 4C06A 2FK7A 1INLA 1QAOA 3LX6A 4C08A 3KR9A 4AZWA 1G60A 3TM5A 3FUVA 5CVJA 4DMGA 4R6WA 1L3IA 5CVEA 1VBFA 4QDJA 1NW5A 3A25A 4EK9A 3MAGA 2NXNA 4RTJA 8MHTA 1VP3A 5E8RA 5FTWA 4DQ0A 1G8SA 3C3YA 4QTTB 2NP7A 3IEIA 3KQTA 3MTIA 1UWVA 2FRXA 3KPJA 3JWIA 3CCFA 3EVGA 4RV9A 1P91A 4AZVA 4CKBA 5G02A 1DUSA 2NP6A 1AV6A 1TW3A 1O9HA 1ZKDA 2G8NA 2FYTA 2XYQA 3OE4A 3R0QA 2ZWVA 3JWHA 4FT4A 4A6DA 2XYVA 4RTQA 3BT7A 3O4FA 5EMLA 5FA5A 5DTRA 2ZIFA 1JG3A 3UA4A 4BP3A 2VDVE 3HA3A 3DMFA 3LPMA 4RWZA 4PYKA 4G56A 5KYGA 4OQDA 3LCCA 3OU2A 3EVEA 5ICCA 3NWEA 4PCLA 2G1PA 3L8DA 2QE6A 3HVIA 1NV8A 4M36A 2YUIA 3PB3A 2AVNA 3V97A 1PRYA 1P39A 1IY9A 4HH4A 5K0GA 1P1BA 1FBNA 1NKVA 3LHDA 3P9CA 3DH0A 3NVKI 1X1CA 5GINE 3HVJA 2YTZA 3DMGA 3IYLW 4RSRA 3SXJA 3NDJA 3KPYA 1KPIA 2ZW9A 3OPNA 3TQSA 5DX1A 4ATNA 3CGGA 5K0FA 2IH5A 4MIKA 1XVAA 3UJBA 2AOTA 2OO3A 2PWYA 1AF7A 4IV8A 2YXDA 4ER7A 4PGHA 3G2MA 2HV9A 3DULA 4LECA 2EJTA 5M5BA 3B7PA 2ZCJA 4GOOD 4Y2HA 5D1NA 4OA5A 3ER8A 3B89A 3HCAA 4PIMA 1WXWA 3P9KA 4GBED 5T64A 4OBWA 3LL7A 5FWAA 4ISCA 2UYCA 1XDZA 2A14A 1YUBA 3G2PA 3M4XA 4LG1A 3PLAE 4QTUB 1KHHA 3QOWA 5EKUA 1EIZA 3P97A 4M38A 4RTPA 1P1CA 5FA8A 3WSTA 4U7TB 3BWMA 1ORIA 3DXXA 3MERA 3PX3A 1XCLA 4HTFA 5D1HA 1BOOA 3TRKA 4C04A 5K09A 5CVDA 2ESRA 1NW3A 4MTLA 5B1SA 2P8JA 3I5UA 2QYOA 3Q87B 4NECA 2I7CA 2GPYA 3HM2A 3EVZA 3PFGA 5U4XA 5E1MA 5HIKA 3DLIA 2AOWA 4RTLA 4YV1A 4PYLA 2I62A 3UJDA 3FYDA 1VL5A 1X1AA 1XDSA 3HA5A 4ER0A 3HCEA 4PINA 5E9WA 2PX8A 4HSGA 2BR4A 4CWAA 3FUXA 5JR3A 1U2ZA 5HIIA 1YZ3A 3G2QA 5P8WA 1EJ0A 3P2KA 2P35A 5E1BA 3KQOA 4QPNA 3MHTA 5DPMA 2CMHA 3GRYA 2AN5A 2K4MA 2NXEA 2Z6UA 4YMHA 3LSTA 5DXAA 3PTAA 4GOMD 4HC4A 5EVJA 5CVUA 9MHTA 2JHAA 4AX8A 3DUWA 5E1DA 4FR0A 2C7QA 3EGEA 1RJFA 1SQFA 3VYWA 1JQDA 1JSXA 5CM2Z 3BGVA 2WK1A 3DOUA 2OB1A 3KQMA 5CVVA 5FUBA 1KPGA 5ICGA 5DX8A 1NV9A 3M6UA 2IDJA 4IV0A 3BGDA 3EVFA 2R3SA 2IH2A 3FTEA 2NYUA 2CKDA 3FPHA 1N7IA 1QANA 5EQJB 3REOA 4E2ZA 3SR4A 5BW5A 1XDUA 1I1NA 4EVIA 2C7OA 1UIRA 3C0KA 4XCXA 5HIMA 4WVLA 5DTMA 2P7HA 4GC5A 4PWYA 5E2BA 5CCBA 1D2CA 4RVHA 4R05A 4HG2A 3A7EA 4YUWA 1F38A 1KR5A 3FTDA 2OPBA 4PYJA 2Y1XA 4P7JA 7MHTA 3G7UA 3GRUA 5GIOE 2ZSUA 3RW9A 3CVOA 2LD4A 3ORHA 2PKWA 5KQSA 1JQ3A 1MHTA 2ERCA 4EKIA 3OCJA 5E1OA 3SGLA 4E2YA 3P71T 4E2WA 3HCCA 5KVAA 1FPQA 3VSEA 5BW4A 4C07A 4KRGA 3T7SA 3NDIA 4GQBA 2Z6QA 5EC8A 5EMJA 4PIPA 2AN3A 3G8AA 4DM3A 4OQEA 2B9EA 2G70A 1KPHA 1Q0TA 3CKKA 1NW8A 1M6EX 2P3OA 2IH4A 2DPMA 2GA9A 2VDUE 5DSTA 2AVDA 2ZBQA 1VP9A 3P8ZA 5HIJA 5DLYA 4E33A 1ZGAA 5HFJA 4YUVA 2JH9A 3KPWA 4P7FA 1SQGA 1I4WA 2P3LA 3M6VA 2NNWB 5H02A 4PCAA 3BXOA 3UJ7A 3GNLA 1EJ6A 4KDCA 2AZTA 2P40A 2B78A 5EEHA 5HZMA 2O07A 2GS9A 1VLMA 3EEOA 1AQIA 1H1DA 3MQ2A 1YFLA 3GCZA 3IV6A 1YF3A 1JTFA 2UYOA 2I9KA 2IFTA 3ERCA 2AS0A 4M7RA 3EVBA 3G5LA 5HEKA 1I9GA 3CJTA 4EKGA 2EG5A 4Z2YA 4QQNA 3GRZA 1QYRA 1JTEA 3P2EA 1Y8CA 1Z3CA 5K03A 2C7RA 3NWBA 3G2OA 2ZLBA 2JHPA 1R8YA 2ZULA 2GAFA 2PWPA 1ORHA 1WS6A 2KW5A 3O7WA 5FULA 4EMSA 3TFWA 2WA2A 4CTJA 2P7IA 1FP2A 3UBTA 1KP9A 3LKDA 2ZZKA 5EPEA 2QRVB 2CL5A 3JWJA 3D2LA 4BLWA 4YV2A 2N47A 1R74A 5LQKA 4IWNA 4PYNA 1R8XA 3FPJA 2EX4A 3B3GA 2HTEA 2IBSA 3FRIA 3BWYA 3BKXA 5K0EA 4RVGA 4F86A 1YZHA 4AZSA 2JG3A 3R3HA 1RI4A 3OFKA 4R6XA 4QQKA 3EPPA 3NJRA 3SVZA 2ORED 2UYHA 5E8JA 4RTSA 1VPTA 3GGDA 1RJGA 2OYRA 2AOVA 3QV2A 5LSAA 4MHTA 4OBXA 3NMUF 2UYQA 5IKMA 4EQZA 1EG2A 2FPOA 5K0NA 2E5WA 5EHGA 4AZTA 3AXTA 1ZGJA 3G88A 4F84A 2Q41A 4A6EA 5KQRA 1X1DA 2ZZNA 2ONYA 3ER9A 5F2NA 2OY0A 1L3BA 1FP1D 1XXLA 2DULA 3KR1A 4FZVA 4XUDA 3EMBA 3UZUA 5CIYA 3I9FA 3I53A 5CUQA 1JG4A 2PX4A 1R18A 1BC5A 1ZQ9A 3DXZA 3E8SA 3EMDA 4L7VA 4V0QA 2R6ZA 3TLJA 4DCMA 4YUXA 5EEGA 3TOSA 2IGTA 3A26A 3GDHA 3ME5A 5LQUA 3HNRA 2P3QA 2H11A 3CJRA 3KPUA 2ONZA 4HRAA 2YQZA 5LQJA 3AXSA 1NT2A 3NVMB 4OA8A 3ANXA 1KYZA 2PXAA 4KIGA 3HVHA 2HNKA 1QAQA 1NBHA 1RI2A 1XJ5A 3ELUA 3THSA 5DRYA 3FUUA 3SX0A 3BZBA 1EAMA 3EVAA 2UZ4A 3FUWA 2H00A 1SUIA 4X1OA 5FHRA 2PX2A 4C4AA 3GWZA 4CKEA 3K6RA 3BWCA 5CD1A 2ZBRA 1R6AA 5EIWA 2NXJA 3AWIA 2V7EA 3OZSA 4ER3A 3UFBA 5GP1A 2VDWA 5LQCA 5FQNA 1TPYA 4RTNA 4OX9Y 4BLUA 1IM8A 3VC2A 2QM3A 1RJDA 1OR8A 1UFKA 3FTCA 3LDUA 2OKCA 2AR0A 1QZZA 10MHA 3B5IA 2V74B 5DSXA 3M70A 1V39A 2PLWA 2BM9A 2YXLA 3BWBA 1D2HA 1WY7A 4K6MA 3KQPA 2H1RA 1O54A 2PXCA 1TW2A 5FWDA 1RJEA 5JUWA 3C6MA 3T7RA 3ELDA 4JXJA 3UJAA 5C9ZA 4GC9A 3GO4A 3E7PA 3CJQA 3T7TA 5HOQA 2B2CA 3R24A 5HILA 2O05A 3OZRA 3BUSA 3ELWA 3NW9A 3G89A 1T43A 3HCDA 3P2IA 4LWOA 1QAMA 5DM4A 3UJ6A 4YUZA 3OFJA 2YX1A 2OBFA 2B3TA 3AJDA 2JHCA 3KR2A 1BHJA 3TKAA 4E2XA 5K05A 4P7KA 5E2AA 3RODA 4KW7A 1L1EA 3KQVA 3GRVA 4HGZA 5BXYA 2EFJA 3Q7EA 2PXXA 3CBGA 3LKZA 3DMHA 2YVLA 3M6WA 5EZSA 3CC8A 3A4TA 3FPGA 1G55A 3A27A 3LBYA 1Q0SA 3MCZA 4P58A 3HTXA 5DXJA 5C0OE 2OZVA 4M37A 4GUAA 5FCDA 2AOUB 2HR1A 2XVAA 3SSMA 1SUSA 3KQQA 5T6BA 3DTNA 3TM4A 2C7PA 2O0LA 2IPXA 2ZFUA 5LR6A 2G72A 3A7DA 2EJUA 2VS1A 4X61A 5EMMA 3ID6C 1G6Q1 4KDRA 1D2GA 2ZWAA 1F3LA 4RVFA 2ADMA 4GF5A 3UJ9A 4CXMA 3KQYA 3MB5A 4X60A 4PYIA 5DM2A 1L9KA 4WXHA 5DM0A 5ICFA 3JWGA 3SM3A 4YV0A 5BP7A 5LQRA 5MHTA 3AY0A 4RVDA 4PNEA 5EIFA 1VE3A 3O31A 4PYQA 4BY9E 3M33A 4PYMA 5T67A 3HEMA 2XVMA 2O57A 4DCGA 4RTRA 3F4KA 1BKYA 3R6TA 4FGZA 2OXTA 3KHKA 5DTQA 3E05A 4E30A 3GU3A 3BGIA 2G71A 5EZQA 1JG1A 3MGGA 3LGAA 3C6KA 1NBIA 3KPVA 4RX1A 5GM1A 3TMAA 5EKXA 4CTKA 5GIPE 3QOXA 3LCVB 3DXYA 3FUTA 2IBTA 4B17A 5K0CA 2PVCA 2P1DA 4FSDA 4FT2A 2CWWA 3PX2A 1EQAA 2IIPA 2O06A 3OU7A 3UJ8A 1SKMA 2AN4A 4RYLA 1HMYA 2P41A 2GLUA 1MJFA 4O29A 1YB2A 2PSSA 5EG5A 1JR4A 4E32A 3FZGA 3EGVA 4FS8A 1FJXA 4XUCA 2VP3A 5GWXA 3UA3A 5LQNA 3LBFA 3FRHA 4RTOA 1HNNA 3UJCA 1KXZA 1B42A 3LDGA 5CCXA 1L3CA 3GXOA 3EGIA 3PT9A 1M0EA 2YXEA 2PT9A 5GOZA 3DLCA 2ZZMA 1ZG3A 2FCAA 5FQOA 3FPFA 1SVUA 1KYWA 4HGYA 2BM8A 3OZTA 3OE5A 2WA1A 3VC1A 2HMYB 2PT6A 1R00A 4PGGA 1DL5A 3THRA 1G8AA 2NXCA 4BLVA 4PONA 4GEKA 1RI5A 5EMKA 3MTEA 1VIDA 4C03A 4E70A 4PYOA 4F85A 4FSXA 3H2BA 4POOA 3HA7A 3P9IA 1N7JA 4E31A 3K0BA 3KQWA 2VZ9A 3B3FA 5EGSA 4DF3A 2Z6AA 4IKPA 1JG2A 2QY6A 5EOVA 1XCJA 2CMGA 2Y1WA 3KR0A 3U81A 1NE2A 3IHTA 3MCTA 5FADA 5F2KA 1NW7A 3PS9A 3PFHA 4H0NA 3T0IA 1RI3A 5EHIA 3GRRA 2IP2A 4ZTBA 2FK8A 3V8VA 2AOXA 1AQJA 2XBMA 4KIFA 4V0RA 2BR3A 2PV0A 4ER6A 5DWQA 1G38A 5K8VA 3HP7A 2I6GA 2AOUA 1WG8A 2IDKA 3SMQA 3DR5A 4QDKA 5K0BA 3BKWA 4U7PB 2PX5A 3LECA 3EVDA 4KVZA 4X41A 3TKYA 1JQEA 4BP1A 4QVKA 3EVCA 5DX0A 4MWZA 5E9JA 3P9NA 5K0JA 5GM2A 3TPZA 4RTKA 2JH8A 2PY6A 2F8LA 4LWPA 3RIEA 2PGXA 3G5TA 1PJZA 3NTVA 1SG9A 4P7GA 2XYRA 4YUYA 3KKZA 4CKCA 3FPEA 1DCTA 4UOEA 4ER5A 4QPPA 1O9GA 2ZTHA 3DP7A
chains in the Genus database with same CATH superfamily
3RUHA 1M2GA 2VDNB 3G1WA 3ICCA 1ODIA 1OT3A 3RCBA 2Y67A 3GMSA 5IKXA 1Y6RA 3E23A 4C88A 2P30A 2V5AA 4JU9A 1WMBA 2AN9A 3FWPA 2VK4A 3R75A 1XPRA 2RHDA 1RQXA 3N2NA 2PXEA 3NHYA 3MUOA 1O08A 1GAWA 1UPAA 2F4NA 1T8YA 2IY8A 3LNTA 3NAMA 5C5EA 3L7DA 2QA5A 2HI0A 3RFFA 1LRKA 1O8BA 1TCCA 3K5IA 1L5QA 3GUVA 4GBJA 4HPWA 1XQXA 5I8ZA 5ADWA 4CFSA 1UWLA 4EPWA 1DC7A 2NO9A 2XLBA 3QVSA 3T38A 5C8DA 2QIOA 3ZQKA 2CYBA 5I9NA 1GN8A 3MJHA 2GJ4A 1GYPA 1GRNA 3T7JA 4MLPA 4B3HA 3R40A 4XSHA 1SKBA 2VH1A 3AVQA 4IMRA 2PO5A 2CHFA 3I4FA 2AQIA 3HDJA 3OZDA 5H68A 1QC5A 1XBTA 3GL9A 4R71A 5JSUA 5KAPA 4D0LB 2J9RA 1H23A 1TTHA 3HI4A 2NU6A 3PXDA 1UK7A 2GM4A 5NULA 1SZDA 1K4KA 2R97A 5CK4A 2ZSEA 1HFWA 1M5TA 3MCWA 4MW9A 1CNEA 3GLVA 2Q7XA 3WG9A 4BNDB 4DL9A 3BAFA 5KPJA 3RSQA 2DM6A 1T2CA 1W36D 1INLA 1JG7A 4R0MA 5BMOA 4U0KA 4DOMA 4B85A 1RLOA 4OXIA 4HR7A 7AT1A 4NCNA 2IYWA 3OLWA 3P9QA 3PFBA 1HF3A 4QDJA 4D8YA 3DMYA 4BMYA 1H4VB 2M4HA 1PR2A 2BN4A 2JLAA 4U2GA 5B2EA 4IGKA 4LE1A 1GPAA 5K2OA 3C8HA 3QNMA 1QWSA 2OCGA 3EASA 7REQB 1K75A 1A04A 3FG9A 1IHXA 4QLAA 3AHGA 3LW8A 4RIIA 3TO5A 1WHTB 2Y2UA 3CUTA 5IN4A 4BPRA 2PZ8A 1KF0A 4URHA 4HDOB 5FYQA 2IYSA 2QZJA 1F4PA 2JB9A 2BI4A 2O48X 3R2JA 4IMPA 4OKNA 4RMJA 4A6DA 2L42A 1IZ0A 1V1RA 3FWZA 3ON5A 2DC1A 1J09A 4R1SA 2CNWA 4DLBA 4FHFA 4F3TA 2HIMA 3FHOA 1GUDA 5JY1A 1N3BA 2R5WA 3FNFA 1UPUA 2PNFA 3SBDA 1YI0A 1GAXA 1YVDA 1UZUA 2DWUA 2HRBA 2VK2A 3K71B 5D3KA 1E1LA 2GDJA 3VU0A 1CEEA 3FAZA 1NYTA 2A35A 4G0PA 4WTOA 5IJ9A 3D6NB 2GHIA 2CNBA 5BWLA 1E6LA 3OQNA 1WZEA 1WH6A 2NV2B 3Q3GE 621PA 3BFKA 3RO7A 3IX7A 4FEGA 3ZK8A 4L3OA 1WXGA 2ZR7A 3LHDA 4ZCSA 4MQEB 2W4QA 1BAPA 5GINE 3NIBA 3C5HA 1IY8A 3D0QA 5G0VA 2JLCA 3A2KA 3IURA 1Q7TA 4GYJA 1DQPA 3D5QA 4R9RA 1UC4B 5DX1A 1C7JA 3H87A 2V1UA 2QR3A 3FKSA 1L4MA 1Z29A 4PPFA 1A9ZA 4DZZA 3HGTA 1G18A 2XPCA 1TECE 2O50A 2ROQA 5K7SA 3U3RA 4J0JA 3G2MA 4PPNA 1YVEI 2R87A 2VT3A 2WJ4A 3BS4A 2CVZA 2JRLA 3O84A 3RYFA 3REQB 4EUKA 3I2IA 2GPAA 3IULA 4O2RA 2E21A 5D3QA 1I7NA 1VCNA 2PSDA 4U2BA 3GXBA 4BKMA 2Z1MA 4DR3B 4LG1A 3KQKA 1QVZA 3BIFA 1W1UA 3QG1A 4ZREA 3QVXA 1PNOA 2QPAA 1EIZA 3CPJB 1EQ2A 1XIVA 1NR5A 2H5IA 4HQKA 3P26A 4L7QA 4LMBA 4X5OA 2HM7A 5JFGA 3TIGA 2DFLA 1M6HA 2OC4A 3O26A 2WD7B 5EXDA 4CM5A 4N18A 2A9RA 2N46A 4U0JA 2B4RO 3HI6A 4XSGA 1WHSB 5FJJA 1XVTA 1JEQB 4XXHA 2XV1A 2YMMA 3RVLA 3JAKB 3UG7A 3H9BA 3IQEA 5AJVB 3EIUA 2VDKB 3H5WA 1PCXA 2IOFK 1NDQA 2L2QA 3EVZA 3I9NA 4FDUA 4EHJA 3OPYA 4UEWA 3W3ZB 1SM4A 1V47A 4QPZA 4EIWA 5JJKA 3ED1A 3D0KA 4G1VA 1ITZA 4X91A 3UJDA 3NASA 5EESA 4MV3A 1TOAA 2PGOA 3HCEA 1HNWB 2HKIA 4QDOA 3ND6A 3ITDA 2GVNA 1U2ZA 2YZMA 1YZ3A 4P4GA 1LXCA 3SHVA 4K6HA 3IBYA 2IS4A 2C4MA 1DMSA 1QHHA 2PXTA 2WNIA 2Z6UA 5AKKA 3G79A 1J7KA 3DC7A 4JLDA 5EVJA 3PTAA 1GP2A 4DLKA 5A62A 4ETIA 5A3SA 1E1CA 5JYBA 3UV3A 5LA6B 1KTIA 4LMRA 3KOMA 2PNJA 3EGEA 1WUTA 1PR5A 1RM5A 1Y8QA 4UD6A 4DLNA 4X24A 3SQDA 1HL7A 2FFRA 3KZMA 3WQRA 2OB1A 5KWVA 1K27A 2YJGA 5J2UF 2XGJA 1USKA 4LMAA 3F3MA 1RPZA 3PDIA 4C0AC 5BR7A 1HZJA 1I13A 2JIZD 3GRKA 2ICPA 5K3EA 1Y3AA 1GIAA 3BVPA 1B73A 2VBFA 4GC5A 4KAJA 5E2BA 4JQDA 2REQB 8ADHA 3VPAA 4RPKA 1V48A 5REQB 1UANA 2ID4A 4WK4B 2WZQA 3QJYA 2JD1A 1NUPA 1IAQA 1R6TA 3Q3HA 5I7SA 4J1TC 3F5QA 3GMDA 4GLFA 4N01A 4P7JA 4B7XA 2QVCA 1KYXA 1ZR4A 3FYHA 2VYCA 2HU8A 4EKIA 4KWIA 1P19A 5TGZA 4E2WA 5KVAA 1FDIA 4LYHA 1AKYA 5G3ZA 1G63A 4CQNA 1EGAA 2DWCA 3S2EA 4BC0A 3GT4A 2BHLA 4DIEA 4MW4A 4UNRA 4RDCA 4JJ4A 3O8LA 1Q1AA 2MSWA 4G0MA 3B48A 2OFYA 3OPYI 5EYPA 1N8TA 3ZK9A 4N8DA 1X1TA 1U7PA 3MTDA 5K98B 1P74A 1M1ZA 5JNRA 4Q3DA 3U7FB 3K2QA 3PHLA 3MRXA 4RMHA 2P3LA 3BXOA 4J49A 4DCUA 4KDCA 2AZTA 1WMAA 3BTVA 4FHDA 1M2WA 1VLMA 5BN4A 1H1DA 2JEOA 1ZU4A 3MWJA 5JTTA 3OTQA 2RGAA 2WZDA 4CEJB 1SR8A 5I3CA 4KK4A 1VSQA 3EVBA 2HMVA 4Y6RA 1XTVA 2Q5HA 3UT0A 2I2BA 3TZQA 5AO9A 4AQDA 1JTEA 3HJBA 2C7RA 5DBIA 4EB6A 2FPIA 1BXRB 3T1HB 4QX6A 2DTXA 3TQRA 3V48A 1BGXT 3B36A 5FULA 2ZE5A 1HSOA 3M9XA 1V9SA 3BM5A 2LYRA 2V59A 1TYDE 2R7NA 3AZQA 3KUXA 1GCUA 1MA0A 4JA2A 4EHFA 3HGMA 3WO1A 1TFUA 3WFJA 3G0TA 4AECA 5KNLA 1EM8A 1P4RA 1YJBA 1R8XA 4FYIA 1TLFA 4G65A 5E3IA 1GGNA 2ORWA 3IDFA 4OKIA 5C1PA 1US8B 3OP9A 1N3YA 2Y2VA 4F4UA 4HGRA 3FETA 1IEWA 4CBVA 4ZK6A 3FLEA 2P3SA 1RYZA 2WF5A 2IEDA 3HKEB 4QJ3A 1PEDA 3QNWA 2UYHA 1BCRB 2ZB2A 1CLEA 1PX0A 5K3BA 3GJTA 1UZLA 1GZHB 1U63A 1DBWA 4AN4A 4RAOA 4JR2A 3NBYC 2ZBDA 1V5EA 2Q0HA 4NSNA 4U8HA 4XGQA 2VSNA 4RH1A 4H7EA 1IDN1 3U1TA 1KQFA 3HCOA 3PHJA 4ZMRA 3M6FA 3KK0A 3ZZ0A 2BGMA 5A4KA 5H4GA 3PHGA 1AURA 1R18A 5C7LO 2MXDA 5IASA 2I76A 2YFHA 3KV3O 1LU9A 1JJAA 3BZUA 1IULA 3OSZA 4R31A 1QU3A 2FQ1A 4FM9A 2ILVA 1TQ8A 1ZC4A 4BGIA 3NUQA 3W4KA 3DYIA 3MQ4A 2VHUA 3OFVA 4EA7A 3A9WA 4CDGA 1T0UA 4AZ0A 4QPDA 4CUZA 2B36A 4OA8A 1P9RA 2GBPA 4P2BA 5F1YA 2V6GA 4P08A 2YW2A 5LZ9A 5DISB 1DW9A 3CO0S 3ZV7A 4GXNA 2O2SA 2Y66A 3BULA 5LZ5A 3R5KA 1EAMA 3IJRA 1AT1A 2PX2A 1C0LA 4JSRA 1PP4A 3HYTA 2ZVPX 1M2VB 3DVQX 4JB2A 4V24A 3T4UA 2DPLA 1U0NA 3BIWA 3FVWA 3QWFA 3H2HA 4FC6A 4B6GA 1GTG1 5C51B 5LZ4A 1JNXX 3L8MA 1TPYA 3CINA 3V6MA 4JX8A 1EX9A 4CLRA 3JQAB 4AIRA 2C31A 1FUUA 4PLWA 5BW8A 2PR7A 3UHOA 2QLBA 1ZIDA 1C1DB 3WGUA 3AUKA 4AY3A 1WY7A 3K9NA 4K6MA 3KQPA 5GV7A 2R751 3R1IA 2PXCA 3L0ZA 1A8SA 4ML3A 4FC7A 4UVHA 1Y8RB 1Z2EA 3CX7A 3Q9NA 4NZNA 4UZFA 1SUAA 1LDGA 4CHGA 3ELDA 5LPNA 3G2HA 2CV0A 3PJDA 1XTSA 1D2MA 3KYCB 1DTSA 2ZR9A 3R24A 4V3BA 3ICOA 3ZBPA 5G41A 4LWOA 3IPRA 1W7AA 2CUTA 4R2KA 3B9RA 3OZUA 2CE7A 2H8GA 4B0PA 1KKUA 3C8DA 4XX0B 5E6RA 1I7LA 1DGQA 3A9RA 2BMWA 2I6SA 4CCWA 2VEDA 1MG5A 1IRXA 3IMGA 3MCZA 2A9FA 4NJMB 4P58A 5EHQA 3GCGA 3V55A 1F3OA 3UXYA 4LXQA 3VGJA 4DUGD 2Q2WA 4JKIA 2XF8A 3SSMA 1OFIA 4RPLA 3A6GA 1W9MA 2IPXA 5DLQC 1N57A 3ZBTA 4ZTUB 2JGAA 4BS9A 5IEJA 1G6Q1 5M29A 2ZWAA 1F5NA 3L49A 1G20E 2RG1A 2WTXA 4QNNA 1Q21A 1F2UB 1WBJB 2F7SA 3ML1A 4HDAA 4YV0A 4Q7KA 2I1QA 4NJEB 4HVAA 2QAGA 1IJFA 2O2YA 1ESNA 1C30B 4OK3A 3C1AA 1HMPA 3CH4B 3NS7A 2MT9A 4RTRA 3LVBA 4PY2A 1NTOA 1DWPA 2X6RA 2E2WA 1SCIA 1T0IA 1CUIA 3G5UA 4Q34A 1A4UA 2QTBA 2QLLA 1HDIA 2WIJA 4MINA 1PJLA 2ERYA 4UBOA 4RX1A 4TN5A 1E2KA 3MWKA 3LFUA 1L0BA 3UPDA 4QEDA 5FR2A 1I1OA 4F9TA 1CNFA 1E2NA 1GGVA 2O06A 3G23A 4N7BA 4RD4A 3T3MB 1U31A 1QK5A 3T7DA 3LRPA 2GTIA 2GKSA 1DLJA 2NQTA 3ENQA 3T4PA 4HWSA 3TW8B 5FWXA 2AFHB 4ACBA 3BEDA 3BA6A 4R7TA 4TL8A 5IMBA 4AN0A 1A9QA 1I94B 1Q14A 3D2BA 4CI9A 4UEQA 4E51A 1MBZA 2VP3A 5J5AA 5EA2A 1DWQA 2H1IA 5EJMA 3CVVA 4MGZR 2WUSR 1NJFA 4BCBA 1FFHA 3E9NA 3K9GA 1DDIA 3AKDA 1E63A 2FCAA 3I2JA 2WMDA 2HYDA 5HWSA 1O89A 4HGYA 3ZH2A 2BM8A 4TT3D 2OVBA 3HXOA 4M76B 2IYXA 5A4JA 1QOQB 3Q7RA 2ZRFA 4AMZA 5JRJA 3IALA 4KPFC 2RGNC 4MCHA 1I2CA 2OKGA 3PGJA 1E9DA 4CEIA 4FOSA 1E1QD 2PKXA 2ZCUA 4GKVA 3O0TA 4IHJA 4PYOA 3V4VB 4XM1A 2FHSA 3D9QX 4DMCA 1ZIXA 2B9VA 4DNPA 1NX9A 4MVJE 2CNOA 2X13A 3KQWA 4I6EA 4IIFA 5EGSA 3DPUA 4IKPA 1I33A 4I2VA 2M6KA 5AMXA 3PU6A 1P80A 2C82A 1JU3A 5HKBA 3RC3A 3P9ZA 3U81A 3PITA 1SK8A 5FADA 1ZD3A 4NBNA 4C4OA 1YJQA 3NC4A 4YCDA 1DEXA 2UVPB 1VTKA 1NNLA 2FK8A 2JVLA 1J70A 4A5SA 3S0JA 4UM9B 4P0QB 1CD5A 3QEMB 1PQYA 3AQIA 3DT9A 2AOUA 1FVHA 3T61A 1JLLB 3CY6A 5AKEA 1KYVA 3W4JA 4Z4QA 1ENYA 4TS4A 3RSSA 2CK3D 3LVQE 3MRSA 3R23A 4CGYA 2XRYA 2IXBA 3BXGA 3T5MA 4NIMA 3SJ7A 4M53A 2PGXA 1K3FA 3MWEA 1WULS 1Y1PA 3PEVA 3LQ2A 5AVKA 5LP6F 4M1WA 1KYQA 4GMKA 1HQ1A 4DNQA 3CSUA 1LQCA 3OLYA 1G4HA 2IL1A 5LQMA 1Y4AE 3BHMA 4KVAA 4HMPA 4IZOA 1FU4A 1T0HB 3DKRA 1LSOA 1UDXA 1NLUA 5GGYA 3ROMA 4KX3A 4IGIA 3R6WA 1RVDA 2ZYAA 5A7HA 1ZRNA 1TMYA 1DXQA 3QE2A 2FGJA 2WQZA 2A59A 5HTKA 1HT0A 3FKJA 1CRQA 3KQSA 3L0DA 3ZWOA 1ADGA 1WZNA 1H69A 4ZIRB 1TA0A 2CLEB 4JQCA 3NOQA 3CX3A 1X3LA 3F6WA 4JT8A 3LLSA 1AKWA 4LQDA 3UMBA 5F2OA 1VLHA 1KETA 4OMUA 3HCFA 4LNUB 2EAUA 1P5RA 1KDVA 4TKVA 1QU2A 3PPWA 4H2DA 1Q74A 2ZBVA 1PJSA 2VTKA 3FYCA 3O1IC 4YJ3B 5HCNA 3X1WA 2EGUA 1FUKA 3SZRA 5FV4A 2C4WA 3P9PA 4FP9A 1CE8A 3AERA 5DK6A 1P1KA 2J33A 1VM6A 4N7MA 5K8TA 1KSHA 1KIFA 1Z6XA 1HKHA 3VAYA 2WOJA 1M6YA 5EUBA 4XIGS 3FOFC 3A9XA 1OXBB 1PEYA 3ZD7A 4AZWA 1G60A 2B30A 4Q9LA 3M4JA 1U9YA 4O2LA 1FF9A 3T7EA 1A9RA 5E6SB 2Z57A 1VBFA 1YDFA 4BVAA 1VLJA 3T5GA 3C3KA 3NM5A 5KPDA 1O4VA 4DREA 1VYTA 2VEOA 2I55A 5HKOA 1JHXA 4FMPA 4D0NA 4A73A 3DLTA 5HSGA 1LBIA 4AP6A 4JITA 2DY0A 5K20A 5JECA 4JJ6A 4G0UA 4R2XA 2CEAA 2X15A 5TDHA 3CZPA 1V3VA 1HF0A 2R6R1 5KTMA 4GI1A 1I2ZA 5DE3A 4CUKA 2IXEA 3EQ2A 4QODA 2LPMA 1V0JA 3QG5A 1JALA 2B6HA 1QNLA 2DPHA 3O4FA 5EMLA 3UA4A 2G09A 1QR2A 2Q0SA 5IG2A 1J20A 2Y9MB 1IPHA 5JAHA 4AY2A 1FY2A 3N8GA 4Q37A 3W06A 2BFMA 3PXCX 4Q9HA 2VZLA 3EPRA 3ESDA 4URUR 1EFDN 1KP3A 5FI5A 5EXSA 2M98A 3RT9A 1SKUA 3G82C 2JVJA 3GJSA 1FXUA 4CW7A 1E79D 4ZEMA 2BDUA 2PA0A 1XAGA 1LY1A 3QY0A 2YVQA 2BM0A 2F1IA 5LA6F 2EKZA 5JS6A 5HR5A 2W2PA 5AFSA 4DV5B 3A10A 3N59A 1SHTX 2DQZA 3LLCA 4X7MA 4BRSA 5IANA 5JFTA 3NVKI 3KT3A 4XEHA 3JARB 3UXEA 2FMHA 1XVIA 1Z0FA 2WF6A 5ALFA 1LBSA 1LPMA 1M6VA 2QY9A 3VTAA 3OQOA 1K7CA 1N75A 2H4HA 3HDGA 2AOTA 1KI7A 4R9SA 3UJBA 2UZ0A 1HZZA 3U4QB 3QHQA 3DBRA 1CZNA 3NHRA 4E08A 2NQ2C 4EO9A 3ZCPA 4HEA6 3VMMA 3OWQA 5EJ9A 1SA0A 2RIPA 4Y2HA 3SLKA 5H5JA 2ZCJA 4CN8A 2YUTA 1N1MA 3LKVA 4YECA 2FSIA 4LC0A 4S35A 1QYWA 1UBSB 1DV2A 5BR1A 2HU7A 1A9SA 5I5GA 4YDHB 5DO9A 5H16A 1RQPA 2QHXA 5EKUA 5FB3A 4D4LA 5JU6A 4QICA 5ER9A 1YKFA 5T8KC 1V11B 3VKUA 3D6VA 1Z4MA 1DOZA 5DW0A 3STTA 4R2IA 1EB8A 3UGQA 3WB9A 3LQXA 3EAQA 2F00A 2H57A 5IVKA 1WVIA 4ESVA 3D6JA 1M2OA 1B0PA 1QGED 4Q3EA 3UAYA 3IVPA 5JZVA 5K09A 3F7OA 2MMCA 5KDDA 1X7HA 3VTKA 1TVKB 4HGQA 2I7CA 3OT1A 1JQAA 2CSUA 4XWTA 5E1MA 4TLEA 5KX5A 2GPWA 2YCLA 2QRKA 3I1IA 1AKVA 1AX9A 3S2UA 3VHLB 5JCJD 3RSGA 4XRGA 2XUHA 3HDHA 3IRUA 1G9XA 4Z0NA 2J0UA 2ZUSA 1TO6A 2B0CA 4MRSA 2YN0A 1QSGA 1YJXA 4Q3OA 1RLTA 2PX8A 2C9DA 4ND1A 1M67A 3HCPA 1M73E 1JYSA 2GARA 3E9MA 4UQOA 3NX4A 3VA7A 3I6MA 5C80A 1COWA 1RIOA 3CLVA 2DUMA 4IDPA 1USWA 1BHQ1 4EYQA 1KMCA 1ZD4A 3R5SA 4KGZA 1T9CA 3K1JA 1DTEA 2H1VA 2LNMA 2XKJE 2FW1A 3ZZ1A 2NPFA 3WL7A 4ZI5A 1GDHA 4EHHA 1GUFA 2KHZA 3CPEA 1DT5A 5L3QB 5BSFA 3DUWA 1HXHA 3QYFA 3MT9A 2QGFA 5C8XA 2DLCX 4A2WA 1TUBB 2XJ9A 3O2NA 3TD9A 1IJEA 1EFVB 2G07A 3EG9B 1E6EA 1UJCA 3JQ9C 4E4TA 4AJHA 4CMHA 1BD4A 4IDQA 5EPOA 1GITA 2XUJA 3HO6A 4NNJA 1GNTA 2OILA 2DBVO 4Q7QA 4YH1A 1CDDA 2JGDB 2CKDA 3U49A 1BTOA 3RJTA 4I5DA 2Q9BA 1XDUA 5ENZA 5FBRB 3H8SA 1CEYA 4DDKA 4DGQA 4N49A 2HIGA 4BCDA 2GEVA 2VHYA 1F9EA 1X0VA 4IDNA 1I5EA 2R2AA 4FNOA 3WDSA 2HMTA 5KVCA 4DR2B 4AD8A 2CDAA 4NOMA 5LQSA 2CVHA 3F49S 3DKKA 1DJLA 3EC2A 3LD9A 2AWNA 4UD2A 3MCVA 1FPMA 1NQTA 2WYHA 3FTDA 4IZIA 4M60A 2EFEB 4UUNA 4CCAA 2CHGA 5GIOE 3BMQA 2CBGA 2GAJA 3LHSA 2WHYA 5GPBA 3VQTA 1FMTA 3DOJA 4RD3A 4MLDA 2H2IA 1E7WA 4L0QA 2ILTA 4PC3A 5K1ZA 2VHCA 1GSOA 1M7BA 4KO8A 4CM3A 1OX5A 1ZI6A 3HBJA 1ELOA 2SICE 4IDCA 4BKQA 1V43A 5BV8A 1C7EA 4D98A 2R8RA 1P17A 4RABA 1EPUA 2Y1GA 3BGOS 1ULSA 1PSWA 2EP5A 2B9EA 3K9BA 3F1LA 4RVOA 3U9TA 2H7YA 3CKKA 1G4AE 2B35A 1KQOA 2YFQA 3Q0EA 3QXXA 5CB6A 1XZIA 2VDUE 1SXQA 2EHJA 4QWMA 2R4QA 1HOXA 2DVMA 3S7ZA 5C52B 1CZUA 2BGUA 3TLGA 2ONCA 4P7FA 2LRHA 4DSUA 1ZMBA 3PGMA 1P2TA 4YJKA 4YQYA 1A97A 1E1QA 2I2FA 1T5OA 1H4TA 2X23A 1SQ5A 2EYQA 2UUAB 1E2JA 3IV6A 4MQUA 2AFIE 3VJKA 2I9KA 1A5ZA 2O3RA 4YIKA 2HSJA 2QROA 3KSZO 5CFNA 3TTVA 1QRRA 1Z4QA 2EG5A 3F8TA 4MWDA 3DCIA 2GXQA 3W2GA 4KFSA 1UMKA 2A8YA 2MSKA 3G2OA 3WLHA 1M0EA 1SBYA 4II3A 5D87A 1R8YA 4ZYYA 2GAFA 3QWIA 3B9QA 2KW5A 3KALA 2Z95A 2XWBF 2DETA 2ZKLA 1E9BA 4ZAXA 2OK8A 3JAWA 3TNDA 2ZZKA 5F3DA 5ARCA 1GTRA 4G5RA 2WFMA 4XFDA 1XWFA 3QLJA 3TECE 3ZCVA 3M5CA 4IYJA 3R3HA 4M6WB 5BWCA 3SFVA 3G0HA 4WD3A 1RKQA 3VPHA 1MRZA 4TWJA 1LWOA 5E8JA 4OMCA 2OYRA 2EKQA 2XUPA 2FG6C 4DC9A 5CFPA 1BW9A 2EEPA 3EXFA 3RV3A 3UV7A 3DHEA 1T5LA 4N65A 2DJ5A 5EHGA 2CGEA 3FDIA 3O1LA 4Y2YA 1VE9A 1X1DA 2FR0A 4JL6A 4ZOEA 1Z28A 4A0HA 1LLCA 1JKJB 4NCAA 1WWKA 3Q1KA 1FP1D 1E2PA 5LB4A 1T6BY 3NTRA 3WNDA 3NWPA 2XWJI 1QX4A 4XWKA 4BMCA 4R2JA 5EJEA 4BLOA 1DC3A 2GCOA 3QYJA 3E8SA 1FSSA 1MABA 1I10A 3WL4A 3FTQA 5BQFA 3BAZA 3TOSA 1DXHA 3OM9A 1M5UA 4UXHA 4Z4FA 3SLRA 2PZGA 3MLEA 5MGBA 4GMXA 3TLYA 3K0FB 3SVLA 3TUIC 4HX2A 4A10A 2FA9A 3LPDA 2NSDA 2C95A 1PNRA 1SELA 5KMGB 4YHBA 1J5PA 1JLRA 1KYZA 2CUKA 1DAHA 2CCGA 2QI9C 3EZGA 2X7HA 3HVHA 3GUHA 3SF8A 4YBRA 1XCMA 4NG4A 2I8CA 3I0ZA 1H3EA 3D6AA 3EF1A 2WPNA 3Q72A 4CF3A 3EVAA 4S04A 1OXKB 5HF6A 3RVJA 1LI7A 4O5OA 2DH6A 4H0CA 1WVMA 1J90A 3MINA 2HBZA 2NXJA 3JXCL 3QW2A 4RMIA 2GN8A 1KK2A 5HJEA 4CUJA 1ZM7A 1GKKA 1X8JA 3DQPA 2VF5X 1JPJA 4M46A 3RSLA 4YMTA 3V1KA 4PPYA 3RHFA 4YAIA 2PMFA 1ABBA 2B7LA 3ACCA 3F51A 4G2NA 3ETGA 4NU6A 3D31A 3CW8X 3ROGA 3TW0A 2L18A 1RBZA 4PG6A 2AQ8A 1GPH1 3DR3A 2RBEA 3GFRA 1KY5A 3WOHA 1GSHA 3FWYA 3E5NA 2SKCA 3QIAA 3E7PA 4GC9A 1WLSA 5HOQA 1MJHA 3S8MA 4EUHA 3GP5A 1F20A 2WG0A 4Z54A 3ELWA 3GHHA 1ZN8A 2PSHA 3E3AA 1HDYA 4GR9A 5BQPA 5TQ2B 3BXFA 3R76A 5G0SA 2YX1A 1N36B 1L7MA 3O7MA 1JEQA 2I33A 3QVKA 4V38A 3UWDA 1GNRA 1XD9A 2HLHA 2GCGA 4MH0R 2EU8A 4RLSA 5IMSA 1WMFA 3FMVA 4QUHA 1HDZA 4KQXA 1RBMA 4UPVA 4D56A 2HF9A 4YWJA 3S5UA 3ZE6A 1U8YA 4F6CA 2BMVA 1W8IA 4UDYX 3DV0A 1R6VA 1DTWA 2C2BA 5A4AA 1SCJA 2XVAA 3FHJA 2NX2A 1OCTC 4DM7A 2LR0A 3KJFA 1LQTA 3TLBA 3SP1A 1SOVA 2E9SA 3NOVA 2G77B 4MICA 5GJWC 2GTPA 3DL7A 2NSHA 4QDZA 4REOA 4WGFA 3QWAA 1F3LA 4QOJA 1GQSA 1U9JA 2LCVA 1F17A 1LTKA 3IKMB 4X60A 3AJEA 3OBIA 3T52A 2OHFA 2CNNA 3JWGA 4TM7A 4ID9A 2IXDA 4K6FA 4MP6A 5AVZA 4ACAA 4Q3LA 3PT5A 2PKQP 2QVXX 4RVCA 1LK5A 4X6LA 4M8SA 5LA6A 5DP2A 1LH0A 3H2KA 2B4YA 3V8RA 7MDHA 4FD3A 5HW0A 3F4KA 3TJRA 4Z0HO 4U3JA 2ZTSA 4RDXA 1JN0A 3SU8A 3ZGXA 1EB9A 2ATXA 3BWEA 2VT7A 5AVXA 1OLUA 1VBNA 3FY4A 3DLHA 4F97A 2AJTA 4MV8A 1YA4A 4RMNA 4LFCB 3AHJA 2ODNA 4B2PA 3W8RA 1JI0A 1KK0A 4LC1A 4JEIA 1D8AA 2AN1A 1FFEA 4J4HA 1HBJA 4JYPA 1B41A 4IV5A 2P1DA 4P3NA 4TSRA 5FI0B 4RK5A 4CG0A 1R0YA 3GT3A 3OZBA 4RYLA 1DAEA 4L08A 3QMWA 1SB9A 1VJ1A 2REQA 3IAS6 4O29A 4E4RA 3HXLA 3LOUA 2K2QB 2VPIA 4FS8A 3D8SA 4Z7NB 5B4TA 1S2LA 1MLDA 2BH9A 4PO3X 4F8YA 5CA1F 2P2LA 4Z1MA 2HHCA 5AW2A 4YT8A 1NATA 2IWRA 5KYKA 1Q7BA 1J0AA 5DSZA 3LOQA 2P2YA 1T35A 3P1JA 4ARUA 2XNHA 4DWOA 1JEJA 1UBMS 2OT3B 5H80A 1VA5A 2CHVA 1EXWA 3HGQA 3LWBA 3WFZA 5B30A 1UOPA 2QTVB 5CBKA 3H3XA 3IQZA 3ETNA 3AM3A 4MQFA 4PSAA 3U1BA 3B6ZA 4TXLA 1H9AA 5KC9A 3QOFA 3SFTA 3WNBA 1RWXA 5A5GA 4HNVA 2HRQA 2FQWA 3GGCA 1MCZA 4H18A 1IU9A 2WICA 3GUCA 1H0HA 4HZUA 4YIHA 2VXCA 1DRKA 1UF9A 1ILWA 4W8OA 4OHFA 3R9IA 3K0BA 4LF5B 1PVOA 1JEDA 3SG0A 4QGBA 1KZ4A 3C3BA 3BE5A 4ZAGA 4BYGA 1LC0A 2CXPA 5GAGi 4FS3A 1WDWB 2PSFA 4QARA 1K97A 3WQQA 1DRVA 2Q5CA 1H0SA 3GZDA 1UXKA 2HA6A 2RGCA 4OQQA 4ZT7A 2Z2IA 2Q6TA 3D7RA 5SYAA 3RBZA 3HZOA 2D8AA 1ZK4A 2DUUA 3HUFA 4A6XA 3EWSA 3QTBA 4MDHA 1AA6A 1J21A 3LU1A 2QVYX 5LZ2A 1SD5A 5K0BA 1H66A 1FU8A 3GY0A 3NZLA 4I4TA 1UKEA 2K6GA 2QLTA 1QIEA 2CFTA 4TKMA 3USES 3BZWA 5JSHA 4BX2A 3WLEA 3P9NA 4ZCMA 2CXHA 5IDXA 5K0JA 2JH8A 1U3DA 4X4HA 4IMIB 1MX3A 4LWPA 1EM8B 4AWBA 5KYUB 4H08A 3K20A 4OHXA 1YA6A 4FWIB 4KCGA 1JA9A 3ORQA 1U2GA 3IOMA 4Y6LA 3FTFA 3LDFA 4F3CA 3PFKA 1PR0A 1W85B 3LBAA 1B6SA 2VHVA 2RI0A 1VQ1A 2HNAA 2IXFA 2FSPA 3TGWA 4OSPA 1SXHA 2FW7A 4K26A 1JSZA 5MFPA 4MGKR 1X1BA 2HXGA 3D3KA 3PNVA 1QP7A 1M76A 4JBXA 4JL5A 3TLZA 3OQMA 2XQVA 3NNDA 4ERXA 1RJWA 1U1EA 5AJXA 4F1JA 1Y6GA 1ZD8A 2ZUTA 3MPUA 4WFIA 4L3VA 3DTYA 2WAMA 3OPXA 3RB8A 2A6PA 1M54A 3LLUA 4IVRA 2AWOA 2W2VA 1WF3A 2LYLA 2BHTA 1F1JA 3ETEA 4EG4A 4MVJI 3M5WA 3ST7A 3L8ZA 4FJ1A 1WDTA 4B9EA 1NIJA 3NANA 4DJFC 4XR9A 1W30A 1ZXBA 4XUEA 1VFNA 3DPIA 3U4AA 4PHGA 1Z08A 5BRJA 5JH7F 3T1OA 2R5FA 5ALLA 1D1PA 3BDIA 1JAHA 1BJRE 1PR1A 3EBPA 2A9JA 2OB2A 1Y7PA 1Y5MA 4N4AA 4MCXA 1XZNA 2B25A 3E8XA 1U8EA 2J5BA 2O2CA 4OGLA 2J67A 1EFUA 2O6HA 2PH5A 1U0TA 4GU5A 1SHKA 1C8KA 2PMKA 1VHDA 3WB1A 3L7NA 3RQSA 3TM5A 3OFSA 1EUCB 1UBCA 4FCWA 2GDZA 1L3IA 5C5CA 1II0A 4TYMA 4AULA 2BM1A 1MVOA 1L8LA 1GKYA 2RGNA 4MVJG 1E2DA 1WABA 4J7UA 3TTXA 4WY5A 2WKSA 3QBEA 5FUYA 2ZAIA 3TRHA 4XI9A 1MOSA 1Z35A 3CCFA 4UFNA 5LKRA 3DWGA 1TM4E 3W05A 4AG6A 3LY8A 2D5IA 5JVDF 1D0IA 4HDNA 2FZ5A 1TW3A 2WUWE 3OESA 5F1PA 3LX5A 3T3DA 1ORRA 1JDSA 4GVLA 4E6EA 2ACVA 2PWAA 4FNMA 2GBGA 1EK2A 2QWXA 3FCOA 2ZIFA 3R7BA 1YQTA 3CUVA 1AHHA 1SZPA 3S2FA 1QJCA 1M5RA 3EFBA 4OI1A 1BS1A 4B45A 1Y7LA 2EGGA 3FH0A 1Y9DA 3TSZA 2XHEA 4H6VA 1XDGA 4IWYA 2OSVA 4L5JA 4PQYA 4RQAA 4QAJA 5F5LA 2CZCA 2I65A 1E3SA 3FCXA 3ZQ4A 2F8TA 3NTUA 3GEMA 1UXIA 1RZUA 1CT9A 3IAHA 3V97A 4YMUA 1KI6B 1TF2A 1TUGA 2FMKA 2P5TB 1F60A 4N54A 4DVJA 3ZCSA 3FYUA 2FLVA 4C4PA 2GGSA 2OAP1 4M22A 1R27A 4MR7B 3TI9A 3RRYA 4B6EA 1ISFA 2GWHA 2EKPA 1JUDA 5K0TA 3WI7A 3LWDA 3H2JA 1PVVA 2G83A 1LCIA 4QNRA 1Z6GA 3ITNA 4GBMA 2WY2D 4BO2A 2Q4EA 4G8CA 4PNZA 5FNVF 5JS8A 3OPNA 3TQSA 3GNQA 1GUAA 3BRSA 4QJBA 4WKBA 5FF9A 4CVNA 5DLPA 4WNCA 4KYUA 4EW6A 4G1CA 2FLKA 2GN6A 4F5YA 5EUQB 4XQGA 1AF7A 2REBA 4P3XA 4RD6A 5C5IA 3W6UA 1EYZA 4IXTA 1YUNA 2HX1A 1EX6A 3DZFA 1L4GA 3BS3A 2IU6A 5M5BA 4XASA 1GZ7A 3EWNA 3ER8A 5JI3E 4PIMA 4DSOA 3EA0A 3LT5A 4OBWA 5I5EA 1R9JA 3DB1A 3OMXA 1GNLA 2OA0A 4B33A 2A14A 3B8HA 3EDQA 1HX7A 5BOSB 1UXGA 3B2EA 4MB6A 3WE7A 2HPAA 4WX2B 5SZJA 3ZG6A 4OK5A 4GSKA 1E20A 4M38A 2IZ0A 5J4KA 1H0KA 2JNWA 2BFWA 2RKWA 1AS3A 2O4UX 1BH6A 4EF4A 4KUEA 5HFNA 3K0AB 1RRCA 1NGSA 4WIAA 5BSEA 1QRSA 1X13A 2QD5A 3H7IA 4G4JA 4UEKA 2AX3A 5JBQA 2D2EA 3X1KA 4RULA 3DCNA 2O54A 4NECA 2B99A 1JFFB 2H1WA 2SHKA 1Y89A 3FOBA 4M1SA 4NZMA 2VQFB 2G1AA 1UBFA 3H4TA 3HKEA 3RVQA 1QJ4A 1NVAA 3FYDA 4EBFA 3A6HA 1NJ5A 1QHGA 3Q6IA 3SAJA 4HEHA 2G82A 4FTWA 1KOJA 3LQRA 4CWAA 1REQA 1N8SA 1K8RA 5D3ZA 1BA3A 2BRUC 2VL7A 4DCPA 5JR3A 5IVPA 2CXQA 1P2DA 3JV7A 3G2QA 2BEJA 4RQBA 4BMZA 1NBMA 2ZXUA 2C7BA 4HDCA 5DGCA 5PGMA 2WNHA 3QPVA 2VBGA 3PGKA 3F9RA 4M2LA 4LYJA 4RM3A 1N2IA 4QHYA 2O14A 2R5NA 1JQLB 2ECFA 1S3SA 4MS1B 2C3PA 2Q4TA 1O6BA 4FE3A 1BDIA 4XFKA 2K87A 3SF0A 4G9EA 4CM7A 1FQJA 5FPQA 2FPRA 4YTEA 3VKWA 3ASYA 3IR5A 4RS3A 4GP9A 3DM5A 2O7RA 1U9ZA 2WK1A 3PCXA 4D4KA 3HUEA 1ZICA 4CU2A 3N39C 1QYDA 3W5UA 5FPYA 3QELA 1YR7A 5DM60 3O6VA 4KQFA 2GN1A 4OHYA 4NC9A 2B2XA 4QFMA 5BOVA 1JHOA 1OAKA 3CMCO 3M5PA 2NZJA 1EVYA 1L5VA 4MWOA 4QL3A 4C0JA 5BW5A 4RXMA 2BFCA 2BTEA 3WK5A 2XUKA 4ZU3A 2QD1A 5HOEA 4XDGA 1WF6A 4JT2A 4ZRNA 3VUFA 5FOSA 5AT1A 4MQ5A 3F5DA 1RRGA 1D2CA 2HJGA 1V5FA 4ZQCB 5FA6A 3R5FA 4BBZA 3DHNA 4B2YA 5D6NA 1R37A 2BNOA 1E5DA 1NVUQ 1SXGA 2H59A 4IJWA 4V2IA 2EFHB 1Q2UA 3RRJA 3UAZA 4RJIA 2X8BA 4C6HA 5KOJB 4U7DA 2V97A 3LPCA 4ZVQA 3SQWA 5E1OA 1UP7A 3QYPA 1W5FA 4EHAA 4W8GA 2HADA 5A5EA 2XVYA 3UATA 3V9PA 1HDRA 1HZZC 1EGMB 2IYFA 3IPLA 3NDIA 1DOHA 5DGHA 3KZCA 1NUUA 4MKFA 4OGGA 4H60A 5TQ0B 1L7XA 2OOKA 4GM1A 4GL2A 1WR8A 3E0XA 1YC5A 2C4TA 1U1IA 5DI3A 5KNCD 2RAUA 3A9CA 1AJEA 1C7RA 2E5FA 1UOEA 4P86A 2A5FA 1V4BA 2Y9PB 3QKTA 1DJQA 2LYQA 2ZRHA 3OOHA 4CMKA 4YO7A 4YUVA 4V2UA 5CBPA 4S24A 1SG6A 2WSSD 2GFHA 3QXGA 4G0QA 3ZWAA 1UK8A 4WZBB 2WRZA 2B78A 2KLHA 4K6GA 4MI6A 1DG9A 1U2PA 4LZLA 3D6TB 3F6CA 2DR0A 2CL6X 2PL9A 3FBGA 1T1SA 4UAGA 4W5TA 3OETA 1XFDA 4PC6A 3WGJA 1XXHB 4XJVA 2GKOA 3ASUA 3VR5H 2UV8A 2XW6A 4O4LA 4ZANA 2EZTA 2VJCA 2H0AA 2ZTMA 5BURA 3QU9A 1X7ZA 2Q3FA 1GEGA 2I99A 4FZRA 2R6DA 2ZRAA 3OI7A 2B1QA 1QVWA 1JRLA 2JHPA 4DA7A 3EIXA 3UTDA 2OUIA 1WPGA 4ZC8A 4QPJC 1ONNA 2PZAA 2E4WA 2Q3MA 4DNOA 4UEJA 1DCMA 5C46F 4WT7A 3ZHSA 4UBLA 1GQOA 1T6YA 3MWEB 3QBTA 5FTJA 3O1JC 1GRQA 2VDJA 5FTNA 1W88A 1S8FA 4K1LA 3VZBA 2B8NA 4ZA2A 5A9RA 1GLGA 1YR2A 2KJQA 3R9XA 3CZAA 3EX7C 3RADC 3FZNA 1GCIA 4L5YA 3GR6A 3HDVA 4DABA 4R7ZA 4E1VA 3OOWA 4LUCA 4Z7QB 2AOVA 3I6QA 4PLGA 3SNHA 3LM8A 4OBXA 1FDWA 5B7GA 2HCSA 4RY8A 4CNBA 5IDYA 1GA4A 1L5MA 3CIOA 4DJJA 4ITRC 3BCUA 1XU7A 3G5GA 2G76A 3AXTA 3HRKA 3P4XA 3N0XA 1OTYA 2QAIA 1SY7A 1II8A 4KTVE 4BO3A 1IEVA 4DDHA 5K0ZA 3ER9A 4TYYA 2VNSA 1T5BA 5MN4A 3M4NA 5JYCA 4A7PA 1T8PA 4JLKA 5A9SB 3D4BA 3TLJA 5IX8A 3WL8A 4ID3A 2FH5B 3WGHA 5BMVF 4D25A 4WA7A 2Q07A 2VHWA 4MZDA 3RF6A 2RHWA 3QY9A 3HNRA 2H11A 1Y8AA 3NALA 4HY3A 4U2FA 5KNCH 3GW8A 1L7RA 4MUFA 4UVIA 3RWOA 1I7PA 2VPYA 1F8FA 3C15C 3N8KA 2WF8A 5KYYA 2O8VA 1UL1X 4G86A 4F3YA 1RI2A 1DDOA 4HAUA 3DBHA 2CDRA 3ZH9B 4UAJA 3DZCA 4OQMA 1Z5UA 4YP1A 5KNDH 3JQ7A 1EFRA 1MUUA 1R6UA 4GYKA 3KB6A 4C4AA 2C2GA 3DE6X 1J24A 4R9NA 4Y2PA 4Y8VA 1N2CA 4ZVOA 1HT3A 2N9UA 3PXGA 3MJDA 3WJ1A 1AMOA 4MITA 5U4QA 5I48A 1FDVA 2NZYA 4M0LA 3C8ZA 1FFWA 4X1YB 3SC2B 2O38A 1QE3A 3DBLA 1UJBA 1A2OA 1QH1A 4AMUA 4KQIA 1XSEA 2ZT8A 3PA8A 3Q41A 1T8WA 4MI1A 3VNBA 3PK0A 4JJZA 4BRWA 5HHTA 2AR0A 10MHA 3B5IA 3LUAA 4PSKA 2VRNA 3I8OA 2ALJA 4NE2A 1Z7EA 1DIOB 2VK1A 4K7JA 3VM6A 2YZNA 2CYCA 4EJ0A 1OB2A 5TT0A 1JE1A 2BBOA 3RTAA 2C9MA 3SZGA 4BFYA 3CJQA 4UTZA 4UAUA 8ATCA 1SEPA 2BELA 4YXWA 1HG0A 4UQPA 1GXSA 1YHNA 3LBNA 3W8FA 1JGTA 3C98A 2PXFA 1IJKA 3VR4D 4QASA 4OK6A 4ZYZA 5B4VA 1NFQA 3CFYA 3TLAA 3SHOA 1AUQA 4B47A 1W94A 1PV4A 4R68A 4M9SA 3SHQA 2EL7A 2GFIA 2NU9A 2R00A 2ZJ0A 2IU7A 4GI2A 4L8GA 4HQFA 1U8XX 1F4VA 4X7PA 5FCDA 2Y71A 1SMKA 2GPSA 3HB0A 3RNOA 3WYEA 4EPRA 4CR8A 4R2MA 2ODPA 1WUJS 3JARA 2XNDA 4HADA 1NY5A 2GASA 1PHRA 1P61B 3B6JA 2D2VA 5LOVA 3G68A 4QOEA 3L1UA 1GVHA 4MEBA 2DBYA 3GROA 3I45A 3MS2A 3PL1A 4O5AA 1NN5A 4LBZA 5SY9A 3WBJA 2YIDA 1Z6QA 5EWJB 1D3AA 2IU4A 2RH5A 3W34A 5BP7A 1OHHD 1JDZA 4K9RA 5AM0A 1WKBA 2GNPA 4YACA 5KTYA 4MPPA 1J2EA 1L5RA 2QN6A 2DQSA 5JJ5A 2AJ8A 3S1SA 3E05A 1RYEA 2J3HA 2HLPA 2ZRDA 3M89A 4KEAA 3WMRA 4HB4A 4LQCA 4UKDA 1RFGE 4YP6A 4ZAVA 3NETA 4Z9XA 1YL5A 4HAYA 3RWMB 1YBMA 3PPXA 4EVRA 4MW1A 1VXRA 5JTUA 2VKQA 3U09A 3CB2A 2JGDA 3DXYA 1T15A 4NZOA 4R8KA 1W5EA 4DXAA 4Q9JA 1TYAE 1ZMXA 1BXZA 2QS9A 1PK8A 2P9EA 4XYEA 1CUYA 1MX9A 4NP6A 4OBMA 4B35A 5B37A 2HO5A 2VCYA 4US1R 3OM0A 3U13A 1E5LA 1CY4A 2JAQA 2HDOA 3O4JA 5E6SA 4AKIA 1GTZA 2H52A 2YYZA 3Q11A 2Y1OA 1V1MB 3ZZUA 2FPLA 4FN4A 5GWXA 3WZMA 1FFAA 4CDNA 2IS1A 1O95A 1NMZA 1BFUA 1MV8A 1XD8A 2WAXA 3RSOA 3F78A 3R7DA 4PZEA 3X44A 5AD1A 2QM0A 4X00A 2YXEA 4QTYA 2CFOA 5K2MA 3LC1O 4LISA 4RJKA 3RRMA 3ZV6A 1XLTA 3D3QA 1QB8A 2BSAA 2F2TA 5FPHA 3VC1A 4IJQA 1OBOA 1ULZA 2G9UA 3RS2A 5IWAB 3PD1A 1A71A 3N2LA 4ZYLA 2VWPA 2QVGA 3FRJA 1NSFA 2L0XA 3LT1A 1NJSA 5F23A 3ANLA 2NT3A 4Q15A 1BXKA 4RC9A 5E4YA 3RFCA 4HVTA 3A1FA 5I7VA 2UZ1A 4PW0A 1OV4A 2AT1A 5DCLA 1MDBA 4HZUB 5KVVA 1IN5A 1BS9A 2Z08A 2DPXA 2TRSB 3AEUB 3PXBA 4ZPJA 5AJZA 3UCFA 2EBYA 2MDTA 4J6FA 3TXXA 3ZDRA 4IRUB 1P0MA 5FAKA 2IXTA 1CERA 1PW7A 4N82A 3WLSA 1AQJA 3QH4A 1JQBA 1YOVB 4IS3A 4K03A 2OLEA 3WLKX 1D4AA 2Z4RA 2QI9F 2ZI5A 1NDUA 2NGRA 3SS9X 3IA2A 3GJ0A 3WWDA 1JIUA 1W52X 1YRQA 4YRPA 4YT4A 1T1EA 4O08A 3UIEA 2P4QA 4I4TB 1ZOOA 2CB9A 3SM9A 5B12A 3TGLA 4RTKA 2W4MA 1JSRA 1OFUX 2PN1A 2PY6A 1LEHA 1V45E 4IXMA 5L6LB 2RARA 4YG7B 2IIQA 1PQWA 2AKYA 3NTVA 2QT1A 1QF9A 1K8QA 5F73A 4DEYA 2X3FA 3GRAA 1VRVA 4HVLA 1AQ6A 1Y9EA 3TFOA 3DP7A 4Z53A 3KU1A 5LDDC 3K4HA 1RLJA 2VYFA 3DC2A 2C1EA 1FP7A 3I3SR 2I4OA 3FDJA 2W2TA 4LHEA 2B1GA 3MK31 1YHZA 5DT2A 1FYVA 5CLGA 2B94A 4J0KA 4X63A 2YZKA 2JGKA 3HUUA 1EWTA 4KXNA 3M6XA 1GT0C 1OSNA 3KLMX 4JB0A 4RQUA 4WBXC 1KO8A 1UJ6A 4C4RA 1OU4A 4QELA 4DJAA 3WS7A 3N3AC 1YSEA 3UMMA 4JCXA 1BEZA 4K05A 3BOSA 1QFJA 1GA1A 3T3EA 2MSEB 4BU1A 4YJ3A 4E88A 4UVGA 1NPTO 1Z18A 1AF4A 2VLBA 1B8NA 3K0FA 4OG2A 4LYGA 3WGVA 1E1RA 4EYGA 3JZAA 1T5IA 2ZJYA 4MGHA 5KO2A 1KJJA 2XUAA 2JJ2D 1T1JA 3AQ4A 4BNLA 2EF8A 3H97A 4CQJA 1M1YA 2AE1A 3VFDA 2DZDA 5A0TA 1GG8A 1WJGA 5KOYA 4Z5HA 3K94A 2D54A 2PEZA 4LSGA 3WRYA 5J1TB 3C8MA 3CE9A 3O3CA 3IERA 5CG2A 5LQAA 1AQYA 4F2GA 2IS2A 4F4HA 3MINB 2H7CA 4I9NA 3ABRB 4XSVA 5DGTA 3UQYS 3VVCA 5LN1A 1B1AA 2I4RA 3C2QA 1T9BA 4K2AA 2J5KA 3KT8A 4B40A 3O94A 4DT1B 2XOEA 3W5CA 2QSUA 1EMDA 2VQDA 2W6OA 1ZVQA 3MTIA 1QHFA 4IHAA 4BMNA 4EHIA 2LE0A 1R0KA 1YRHA 1PT8A 1IBSA 1BRMA 2AHRA 2EFGA 2R7MA 3A14A 4JBLA 4C0QC 4CQLA 1W4LA 1LLQA 5HIAA 3IDZA 2JI4A 4E03A 3JXBC 2ODWA 1WD5A 4G89A 1SKYE 4Y3UA 2BFOA 1OOEA 1UOQA 2ZRKA 4YRTA 2XYVA 2QTTA 3IS3A 2BGNA 1AK2A 5DTRA 1AGPA 2VDVE 2BUBA 3HLYA 5CB4A 2EF1A 1B3RA 2CMKA 2DFKB 4LJAA 4ZVSA 3CLRC 4BO5A 4UUQA 4B3CA 3CG4A 3R3YA 4JP5A 1MRNA 3UMGA 4FCTA 4DARA 3OX4A 4DPKA 4GBGA 2GZMA 2DUWA 2WQ6A 4K87A 1ZRSA 8AT1A 2J3DA 5EJGA 5A05A 2FDRA 4K6OA 4DM4A 1GYRA 4LXYA 1X2LA 4OHRA 1H05A 4R5HA 2DBQA 3DH0A 3KQUA 1NBMD 1CZOA 1UMDA 3QJGA 3NKVA 3X1DA 4MCJA 3FVRA 4DE5A 4KXUA 3L4JA 2G63A 5FL3A 1E1MA 5LQDA 2YIJA 2YDYA 2W8BB 2OO3A 4MHOA 3RT7A 3NCTA 3KCNA 1K6IA 5F52A 4K9QA 4A1FA 1HYGA 2J41A 4C1BA 2J87A 3IUNA 2QP9X 3TL2A 1DIHA 4S12A 2GM9A 3D2AA 1YQWA 2IV1A 5I7OA 4JB8A 1Y3BE 1IBRA 4RU1A 2XIQA 4B3XA 1VG1A 1XMIA 2AFIB 1FX0A 4CQMB 1LI5A 2VI5A 1VE6A 1S2NA 4HQOA 4ND4A 4Z9BA 2PQMA 4J3NA 3GA5A 2BE7A 2QMHA 3QMVA 3P97A 3DLBA 3DJYA 3JTEA 2CVOA 2X0RA 3MJEA 4HBGA 4B9AA 4U7TB 1DKQA 3BWMA 2VJYA 4MQ6A 4BKUA 2JIPA 1XCLA 4U6SA 5JDIC 1XMOB 4HFMA 4OB6A 2IU3A 1O5TA 3DZBA 4EI9A 3EFOB 2PJRA 5BWNA 1ZUWA 4I50F 4BVGA 5L4LA 4JGIA 3W5AA 4HV4A 2VHXA 1M2JA 3HM2A 4K6CA 4ZARA 1RLUA 5BN4B 3RTGA 1W581 2IS6A 5KJ1A 3AUJB 4RK4A 1C0IA 1JPNA 2E4VA 3RSHA 1A2KC 4HNAB 1RHKA 1U2RA 3VR1A 2RHCA 5IDWA 1XQVA 1KFJB 2PD4A 3E9YA 4HLCA 5CH5A 5E2IA 3IEUA 3HR8A 4CKZA 3QBVA 4H6WA 2ZIWB 5CLIA 3T0FA 5ETJA 3B2QA 1KAOA 2RGEA 4FGJA 4N6OA 4MW2A 5CTAA 2RGGA 3VU8A 2LXNA 1A8HA 2X14A 1TQHA 3DFIA 2UXCB 4IKOA 5CGQB 5B2ZA 2X5KO 3IIKA 2P35A 3A9TA 4G01B 4Z0PA 1U5BB 2NUBA 2Y1CA 1T8SA 5DPMA 3GLQA 4EJSC 2GK4A 1YKSA 3EYAA 1XRSB 1G20B 5EZ6B 2W22A 3DEKA 2JLUA 2A84A 4S1NA 3VR3D 2IEZA 2P9TA 1GRCA 2V0CA 2L82A 1TFRA 1XGKA 1HC7A 2RAFA 3D3NA 3D8RA 2C8VA 1TDJA 3R20A 1FQOA 2JHAA 4RPHA 1SOWA 1US8A 3EF0A 4DDTA 2C7QA 1JDBB 5T57A 5BVGB 3KKQA 4PLYA 4DA8A 1UMCB 4P38A 5K6TA 5IJ0A 1SD1A 1Y5NA 4QE3A 4RUKA 3UV6A 1XCGB 3SLGA 4FBMA 2XTZA 2R8ZA 5AQ1A 4CRWB 5BUZA 2C3UA 3G59A 5LMCA 2PCLA 4G0ZA 4IQFA 4N8SA 2NTYC 2LKDA 2UVDA 3B52X 3FPHA 3E0QA 4WBSA 2C4UA 1ODJA 3Q3CA 4KODA 1AKTA 2EFDB 2YVKA 2LCQA 2XB2A 3QA3E 1P2FA 1UBKS 4PS0A 3KHSA 5CX4A 3QFFA 1T4CB 1WDLA 2PFSA 3D5TA 5D51S 3RYCB 4YMIA 1RSZA 4KOAA 4DRYA 1SPXA 2Z9BA 3U5ZB 1IG0A 5B1DA 1KI9A 2RC6A 2F9MA 2XUIA 4FFNA 3RW9A 3KWFA 5EIXA 2OD2A 2V55B 3ORHA 5SYNA 4H0FA 2JGJA 3AU9A 5DNWA 3R0ZA 1KEEA 2HK6A 1B16A 1OE0A 4N0DA 3D59A 4W5NA 5GAHi 4Q18A 4M9QA 3BK1A 5EHNA 1N6IA 2QRUA 3CYFA 4D9IA 1BS2A 3BTOA 4HWTA 3I12A 2X1VA 3LQYA 1RDFA 4MWGA 3K1AA 4X8OA 1JFVA 1W59A 2V96A 4HRVA 1LS1A 1AS2A 1UJNA 3ND9A 2C5GA 3UQZA 1IHUA 1XRLA 4JLMA 1VP9A 3ZIDA 3C97A 1N7HA 1A76A 4MO2A 3PNQA 3ZU3A 2P4SA 2P67A 1NLZA 3B5JA 4NZ9A 1X87A 2C2YA 4JH0A 4TKUA 2AI3A 4CLRB 3IA7A 1SC3A 2BI7A 2ADOA 5TXGA 2XMBA 2ZB3A 3ESBA 2WJPA 3I6IA 4NMXB 4PBSA 1R69A 4P5EA 1D9ZA 3OECA 3GCZA 4RFSB 3N8HA 2ACWA 2UYOA 2ZJFA 5ADUS 4UU1A 3OJWA 2F1KA 3TXYA 1G59A 4ROSA 1BMFA 4EEXA 4EYKA 3U39A 3U6BA 2XECA 3DDHA 4OFZA 3FVVA 1X2EA 3PJFA 4Q93A 4Z2YA 2HCFA 3WL5A 2XD9A 3W5IA 3PNLA 1UM9A 4RZ2A 4ZZ0A 3A9VA 4KUGA 3H5TA 3PC6A 2AE2A 3OPMA 3ZY6A 3S2ZA 1DO2A 1H6DA 2IV2X 1GZVA 3UB2A 2OC9A 4EY5A 2PPVA 2Z04A 1XK6A 4K3VA 1ORHA 2VNHA 3AGQA 4F5DA 4ZI3A 4IIVA 2I7XA 1HYQA 2ZS9A 5GJVC 2V6JA 4IVNA 4DYVA 3WWPA 1ZUGA 3RYIB 5EY5B 2Z1NA 3HHPA 3JWJA 4YV2A 4D5EA 4Y2SA 1J23A 2EG9A 3H11B 3O1HB 4BQNA 3FF1A 2WP0A 2Q3BA 4RKRA 3GGPA 4F45A 4XLTA 5C37A 5JAPA 4HDRA 5K0EA 5LOVF 5FO1A 4AZSA 4W5HA 2I8AA 1XUOA 2R6CA 4JLWA 4WY2A 4YFVA 3QTLA 4NU8X 2CKMA 4XCVA 5EWLB 2K7ZA 1F14A 1U1FA 4H4CA 5JVDB 3RRZA 1HYHA 3T7CA 4EHBA 1Q12A 1CQZA 4FMCF 5EKSA 4N0QA 2Q4OA 1V6AA 1ACMA 4IEEA 1NXQA 4AAYA 1QF6A 2ES4A 2WFZA 3HACA 2FUG6 1KOFA 3THXA 1W93A 1XCOA 2WAOA 5CIYA 4D2IA 1C8LA 1B8UA 3TQCA 5G3YA 3I53A 1GLVA 4ZD6A 4DCMA 3I2KA 2RONA 1KI2A 1KAGA 3LC7O 4DBVO 3R5JA 3C6XA 4TTAA 1U0JA 5AESA 4DV2B 4JI4B 3GDHA 3WLQA 5LQUA 2QRPA 3PF9A 3IE1A 1J1UA 5TARA 2JGLA 3GJ8A 1YTLA 4P33A 1YE5A 3NVMB 5LMNB 4ZDIA 2DERA 4FK8A 3LFHA 4QXPA 4IIBA 1ZZEA 4X9XA 4W5OA 2B5WA 1D6NA 1Z17A 2C2ZA 1UM8A 3BMNA 3F46A 3KM0A 3AP3A 2MJLA 3FYUB 3LQ4A 1N25A 3CXUA 1S96A 3N0WA 1TB4A 3Q8KA 1SUDA 4KBFA 3MAAC 4L07A 3OURA 1MQSA 2H00A 5KB3A 1QG0A 2QGNA 2MHCA 2WD9A 3SIWA 3DW1X 1YQQA 5ALUA 1Z34A 5H7XA 4Y2TA 1NAIA 5JT1A 1V8FA 2LW7A 2G3YA 5G1NA 1E4YA 2AXEA 4BLUA 3VC2A 1I7SB 1XTIA 3IQHX 1D2EA 4OHWA 4C43A 1ZHOA 3TJZA 2HQ1A 4BNYA 2XGMA 3RK0A 3LDUA 2OKCA 1J39A 5JHGB 5F64A 4BE7B 4GZ3A 4RZ3A 1GPBA 2YXLA 4MIYA 2PFGA 3BWBA 2UYYA 1U9IC 5HIKA 3FN4A 1DRUA 1PKXA 4KP7A 4CM9D 2BDEA 1CJUC 1RJEA 1LNSA 4PQGA 4BFWA 3MJ4A 1FDOA 2IITA 1J2YA 4RS4A 3GO4A 3CV3A 3T7TA 1FNCA 3OJFA 4CLXA 4EPVA 2OG1A 1U3FA 2WIAA 4R1PA 1N2OA 3NEJA 3WBBA 4ZOAA 5I7AA 5LNK1 4B3MB 5AJWA 4RKFA 3LQFA 5CP8A 3ADPA 1LNZA 3ZV5A 1G5HA 2B3TA 4FBGA 5DNCA 2OFWA 1XC7A 5KYUA 1W19A 1UQTA 3VX3A 3LUJA 3KQVA 3GRVA 2WLTA 2YWJA 3KDPA 2PXPA 1HKUA 5TX7A 3L6RA 4F93B 1TRKA 3HJUA 3HY4A 5EZSA 1PRVA 5EJIA 2CD9A 3BN3A 3WGGA 1DAGA 1W49A 4WN9A 2B82A 2VO1A 3PC3A 3T1VA 3GAAA 4QOSA 3R44A 4Y2RA 3D6FA 2GZDA 2JIZA 2AMYA 1OBHA 2AXNA 4WCDA 2FZKA 5LR6A 4ENSA 5CCEA 1UPTA 4RKYA 5LNK6 3FHTA 1GM5A 2ADMA 4HH1A 2AXUA 3CWQA 1T1IA 2CXSA 3EUAA 1WL8A 3KQYA 2IQ5A 3LTNC 1C9KA 1G5QA 2YKGA 5A02A 4OI4A 4NH4A 3BDAA 3DB2A 5TS2A 4PRLA 4BNXA 1YZUA 3P0HA 4I9HA 1YHYA 4KK3A 2P2NA 2Q3DA 3HEMA 1XCPA 1JH9A 2P4UA 4O1MA 4OJMX 1GZUA 3R6TA 4RA6B 2OXTA 3ZHMA 2ZE8A 4ZOQI 3A70A 3GG9A 1QQTA 3CEPB 5CLFA 1OIVA 4D45A 2H3HA 2H08A 3PVSA 2FQYA 3PQ5A 3O74A 4NBLA 3L3BA 1FDUA 4CCYA 2G4LA 4BTLA 3VPSA 1K6XA 1VJGA 4XQCA 4DIDA 2VYQA 2AYYA 4HNQA 1PT5A 2A92A 2E4UA 2ODBA 2XSZD 2PGLA 1U1DA 5WRFA 1KDYA 4MROA 4D81A 3O8DA 1EZ4A 1PO7A 4FDAA 3UJ8A 1DO0A 3HNOA 3PYMA 4RHCA 4WLNA 4YXWD 3I09A 9ATCA 2W9XA 2Z43A 3K6SB 1RXSA 5KDLA 2B4KA 4PG5A 4BQQA 2I7VA 2AK2A 3IBFA 1YZNA 4OQLA 5B3LA 3A6PC 2OENG 4LGVA 4C14A 5JH7B 5KJFA 3SQLA 2HWUA 1EVJA 1MIOA 3T6KA 3AIIA 2XNKA 1KXZA 4IQ0A 4CMIB 3RUDA 2C8JA 1X57A 1OLOA 4OHUA 3UK0A 4KBYA 3GUZA 2CBXA 2R85A 5EE0A 4AMVA 1CQWA 4JFAA 4O2AF 5L3VA 2JI9A 1SVUA 2QN3A 4W82A 4CKWB 1ATIA 2BKLA 3G49A 3AL2A 4RGYA 4BEBA 3PCTA 4GGMX 3E53A 3H1FA 2EWTA 1V5WA 1UZAA 2N42A 1II9A 3TS1A 3A6FA 3HP1A 1DL5A 4TTVA 2ZIVB 3RUCA 3DVLA 2PT5A 4JGGA 1DAMA 5EMKA 1EAYA 1VIDA 1UXJA 1JB1A 3OEYA 5ESXA 5JXIA 5MGNA 1KVTA 4MUMA 4TLLB 5BSHA 2DKNA 4K2HA 4KV7A 5IBCA 2HMSA 3CONA 3QPDA 3B3FA 1KOLA 1NY6A 3UC9A 2ZVQX 1L7EA 1G17A 4OAQA 3B1ZA 3O9XA 5C1BA 3K9CA 3DUFA 5BWBA 2O8CA 4A0QA 2J3IA 2WJIA 1CIJA 3OLCX 3GLFE 4EL0A 4I3HA 2GZ3A 1TO2E 1NYQA 2IUSA 1ZGHA 521PA 2IUOA 4L8VA 4TVSA 1H2EA 2WKWA 1B1CA 3C24A 3SHWA 1VKHA 3GBFA 4PE5B 2VYNA 3B1WA 2XSZA 4ZT5A 4EF6A 2R00C 1U11A 3CN9A 4DCVA 3LUHA 1BXGB 4KVZA 4PX5A 4RKWA 4K9SA 3BPSA 4M1KA 3HO1A 1OMOA 2PIAA 2R8PA 5H81A 1CK4A 1OIXA 2P27A 4ZOLF 5CVTA 1QOPB 1G21A 2ZBUA 3DTVB 4MWZA 4YAJA 4LJ9A 5E9JA 3ZWBA 4F2PA 4YRMA 1EUYA 1USGA 1IUOA 1XQ1A 5LFAA 1OZFA 1V7QA 3K53A 3L6BA 1TT5B 3ZJ4A 1NXXA 4MRMB 2YVUA 3B6EA 4BPBA 1XMPA 3TZCA 1P4HA 3HLKA 2HREA 1I32A 4MJ7A 2GJAA 1M7GA 3LCUA 5IZ4A 1KS2A 2GPNA 1J8FA 5AI8A 1TZKA 5BOSA 1Z36A 3QVMA 4B80A 2GB4A 4DIFA 5BXQC 1QFXA 3ILSA 3KWJA 3GQBA 1QO7A 2RHOA 3PFWO 4MUXA 2FRVA 2XB6A 1YFJA 5DH9A 2JBAB 3BBLA 2AUWA 2WYVA 4LVOA 4R8SA 3AY6A 1DC8A 1W6UA 3OFNA 2PXUA 1XFAA 4GICA 3IE2A 3D2CA 1KEKA 4F0JA 4ZI7A 4QG3A 4MIOA 1RHQA 4EW2A 2YOHA 4B3RB 3EOAI 3KYJB 4IIJB 4PG7A 2JBWA 1BE0A 4JDPA 4IJ6A 2PH1A 2MCFA 2ZB4A 3VVBA 3FMFA 4WJKB 2ZG6A 1MEEA 1OXUA 3ELYA 4CLHA 4PR0A 3UK6A 5EJ5A 5LYYA 5L9AA 2DH5A 2FGKA 4YALA 5B3AA 1PZGA 2FZWA 3HBLA 1RXUA 1SVWA 3AM4A 4PO1A 5AJYA 5LYJA 3M9LA 3I01A 1DRJA 1FYFA 2R8EA 2PM8A 4WWHA 2EARA 1L5NA 3IUBA 2ZM5A 2X4DA 4YRQA 1VJTA 4EHKA 1NPYA 5K99A 1TIKA 3L7CA 2QD4A 5ALOA 2CLDX 1JI3A 1PS0A 3RUIA 4JLOA 5GVRA 3RJMA 1SXJB 2C5EA 1TEZA 2ZVJA 3EEYA 5JQWA 1DG3A 5CT9A 3T3NA 5ENDA 3E9QA 3IFSA 4Z4CA 1XLTC 3MRTA 1RZ3A 2VHZA 1TKBA 3FNRA 2B34A 3A4IA 4M87A 3Q3VA 1YULA 3ZJYA 2RCNA 3QX3A 4C4ZA 3H17A 4TWBA 1Q1GA 4QTTB 3IVRA 1P5JA 3KPJA 4PWZA 3KV1A 4IZ6A 2PRZA 4NYIQ 1OZ0A 2OBXA 1DUIA 1ZI9A 2BFCB 2Q3LA 3UMFA 4IIHA 4KSYA 4CLOB 3HSKA 4K0RA 5B6JA 1YONA 3NKFA 2I6XA 4RY9A 5EZYA 1G8HA 1XDDA 1WZIA 3E27A 4TL6A 3I2HA 3BK7A 3UAVA 3LUFA 1VG9B 3JQ8B 4CMJA 4Q3CA 1NJ1A 1TI7A 1W46A 3OCWA 4RWZA 5DTJA 1UBNA 3LPAA 3DOHA 5KYGA 3M34A 2YJ5A 4WUTA 5CB4B 3TLXA 1ZCFA 3IP1A 2VPQA 3T12A 2QM7A 3HADA 4HX9A 5AUPB 5IVDA 2WI8A 1UOOA 1Y3CE 2BFEB 1VKJA 2P79A 1P39A 1VHWA 2NO7A 3L5OA 4Q21A 2HFZA 3ZGVA 4PAOA 3ANTA 1P2GA 4ZEXA 2II6A 1ZUHA 5IYZF 2QK4A 4WOCA 1EH5A 1W2WB 1BH2A 4CU5A 1Y9ZA 2FQXA 3A6JA 2GJSA 3CTPA 4WXEA 4DQVA 1OFVA 3OKAA 1KPIA 1PV1A 3NHAA 1CQPA 2OHIA 2QB5A 4KWEA 4MW5A 4JXZA 4G4GA 4KQ1A 3T34A 4MV7A 1GY8A 3K05A 1SWWA 2R62A 1FFCA 4JFRA 4YX9A 4F8DA 1KK1A 3AUSA 3UHJA 4PGHA 1VPLA 4M7PA 5B7PA 1XYVA 2JFQA 2ZI6A 1TK3A 3GOHA 1PJQA 1UAYA 5D1NA 1ZK3A 4DTIA 1ISHA 3I32A 3RYFB 2XNCA 3K70D 3W7VA 4YRKA 2W90A 1OT5A 1T4DA 4RGBA 4W1RA 2NUPA 3RS3A 3B53X 1QK3A 1YUBA 2CJPA 4M98A 4L78A 4KPEC 3E6AA 3JQGB 2V8OA 1OROA 2B8TA 3H2IA 1A8UA 2OMKA 2AXQA 2O1XA 2ZRIA 3EY9A 2NV6A 4FGUA 2H9IA 1TVMA 5HCIA 3SEAA 3PLNA 3JPYA 1W48A 1S1MA 3I05A 4AJJA 4AMYA 3MJTA 1C4XA 1LBHA 3I5UA 2FFAA 4C2UA 4EJ2A 1ABFA 1Z56C 3MEQA 2DKOA 4PVCA 3K9HA 4RTLA 2JLRA 1SXJE 1VC2A 2JD0A 1BMDA 1XWRA 2V6FA 3LQ1A 2JFYA 1REQB 4MCIA 5FBLB 3HA5A 1XN4A 4PINA 3D1JA 4C0WA 1LRLA 2QUKA 1RXCA 4P1ZA 3QQPA 1I2BA 3EFEA 3VZQA 1XHEA 1M3SA 1IN6A 1G2QA 1X6VA 1SCKA 2WFLB 3GAFA 3GLKA 4H7PA 1WD7A 2JIRA 2Y92A 4RANA 4AU1A 2V58A 3GRYA 4KITB 1S9DA 1PFQA 3A3OA 3TD6A 2IPLA 1IXYA 5IAAA 4GOMD 3OE7D 4DQUA 5FPKA 1SN7A 5I4IA 3P45A 5A4IS 1F48A 3CR8A 4XRRA 5HNKA 2GPBA 1QRDA 2OM6A 3FFBA 2WWVD 5HQ3B 2F3QA 3UJNA 3ZDDA 5BUQA 1Q20A 2MOKA 3AOEC 4Q19A 3VYWA 5C7IO 1RRKA 1GU1A 3FNIA 5KNBA 3C7AA 1C7ZA 4JVNA 4CEHA 2C83A 4IJUA 2DWPA 3GCDA 4UM8B 3PEYA 1BWRA 1P6UA 1N6KA