4EKGA

Crystal structure of dot1l in complex with epz003696
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
327
structure length
319
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational adaptation drives potent, selective and durable inhibition of the human protein methyltransferase DOT1L.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
total genus 89
structure length 319
sequence length 327
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4ekgA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ekgA02
1AQJA 5MHTA 4ER0A 5GP1A 1Q0TA 2WK1A 2FHPA 1KPHA 2NXJA 3P2IA 1FBNA 3BGVA 1NE2A 2C7RA 2AOUA 3KPWA 3UZUA 2R3SA 1BKYA 3ORHA 3G8BA 5FHRA 2FPOA 3TOSA 3DTNA 3R3HA 1JG4A 2KW5A 1M6YA 1EJ0A 3A7EA 3PT9A 4CWAA 2BM9A 3ID6C 5D1HA 2AOWA 3NJRA 3B5IA 3FYDA 4U7TB 2P8JA 4CTJA 2IH4A 3KQOA 4JXJA 4MWZA 5DPMA 5EEHA 3EVFA 3HTXA 3SSMA 3P8ZA 1UWVA 4ISCA 3T7TA 4EMSA 5HOQA 2QYOA 5BW4A 3P9CA 1JTEA 2P35A 3A27A 3KQTA 3LX6A 3EVGA 1RJEA 2ZTHA 5DTMA 3DULA 3MGGA 3MTIA 3VSEA 4E2YA 4P7FA 4RTLA 2XBMA 4RTMA 5EZSA 1G6Q1 1R8XA 3C0KA 5ICFA 4KRGA 3P97A 4HC4A 4DZRA 2BR3A 2WA1A 4YV0A 4PYJA 4RVGA 1VE3A 2PVCA 3A26A 3HVKA 5E1DA 5FQOA 4F85A 3H2BA 3LECA 4LG1A 5DX8A 3TKAA 3FUXA 2EJTA 3EGIA 3GCZA 3HA3A 4E2ZA 5IKMA 5GINE 3OU2A 3HVIA 4HRAA 3LKZA 5DM1A 5B1SA 4QQNA 1XCLA 1BHJA 2B2CA 5DX1A 4P7KA 2K4MA 2PSSA 3G2OA 3GWZA 1EAMA 4V0QA 2ZWVA 2O07A 5FADA 5K05A 3BWBA 4CXMA 5EZQA 1YFJA 3NTVA 2IH5A 1UFKA 2ZULA 2JHCA 1XDUA 2E5WA 5LSAA 9MHTA 1KPGA 2H00A 2QM3A 3DP7A 5T6BA 3EGEA 4ER7A 5DT2A 4KVZA 4DKJA 2ZCJA 2JHPA 1NV8A 1VP9A 1XDZA 1PJZA 2ZVJA 4YUXA 4RTJA 5CVVA 5CVUA 1VLMA 1SUIA 3ERCA 2NYUA 5EOVA 3O7WA 3M33A 2B25A 8MHTA 2PKWA 4FS8A 5JR3A 4GOND 5K0CA 3EEYA 1RI4A 4E70A 1EJ6A 3NVKI 1G55A 4BLVA 4YUYA 1AV6A 4B17A 3FUTA 3TFWA 1QAMA 3C3PA 1QYRA 3LL7A 3CC8A 5DSXA 3TLJA 4BLWA 4RYLA 5EIFA 1KPIA 4PCAA 5CIYA 2AN5A 3UJ6A 5EEGA 3C6MA 5K0EA 3DXYA 4X1OA 3G7UA 3QOWA 5E9JA 3EMBA 2OPBA 1R74A 3B3FA 3BGDA 4WVLA 4HH4A 4LECA 2UYCA 4V0RA 5H02A 3UFBA 2IDJA 2EX4A 2B78A 3OPNA 4M36A 4PIPA 4Y2HA 3A25A 5CVDA 5EMMA 2NXEA 5JUWA 5GM1A 1IY9A 3C3YA 4HTFB 1N2XA 4R05A 5KYGA 5FUBA 2XVMA 2YTZA 4KW7A 5KVAA 5LQCA 2ESRA 2QRVB 1FPQA 5DTQA 3OE5A 3EVEA 3KPJA 5LQRA 2EJUA 5K0FA 3R9XB 2AOUB 2N47A 2LD4A 3SM3A 2PX2A 2VDUE 2ORED 3SX0A 3KQSA 3I5UA 2QE6A 1TW3A 4FGZA 2HMYB 1L9KA 1SG9A 2G8NA 2B9EA 3FTDA 4K6MA 3G5LA 4QVGA 4YMHA 5FQNA 4YMGA 4BP3A 1XJ5A 1T43A 3BWMA 1EG2A 3SXJA 4PNEA 1D2HA 1V39A 1QAOA 3HCAA 1SQGA 2GA9A 2GB4A 4XUDA 1XCJA 4L7VA 3O4FA 2AS0A 1ZHFA 3G2PA 5FTWA 1JG2A 3MB5A 1JSXA 1OR8A 3KPYA 4POOA 2Q41A 5EMJA 3BKXA 3OU6A 2OB1A 2G71A 5LQNA 4DA4A 5K01A 3LBYA 2ZIGA 1XXLA 2DULA 3DXZA 4O29A 2ERCA 3OU7A 3PFGA 4AUKA 3CJRA 4RX1A 4CKEA 3FUWA 2AZTA 2GH1A 2IPXA 3TM5A 2OBFA 2WA2A 3BZBA 1QAQA 3IHTA 5BXYA 2NP6A 3TKYA 5GIOE 1R8YA 3R24A 4RTKA 5K0BA 4IV8A 3ELDA 3B7PA 3SSOA 3HCDA 1KHHA 2ZLBA 1QZZA 4EQZA 5BP7A 1JTFA 2V7EA 2HR1A 4EKGA 3Q7EA 2P7HA 3NWBA 4PYKA 1SVUA 2PJDA 4QTTB 5F2KA 2P40A 4RV9A 1M6EX 5P8WA 3HVJA 1SKMA 3BKWA 3QOXA 3EVDA 5T67A 2UZ4A 5FA5A 2BM8A 3HA7A 3K6RA 2H1RA 4QDJA 4KDRA 3B3JA 3PFHA 3EMDA 5E8RA 5EPEA 4IKPA 5DRYA 1WZNA 2I62A 3ELUA 4RVHA 2HWKA 1NW3A 1X19A 3FPFA 2GPYA 3DLIA 3LDGA 4PONA 2FK7A 5FCDA 3JWGA 4BLUA 4DMGA 4RTSA 2IP2A 3GIWA 3LSTA 2VDVE 1FJXA 4EKIA 3A7DA 1L3BA 3ELYA 2AOTA 4PYOA 4P58A 1YZHA 1AQIA 2AN4A 2EFJA 2P1DA 3GRYA 5CUQA 5HIIA 3V8VA 4BP1A 4C06A 4C08A 1RJGA 2QRVA 1N7IA 2VS1A 4C04A 1SUSA 3WSTA 1NW5A 5C9ZA 4ER5A 4E2XA 10MHA 1ZGJA 3REOA 5E1MA 4IWNA 3A4TA 5F2NA 3KHKA 4GBED 2ZZNA 1P91A 1WG8A 3B89A 1WY7A 2HTEA 2XYRA 2GAFA 2AN3A 3G5TA 4KIFA 2ZBQA 4DM3A 2FRXA 5GIPE 4RTNA 4A6EA 4QDKA 4IV0A 5EG5A 2BZGA 3CBGA 2ZIEA 3G8AA 2P3QA 2PT9A 2ZWAA 4YUVA 5EHIA 3UA3A 5DXJA 4PYNA 4XUCA 5T64A 3DOUA 2OYRA 4BY9E 3HA5A 1XVAA 3P2KA 1O9GA 5E2AA 4ATNA 2VP3A 3NW9A 2ZW9A 1BC5A 4R8SA 3MERA 4FZVA 5K0NA 1I9GA 3MCZA 2ZBPA 5K03A 4X61A 1YB2A 5K0GA 2GLUA 1VIDA 2PBFA 2PLWA 2PX8A 3GRUA 3HNRA 3FPEA 4NECA 3V97A 2EG5A 1N7JA 1WXWA 4E33A 2Z6UA 3THSA 3T7RA 1ORHA 1L3CA 4G56A 1P39A 4GOMD 3LGAA 2YX1A 3MCTA 4OA8A 5M5BA 1M0EA 1JR4A 1DUSA 3DMHA 4F86A 5LQUA 1BOOA 3EVBA 3P9IA 3UJ7A 5LQJA 5HIKA 3NDIA 2F8LA 3ANXA 2AR0A 1KR5A 1X1CA 3G88A 3OE4A 5ERGB 3KPVA 2YXDA 4YUWA 1IXKA 3KQQA 2OXTA 3FZGA 3AXTA 3MHTA 3EVCA 1F38A 5C0OE 3HM2A 3KQYA 2P41A 3CKKA 3FUUA 3HEMA 3KR1A 3NVMB 4PGGA 4RSRA 4X41A 4ZTBA 3TR6A 3E23A 3NDJA 4WXHA 3RODA 1ORIA 4PYQA 3DMGA 2FCAA 4GUAA 2IH2A 2PT6A 2H11A 2C7OA 1INLA 1NBHA 3BGIA 4GOLD 3GRRA 3LDFA 3M70A 5FWDA 2FK8A 2VDWA 2IIPA 5G02A 1EIZA 4YV2A 5CD1A 3DMFA 5FWAA 3NWEA 4FT2A 1G60A 5K0LA 3AJDA 4GC9A 2AVDA 3EVZA 3ER9A 2P3OA 2JH9A 2NXNA 3LBFA 3NMUF 3AY0A 3HCEA 2ADMA 3JWIA 3R0QA 2G72A 2DPMA 1YUBA 4HSGA 3LCVB 4QTUB 3ELWA 4R8RA 5IH3A 3T7SA 4CKBA 1KIAA 1RJDA 4LWPA 3X0DA 1I4WA 1NW7A 3VYWA 5C1IA 4FSXA 4RVDA 4C4AA 4M38A 2I9KA 5ICGA 1YFLA 2HV9A 4QPPA 1NT2A 2Y1WA 3DH0A 5FULA 3DXXA 1WS6A 3FYCA 3I9FA 4QPNA 2Z6AA 2CMGA 3E7PA 3M6WA 3IEIA 3UA4A 2ZZMA 3VC2A 3SR4A 1JQDA 3HP7A 3R6TA 2O06A 2NNWB 4GF5A 5CVEA 3SSNA 5U4XA 2GS9A 5DSTA 4LWOA 2ONZA 2P7IA 4PCLA 4DCGA 1MJFA 1VPTA 1NV9A 2BH2A 1YZ3A 3KU1A 2C7QA 4MQ4A 1P1BA 1JG3A 4RVFA 1VBFA 1O54A 3SVZA 1X1DA 1I1NA 3L8DA 3O31A 3UJCA 3UJDA 3BUSA 2AOVA 2YXLA 3P2EA 3LDUA 1RI1A 4QQKA 2ONYA 3D2LA 2NXCA 3TQSA 3GRZA 2VZ9A 4OX9Y 4OBXA 2O0LA 2YQZA 3LCUA 4XCXA 3BWCA 3E8SA 3MTEA 2Y1XA 2FYTA 3PX2A 5BW5A 5EKUA 1ZQ9A 3IV6A 3G2QA 3HCFA 4OA5A 5CM2Z 5HZMA 1ZGAA 1KXZA 3EGVA 4AZWA 1QANA 4ER3A 2IBSA 5DLYA 3BWYA 4C05A 4AX8A 2ZZKA 4MHTA 5LR6A 2JG3A 5KQSA 3T0IA 1WXXA 5EKXA 1KYZA 5LQAA 4H0NA 4E30A 1L1EA 1YF3A 3LCCA 1B42A 4A6DA 1H1DA 2PX5A 4FT4A 1EQAA 2PXAA 2OB2A 3FUVA 3P9KA 2OO3A 4P7JA 3MAGA 3I53A 3HVHA 4CKCA 1FP2A 2IBTA 2BR5A 1Z3CA 5K0JA 1XDSA 2CWWA 3AWIA 3OFKA 1G8SA 1U2ZA 2XVAA 3GNLA 3KR2A 4GOOD 1R18A 3FPJA 1TW2A 3UJBA 4E32A 4HTFA 4FP9A 3KQPA 1DL5A 4AZSA 3UBTA 1HNNA 4OQEA 2HNKA 3G2MA 2CL5A 1VQ1A 3KQMA 5CCBA 4GQBA 2UYOA 2IDKA 3TPZA 3KQVA 3TMAA 4YUZA 3K0BA 3GO4A 2AOXA 2OZVA 1Q0SA 1UIRA 3GU3A 2UYHA 3UWPA 4M7RA 3BT7A 3DR5A 4PYMA 4RWZA 3GRVA 4HGZA 2ZBRA 3EVAA 3GJYA 3OZTA 2I7CA 3TRKA 1JSZA 2O05A 3LHDA 4PGHA 2Z6QA 4DQ0A 5E1BA 3RW9A 1NKVA 3PVCA 3OZSA 2YVLA 3PB3A 5CVJA 1XTPA 2ZFUA 3OZRA 3FTCA 2P3LA 2PXXA 2R6ZA 3IYLW 5DM0A 3RIEA 5K8VA 4RTOA 3FPGA 3OFJA 3FTFA 4MIKA 1NW6A 5HEKA 5KQRA 3ME5A 3EEOA 2B3TA 5EMLA 4E2WA 1Y8CA 2C7PA 3UJ8A 2PX4A 1DCTA 5E9QA 4QVKA 2PWYA 1PRYA 3PX3A 4Z2YA 4AZVA 4RTQA 3CGGA 1RI5A 2PY6A 1KP9A 3VC1A 5ICCA 5DM2A 5F2OA 5DXAA 1G38A 1MHTA 2AVNA 3SGLA 3PLAE 4YV1A 2ZIFA 2XYQA 2PV0A 1NW8A 2JH8A 3LKDA 2JHAA 5E2BA 3KQWA 2AOTB 3CCFA 2JJQA 4MTLA 3CJTA 3C6KA 3FTEA 1JQEA 4OBWA 2BR4A 4KWCA 2CKDA 4X63A 5K09A 3PTAA 3M6VA 5CCXA 1RJFA 4CTKA 3PS9A 2ZSUA 1ZG3A 4EVIA 1O9HA 3M6UA 1L3IA 2PXCA 4PINA 4R6WA 3UJ9A 3EPPA 3I58A 3MQ2A 3QV2A 4PWYA 2QY6A 1R00A 2OY0A 3FRHA 2O57A 3KKZA 5E8JA 4GEKA 1RI3A 2OKCA 1TPYA 1HMYA 2XYVA 4EK9A 3DLCA 4M37A 4X60A 5D1NA 4DF3A 4DCMA 2NP7A 2G70A 2YR0A 5FA8A 3SMQA 3THRA 3FPHA 5EIWA 2PWPA 3OCJA 3F4KA 4RTPA 4P7GA 4Y30A 3G89A 2IFTA 4E31A 4GC5A 4RTRA 3GDHA 1JG1A 3CJQA 2A14A 1FP1D 3HCCA 4XUEA 5E1OA 1RI2A 1R6AA 1NBIA 5GWXA 3DUWA 5FHQA 1IM8A 5EHGA 1KYWA 1P1CA 1ZKDA 4PYIA 1X1BA 3CVOA 5KS2A 4OQDA 5EGSA 4C03A 4HG2A 2UYQA 3I64A 5DWQA 3JWJA 4HGYA 3E05A 5GM2A 1F3LA 3HCBA 5EVJA 2CMHA 4F84A 3GXOA 3BXOA 3KPUA 5HILA 2YUIA 3M6XA 3S68A 5LQKA 3ER8A 1G8AA 5EC8A 2V74B 3TM4A 4PYLA 3GGDA 3KR0A 5DM4A 5EQJB 5HIMA 1SQFA 5DX0A 3U81A 3M4XA 4AZTA 2YXEA 3JWHA 7MHTA 3AXSA 4KIGA 4UOEA 3P71T 4FSDA 1VL5A 1D2CA 1D2GA 5HFJA 4KDCA 5DRTA 5GOZA 1JQ3A 4PIMA 4U7PB 5EMKA 3UJAA 1VP3A 3P9NA 3KR9A 3LPMA 3Q87B 4FR0A 4C07A 1X1AA 5HIJA 4R6XA 2G1PA 1AF7A 5E9WA 5ICEA 3FRIA 2IGTA 2I6GA 2PGXA 4ER6A 5DTRA 3B3GA
chains in the Genus database with same CATH superfamily
5KOJB 3I2IA 3UW1A 3BD9A 1AQJA 4ER0A 2EOAA 2BFNA 1J0BA 2YWXA 4WA7A 4F5YA 2VDNB 4H1VA 3C4QA 5J1TB 3KJHA 3P2IA 4L7QA 4O4IA 1IWBB 5KDLA 2BBWA 4C0BA 3J81k 4JN6B 1QNLA 2I6FA 1S2OA 1ZRHA 3F1LA 2Q62A 1WDKA 3AR4A 4E7OA 2Z5LA 4BASA 4PGFA 5DGXA 3FYDA 2PH7A 3UCXA 4BAUA 1FMLA 3OICA 4JXJA 4QDXA 4X7PA 3IEMA 2A7XA 3C6XA 4ZPJA 3SJ7A 3GBVA 4YXWA 1RJ9A 1BDIA 2IYLD 4QYIA 1E96A 1JEDA 3WGMA 1S2GA 2AG0A 3N39C 3WMEA 1DCTA 1IIBA 3KXLA 4Q3OA 2BEWA 3V6LA 1X74A 2MR5A 3B20A 4FNAA 3SS9X 4MR7B 1N32B 3GELA 4UTZA 5ILQA 5BR7A 3R8XA 1MFZA 3SR3A 4WBSA 5E1DA 1LVHA 2PKQO 1KE2A 2GM9A 3AEKB 2BZ1A 4LKOA 5A0VA 1CY7A 1UBCA 3ESZA 3BEOA 4LZAA 1YNSA 1HRKA 4URZR 1N9GA 3B1XA 2H4JA 4O4IB 1YC2A 4S1TA 5CT4A 1XTSA 1EAMA 2NPIA 3K8ZA 3CURA 1FW8A 2OV4A 3VC3A 2VPTA 2IBMA 1XU4A 3QOFA 1MB3A 4DIFA 3FMGA 4TWJA 3AC0A 1XDUA 2HV8A 3MNFA 1ZJZA 4TXNA 3UWDA 3EGEA 3LY5A 4JROA 2JIPA 3IA7A 4ZHQA 2DJIA 3CX8A 3DQPA 4KUGA 3L8HA 3ED1A 3DD1A 1WPXA 4GWLA 2GKGA 1IB0A 2E9SA 2ILTA 3IV9A 1ECPA 4G5SA 3TSCA 3PFKA 3IBSA 5JD4A 1XEXA 1L1QA 521PA 3G0HA 1WSAA 3ESDA 3UFDA 2HK6A 2NO1A 3PCXA 2J0UB 1AKTA 1NZJA 1RI4A 1DX6A 1OXMA 4AWBA 4M7PA 3D6UA 4HGOA 1Q14A 1AV6A 3O26A 1QAMA 2SICE 4A73A 2WTAA 3QWHA 2XMSA 3PGMA 2DHEA 4FCVA 4JB3A 4RVNA 3WNCA 4RYLA 1KPIA 3I34X 3GD7A 4ZAVA 2ZYSA 3QLTA 5BOVA 4Q6WA 3VPCA 4TVSA 1NMZA 3HJTA 1BGWA 1GRCA 1W5BA 2X7HA 2GK7A 5BWCA 4J7XA 2FP4B 4A6PA 3EW7A 1DJQA 4UNSA 1EVYA 3TECE 5DEIA 1QFYA 3CO5A 4OMDA 2HZBA 5DYWA 1UJBA 1B23P 1G63A 2I4IA 2BPOA 1N57A 4TUYA 4Y2HA 2NO5A 2O2JA 1GKUB 1SC9A 1UK6A 2CNBA 5MN6A 4DT1B 1XRJA 2AQHA 4ONEA 1XOIA 1EM8B 3Q3IA 2D2XA 4GNKA 2H6EA 2F1KA 3NWOA 4MV5A 3WB0A 2J4CA 1LZLA 1WW3A 4Q12A 3A6HA 4YMIA 1OFHA 1RLIA 3EIXA 4H1HA 2FSUA 3SIXA 4XEHA 1A97A 1P17A 3SM3A 2HQOA 2IODA 3L4BA 4AJHA 3QFSA 3PUKA 8OHMA 3HBFA 1F2DA 1SG9A 4MVJI 4BBAA 5L95A 2XUDA 3GRKA 5KJ6A 1QLJA 5AK3A 5IXJA 5J4VA 3EISA 3MZ0A 2RK6A 4OG2A 4UVGA 4YRSA 5K2OA 4UHJA 5A0TA 2CHFA 1EQ2A 3EXHA 3A9VA 3IT3A 4UJ5A 3K6SA 2XYHA 2JJ8A 4FMCB 5EIHA 3KUUA 4ENPA 1RXUA 1XCJA 3OWQA 2CNDA 1RNLA 4PQYA 2H1WA 3G2PA 3QF4B 2BUAA 4Y1RA 1NJGA 1AT1A 3FGZA 4KDFA 4WJLA 4POOA 4WZZA 4RHYA 4R69A 2DWCA 2O49A 3RUIA 4TZ0A 3PENA 1C30A 4BRWA 1Y1QA 4ISBA 1W93A 1ZLYA 3K5IA 1XLTC 1RVV1 1NFFA 1LPNA 3MBIA 4R01A 2RGRA 4V2UA 1LDMA 3U0VA 3R3YA 5CFOA 2OCXA 5FNZA 1UAYA 4ZP1A 4G1MB 4LYGA 2ZUSA 1EM6A 4NMXB 5JAIA 5JNSA 1U7UA 2GPBA 2IDZA 1ZVJA 3GJ3A 4O08A 1P0FA 3R24A 5IBQA 3O3OB 2AFIE 2AMVA 1L4UA 3WIUA 1YVRA 3CH4B 2B34A 3DBRA 2P2LA 3HCDA 1KHHA 4J4BA 1H8HD 2Z0MA 3VOSA 2F9LA 3LA6A 5LNK1 3CINA 2V4UA 2CC2A 2XQJA 3PI6A 4YMUA 1XP5A 4EB8A 2PJDA 4JWTA 1M6EX 2R8XA 1ZZCA 1RKBA 1CIJA 1SXJE 4NBTA 1WP4A 1HQKA 4ZV7A 1W85A 1NSYA 3TJMA 1DKRA 1AS2A 2X2PA 3FPKA 5BV8A 3KOUA 4V0SA 2YIVX 1Q20A 3SP1A 4CV2A 2IOHA 5K8CA 4HPJB 2Q1TA 3BN3A 2AG5A 1IEXA 4RVHA 5L53A 1KFEB 3A6DA 1WMEA 3CLRC 1CETA 1RXCA 2C9ZA 2VCEA 1TXGA 1CY6A 3WHLA 5JAZA 4JT8A 3QFCA 1PHRA 4MYHA 1E79A 2KMLA 3HJAA 4JQSA 4LJ4A 2EFJA 2OMKA 2G0NA 5AJYA 1URPA 5E6UB 5AM5A 4C88A 4OM7A 1NI5A 3VNUA 1RE0A 4BNUA 1NFRA 2LPMA 4C04A 4BEWA 2ARKA 1TCVA 5EZYB 1C3XA 3ITEA 1AQNA 1XZCA 3E2PA 1HKUA 2L1PA 4NMMA 2CY0A 3SOZA 4XWKA 5E1MA 2FFHA 3DM9B 4OQNA 4WK6A 2NU8A 3C7KA 4PGAA 4OB6A 4QC2A 4AT1A 2HA2A 1O95C 3U7RA 4DLUA 4UMVA 3UOWA 1G20E 2CMDA 3FGNA 3IP5A 1FSZA 4UTRA 4DA6A 2WP8J 4D99A 1E2FA 1Q7TA 1CUEA 3C1UA 5JQGF 1I24A 4HDSA 4IUDS 2BM1A 2H5LA 3RTAA 2MCFA 2IU6A 3FF4A 4NJOA 4QQ8A 1FU8A 1XALA 3UATA 5JTUA 5HRCA 1MO5A 2E4YA 1X3SA 2C2WA 1UJ6A 5EHIA 1QM5A 5HVNA 2AF4C 1IQRA 3M1IA 4QL3A 2OYRA 2BRUC 3ZWQA 4UDYX 2OGTA 3G0GA 4OYHA 4PWZA 2ICTA 1G41A 2JLSA 4YQFA 1C9DB 1UT6A 2AJBA 2VP3A 3OF5A 2D7DA 1H9CA 2ZW9A 3H86A 4PG8A 5CA0B 1P3DA 4DFDA 1MO6A 2P9YA 1KK3A 1PNVA 2QW8A 3KE9A 1L5MA 3SBEA 1DJPA 3DTTA 4ETNA 2W42A 2QAGB 3GVXA 2L0XA 4L72A 4QGHA 3W04A 3HXMA 2V9CA 4I19A 1TJ4A 2FR0A 1T4DA 3HYLA 2Z6UA 4DYHA 2Q3EA 1P7VA 5ECGC 1X1QA 1CJKC 3PA6A 4OQFA 1NXXA 3FNBA 5HKLA 4JXZA 3I2GA 1FLAA 1V3VA 1G98A 2BEKA 2DKNA 4NJMA 5HKBA 1I2CA 4J4TA 4PC3A 5HIKA 1SD1A 1F9AA 1JHYA 2QW1A 1FLNA 2QTGA 3N3AC 5CH3A 1KR5A 3BXXA 4LJYA 1GGMA 2BBSA 2GUGA 2JFNA 2YCBA 3LHFA 2BI8A 3DCNA 3LOUA 3CNLA 2X1MA 2EZ8A 1J4AA 2QVCA 2ZEJA 4UU1A 4RV5A 3R7FA 1NNI1 1ZW6A 2OCBA 1JDJA 2DY0A 5HZKA 3FFXA 1Q0QA 1JLRA 2G88A 1QGAA 2FVXA 2GGSA 3CR7A 4F5EA 5I6DA 1WD7A 3EXEB 2F8TA 1SIBE 3VOBA 1QPGA 1J5PA 2IGBA 1XHLA 4PYQA 1DX9A 3BWVA 1T36B 4IPTA 2Q5LA 2CLFB 2PQ6A 1RQ2A 2BEUA 1X2LA 4U3JA 1H69A 1HA3A 2YVKA 5FWDA 2VDWA 4QOHA 3RSLA 3NKLA 4GQIA 3JQGB 1NAHA 4MR9A 1O94D 1FU4A 5AHXA 2C59A 5G02A 3W8FA 2R5WA 1XB2A 1XE3A 4KJZA 3THXB 4L85A 2JAWA 4MVJD 1BX1A 1VBKA 5BUQA 4GC9A 2C07A 4EPRA 3H0EA 1W96A 4OEHA 3DZGA 2B8TA 4MMXB 1GHTA 5HDBB 3COYA 5C9ZA 2G72A 3UPUA 3UT6A 4DMUB 4D96A 4DWWA 1RJDA 2R0QC 4LZOA 3VKGA 2FJUA 1VA5A 7REQA 4M0MA 2YASA 3DBLB 3VYWA 2JD1A 2PZLA 4J7AA 2PN1A 4FZJA 4JHXA 4WL0A 4A26A 1YFLA 3I01M 4QPPA 1Q15A 2GFIA 4WVFA 3E0QA 1U8YA 3AYXB 1OVMA 2J48A 4DARA 3G9TA 3K9LA 2IYWA 3E7PA 1A4XA 3ZCXA 2Y0EA 3V5NA 1E2NA 2RAFA 1QV9A 1YRLA 2M2IA 1YDGA 2OLEA 3LXXA 4IOKA 3ZVNA 3RC3A 3TINA 1W0CA 5IXSA 2GA8A 4GT1A 4LWOA 4AN4A 2EHJA 1UL1X 1XMQB 4K9MA 1WP9A 4R4JA 5F9HA 1SKQA 4J90A 2H1LA 4NMLA 3HNOA 1KGSA 4FDTA 4WW0A 1KFBB 2BOVA 3HWSA 3RVSA 1CR0A 4JZKA 3ICCA 3OJXA 1WNTA 1Z83A 3IKLA 3NRJA 3N2LA 4DEVA 2C5SA 3EXFA 4JOSA 2BL4A 3VJKA 5A6SA 3P2EA 2JVKA 7REQB 1E3IA 1VHTA 1DJOA 2VL7A 2BSXA 2Q46A 1A9SA 1C9YA 2B6NA 2RHJA 3PP8A 4JJEA 4X6UA 3WYDA 3IRVA 5JT1A 2G36A 2LE0A 3B6JA 3D8SA 2VZ9A 4HAYA 5AVJA 3BGWA 3Q3CA 2FHSA 3IULA 4J4HA 4P3YA 4Z99A 3KIPA 4NFYA 1EUCA 4B85A 2JQEA 3KB2A 4G4SO 2GF0A 2XUPA 2X0EA 4DE5A 3BTVA 1XAJA 4PR3A 1RRGA 5KYUA 1BHQ1 3A9ZA 2HHJA 3LY9A 5CA1F 4R9NA 2EP5A 2XGGA 4MWCA 5EKXA 1APBA 4BE9A 1RYDA 4FHDA 2H0AA 3GC6A 5REQA 2CLLB 2Q29A 4W5HA 3DEYX 1EP2B 2BNMA 1VYVA 1GPYA 1KP3A 4BEVA 1T3LA 2GZAA 4PM4A 3OT1A 2I78A 4D9MA 1XXHE 5KO2A 1VDMA 1XDSA 1VL8A 3GNLA 4CETA 1UXCA 3VR3D 3FPJA 2VAXA 3E4DA 4GI1A 4TTTS 1XQVA 4LXQA 1UP6A 5IC5A 2WYUA 5FUYA 5DNYB 4FB4A 1A5SB 5BUSA 3H2HA 3ABOB 3AHHA 4EPTA 4JC4A 2W8BA 1UIRA 1PG0A 2PS0A 2WKWA 4H4DA 2H92A 2QY9A 3VO2A 3DF7A 4HXEB 1PT6A 5AW0A 2D1QA 1CZRA 3LHSA 4ZAWA 4DG9A 1IFXA 4F06A 1J0XO 4JI4B 2RHHA 1YMVA 2XYGA 3KELA 3WK8A 2YVLA 1LS1A 3MQFA 3FKQA 4UBMA 4ZIRA 5F12A 2CV1A 4W5TA 4HDQB 3O7MA 5DM0A 1EEXB 1VLLA 3D7MA 4L3WA 3R76A 3FPGA 1II0A 4NPCA 1DAKA 2P0YA 2R84A 3ME5A 3DNFA 3NHRA 4QULA 5L4NA 1PG5A 1XEWX 2EBYA 4JXKA 3RD5A 1XV5A 3UJHA 4Q39A 2C7PA 4NK5A 5IRCD 2P77A 1A9YA 1JHDA 1FYWA 1Y98A 5ICCA 3TQQA 2O4CA 1CEQA 1JR3E 2VK1A 1QDUA 3JSAA 2ZBGA 3RKUA 4JI3B 1QX3A 4YRLA 1WXHA 4EPWA 2ASEA 1V96A 1LTQA 2RK3A 1LBEA 2WG0A 1N8NA 3MUNA 4YT4A 4KFCA 1LLUA 5ED0A 3O6VA 2P2SA 1UBOS 2QVXX 4DQVA 2J85A 1WDWB 3ASUA 2YXPX 4BNLA 2R9VA 5AJUA 5BVGA 5J9FA 5KIAA 5CYPA 5JYBA 3ZV3A 1QYCA 1W7AA 2ZSUA 1X39A 1QH1B 3C7TA 1RYYA 4IDHA 4LYFA 1JR6A 3FTNA 4GO1A 1ZZGA 2D59A 3CZ5A 4GBMA 2J9ZB 4IX9A 2A57A 2VQDA 2J30A 1SXJB 2ZT6A 4MOWA 4DF3A 4UUNA 3NV7A 5I8WA 5FB3A 1IY2A 5IMSA 1A76A 3QUQA 3L07A 3FPHA 2GM4A 1GSIA 3RVQA 1XSEA 1GDDA 4AZ0A 1QQ6A 1U2GC 2GJ4A 4YDSA 3CWZA 1CR6A 3FY4A 4M9SA 3CJQA 4OUDB 4DLYA 2P4UA 1XK7A 3BVPA 5B12A 4U9HS 2M6KA 4EW3A 3PF9A 3U7JA 4IJKA 4DR6B 1B6TA 3CX7A 1JRLA 3VJRA 4MI9A 4RA6B 2ZT7A 4RNDB 1I5EA 4MGZR 4OQDA 5BVHA 3QKSB 3WIEA 1TA4A 4NS4A 2P8SA 3T3DA 4DIDA 3HB9A 4IUCS 3CLHA 3U6BA 3W5VA 2HQ1A 4YV7A 2IX3A 4J6EA 5ALMA 3VNQA 4NONA 3U60B 4KPUB 1L4NA 3ZY6A 4MZXA 2AWOA 3TM4A 1FTYA 4LJAA 4X62B 1A9PA 3A10A 2XNHA 3GLFA 3DZKA 5HIMA 4RK1A 1DXOA 1ODFA 4AZTA 3OIFA 5AOBA 3ROTA 5HE8A 2HADA 4UOEA 2F64A 2FMTA 5LUAA 4CM3A 4BB0A 1JE0A 2GNPA 3BFVA 4H7HA 4RPCA 1XZMA 4Y8VA 3H1AA 1XTTA 4UZEA 5EMKA 3KAJA 5IKPA 1DAIA 2DR2A 2Y6VA 2O7QA 3Q87B 1M2OB 5DGTA 4YP6A 5JNUA 4K6FA 5AD1A 3V7WA 1T4GA 3B3GA 5JZ9A 2GN2A 4WLUA 1SC1A 1PERL 2Q5IA 4A2CA 1LK5A 3OECA 3MT0A 1AVTA 1MB0A 5IUNC 1JSLA 3SEFA 1MPTA 3N2GA 1RYBA 4IMIB 5CHEA 1FDUA 4M0KA 4RHTA 5EUBA 1I5RA 1MMFB 4PHHA 3T9DA 4FSHA 5LVAA 3VNBA 1JR2A 3GLFB 2BM9A 3AZQA 3U7QB 5D1HA 4FGLA 4JL8A 3HPRA 1GR1A 1N5JA 3FYUC 4HH0A 5G4KB 3MGGA 3LX6A 4LZPA 1XRMA 4EG7A 5I8PA 1NHWA 1AG9A 1IHDA 2FLKA 2BKVA 4I55F 4Y2GA 4BS9A 5CEFA 3IPXA 4QSMA 1W6UA 3F67A 1H2ZA 4PX9A 3SICE 3ZU5A 4EFDA 1A9OA 1OH7A 1RTKA 4NJEB 1MABB 1Z45A 1R8JA 1I6KA 3FHOA 2WQ6A 1NOKA 2B0JA 1OH6A 1CT9A 5SY6A 2G7ZA 4Z8YA 4M1ZA 4U3JB 3QG1A 3VKHA 5EUMA 1TO1E 1JEEA 3W5UA 1FNDA 4HH3C 1IK6A 2C7GA 1H2XA 5BQFA 3AI3A 1U7ZA 1NQAO 2E2WA 2RKWA 3GGSA 4ER7A 3O3MB 3RWMB 2FJPA 2JBAB 3MRTA 2P0EA 2ZYIA 2LRHA 1J2RA 1SU7A 3VYSB 4EJ6A 1O89A 2GK6A 3PA8A 4YP1A 3RC2A 2IZ5A 4K9DA 2RAPA 1L5HA 1AK2A 3VR5A 3AV3A 3ZE0B 4C14A 4Z5DA 2NU6A 1YSEA 2IUYA 1TGYA 4W5OA 3ZDQA 2AX4A 3ZZUA 4KX5A 4E70A 4DSNA 1P60A 1TCUA 2REBA 1P5RA 5C1OA 3E9EA 3ZEIA 1KEVA 2ODRD 1PT9A 1H1LA 1NMXA 3WI7A 3U44A 4CEHA 1PTKA 4LBYA 2EV9A 3CLTD 5CDFA 2QAGC 3FDFA 3UJ6A 1I2AA 5HUQA 2KE5A 3M6MD 4BQEA 4GPAA 3DD5A 2N46A 1NVGA 3GEGA 2TMKA 4CU2A 4ZGBA 4JI0B 1SMKA 1ORWA 1XWIA 4XFJA 4GHJA 1BWQA 4C0HA 3ZS8A 2CNNA 2MSEB 4HH4A 3TR5A 3JQAD 1YCDA 4E51A 2M9MA 4F2WA 3NDRA 4IOMA 5IHXA 4RIGA 1XWWA 5IS2A 3E7XA 3ZD6A 1B73A 1KEPA 5DHQA 1ZZ6A 4TWRA 2VI5A 3IUEA 1JL3A 2JCXA 5IULC 1N2XA 1RCTE 3FIJA 4ON9A 2XVMA 4X9XA 1U0NA 1DIGA 1RBMA 2XSZD 4BFUA 5KYWA 1TMOA 3FMFA 3R6WA 2V45A 3VO8A 4ZMSA 1FPQA 1QHEA 3OOWA 4G41A 4LYJA 3KJGA 4X44A 2W2VA 4H6XA 4A8TA 4E5PA 4NE7A 5LQRA 2VF2A 3DM5A 3NFYA 1UJCA 5BQ5A 4DLXA 1HKHA 3JPWA 3R9XB 4PAOA 4NPAA 1N6OA 3H19A 3SN6A 5KWIA 3DZIA 5FNVB 5TQ0B 4EBBA 4AICA 3IOBA 4E3ZA 3D2AA 1IZZA 4Q15A 4B2PA 3LC1O 2PXKA 4I4TB 1NPTO 2NAPA 3BWMA 3RS7A 4DMRA 1WE2A 4V0NA 1HEUA 3O0DA 1QAOA 1UPUA 4PN7A 1WBDA 3D6TB 4HDRB 3ASYA 2W71A 4M1EA 3FVQA 4G5QA 4R9UC 1NY5A 1LF0A 3QU7A 1Z4MA 2FPIA 4OP1A 3WZLA 1PGJA 5TY0A 1W59A 2IVQA 3SYLA 2B4QA 5I5EA 5JJLA 3EIHA 3HS3A 2NPOA 4CTMA 2EQBA 5A4MS 1SURA 2F43A 4XX0B 3IAEA 2ZRMA 2FWJA 2XUFA 4M0DA 3A0RB 3C3WA 1KI7A 2ERXA 1ZNYA 1IQPA 1T1SA 2GOYA 5CB4F 4UBLA 2Q2OA 4LFCB 1P7CA 2M1XA 1XD2B 3SSAA 1D6SA 4HO1X 2JFVA 5HE9A 2RH8A 1NC3A 4Q9LA 2QN2A 4EGSA 2IP4A 5CK4A 3DXFA 5JXJA 3JQCA 3DLPX 2YS7A 3HYRA 4XIFA 2GXSA 1EVIA 3A1CA 2ZUTA 3R6DA 3FNFA 3JD3A 3NORA 2ZBEA 4KQ9A 2BMDA 2H48A 4JLSA 1JDSA 4RD6A 1BD3A 3RFUA 1ZUWA 3GJ7A 3H2YA 1SKMA 3BKWA 2GN9A 4ZIRB 2WAOA 4INAA 1Y1RA 3OE7D 4I1OA 3B3JA 1AHNA 4DC1A 3MGBA 1KDTA 2BY4A 1CWUA 2QL6A 5LXTF 2I62A 4TPKA 2HWKA 1E98A 1M8FA 3UYLA 2VRNA 2BGMA 3LSTA 4JJZA 4CDNA 4TUYB 2PXBA 2YHAA 4UXJA 4DAOA 2VNIA 2QN3A 1RABA 5HMMA 1K9VF 4X1YB 4MS1B 3CGWA 4QGGA 5L51A 4G1FA 1CK4A 3EXIB 1WOYA 1ZGCA 3IUPA 2QRVA 2WE8A 3V8BA 1Z9BA 1EP9A 3CZ9A 1GD1O 4K3UA 3GY0A 5LD2B 3CPEA 3GDFA 3WLLA 3GZTB 4U9IS 5FPKA 1X7XA 2OQ2A 3GVPA 2MEZA 4Z5HA 1CUWA 3A4TA 1TFRA 2DU8A 3OA2A 1BVYF 1NX9A 1W35A 1ULHA 4R1UA 1UOQA 4B79A 1N6KA 1SJ9A 2Q8NA 3A0UA 2GCGA 4B34A 1R9MA 4YQEA 1O4VA 5IAKA 3ZV4A 3AEUB 5BNTA 1GTVA 3LT5A 2GDJA 3VR4H 1V0JA 3MWEB 4J1TA 2PV7A 4NDZA 4PN3A 5EZ5A 2OXEA 4Q5IA 4WNAB 1U0GA 3DDSA 1VIVA 4MGIR 4RIHA 5EP2A 5I45A 4X66B 2WWIA 1R6XA 2PU5A 3LYAA 4OCZA 4D8UA 4BY9E 2BMWA 2MOKA 3KFVA 4TSRA 2FFAA 1J8YF 3KAKA 1KJZA 3QELA 4IVNA 3IS3A 3D6HA 4MGYR 1PZEA 2OHFA 4O5AA 3AKZA 1XZAA 5FOVA 1PGNA 2CHEA 1HSZA 1GA1A 3NYQA 1MEOA 2FEWB 1KGDA 3B82A 3DW1X 1I4DD 1JZSA 3ZE2B 3S6JA 5EXSA 1KDZA 2PX8A 2R86A 1EPUA 1U2EA 2DVMA 1RPEL 3A6PC 4TM7A 1I80A 4EZIA 5JEEA 1SKBA 2GHTA 4PLCA 1V7PC 1VHQA 1J06A 4CQMB 1LJLA 5D5PA 1BCRA 2PCJA 2F3PA 2KLBA 5ALQA 4ZMBA 3MA0A 2WJHA 4WLVA 2OD7A 1W52X 4ESHA 3B5JA 1U5CA 4RK5A 3EULA 4ZI5A 1M6VB 1L5QA 4ZYZA 2FZWA 2PTHA 3HZOA 4BX9A 4E11A 1OXSC 2WJZB 3ZLBA 2J08A 1OAAA 3K9WA 1M8KA 3PFIA 1DEOA 4URHA 1YI0A 3QJYA 1CY1A 3AI1A 1N5DA 2HFZA 3THXA 2A6CA 4MW1A 3A9SA 1UKVY 3BCUA 5DYIA 1KMIY 1PV4A 1RPJA 4Q4DA 3NALA 2V7VA 1QH1A 2FK8A 4AJ1A 4NEHB 2HMUA 2WB2A 4MH0R 2WD7B 2YY7A 3L6CA 3LI2A 4AN1A 1AKYA 1D7AA 3NWEA 3R5KA 3EHEA 2AW3A 2I5PO 4WZBE 1NWCA 1J2EA 3B53X 1CUZA 2G83A 3ESQA 3V8MA 4HUQA 1XUOA 2Z2XA 2HK8A 2VRWA 3WZ2A 5FUVA 1NSTA 2HREA 2VQEB 4QXPA 1XTJA 3O4IA 1L7VC 4M49A 4R81A 4DR3B 4XYEA 1E4EB 3PKZA 2HK9A 1U5BA 3OKZA 2B21A 3BMCB 3L9WA 4Q19A 4E94A 5EL0A 2A88A 2AE1A 3FNIA 3RFVA 1Z2AA 2D5AA 3ZHXA 1ZCJA 3QI2A 4JUDX 3S29A 2I71A 2AUMA 1NVVQ 3HCWA 4I0WB 4B35A 4LPSA 3FYCA 5FTJA 1MNQA 3E3LA 3JRXA 5EJ6A 1E2EA 1NJ5A 1Q0PA 3UA4A 2WTBA 4OAPA 3FYAA 2Y68A 1RYNA 4F2DA 4GF5A 5ALPA 5U4XA 3LRXA 3KYCB 4L9AA 4S1VA 4BV9A 3GJ6A 1OWOA 1PR0A 2GD0A 3AFGA 4BIMA 4D57A 4NXNB 1N33B 1OQAA 3CIOA 4OGFA 1N1DA 1X7WB 3E9DA 1QVAA 2D5BA 2R97A 4MQ4A 1P1BA 5B37A 4CVNA 2COKA 3FWKA 2QZ4A 4B81A 5BPFA 2CL6X 2ZRBA 3RRJA 5H3HA 1GRVA 5IFLA 5BYAA 3EASA 2JANA 4YJ2A 3PTZA 3T52A 1DI0A 5EJMA 2BFPA 5BYJA 4TSFA 3I1JA 1CZLA 3PUVA 5C4GB 4J29A 4B4DA 3FFAA 3PIIA 5L9AA 1WDMA 5AKLA 2GRUA 1AUPA 1E1MA 1UFOA 2AB0A 3E81A 3KCNA 4MO2A 3EZYA 3UIEA 3OEEA 1LPSA 1EIWA 4TTIA 1V1RA 1C2TA 2FPPA 4ZT7A 3Q9NA 3OD5A 1JFSA 2PA0A 1ZGAA 1AGNA 3GI1A 4LXGA 3GGCA 2IBSA 5TMPA 4F97A 4XE5A 2I1VB 2X7JA 1WVMA 1Q91A 2Q0QA 1R6BX 2Y1FA 4R83A 2OBXA 5LMUB 5AK0A 2WFMA 1J07A 5B1EA 1N5OX 4OI0A 2G9NA 4FT4A 1P6UA 4G4SP 4I5EA 3SQWA 1VSTA 2AD1A 2ACWA 4NK4A 1E5LA 3UMJA 1E6CA 1PNQA 4C5CA 2AKEA 1GZUA 1OBVA 3QYAA 1FP2A 5KTTA 4F8EA 2AUWA 1U2ZA 3W4IA 1N2HA 1TW2A 1GPDG 2CHGA 1AZLA 2O2YA 3O73A 4AF7A 1RACA 2QSJA 1HNNA 3OLVA 1KDPA 3X1WA 2CLHB 2CL5A 1VQ1A 5KTOA 2P2CA 4P1ZA 4FDMA 4OHWA 3WYAA 1BS9A 1Z6PA 3U26A 3ZGXA 2VK4A 1QO7A 1E62A 3C6BA 3RU7A 5BY2A 4JVOA 1RM3A 4RWZA 4TV8B 1FP7A 2W6PA 2ZBRA 4CIVA 4ZYWA 2IHUA 5DLEA 3AETA 4NZYA 3W79A 4M7WA 3UTDA 4EGJA 4I1PA 4PFKA 5JXIA 1LNZA 1KQPA 3EEQA 3SCHA 3DMNA 4DJDC 1EZ4A 2B5WA 4MVJH 2ETXA 2IXAA 4HXYA 3OZFA 4HWTA 4XSHA 4TTJA 1E1KA 2BFEA 3N2NA 4WCFB 5E4JA 4AO6A 2BTOA 3U62A 3WL4A 5FBVB 3ZYZA 4JJ7A 4FZRA 3UJ8A 1N6NA 4OOFA 3DFZA 3VTZA 4Z7QB 3CGGA 1V41E 1D03A 1TX4B 1NW4A 2YFQA 3ITNA 4P98A 4UTXA 4ZZ3A 2AVNA 2VSNA 4Q1EA 3JXDL 5B55A 2VTDA 1OYVA 1CUCA 2J4DA 1GPJA 4BB6A 3MM4A 1QO0A 1C7QA 1JDPA 2HHCA 1AKVA 1G9XA 2AG1A 1AHIA 4WESA 1JJ7A 2W2NA 3JQDA 4AKHA 4DC0A 2YFKA 1J1ZA 3ZDFA 1WPRA 1KDOA 1HOTA 3FGOA 5GZ6A 1W0JD 4LNHA 1GTSA 5A3RA 1WF6A 3GL9A 5ADVA 5ITZA 2Q4DA 1L3IA 2AV6A 4AY6A 3ANNA 1FRFS 2BGUA 2XUAA 3LQFA 4ZRMA 1M54A 4ZVNA 1PDVA 3LG2A 4FGJA 3G9XA 3WO1A 2O57A 4C0LA 1Q3KA 1S1CA 3VVBA 4RTRA 2QUHA 3QMPA 3KALA 2TMYA 2GPNA 3RUDA 3ILSA 5KBYA 2YR0A 3V1MA 3H9QA 4L07A 2YV5A 1C41A 1HYGA 1XQ9A 2QM8A 4MP8A 1CQIA 3SVTA 4TZ6A 4XB1A 4CF5A 2CVQA 4WOCA 2QTLA 3DVAA 3LUCA 4K26A 2X6RA 2YQ4A 5B3JA 2PMWB 1QRSA 2BDUA 1KVUA 2W00A 3DJFA 1JSCA 3T9EA 1Z25A 3AFHA 2WT9A 2J7KA 3NX4A 4J1SA 3AEKA 4EKEA 3OWOA 2FOXA 4B46A 2VPIA 1ZPDA 4PC2A 1O4WA 4F2HA 1SXJC 2A4MA 1ZUGA 5EXTA 2EQAA 1E3WA 1AE1A 4ZU1X 3IIMA 2UYQA 1TEXA 2V6BA 4MVJP 3RBZA 2QBYA 4BXOB 1GZ4A 3C3BA 4J9UE 2G07A 1ODTC 1F3LA 1D6MA 2IT1A 1ZUHA 1KZ7B 3F2VA 4KWEA 4Q3EA 4EPYA 5CFZA 2HDOA 3AVOA 1P5HA 5HILA 5AW4A 2JJ2D 4J76A 3SD7A 5BSVA 3L0CA 2WSMA 4NOKA 3NM6B 5C8DA 3INTA 3WIOA 3EZXA 3KT8A 4PYLA 3WV4A 5J43A 2AIRA 2C0QA 1FU7A 3TTUA 3WHKA 3R3VA 1KC3A 4LXHA 4AYTA 2EF8A 2GAJA 5KKNB 5KNBH 4X4FA 3NTRA 4LZNA 5GAJA 4BFZA 5J2UF 4G3XA 3ZGVA 5FTNA 1WUYA 2WEKA 4PAGA 1ZL0A 4TYNA 5CNIA 2WM9B 2C84A 3LPLA 2DFLA 1RFLA 2O48X 1NSFA 2D3TA 2W43A 3CNOA 3CUUA 4IFTA 4U7JA 1WPQA 1LKZA 4U6SA 4YHBA 1VP3A 3A6EA 3KR9A 1T8SA 4FR0A 2J87A 3CPSA 1QK5A 3EDYA 1IEQA 1MABA 4JCYA 1JG7A 3HXKA 2ZG6A 4K6KA 1AF7A 4L5CA 5AKIA 5DNWA 3TIVA 2X1HA 1CG6A 2ON6A 4LDZA 2O38A 4RE6A 2QMEA 3SAJA 2AZXA 3NNDA 3NH9A 3K1TA 3F51A 4BN4A 3ZVRA 3NZLA 2BFBB 1KIMA 1VMKA 4ALNA 4MKHA 4D3FA 1SHZA 2ZT8A 2ZYVX 4KXVA 1BKYA 1BS2A 2DHCA 4CR8A 3MWGA 5HG0A 4B82A 1AKNA 3R3HA 1P9LA 3LQ4A 1EJ0A 1DRUA 1YZFA 4EDFA 2DGDA 4EQ6B 2EU8A 1X7GA 4HZIA 3BE4A 3N7AA 4FYVA 4X4HA 3BL5A 1ISRA 3KTOA 5I7RA 2PO7A 2YZGA 1T8YA 3HCNA 3MJCA 3RAGA 3DTYA 3UH0A 2P35A 5A4JA 1KOFA 2HCBA 3KQTA 1JDVA 4HZGA 2QR5A 3DULA 5ABPA 3J81A 1HC7A 1V43A 1XN4A 3SCZA 4D79A 3PC3A 1PRUA 1ODSA 1KSHA 3U44B 5IC6A 1I3MA 2WAXA 4PZPA 4AC9A 4PYJA 5JNVA 1ISFA 1ZD8A 3R5SA 5GV7A 1JA9A 1I30A 1LU9A 2RAVA 4S2EA 5GINE 1Z17A 1LY1A 3O2JA 1USUA 2IPNA 4GX1A 3GLIA 1MA0A 1XPJA 3HVIA 1DAPA 5GV8A 1L4FA 5DX1A 5LZ7A 4DUGD 5KNCD 1USGA 1OFGA 2G67A 3M3PA 3WDKA 3BWBA 2C2OA 4PQRA 3PUXA 5TGTA 4DN6A 1T1EA 5IU6A 1GL3A 2AG8A 1CUUA 1L8XA 2E5WA 4IDEA 1NFQA 4WZBA 3IALA 4MUBA 5CJ2A 4EP1A 1OXXK 4F96A 1OTHA 2IUEA 1YDFA 5JC8A 2LP4Y 4DLSA 1IMOA 3UK2A 1PI3A 4EG1A 3IA2A 3ZHOA 1C8LA 1G7SA 1CS4C 1PTJC 2WR8A 3CZQA 3PC6A 1T5TA 4DSUA 5G1OA 1C4OA 3IMGA 4TRNA 2Q7DA 4GSYA 2Q6TA 4BNMA 2G9RA 4UEJA 3LO5A 3N28A 3B3AA 3C48A 4X84A 3OVMA 2Y1OA 4M99A 5HRUA 2V97A 4W9MC 3YASA 3NBAA 2FEPA 3IKJA 3QW2A 1M34E 4G5HA 3WGKA 2A3NA 4P5DA 4W5WA 5A06A 4MQLA 4WBNF 5KSOA 4EO9A 1YZTA 1BQ4A 4QT0A 2C2MA 5ETJA 5JMPA 5T41A 4ZYXA 1H9AA 4W9NA 1VDZA 3E8MA 1T5SA 4ZQIA 5LNK6 5FAKA 4JQCA 3KLPX 2KS6A 1HOXA 1HPLA 4PQFA 2G9UA 1LV7A 5JCPA 1XKQA 2ZI5A 1JAHA 3D8UA 4OP2A 2JFHA 4IHJB 4LVUA 4XTCS 1U4NA 4N3AA 3B52X 1UODA 3H11A 2AN1A 3R5FA 4KGZA 2YZMA 4IKOA 4K5QA 5LP6C 1O96B 4C6RA 1AU7A 1T9KA 1XRLA 3AUUA 3F6SA 4KR2A 2AJTA 4QUKA 5ALZA 4X4DA 4UTOA 2AXZA 4MDYA 2HPVA 1Y89A 4EATA 3C3YA 2EYUA 4FWTA 5LYJB 4YUAA 4KW7A 2YJNA 2NAFA 4A8JB 4BLQA 3BGOS 4QNMA 2NV2B 2CXPA 4XWTA 5JZBA 1GAWA 2W93A 1J21A 4BC1A 2OXIA 3ZHQA 1C9EA 2ZATA 1ULTA 5CDHA 3BJIC 2CXNA 5LMCA 4DSAA 2ONKA 5CX1A 3H9JA 1I33A 3TAUA 1YUNA 1RXSA 2B9EA 3U40A 3HHPA 1WV0A 2CVPA 1GEEA 3ZHTA 4HAIA 1P9RA 3BIXA 2SKDA 5K2MA 1BH2A 3LBHA 4MMYB 3AESB 4EYQA 1KNXA 5KDDA 1KQFA 2GA9A 5AK6A 1GQRA 4WFQA 2IHYA 1D2NA 1E64A 2WV7A 1HFEL 1G20A 2MINB 3OIVA 2ZWMA 5IAOA 3LVFO 1Z5PA 1TA9A 2Z08A 3JVVA 4I5FA 4IHJF 3UG7A 3DHYA 1VSQA 4FDUA 5K8IA 4PVDA 4BTVA 2UAGA 3OUUA 4GOKA 4PLTA 4WCFC 1N5MA 2NXWA 2ZS9A 2GETA 4H9GA 2ZU6A 4MS3B 1GSHA 4P4GA 1FSSA 1LA2A 3EXHC 1PJ3A 4AMVA 3C3JA 3CJRA 1EI9A 3HUFA 1VKZA 3PPWA 4PZYA 5SZHB 2J46A 1KFCB 3REQA 3ICPA 2ZQ5A 1LJUA 2LBPA 3W6NA 2ORVA 5CG2A 1B16A 4FFWA 3C24A 3DDOA 3IPCA 4CR6A 4BVKA 4EL0A 3WLRA 4Y6SA 4U0KA 3BMNB 4Z6KA 4FMDF 3F7MA 1ZJJA 3M6LA 2V7EA 2YMQA 3M83A 1ITZA 4NEGA 4EX7A 1B6RA 1CQIB 2R4TA 2BP7B 3HXTA 3HVJA 5K51A 4B7ZA 4X90A 2PKQP 3LNTA 2EJBA 1JFFA 1MO4A 4TS3A 1TO6A 4C0XA 2PLFA 2R63A 4HSEA 4EI7A 3ABIA 1ZN8A 4YJ2B 2D5CA 3ZBTA 1Z6QA 3T1TA 3L1UA 1FB5A 4K9RA 3WYEA 1FVOA 4WBXC 4D41A 4XM2A 1UXJA 2G6BA 3OOEA 3WL8A 1V8OA 5FV4A 1KKMA 1ZJ5A 2Z43A 4KMRA 3WLIA 3QUTA 3ZWWA 2CZCA 4PYOA 4XQEA 1E0DA 3L2OB 4WZ6A 4EELA 2J3EA 4MW5A 5BSRA 3X1JA 3HH8A 4FOSA 2VDWB 4E5SA 1NJFA 1N7IA 2AMLA 2I76A 2KSQA 2OCDA 2QYSA 3DUFA 4I4LA 4C76A 1JG6A 2PGLA 3U3XA 3E3NA 4V2IA 3X2FA 4CL3A 4PICA 4URUR 5F3RA 4LDRA 1KEEA 2ZETA 3KYIB 3QKIA 1SD2A 3W3AA 2I34A 2X8BA 5GMOA 1T6ZA 5CFQA 2FSHA 4ZYTA 4KIWA 1SHTX 4JJ4A 4RFSA 3S8EA 1T24A 2F3RA 5JADA 2GAFA 3HXLA 3NGXA 1AA6A 4H6WA 1SOMA 2VYND 3MUOA 1UR5A 4QUAA 2VP0A 9LDBA 1JLKA 2O0JA 1I01A 3JARB 1HT3A 3G8AA 4HN9A 3UA3A 2UUCB 4RAQA 4JI5B 1T2FA 4B2LA 4RELA 1BHSA 1NNSA 2ZYGA 3VISA 1TPZA 3D5TA 1GU7A 2FAXA 3K4HA 4HB0A 1ZK4A 3P2KA 3CE9A 3QTLA 5CB4A 3JVDA 3M8KA 4FFMA 2RMKA 3ZI0A 4MQMA 3KJZA 2ZE8A 4BGVA 1FRNA 2XQIA 5DTEA 2PBRA 1CUVA 1VG1A 2BCGY 4GXTA 4NCNA 4NATA 1QTQA 1B0ZA 4GLLA 1Y42X 2C03A 3CKMA 4N3BA 3WAGA 3DGEC 1ODKA 1QBGA 1QK4A 2XNDA 1SUBA 3HNRA 1SUWA 3B6MA 1XELA 2QV0A 2WU4A 1IJEA 1C4XA 1FXWA 2IY8A 4GPIB 4NMWA 5HF6A 4BLSA 4RF2A 2AHRA 4C2AA 3ZJYA 4EKNB 1ESNA 1TQ2A 4IQ0A 1CY0A 3D7NA 4F86A 2EKZA 5LQUA 2VJMB 1N5KA 2XUQA 3P9IA 1SCKA 2XMBA 2XVXA 1H4SA 2CXUA 1WTCA 2CEKA 1EM8A 1M2GA 5GPBA 2O2EA 4MKXA 6REQA 4IDOA 2R8BA 2O2CA 5ERGB 2WJVA 1FZQA 1M1NA 1Y1PA 5CH8A 3DQQA 1UBHS 3HADA 1EK1A 2O4UX 4RSGA 4BE7B 2CBGA 2VPXA 1KMHB 3N58A 2MHCA 4N5IX 4A7PA 3ITKA 4GZ5A 3E23A 4RLQA 2VDQB 3D6NB 4IS2A 4GZLA 5CIQA 1TECE 3DEIA 2I7XA 2Z2KA 3IT0A 4GBGA 2AYYA 4MLZA 2JVLA 4B3BA 3H1TA 3VPAA 1NL3A 2IW1A 1VA4A 2P9JA 1MA3A 5H81A 3DBHB 3ZTTA 4QPCA 4NS1A 1NEQA 3G5GA 1QHNA 5G0SA 3WSWA 4DQDA 2HSJA 4PU8A 2Q4RA 4K05A 5DGCA 3K71B 5AW6A 1MG0A 1O3YA 3N2ZB 4AX4A 3MLFA 2NOAA 4DCUA 2JGLA 4P4SB 3DMTC 3T0FA 2HWWA 1L5HB 3TDMA 4PG6A 1XTIA 3VX3A 5G4KA 2GEUA 1RS0A 5TVKA 3H8SA 4NBWA 1JHMA 3AEZA 1Z0DA 3SS8A 4RVDA 2EVWX 2LTAA 5ELMA 3DL0A 1DIRA 3ZVMA 3KKMA 4ETWA 2Y1WA 4UUMA 3T3NA 4JH0A 3DXXA 2P9ZA 1XZKA 2OZPA 4G37A 2HQSA 2LZ0A 4DAEA 3IAFA 4ZU6X 2HMAA 5A0FA 4E12A 4V1CA 5EKSA 4QYXA 5AJTA 3TIGA 1KI3A 4IDGA 3ZI7A 4BNFA 3BWEA 3DLAA 1QHFA 3CQ9A 1ULUA 4RDHA 4J49A 5AHKA 4DGSA 4A91A 5J3JA 4ZRDA 1HF0A 1R4NA 4BE4A 4KZKA 2MT9A 1ATIA 5I5GA 1V6SA 3W5CA 4ESEA 2B4TO 1SBQA 4WQMA 3BUSA 5B3LA 2FMKA 4LMAA 4DT1A 4C0JA 4MZDA 1C7EA 4IL5A 3DWEX 4CM6A 3RUCA 3CVXA 1IMJA 3IUBA 2C4UA 1V48A 5JV5A 3IT1A 1P1HA 2C2BA 4BMZA 5KYVA 1P44A 1CJCA 1VL0A 2Y92A 2B36A 3QE2A 3KTFA 3NIFB 4XCXA 2B1RA 4XGKA 5F3WB 3OZEA 3VR6A 1V6CA 3TCNA 1ZMBA 3CRNA 1HT0A 1X86B 3Q85A 1QP4A 4G5RA 3AF6A 2W2QA 3A4IA 3M6AA 3FPCA 4XDGA 4CIWA 3L7AA 4ZV9A 3RAPR 1C9JA 4M8NE 2X76A 3SFZA 4GLJA 4DMLA 5IJ0B 2FJ0A 5JRZA 2I1QA 1H9BA 3H83A 3T38A 2HQBA 5HDQA 1Y1TA 5B58C 5A2QA 3CX3A 1ICEA 5LYJF 2O8FA 1NDQA 4O4HA 4WKBA 4ZO8A 3WJAA 2WYWA 4I5GA 1DADA 2YNMC 1LQCA 3HVHA 4NE9A 1UMBA 2QUZA 1DEAA 4GGOA 2R8ZA 2E4UA 4MCHA 2CWWA 4QQRA 4A23A 5A5FA 3KQNA 3C98A 4J94A 4OKNA 1O96A 1H0SA 1C7RA 1UZUA 2G76A 3LP8A 4S1WA 1L5VA 2H08A 4WESB 3L04A 4C21A 1FIUA 2QZ9A 1EMDA 5BMVB 1Z16A 1YACA 1A5AB 5HCIA 1LW6E 4GU5A 5FLEX 1O97D 2Q07A 2NZ2A 3SBDA 3PZBA 2HWXA 2VF4X 5SV2A 2K7ZA 2XPCA 3VU8A 2E6KA 3D2CA 3WBJA 4AO7A 4CLHA 2GK4A 3GQVA 3OY7A 2DMRA 1XHEA 3V3TA 1ZK1A 2JAXA 3F6YA 2ATCA 1YR8A 4QM6A 3ZDEA 2HSWA 4NKRA 2O3QA 3OPYA 2Z6QA 4R3WA 4B7XA 1QB8A 3HUEA 1U65A 1JQBA 2BELA 2LWIA 3M9XA 3N8IA 2OZEA 3OQ6A 4JUCA 4Y9UA 4Z4IA 1Z22A 3AINA 4FFDA 2PPXA 3MIZA 2J9RA 3N53A 1YS1X 3VO9A 3AL3A 5IF3A 4M1SA 1JE1A 1HLPA 4LDNA 2QX9A 1ANKA 1PR2A 3LYLA 4IJ6A 1PX0A 3AUAA 3CFYA 4KVGA 5DHUA 1JKMA 5FJIA 5BV1A 3RADC 8MHTA 4QVKA 4BDSA 1PRYA 5CBKA 4AZVA 5K6AA 4FBIA 4G67A 4M87A 3RTDA 2C4KA 1ENPA 4GKJB 2XNJA 4RF5A 2X4LA 2C8KA 3PXXA 3QPUA 1QORA 2VJDA 3TQOA 1WLYA 2KQUA 3LKDA 1SU6A 1BA2A 2X58A 5B53A 5IM5A 4X1YA 1Z2OX 3CHYA 1CS0A 1SA0A 3H5VA 1X80B 2GERA 1JAIA 3PQFA 5J4LA 5BMVF 4F12A 2C1EA 2ZBVA 3JPYA 1Z38A 3GRCA 1L5ZA 1PFWA 2CCKA 4JVMA 1XZEA 3ADCA 1T25A 4QUGA 5CNMA 1GGNA 1CFZA 5JXGA 4HDNA 3TTVA 3EIOA 4RZUA 3VSAA 3OFSA 1NT4A 3RRYA 3RNOA 5EKDA 5ISMA 4QODA 1N5LA 3D6VA 3ZGLA 4CGZA 2YHSA 3P4YA 3D5QA 5ALXA 2JBHA 4AP6A 3HBNA 4XLTA 1Z7BA 1W25A 4IGKA 4OBBA 4A8JC 4N1AA 4E31A 2C04A 1L1RA 4TWAA 3RVNA 4FXOA 1V1RB 3F73A 1FP1D 1QFSA 4OK3A 2R6R1 4TLLB 3WLHA 4IAOA 4FNGA 2PD4A 2VT6A 1U2DA 1I7SB 1WH6A 1IHXA 5HNKA 3QKUA 1P80A 1TB4A 3DOEA 1DC7A 2DUNA 1T2AA 3I64A 5DWQA 4MJXA 5EJIA 1SOVA 3UXHA 3R7SA 1VJTA 3GOQA 1G4HA 2P62A 4KXMA 3ZDYB 4F84A 2JGKA 3WK5A 4B6SA 4G0XA 4MV1A 4PG5A 3SLKA 3B12A 3R44A 4IW3B 1EFPB 1XFDA 5IXYA 5IWAB 5CCDA 3H84A 5KX5F 1SQFA 1GL9B 3B85A 2F17A 3NEPX 1PJ4A 4BNGA 4U0JA 5CT9A 4YJGB 5CW1A 4DRXB 3GAZA 1JDUA 2A58A 2FP4A 4KIGA 7MHTA 2I80A 4ZVMA 2GN6A 2CZGA 4REOA 3QYXA 1CB0A 3FI9A 3SDBA 1X6VA 4DTIA 5EJ7A 3AGPA 3NYIA 2VJAA 4KLAA 1CVLA 1QZUA 2WV9A 3OIDA 1Y33E 1YKSA 3R0JA 3VZCA 1GZ7A 1BQEA 1H42A 2E4XA 4KMSA 2EL9A 3FLAA 4CG1A 4CV3A 2AKAB 3Q1LA 5HS4A 1SZJG 1AB5A 1PN3A 1YHYA 2I6GA 4ER6A 3QUAA 4PZAA 2QG9A 3E03A 4O4JA 5DV9A 5JAUA 2Q4BA 4Y1EA 2D4HA 5B30A 4DWJA 1X42A 3D8HA 3ZDDA 4R2MA 5ALGA 3ZCRA 2P4QA 3HYTA 5C7IO 3RV3A 2DPGA 4A8HA 1ARZA 1FBNA 2JCSA 3ND7A 5LQSA 3WRVA 2AH5A 4XLLA 1CDDA 2V7XA 3HV2A 4Z1OA 4PPGA 5MFZA 3L7MA 4B8WA 3DTNA 1I0LA 4J6FA 3PT9A 2B35A 2DECA 3H7AA 5J63A 3AK4A 3ID6C 3O4JA 5JWRA 2P8JA 1B41A 1LLDA 1KF0A 3BH6A 3EODA 2GUWA 4HFJA 5EEHA 2OTCA 1L7EA 5MF6A 3L6BA 2PU7A 4EA8A 3F2IA 3W9SA 2XHEA 3MGAA 3OEED 3ABZA 3GPBA 1RHKA 3LFHA 3M6IA 3L8EA 2QJTA 2DHQA 2XGMA 4HC4A 3B5EA 4JQYA 2W8ZA 1Z13A 5TE9A 4RVGA 4DZRA 4B6QA 5FQOA 1YB5A 2QG6A 3MWDB 3NKFA 2NZWA 4G24A 3BWXA 4QUBA 2F43B 3SR0A 3RYTC 3W5IA 4B3MB 1JFLA 1N6PA 2WIDA 3NO4A 3OU2A 3PQ2A 1YB6A 4D44A 1RP1A 2DERA 3U48A 3K35A 3RTBA 3W2EA 3T06B 4IXWA 2O07A 5JJKA 1IHPA 2P2GA 3VSCA 1I6LA 4U6NA 1DQSA 1U9IC 1Z88A 2FSFA 3NIGB 4JD5A 2VJQA 3H1PA 3G7DA 4Q3LA 4Y2TA 4EFLA 4R2HA 4KVZA 1HDIA 4QASA 3DBRB 1I94B 2EFGA 3FWZA 1G16A 3FXAA 4OGGA 3E5HA 1EUYA 1E2IA 3QJ5A 1XMPA 1Z6YA 5DIZA 3RGWS 1GTL1 2KI5A 2A4KA 3GT4A 1E5DA 2NYUA 2CV2A 2JJ1D 2IL1A 1Y7TA 4CRWB 4FS8A 1HYHA 4HTAA 3SXUB 3UYKA 4C6SA 1KWGA 1OFUX 4BBJA 1JYFA 3ZZMA 5JROA 2AA3A 3PXAA 4F9TA 3ANYB 4BLVA 1B3RA 3VHXA 1G5HA 3TFWA 4JP8A 1W48A 4KGDA 2C3OA 2G82A 3F96A 4XARA 5DSXA 4KR9A 4A0FA 2P6MA 4Q03A 3DOCA 2FCRA 2ZYHA 4H1TA 4LAFA 4MW0A 1GPNA 3RIGA 5JC1A 1KZ9A 2JLBA 1XMJA 1PFYA 4I1IA 3IIEA 3IAHA 3RS4A 1DLJA 4II3A 2OPBA 4MQEA 1VPEA 3WQRA 1J7KA 2IEGA 1MJ5A 3DO8A 3U4MA 1KAMA 2WSIA 1OROA 3N2YA 1L7MA 4MWBA 4OREX 2X9NA 3L7KA 4ME6A 1SVNA 2IDJA 3NB0A 2UV8A 2WTXA 2P6RA 1ZPQA 1YL7A 4ZVVA 1XVIA 2HUPA 3A4NA 1H0KA 1MP0A 4TQ9A 3WIVA 1YDWA 5JUWA 2NXEA 4M1YA 1N5IA 2QX7A 5CR9A 4B3JA 4DJJA 4E7PA 2H65A 3HLKA 1MX9A 4HRXA 4Q9JA 2VPWA 1QO0D 3LLUA 5LQCA 2N9UA 4CQJA 2JFWA 3M1LA 3BK7A 2J9YB 1Y7LA 3KPJA 1OWPA 2B5VA 3EH1A 3GBFA 1OLSB 1T8RA 4FDLA 1HURA 4WI1A 2ZB7A 3EGCA 4C5AA 4BB9A 3CRQA 2LD4A 1TZBA 3LX5A 4LJSA 4HFRA 5DYGA 3DZCA 3INGA 5IG2A 1FFCA 4OGLA 5CU7A 1XKTA 1ZM7A 2IRWA 4HATA 1I7DA 1BEEA 2R11A 2VPQA 3BTOA 1T43A 1GZHB 4M1MA 1F8YA 4KFRA 1V39A 2IH5A 2HB6A 1LLQA 6ABPA 1FMJA 3KOZA 1XNJA 3BJEA 3G3EA 2Q6KA 3C3AA 3N8HA 2AS0A 1GXSB 4FHZA 3SHWA 5JALA 1E7SA 5FEMA 4N47A 2O14A 4YR9A 2O0MA 1PTJA 3BRWA 2ZIZA 3QE0A 3GT3A 3QPWA 1K5PA 2ZIGA 2BGKA 4MYCA 4GI5A 4QGSA 2ET6A 2QX6A 3CX4A 3OU7A 3ZWPA 5BSUA 4AUKA 2A2ZA 3BA1A 2BYTA 3O9VA 4ERXA 2JGMA 1S9HA 2VT7A 2A3RA 4PX3A 3DFUA 4RADA 3BZBA 2CUTA 2OK8A 4L4SA 2PPVA 2GVZC 2XWJI 3L0BA 1UZMA 4FEGA 5A03A 2J3QA 2JJ2A 1J5XA 2ZT5A 1YQXA 3OCZA 3V8NA 3OAAD 1RYEA 5JQGA 2IC5A 3KL2A 1W8IA 3SG0A 4DC9A 1UPCA 4W5QA 4RMGA 1JZTA 4L9WA 4PW0A 1GLGA 1ZIXA 4QTTB 3FF1A 4UHHA 3G9QA 5P8WA 1C50A 1Z34A 3NBUA 2J6CA 4NU0A 3QOXA 2WJIA 3PNLA 4LRQA 1GKYA 4XGIA 3SZOA 1OBHA 4G4GA 4XCVA 3TTTA 1FJGB 1XYVA 4IJWA 2EXXA 3IAM6 1UZNA 2WMNB 3UVEA 5DRYA 3TDKA 3TI9A 3KHTA 4BLUA 3RRNA 3JWGA 1QDLB 3NVDA 2EKPA 4F6RB 2HA0A 4H7IA 1DDGA 2HPAA 3BRQA 3BXGA 4G89A 1AY0A 5TLSA 2VZ0A 4M8KA 2IYSA 4YGXB 3CUYA 4JFAA 4D9NA 3GLIE 3NJ4A 2XNCA 4XDHA 1AN0A 2VTKA 3KUKA 3LQKA 1SG6A 1UKEA 1N0IA 3JZIA 1NW5A 3QXHA 3ECAA 4KYIB 2W2LA 4JUFA 1ZGJA 4AFNA 1EQUA 3KEGA 4NE2A 4O3FA 1V8FA 1ZJYA 3I0MA 4DE8A 4K0KB 1NZDA 4OHMA 4RM3A 4E88A 2AR9A 4DM3A 2HTEA 1ZRMA 2Y66A 3UPDA 4WGFA 1N0VC 4FW8A 3N87A 4Y0AA 1AU9A 4IV0A 1R4ZA 3NT4A 1IBKB 1B8NA 2P78A 1BXGB 4A92A 3E5MA 1EWYA 3WLMA 4BQQA 4R68A 1KAOA 4DY4A 1QPBA 2GZDA 4LC0A 5AK5A 5F7OA 3COPA 1XVAA 1WCXA 4DIOA 3IEUA 4HNUA 3FIUA 3QEAZ 1G5FA 5JW6A 2DQ4A 1WXDA 4PQEA 3OMLA 2AWNA 2XDYA 3G8DA 4AY5A 5AW7A 2JGDB 3IDFA 4L74A 3E9MA 4ZT5A 4Q9IA 4LYEA 5TX7A 4DUGA 2N1BA 5KNCA 1SIUA 4L3VA 5JRJA 3T4XA 1WH8A 2Q5OA 3UHJA 3I3SR 1RWXA 4GYKA 3HCRA 2QNIA 3IVPA 1DULA 2XRFA 2D54A 5CMLA 5AM1A 1TIKA 2AQKA 1C3JA 2HINA 1ACJA 3PUWA 2E87A 4G8DA 4RE5A 3TVTA 1D04A 4E33A 2C4NA 5JVDA 2JJYA 3AONB 3T7RA 1XEFA 4GMDA 1ZY2A 1TF5A 1U0RA 1VI5A 2ZREA 5DM70 2ZWPA 3L7IA 2EG9A 2PSFA 2XUOA 3NBKA 4PO9A 5JIBA 1K27A 2GAOA 4OOEA 1QCZA 1LDBA 4XM0A 5EWMB 2CB9A 3MMXA 2A92A 3WRXC 4D2IA 5BR1A 1CSEE 1GRNA 2E49A 2Y0DA 3L82B 3EEFA 4HEHA 3RC1A 4CLOB 1C4WA 1MVLA 5K98B 2QHXA 4EG0A 1K9SA 5TS3A 3IDQA 1EXNA 1KIFA 1QG0A 2AJCA 4M9UA 4Y42A 4B4OA 5C8XA 3COWA 4WXHA 2E0IA 3X1XA 4QG7A 4UPDA 1WL8A 4YDRA 1ENOA 4WHMA 3BGIA 4HI0E 4JX8A 2L69A 4ZV4A 2JLVA 3EXIA 4DKXA 1JQJC 2AXUA 2G04A 1UZAA 3KRTA 3OO0A 5FBZA 5GVSA 3P2YA 4AY2A 3RVDA 4DDWA 4KR0A 1E6MA 2I4NA 5FWAA 3V8QA 1Q0RA 1P2FA 1R0XA 4UU8A 4IMRA 4L08A 4MWEA 4JLDA 4TL7A 1JIJA 1QKJA 2WYIA 3E48A 4J1QA 4R8RA 3TE6A 3DDHA 4LE2A 1Z7YA 2GEDA 4AWAA 3UUEA 2GHRA 3IVCA 3MPOA 2BKEA 3L4SO 3KOXA 1K88A 4MV4A 4Y0VA 2BFOA 1GRRA 2R60A 3DKPA 1VSBA 1ID1A 4MRNA 1X3LA 4KH1A 4DB2A 1K3TA 5JO9A 1EU1A 3C3KA 5AOCA 3AI2A 3BAFA 1Z4JA 3KZXA 1QZTA 4C01A 3MWJA 3ETGA 2C2GA 4XWWA 2PUCA 4ZT3A 2OSBA 3BYZA 2ZRDA 3W3AH 1GZ3A 1YVPA 4Q02A 3SSNA 2KYRA 3KUXA 1KAHA 3CKYA 4YIHA 3AIOA 4KBFA 4PCLA 3KVYA 4O3MA 1SZDA 3KZOA 5I7FA 4LOJA 1DB3A 2I99A 1J2YA 4C43A 2WJGA 2JGRA 4G2TA 5CD9A 1A1VA 3W34A 3ZWDA 2C4MA 2UZ0A 1MXFA 3UANA 1F06A 1X1DA 1I1NA 1TM2A 3U0BA 4HFMA 3WLAA 3U4CA 4BUJA 1ML3A 1Q5PA 1CIPA 3KDPA 3LKVA 4BNIA 4DWOA 2H4FA 3N0TA 4YDQA 3ROZA 1C3LA 2IZ7A 3P0JA 4J1NA 1C0LA 4FLFA 3NC4A 4LA4A 2IYQA 3LUBA 4TTRA 2CXHA 3LCUA 2GBIA 2QRKA 2WSSD 4OUDA 1LI4A 3KYBA 4MVWA 2P6OA 1Z2PX 3QFRA 1JU3A 1ZXXA 5K3AA 1C1XA 1QUFA 5EZYA 1FMCA 4LCEA 4AZWA 1VE5A 2V03A 3RVKA 4UVHA 4AJJA 1YRWA 3ZBPA 1IPEA 4JSTA 2DQYA 1BRMA 1DIBA 1VI2A 2KWIA 3QLVA 4LXTA 1TYBE 4ZHQF 1UC9A 2ORYA 1XLWA 2FR8A 3U4IA 5ENDA 4DPLA 2R68A 1NMYA 1ZD1A 1L5FA 2ZIXB 4HWOA 4RD0A 5F23A 3V2GA 4CKCA 2P9EA 3OKAA 1TTTA 4YJ3A 1W5SA 4JLUA 3OTGA 1FP4A 3HZRA 2GYWA 3R3ZA 2ECKA 5IBPA 3TQFA 1WIWA 3DYVA 2RHBA 3AUSA 2PZ8A 4OQEA 4TMKA 3SY8A 1NI4A 1YZUA 3K8QA 4LNUB 4R40A 4XD7A 3VYRB 3C7CB 1IH8A 2RGDA 1Z26A 3L77A 3TPZA 2GEVA 3P19A 2KPOA 1TF2A 1TVKA 4OIMA 1Z75A 3GU3A 3QU2A 4TL9A 4B32A 1QRTA 4JUAA 2UZ3A 3WK9A 1GG8A 1QCYA 1PR5A 3IPLA 1CV2A 2ACVA 3DBLA 3JD2A 2D1TA 1TCCA 2LLVA 3GJYA 1TZMA 1W4ZA 1E2UA 3CZPA 5THQA 4ZOCA 2PXTA 2YFYA 4FGSA 3G0IA 1C8KA 1YUMA 3BD8A 2WIJA 5DI3B 4HAWA 3HHEA 3OZRA 2DETA 4YRNA 4Q4JB 1JIUA 3ZE8A 4PXYA 4BX3A 2Y67A 3LDAA 3T5AA 4G23A 5KHLB 1J00A 2XH8A 3SC2A 2HOQA 4J0HA 3UB4A 5H9WA 2O2XA 3DE1X 3WGZA 2DKOA 4DA0A 2QD2A 3IR7A 5JDIA 4YV1A 2R6HA 4L2IA 3ZK7A 4JCXA 3PHHA 4KO3S 4L4UA 2JH8A 2FPKA 1JHAA 2E1PA 3EUFA 4FOOA 3T99A 3OSUA 1J8QA 3KKLA 3OJLA 2HJGA 5JPIA 4KLRA 3FSJX 3FBGA 2CKDA 3NYRA 2PIAA 4CEIA 3JQ7A 4RH0A 5DULA 5CCXA 1RWPA 1HSOA 2H17A 2Z57A 2X2FA 2EP7A 1QXSA 3C7AA 4PGMA 3ZY2A 1QIEA 2JFQA 3MJEA 3NLLA 3IOMA 3QV2A 4TT3A 3VU1A 4B6FA 4YXFA 3GN5A 4D81A 16PKA 1C80A 3MG9A 3UWKA 4C0SA 2NSLA 5EHNA 4TRMA 4A5OA 3K9FC 4X7RA 4HUQB 3G17A 4KE7A 2DFKB 4NZ9A 3EWNA 3THRA 4X20A 3IODA 2VP5A 3OY2A 4OQZA 4PU7A 2R1UA 3EY9A 5C81A 2ZDQA 1QHXA 3IQFA 5JI2E 3TZ6A 4QVIA 1B93A 2J45A 2ZUBA 1LW7A 3OLQA 3W2HA 2XMPA 1I13A 4JMLA 3DP9A 1H8EA 1Y4DE 5L7TA 2AFVA 5K1ZA 5A4KA 2WSLA 2O1EA 1EXWA 3A9RA 3NAMA 3PDHA 1WXIA 1B6SA 3SNKA 2OHJA 2VHCA 4Z53A 4J8PA 5EGSA 2FPGA 1M5TA 5L3SA 2PXLA 2G8LA 3JWJA 1PEKE 3CEJA 2CMHA 2XOEA 2WB4A 1RWWA 1XN1A 3PBKA 1LI7A 2OAQ1 3GXOA 2D8AA 3KPUA 5JOQA 1UMBB 3KKPA 4LY0A 4NLLA 4AUNA 5LQKA 5IT9A 1L7RA 3D6JA 3QBEA 3L05A 4M0CA 1GU0A 4HVTA 1ZIYA 1C9KA 1KY4A 1Q7CA 1OIXA 2IHTA 2P27A 3B2NA 3QU5A 3R3WA 1QQ7A 5AXDA 3V4ZA 4CM9D 2RKBA 1O5TA 1U98A 2RHDA 3AXSA 3PRHA 2FGKA 1KJ9A 2M6SA 4U9UA 3RK0A 3MOSA 4C0QC 4JVSB 1F6BA 3AY6A 3IFSA 4HVAA 5I9MA 4PIMA 5LIRA 3DS8A 1B3BA 221PA 2P75A 3BJRA 3QQ5A 4U7FA 1UFRA 4LEIA 1UKAA 2VRCA 3A58B 2H8KA 4CIDA 5FUWA 5COBA 2WWWA 1BVRA 3AP3A 3D4IA 5GP1A 3DR3A 1HDGO 2HRCA 2NYVA 2Q3HA 2FHPA 1KETA 1NJ2A 1KPHA 2MYNA 2NXJA 3BGVA 3S1LA 2XIQA 1OVGA 3EC2A 2ECFA 1H22A 3L4KA 1S3FA 3V46A 2B92A 5ECWA 1V9SA 2WVHA 3A6ZA 1NLFA 1Z6TA 2WD9A 2FPOA 5AI9A 3TOSA 1JG4A 4Q18A 2H5IA 1FQKA 5HXAA 1FQOA 4FZ3A 3OC6A 4RXMA 3NROA 4CTJA 1PQ4A 1H65A 4HAVA 1MX3A 2GXQA 1QIIA 1JJVA 2O8NA 4ZVKA 1RAIA 5AJVB 3O1JC 1WOMA 3KETA 5BW4A 3BE6A 5D3MB 1L5SA 4F2PA 5J4YA 5MDHA 5CP8A 5JDCA 3FMIA 1LI5A 1K0UA 4F21A 2EIXA 1NVDA 2X5KO 4MRVA 3TGLA 4N18A 4YV0A 2GESA 3NHPA 5I7SA 4NULA 3HVKA 5DH9A 2ZYDA 4JELA 1YR1A 2Z2IA 4P84A 4ENWA 4HDNB 5L6MB 3LF1A 3CEAA 4AJEA 2RB4A 3LOPA 3LRTA 2YYZA 1RXVA 4QQNA 3I45A 3H0CA 1LLCA 3URKA 1QH0A 4Y2SA 4BEJA 2KEKA 3REQB 4V0QA 3V80A 1E4VA 1IWPB 1M2FA 4HBZA 4XCQA 4JBYA 5EZQA 3AR5A 4M9QA 4RKQA 3VX4A 2A1UB 2FQXA 2Q1SA 3GLVA 4HGPA 3RIMA 5J2TA 3C85A 1NYQA 5AOVA 2ZCJA 3LPAA 1L4YA 4FFOA 5LBIA 4ZKEA 3WNVA 3VHLB 3CUVA 3PL5A 3AF3A 4TV8F 4AIIA 1VLMA 1ZM2A 2EDAA 4YDHB 3X2EA 4D6XA 4U00A 5KOHB 4RD4A 1RZRD 3T9AA 3I2FA 2H1VA 5FV7A 5JNLA 2YRWA 1OWMA 3OQJA 2B7CA 4KLZA 3LX8A 2JCGA 4I1YA 2QVBA 4GIBA 5LP6A 4RCVA 2F1JA 3TLJA 3PNPA 3LPDA 3PR1A 3AUKA 3F52A 2CLCX 4CUZA 4KE6A 4RFVA 1SC3A 2A94A 2QL5A 2ZYAA 3CG4A 3E18A 3QY0A 1XQWA 4I4TF 4Y2PA 4MQ6A 2BFMA 4DDTA 1BTOA 2OBBA 2ZIXA 1A9RA 1TU0A 1U11A 4OQYA 4YR7A 3H5IA 1MZVA 4US2R 1GNRA 1U7OA 4QX6A 4DGQA 1VMAA 2HWYA 4LHSA 1D0IA 5I9BA 1BDMA 4DDHA 5DFAA 1QC5A 1PW7A 4HLDA 3A1TA 3KYDA 3FOBA 3AILA 3BGSA 5GM1A 1A3CA 3ZPXA 4YTEA 2HLNA 2AXPA 4R05A 3D4NA 5FUBA 4DQUA 4ECAA 5BWBA 4TKVA 3ZOKA 3LUGA 4ZI7A 3JASA 4P3NA 4ZGGA 5F51A 1F4PA 2VPZA 3CYFA 3HA2A 4IDQA 1NF2A 5AHRA 3EK2A 1HE2A 4XJXA 5GVRA 1NNLA 3G2NA 1ZITA 2JJMA 4KVFA 2BHRA 4NABA 1LSJA 4TQGA 3SQOA 5JHGB 1WX1A 4JR1A 2ODWA 3O2SB 4MR7A 5D87A 1E3EA 1RLOA 4FGZA 3SS7X 3ZY4A 1U8ZA 2VHXA 4RS4A 3AX6A 2ZTUA 1P72A 4BO2A 4MTCA 1MAUA 1KAGA 3D43A 3H1GA 1QJCA 3PV0A 4BO0A 5KB3A 2ZJ8A 3H9EO 1EHCA 2VSXA 3KFLA 1E2JA 2GEKA 4YFVA 1YD7A 2XEDA 1K8XB 3AF5A 3PHBE 3L0YA 3T61A 3TK1A 3VH2A 3E0XA 2GCEA 4EFMA 1R4AA 2WF6A 2XCLA 2ZUCA 4DJ5X 4IVZA 5LIPA 3SJZA 4DCSA 5LZ2A 4TKVB 2CK3A 2OENG 2W37A 4EEZA 1BMFA 2O0HA 3O74A 3BKXA 1XPRA 1XQ1A 5LQNA 2PK3A 4DSTA 1QVWA 5AXCA 3ZU4A 4HADA 1DW9A 1HEYA 3D0KA 2EIHA 1VFNA 3DWGA 4WK2B 2NG1A 1CP2A 2A1IA 3I4CA 2JLAA 4B1FA 4G5OA 5HZHA 5BXYA 3ZH9B 1T13A 4RTKA 1M1XB 2CUNA 2HJWA 1E6LA 4F4IA 2NU9B 3WGNA 5BN4A 5BP7A 2X6QA 3FOZA 4G81A 5HUHA 5IKOA 2DQSA 1U0LA 2J67A 4D1YA 5A7FA 3QRWA 5BV0A 5IX8A 4CUKA 4YARA 3GCGA 1T34A 1I36A 1BDBA 2E89A 4FMDB 1XZDA 1TYEB 2P5SA 3T1VA 3K6RA 2H1RA 3I1IA 3TXYA 2CNWA 3FHTA 3I6IA 5TC4A 5LN1A 5E8RA 1E1CB 4ENSA 3W8RA 2PEYA 3I9MA 3USCS 2HU8A 3FRJA 2XIUA 4GPBA 2WTNA 3TNDA </