4EKGA

Crystal structure of dot1l in complex with epz003696
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
327
structure length
319
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational adaptation drives potent, selective and durable inhibition of the human protein methyltransferase DOT1L.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
total genus 89
structure length 319
sequence length 327
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4ekgA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ekgA02
2G8NA 2CMGA 4MQ4A 1T43A 2G71A 3HCFA 3X0DA 5DM2A 4YUZA 5DRYA 5T67A 4CWAA 2JHAA 2UYHA 1X1DA 3GGDA 2ZBPA 4PCAA 4CKCA 2AN3A 4DM3A 3EVAA 5HIJA 3TKYA 3KPUA 4HH4A 4ISCA 2IP2A 2BM8A 4DCMA 1KP9A 2ZVJA 3GWZA 3P9KA 3PB3A 3TM5A 2O06A 1VP3A 4K6MA 3OE5A 1KPGA 3NDJA 1VPTA 4FS8A 2IPXA 2ONYA 4X61A 5GOZA 2IBTA 2LD4A 5CVUA 1Y8CA 3GRUA 5EQJB 1RJDA 2JHCA 2NXNA 1KYZA 2XYVA 1BHJA 5B1SA 5EIWA 5EMMA 3CJQA 3AXTA 1YB2A 2JJQA 2G70A 2ZWVA 4OA5A 4PINA 4QVKA 5CVDA 5EMKA 1FP1D 2AN5A 2O57A 2GPYA 1UIRA 2PWPA 3KQWA 5HEKA 1KPHA 4AZTA 4AZVA 1M0EA 4IV0A 4C06A 2AS0A 3DLIA 5GIOE 2Q41A 3DLCA 2IDKA 3R3HA 3HCCA 5EHGA 3FRHA 5GIPE 1YFJA 2ZZNA 4RTSA 3EVDA 3B7PA 3CC8A 4WVLA 5EC8A 5HFJA 2JH9A 3UJDA 1NT2A 1G38A 1WXXA 2PY6A 5FQNA 1IXKA 3FTDA 3DXYA 3GRVA 5DM1A 2ADMA 5CVVA 2HWKA 2V7EA 4OBXA 2Z6QA 4OX9Y 4PONA 4P7GA 4CXMA 1WG8A 1KPIA 5DRTA 1KIAA 5DTRA 3FPEA 3NWBA 1R00A 5DTMA 1JQEA 2PGXA 3AXSA 4DQ0A 4PYIA 5K0LA 3M6WA 3CJTA 4CKEA 2CKDA 4FSXA 1YFLA 4YUYA 5K0JA 3REOA 3U81A 1SKMA 1EJ0A 4ER7A 4GUAA 1IY9A 3PFHA 3AWIA 2FPOA 2GA9A 4AUKA 3DXZA 2N47A 3DOUA 4HSGA 2ZWAA 3EGEA 3GJYA 3UJ9A 4CTJA 2AR0A 4PYKA 3DULA 1ZQ9A 5EIFA 5E9WA 3KPVA 2AN4A 2OZVA 1FPQA 5EZQA 4RTNA 3GNLA 3ANXA 5F2KA 5HIMA 1NW6A 4R6XA 2PX4A 3EEYA 5EMJA 5T6BA 4X63A 5BW5A 3PLAE 3HTXA 4RVFA 3GXOA 3LKDA 4DMGA 3CGGA 2XBMA 2NXJA 5LQRA 2ZIGA 8MHTA 3ERCA 4HTFA 3P2EA 3HCBA 3LCUA 3THRA 5FTWA 3DXXA 2IDJA 3EVZA 4KRGA 3MQ2A 3KR9A 3HNRA 4LWOA 3LBFA 4ER5A 1M6YA 4GEKA 1R8XA 3FUWA 5E9QA 1KXZA 5T64A 2CL5A 3BKXA 2P41A 3EMBA 5DX0A 4EVIA 2PT6A 3KQVA 3NTVA 1N7JA 3WSTA 2YX1A 5K0FA 3LDGA 2PX5A 1R8YA 1SQGA 4M36A 1O9HA 5LQKA 3FUVA 5C9ZA 2VDUE 5D1HA 5GWXA 1VQ1A 3KR1A 3IV6A 5FHQA 1NW3A 3KU1A 3QOXA 2EJUA 3RW9A 3UZUA 2EFJA 1ORIA 2VS1A 3O4FA 3FPFA 4RVGA 4KIFA 5ICEA 2NYUA 4FP9A 5E1OA 3ELWA 5DXJA 10MHA 3EVBA 2JHPA 3BUSA 5CIYA 3FRIA 3DP7A 3R24A 3HVIA 3VC1A 4F86A 5ICCA 4PIPA 2PLWA 3H2BA 4PYOA 3PVCA 4QDJA 4H0NA 4PYLA 2NNWB 5G02A 3SSMA 3QOWA 4MIKA 1FJXA 4RVHA 2DPMA 1FP2A 5IH3A 1RI1A 1JTFA 3F4KA 2WK1A 4NECA 4C4AA 1P91A 3E05A 4QPPA 2PWYA 3DMFA 3I53A 4R05A 1RI2A 1JG1A 4IV8A 4A6DA 2ZTHA 1ZG3A 3KQPA 4PYMA 2AOXA 3UJ6A 5F2NA 2PSSA 3BGVA 3G89A 3ME5A 3UJBA 3KPWA 2V74B 4C04A 1YF3A 1L1EA 3P9CA 5KQSA 4P58A 2OXTA 4RTPA 2QM3A 5EZSA 1V39A 3DH0A 3FYDA 3Q87B 5DM4A 4DCGA 1RI3A 2CMHA 3LCVB 3PFGA 4RX1A 4V0QA 3SGLA 3HA3A 5E8RA 2P8JA 4E70A 3A26A 3BGIA 1JSXA 4GOND 1NV8A 3DUWA 3P71T 3MHTA 3LDFA 4XUEA 3EGVA 2WA1A 1N7IA 5KVAA 3MAGA 3LCCA 4RTKA 1Q0TA 3A4TA 4WXHA 2JG3A 4HRAA 2AVNA 3CBGA 2H00A 3NW9A 4FSDA 4JXJA 4DKJA 5GP1A 3I5UA 5LQAA 4QQKA 1JG4A 2XVAA 3LGAA 3THSA 1AQJA 5CCBA 1XVAA 3FPHA 3M6UA 3SSNA 4E2WA 2P7IA 1NBHA 4RYLA 1IM8A 2PJDA 5HOQA 3C3PA 4DF3A 3K6RA 4FT2A 5GM2A 5K0CA 3KHKA 2YXEA 3DMHA 3OZTA 3BWCA 1EJ6A 2HNKA 3C6MA 4E32A 1QZZA 5LQUA 5EHIA 2GLUA 4LG1A 3BXOA 2P35A 3LDUA 2ZULA 4QTTB 3AY0A 4V0RA 4YUXA 2HTEA 2P3LA 4X41A 4EKIA 4OA8A 5KYGA 3OZRA 3SX0A 1KYWA 1SUIA 4ER6A 1R18A 2QE6A 2YXDA 3BWBA 3GCZA 3G2MA 3GRYA 3G8AA 3LL7A 3MTEA 1QAOA 4E2XA 5LQJA 2P40A 1RI5A 3RIEA 4GOMD 4P7FA 4OQEA 4E2ZA 4E33A 2I6GA 4RTQA 5F2OA 3JWHA 3PX2A 3QV2A 2YQZA 1XDUA 2NXCA 3G5TA 4C05A 3UFBA 1EG2A 5C1IA 2FRXA 2ZZMA 2XVMA 5FWDA 4OQDA 5K09A 2P3OA 3LHDA 3DR5A 1AF7A 1JSZA 3KKZA 3M70A 1INLA 3MB5A 2A14A 3HCEA 4PCLA 4AZWA 2YR0A 4YUWA 5K0EA 7MHTA 2O07A 3DMGA 2P7HA 2ZCJA 2G1PA 4POOA 3TQSA 1FBNA 3NDIA 5U4XA 5LQCA 4XCXA 4P7JA 4M38A 2WA2A 3TOSA 4Z2YA 3VSEA 2GH1A 1BOOA 4IKPA 3JWGA 4MHTA 4RTOA 1DCTA 1ZHFA 2QYOA 2O0LA 3UWPA 2OKCA 1L9KA 5K0GA 5CUQA 3TPZA 3R9XB 4Y30A 2ONZA 1X1CA 3PX3A 2PVCA 1TW2A 3P9NA 3PS9A 2PXCA 4QQNA 3TM4A 3M6XA 3UJAA 3SVZA 3BWYA 2H11A 3E7PA 2OY0A 4GC9A 1U2ZA 3G2PA 5DWQA 3HCAA 3EMDA 5HIIA 4HGYA 5IKMA 1D2CA 1XCLA 3FYCA 4UOEA 4EK9A 3A27A 3G7UA 4MTLA 4RTMA 3T0IA 4BLVA 2R6ZA 3MGGA 5FA8A 3ELUA 3LX6A 3SM3A 3T7SA 3OCJA 5LQNA 2YVLA 5K8VA 2PX2A 3KPYA 1XXLA 2AOTA 3Q7EA 4BLUA 2QRVA 5EGSA 2VDVE 3HVHA 1VBFA 1R6AA 3GRRA 3KR0A 2H1RA 4E2YA 3P97A 2Z6UA 3CVOA 3OPNA 4KVZA 4C03A 2B9EA 3B89A 4RVDA 4PWYA 2NP7A 3G88A 3FUXA 2BR3A 1L3BA 4QDKA 2IBSA 3UBTA 2FK8A 3JWJA 4MWZA 3SR4A 4GOOD 1M6EX 3LPMA 4QPNA 1MHTA 2ORED 5KS2A 2FHPA 5BXYA 3A7EA 3GO4A 3UJ8A 1VLMA 2BM9A 4HTFB 1XCJA 3BKWA 3TR6A 4YV2A 5BP7A 4ZTBA 2PX8A 3PTAA 5DTQA 4R8RA 5CVJA 5K03A 5LR6A 4QTUB 4RSRA 5E9JA 3TFWA 5CVEA 1QAMA 1DUSA 4PYJA 3V8VA 3O31A 3UA3A 1NW7A 4DA4A 1L3IA 1JQ3A 4R8SA 4F84A 4DZRA 2I62A 4BP1A 3FZGA 5DT2A 2DULA 3B3GA 5HZMA 4AX8A 3A7DA 2G72A 2I7CA 2I9KA 4FT4A 4P7KA 3NJRA 5EOVA 2CWWA 1JR4A 2VDWA 1NKVA 1WXWA 3HVKA 3ER8A 2JH8A 3I64A 5EMLA 5GM1A 5ERGB 4EMSA 3FTEA 4E30A 5FUBA 1NE2A 5CD1A 2Z6AA 3B3FA 4PIMA 1YZHA 4KDCA 3P9IA 1O9GA 2P3QA 3HM2A 3NMUF 1RJGA 3NWEA 2OYRA 2AOVA 3HVJA 1RI4A 2IH4A 1F3LA 1X19A 4ER0A 1P1BA 4YV1A 1P1CA 3LKZA 5DX1A 1WS6A 5CCXA 4U7TB 1G8AA 2B3TA 3KQQA 5EEHA 1AV6A 3T7TA 1VE3A 3EVGA 3S68A 3UA4A 1SVUA 2PKWA 4R6WA 2UYCA 5FHRA 1NW5A 2ZIFA 3KQOA 3GRZA 3P8ZA 3UJ7A 1VL5A 4RTLA 1I9GA 2BR4A 1ZKDA 3K0BA 5EKUA 5E8JA 1RJEA 3B3JA 3HA5A 2OO3A 3DTNA 3HA7A 3L8DA 4KW7A 4X1OA 5DX8A 5DM0A 2C7PA 2ZBQA 3ID6C 5EKXA 2IH5A 1Q0SA 2ZBRA 1PJZA 3CCFA 5P8WA 1DL5A 4EKGA 3KQTA 1XJ5A 3OU6A 3LBYA 4GC5A 5FQOA 2PXXA 3EVEA 2B25A 3GU3A 4FZVA 5M5BA 1SG9A 4PYNA 2IFTA 4GOLD 1H1DA 4CTKA 1HMYA 5EPEA 1SUSA 3P2IA 4M7RA 2EJTA 2ZIEA 2ZLBA 3HP7A 5LSAA 4E31A 5DXAA 3IHTA 5E2BA 5MHTA 2GS9A 2HV9A 4GQBA 2ERCA 3TKAA 1I1NA 3CJRA 3AJDA 3O7WA 5EVJA 4YV0A 4QVGA 4KWCA 5GINE 2GB4A 5FWAA 2UYQA 2ZFUA 5DSTA 2K4MA 3RODA 2NP6A 3MCTA 2B2CA 2PV0A 2ZW9A 3C3YA 3M4XA 3PT9A 1X1AA 1ZGAA 1XDZA 2BZGA 4PGHA 1EIZA 2IH2A 3BZBA 3VYWA 4KIGA 1BKYA 3KPJA 1YZ3A 1O54A 2FYTA 1UWVA 3SSOA 4Y2HA 3GIWA 2VZ9A 1L3CA 5D1NA 3NVKI 5E1MA 5FADA 4RTJA 1BC5A 2UYOA 4OBWA 1I4WA 2C7RA 4PGGA 3M6VA 4YUVA 3G8BA 3FPGA 3EVCA 2C7OA 3G2OA 4A6EA 4C07A 4HC4A 2AOUB 2P1DA 4PYQA 3D2LA 5FULA 3HEMA 4AZSA 3KQYA 3OE4A 1NW8A 3E23A 1WZNA 3FUTA 5JR3A 2XYRA 1SQFA 2ZZKA 2ESRA 2IIPA 2R3SA 3OZSA 1VP9A 3B5IA 2AOWA 1NBIA 2IGTA 1AQIA 1ZGJA 2Y1WA 2EG5A 3LSTA 4F85A 3I58A 5ICGA 3SXJA 3OFKA 3ER9A 1P39A 3MTIA 5KQRA 4ER3A 4EQZA 2HR1A 4FR0A 4IWNA 2PXAA 4ATNA 2PBFA 3UJCA 1JTEA 3FUUA 1VIDA 2VP3A 3BWMA 2HMYB 3R0QA 5EEGA 1B42A 3BGDA 2PT9A 1QAQA 3JWIA 1N2XA 2Y1XA 1KR5A 5HIKA 3BT7A 3LECA 5K0BA 4M37A 3ORHA 3M33A 3T7RA 5E1BA 3TLJA 2C7QA 1EQAA 1R74A 2YTZA 3KQSA 5C0OE 5K01A 2AOTB 2BR5A 4X60A 2YXLA 2O05A 5K05A 3OU2A 2F8LA 1YUBA 2QRVB 4CKBA 5BW4A 3TRKA 3FTFA 3EGIA 3FPJA 4G56A 1RJFA 1JQDA 3IEIA 1QANA 1X1BA 4BY9E 1NV9A 1UFKA 1TPYA 4YMGA 4XUCA 1XDSA 2OBFA 3C0KA 4U7PB 1QYRA 4L7VA 3MCZA 1G8SA 4FGZA 2E5WA 5DSXA 1G60A 1MJFA 1TW3A 1EAMA 2OPBA 1D2HA 3I9FA 3GDHA 1WY7A 3OFJA 2OB1A 5E2AA 3SMQA 3P2KA 2QY6A 1OR8A 2GAFA 4HGZA 4RWZA 5DPMA 2AZTA 3A25A 3C6KA 4HG2A 4C08A 2ZSUA 2NXEA 5DLYA 3EEOA 4YMHA 1G6Q1 1ORHA 3TMAA 3EPPA 2AVDA 2OB2A 4BP3A 3ELYA 4RTRA 4XUDA 2KW5A 4LECA 3G2QA 2EX4A 3G5LA 3V97A 5HILA 2FCAA 4O29A 5EG5A 2BH2A 1Z3CA 3NVMB 4BLWA 4LWPA 5ICFA 9MHTA 4B17A 1HNNA 2XYQA 3HCDA 3MERA 5JUWA 1PRYA 1F38A 3FTCA 3KR2A 1G55A 2B78A 5FA5A 4PNEA 3KQMA 5E1DA 3VC2A 3IYLW 3OU7A 2UZ4A 4KDRA 2FK7A 3E8SA 1XTPA 1JG3A 1D2GA 1KHHA 4RV9A 5CM2Z 3ELDA 5H02A 3CKKA 3EVFA 3R6TA 2YUIA 4GF5A 1JG2A 5K0NA 4GBED 5FCDA 2AOUA
chains in the Genus database with same CATH superfamily
3BL6A 3AMVA 2O2DA 2P9QA 3G1TA 1QM5A 4OB6A 3JQQA 3E9MA 1N1EA 1SXJA 5GV8A 4KNVA 3WYBA 1A5ZA 2IZ1A 2PFKA 4XUGB 3K4HA 3V46A 3ZWCA 4DJFC 2Z09A 4EHBA 2UUCB 1S2MA 4C6TA 2CNKA 2CE2X 3WGYA 3ZWXA 4CLRB 5HQTA 5ICMA 4GDFA 1IAQA 3U7GA 2FN9A 2DTDA 5TS2A 4OQQA 4NDZA 1TKAA 4XCVA 1XA3A 4XIFA 3N2YA 2ISSD 5A4JA 1LSOA 5SYMA 4X6LA 2R8EA 5KINB 3T38A 2ZR9A 1NP3A 1GCAA 2C8VA 2QVZX 5G53C 1R6DA 5AHKA 3MWLA 1E2DA 2GXSA 1A2BA 4MA0A 4I4IA 3EG9A 2WUSR 1U0GA 1S0UA 2ZI5A 1Z5ZA 4BNDA 1W8IA 1VIYA 4JLUA 1ZM2A 1E79A 5IASA 4ZARA 1QF7A 1J2JA 2PGIA 2WKPA 4ID9A 1H3EA 1TO1E 4DMCA 1CJGA 1SOAA 1NT2A 1YJAA 4NG5A 1QPBA 1TF7A 3AHEA 4C4TA 2QLFA 4LI3X 2OV4A 2OFXA 1M5TA 4OX9Y 5EXTA 4CLXA 2RHBA 2ES4A 1M72A 3DL2A 4P1ZA 2GCOA 3L7LA 4KLAA 1U99A 1RPJA 4XM2A 1TPZA 4HYQA 4ECAA 5JLAA 1TA4A 3TFQA 1SUDA 4A8TA 1NVDA 3RVSA 2CMKA 2H2AA 1N3BA 3B78A 3P0IA 2QYSA 4PPNA 4RVOA 4X3CA 3DOJA 3STWA 2IZ0A 3OLVA 3CN9A 1WU8A 3W9SA 4HSGA 2QEQA 5F64A 3TVYA 4DWWA 4UAUA 5KU1A 2D0IA 2WIGA 4RBNA 5EZYB 1S7GA 4H0CA 5M7EA 2B37A 4RTNA 1O94A 1PF7E 5AJWA 4DQLA 4U63A 3ZIAA 3FE2A 3TDNA 3W2FA 3SY8A 1CEXA 1EE2A 2QV0A 3FMGA 3OTGA 4MB6A 5IVIA 1FRFS 4R5MA 4R7ZA 2XVZA 3AKYA 4N6OA 5FL7A 4WZBE 2R7AA 4Z4QA 4ZHQB 1PL8A 1P1JA 1Y42X 3W5VA 1WPXA 2PZEA 4HTFA 5FTWA 1ZUNB 1NEQA 2J32A 3LBFA 1WD5A 1DI0A 5G3ZA 4KXMA 3KWJA 5DX0A 3VXKA 3LU1A 4QT0A 3DV2A 3LBHA 1HZJA 3FOWA 1GZ4A 3G02A 5BR7A 4R41A 2HYDA 3E5NA 4TN5A 5CP8A 4AO8A 2WY2D 1NI3A 1WMFA 4HDAA 2W8BB 1E8MA 4K9PA 2IC5A 1N2EA 4CIYA 2OMKA 1K97A 1M2JA 3IERA 2FJUA 3C3WA 3SEFA 4KTTE 5L3QA 4H1WA 4AMUA 3VI4B 4RDIA 5C31A 4W63A 2NO0A 4L9AA 5F78A 3MWEA 2ZTUA 2PEZA 2ICAA 3FFBA 5CJPA 5A3QA 3HVRA 3O3NB 1JEYB 2EV9A 3ZE2B 3BIJA 5DXJA 3AF4A 2Z8XA 5K2OA 5DYWA 2HOQA 5EJ5A 2WU3A 1AKWA 2XA9A 5J1SB 1DQRA 4NYIQ 4EGFA 1NSTA 2B69A 3QWFA 4LQLA 4C0HA 4ON9A 1JF8A 1R0LA 4MIKA 1J9EA 3T12A 4DEVA 2XCSB 1PGQA 5THQA 4HKTA 3RU2A 4EYQA 1EFPB 1UWCA 2X9QA 3F4KA 4TXLA 4KITB 2XDYA 1NXVA 2QTGA 1QP0A 3EFOA 1N5RA 1UMCB 3ASUA 3U3DA 1TVMA 3Q7TA 2BL4A 4FMDF 4QOGA 2AOXA 3SDZA 5JHGB 4TRMA 1ATIA 4ZICA 2CD7A 2NTJA 2Z2XA 1T3ZA 1WMAA 3P9CA 3AL3A 2OXTA 4XSHA 3LFUA 3FSRA 3E0QA 4BCCA 4RIFA 1V39A 3FYDA 5ILOA 2JGIA 5DM4A 1RI3A 2BFCA 4JEUA 1JT9A 4V0QA 1UJ4A 4RKYA 3HA3A 3LRTA 3VNAA 3OP1A 4G23A 3GLVA 4KNYA 1EDZA 1I32A 3DE6X 2BJVA 2WZBA 2P9JA 3D43A 5AJVB 1F2VA 1GQYA 5LZ9A 3A9CA 1Z08A 3TD9A 2CDBA 4JCCA 4WXHA 4ZT7A 5HCUA 4H6VA 3W3ZB 3OEHD 1Y8QB 1JG6A 2W6NA 3GFFA 1PDWA 5JQGA 1K2WA 2QMHA 1GRRA 5AH0A 5JWHA 2X6TA 4IDNA 3BRQA 5BN1A 4TWBA 1Z6ZA 5J4VA 3RSZA 1IM8A 2WG2A 3IESA 1MC5A 1S1MA 2C5EA 4GX2A 1ZDMA 3L49A 4CHGA 4DIUA 5AVZA 5SICE 3T3EA 4B6RA 4F1JA 1FRZA 3A0UA 3V00A 1Y63A 2BM1A 1M1YA 3MUNA 4QTTB 1KAMA 5F2EA 4AUMA 4YUXA 2HTEA 5JNRA 1EWVA 1PERL 4UAVA 3S40A 1IMOA 2PMKA 2GTIA 1GUZA 1Y1PA 3C7CB 1RHMA 5B3JC 3X2FA 2YXDA 2R11A 5JG7A 2AQHA 1SHLA 2GEKA 3D2AA 5ALQA 5EWLA 5M2QA 4D79A 1NNSA 4MWBA 4AKGA 1GRQA 2JI7A 4PAWA 1AU9A 1E0DA 4E33A 1P1RA 1IL0A 3BS3A 2LUOA 1NYQA 3PPXA 3RC7A 2HRQA 3WLPA 5LP6F 4U0KA 3I0ZA 4QZVA 4RFLA 4MVJE 3WNQA 2YWJA 5B4UA 2XY4A 1SMKA 1YZGA 4FFBB 4NOLA 3UT6A 4D5EA 3DBLA 2YR0A 2X4IA 4HZGA 4KXFB 4DV7B 3DZ8A 1E96A 3BEOA 4YRGA 4N5HX 3PQ7A 1LQUA 4QUKA 1X80B 2ACKA 2O7RA 3E81A 4M8LA 5AWFC 5KYNA 2C0QA 2FZEA 1IN5A 3K9NA 4BFYA 2CVQA 3U9LA 1PLJA 2QYOA 3LGXA 3DOEA 4JX9A 1IY1A 4PHCA 4TSKA 2XEDA 5BUCA 5G0TA 1E5VA 1SXIA 2UXCB 3R9XB 1WF3A 2PRKA 2C84A 3AR4A 2VO1A 1T5LA 3WB1A 2XJ9A 3R5KA 1U0EA 1XQ6A 3E35A 2W43A 3KJZA 1TOAA 2O2HA 5CGZA 2VJPA 4YQZA 4UQLA 1CQXA 2NUTA 4PFKA 5HYVA 3LXRA 1CS4C 3IJEB 3L6RA 5HDQA 3SWWA 1IK4A 1MO5A 1XZJA 3AKCA 1JYSA 4G5GA 5KHAA 4OP1A 5IRCD 1N9KA 2VF4X 1FX0B 2CLKB 4FHZA 1USUA 3ZZ0A 3AVUA 1D2EA 4BFCA 3EWAA 4XOUA 1MZPA 2LYPA 1ZUD1 3DG9A 4EY4A 1T0JB 4EY7A 1B2LA 1VE9A 3GZDA 1EVKA 4NPAA 4R83A 3SQMA 1PJRA 1QTIA 2X7JA 3L8GA 2E1RA 5BO5A 3C5VA 3CLVA 1K9VF 5JAQA 3L7YA 1EMDA 2JBWA 3PA6A 2XDAA 3GLSA 3CNQS 4PZ9A 1CQWA 2A6PA 3EBPA 3AVWA 4CKXA 3KQNA 1TU0A 2VDVE 1MR3F 1VBFA 3WSVA 5LNK1 3TRDA 3WLEA 3L41A 3F46A 4ZKEA 2I5PO 4AMVA 3INTA 1LDGA 3LYLA 5JSKA 3C97A 4LYEA 1DAKA 1M34A 4NY1A 4I4TF 2VXCA 1S6YA 1GGKA 3PPVA 1L8AA 4DLVA 3OKFA 1NFRA 1JKJA 2GN2A 5FBHA 4FYXA 4AKEA 3TX6A 2WNHA 1RQPA 1U02A 2WTMA 5C80A 5C34B 1D6SA 2OFOA 1JIJA 2GCNA 4ZU6X 1N6RA 2WHPB 5IC6A 1VFPA 2HFZA 2P77A 3B3QA 4FE7A 2PLNA 4M89A 5BXYA 1F2DA 2ODRD 1NXTA 2ABWA 3QMPA 4EY6A 2YHIA 4RQAA 3HR4A 1P6UA 4HDMA 1CE8A 1CRZA 3G68A 1Q0PA 1K8QA 5F4BA 2HLNA 4O63O 1Z47A 2QVYX 2J9XB 4B3DA 2CFCA 2Q6KA 2H8RA 4J2TA 4EB6A 3FGOA 2LR0A 3HB4X 3I9JA 4XIJA 5BWCA 5FUYA 2X0RA 3EGCA 4D46A 1V4NA 1BZYA 1GA1A 2FEXA 3QUBA 1E2QA 1J1IA 1YBHA 1EFCA 1QGZA 1UAAA 1V4VA 3TR0A 2G72A 1FNSA 4RA6A 3UXYA 4H60A 1E2PA 4BMZA 1J56A 4Y6OA 4YMTA 3G8CA 3PQ5A 4ZEOA 1CJTC 4BVGA 3NC4A 5DVZA 4U00A 3PX7A 1QGDA 1UBLS 4Q3LA 4XQCA 2BTQA 1EDOA 5IBPA 3LXXA 3S8YA 3A2LA 2Z6AA 1JHQA 1GRVA 1UL1X 4L0CA 4IZHA 3LQYA 2FMUA 3SNHA 2OE2A 4FEGA 1ND5A 1I5RA 5AKXA 4MQLA 4PG7A 1SIWA 1THZA 1XBTA 1O6CA 4TPKA 1OI7A 5AW2A 1ZGBA 3NTLA 4EHDA 2OV6A 1VMAA 4JITA 3ZTWA 3AKZA 3MBOA 3C4VA 1E1QA 3KQQA 5EEHA 2CUTA 1GLNA 1U0TA 4W5WA 3SC2B 3EF3A 3BILA 4KO2S 1KK3A 3OX2A 2ZIFA 2JBAA 3KDSE 3IR5A 4E5UA 3KELA 2E0IA 5E3HA 3K0FB 2QXTA 3AINA 3IBYA 4B3CA 4CMGA 5KKNB 1ONPA 2BR4A 5GADl 1BMTA 2ZI7A 1QFJA 4HH0A 3UHJA 4CG0A 2P62A 4DGSA 2PUHA 1T1IA 5E3IA 4AMYA 4P5EA 2X3UA 5HIAA 1PS9A 3ZKCA 1DAOA 3W3AH 1PJZA 1YR3A 4UE3S 2BZ1A 4K9RA 2QAGB 3ZK7A 4CMJA 5TGZA 3GJ7A 2P4SA 2IWRA 3NDPA 3JQ8A 2W58A 3LBYA 1GARA 3MTAA 1U7WA 2K7ZA 4L0QA 1R8JA 1TAQA 1YGYA 2PXXA 3PQ4A 2P2SA 1ISPA 4KN5A 1KTVA 3NHLA 3ZI0A 4QJ3A 2ZLBA 1I13A 2HA0A 5CX4A 1T8SA 3S7TA 4F9GA 4UAGA 2R25B 2QRPA 1LW7A 2V59A 2AA3A 3KJGA 3OQ6A 2HX1A 3PQCA 2WUWE 4GHWA 1CUIA 1N1GA 3W0LB 4EMUA 2J0UA 3D02A 3EB9A 1P1KA 3IO5A 1TKRA 2NO1A 4JUCA 4KGDA 1ZH0A 3PITA 4NFLA 3QTTA 2NU8A 1JE1A 4DCUA 3FMFA 3NHAA 2ZRNA 1IN8A 1EIZA 3SBXA 3REFA 4ARBA 4ZHQA 2AWIA 3V8QA 2FPMA 3T1HB 4LRWA 4HGNA 4IZ6A 2O4CA 4RF5A 3RS0A 2Y77A 3SSOA 4URHA 3UWDA 4D4JA 4ESOA 1B0PA 4TVSA 1AHPA 3CXUA 4MPJA 3DR3A 4I9HA 2RGEA 3LKZA 3WLHA 5LN1A 3X3HA 1UMDB 1YZVA 1HQYE 1LQCA 2FMHA 2GM5A 3GJRA 5KNLA 1T2VA 2EBHX 4D2IA 5HKAA 1NJFA 3ANNA 4J4BA 8MHTA 3OZSA 2PIAA 2H06A 4P4NA 5C7OO 3K31A 3RSGA 1ZGJA 1VC2A 1XRMA 4CGYA 2BUAA 4FNOA 5DK6A 3UVEA 1GTRA 2ZSHA 4C29A 4GDMA 3S1AA 2XOKA 2WE7A 1UKCA 1GYQA 3IAS6 5BRAA 1HWYA 1MX3A 3M9XA 3MTJA 3IUPA 5MDHA 5ITZA 1U9CA 4L02A 3REQA 1A4XA 3FUUA 3HP1A 1FJGB 3RF7A 4AMZA 4AFNA 1LQTA 2FE4A 1ULBA 3ZDZB 2BN4A 4XM1A 4CM3A 3AG6A 2G1JA 3DFFA 1G3IA 1LJLA 3K9LA 3QKUA 4GYKA 1ORTA 3ORHA 4TLBA 5IAJA 4M9UA 3RRFA 4CQLA 4TTVA 1SIBE 3QSGA 2PRYA 2BAGA 3QYPA 4KHZA 5C0OE 3GVPA 9ABPA 2O8EA 2ZSKA 4HUTA 4D02A 3ZV5A 4JI4B 2AKEA 2E2WA 5EPOA 3K32A 1TM2A 4AF8A 4TQGA 5TF0A 5DGXA 2NO6A 2G6BA 4BP8A 4EB3A 1AUXA 3RSQA 1U3FA 5LM3A 4KUGA 1U81A 4YDHB 2QKYA 1WXDA 2HWUA 3H5LA 2D4AA 4WFKA 1IOVA 2JCXA 2E4AA 2Y05A 4JLJA 1WPGA 5E38A 4IJ6A 4IIJB 4BOYA 4QM6A 2EEZA 4LOHA 4LNAA 3C3BA 2AUMA 3U60B 4BC0A 4YCCA 1EXNA 3OI7A 3TRFA 5TLSA 4UW9A 2O49A 3FVWA 5LP6B 4HT3B 4HRYA 3NALA 2GAFA 2YHSA 5KDOA 3VH3A 3GLGE 2GOYA 4MI6A 5KYVA 4D4KA 5JCJD 2QGFA 4IXDA 1FXUA 3EEOA 2IOQA 1B0NA 5LB4A 4NSNA 2MINA 2R2GA 3LK6A 3JYQA 4EKDA 4UNIA 2HCFA 1MU0A 1OWMA 1YU9A 4IDOA 4WLNA 3G5LA 4AI6A 3EDYA 3GUYA 4TTQA 4ZCPA 3LUKA 3W8FA 4F06A 2V54A 3NX4A 3QUCA 3U4IA 1EGVB 1RM4A 1E3JA 3IS3A 5DIZA 3PUHA 3ZWBA 3WVNA 3UT0A 3SX2A 5LC1A 1F38A 2A1TR 3W4KA 4S1VA 1C7IA 3T4XA 3ZHUA 3RH0A 1G59A 3IYLW 3DZJA 4KDRA 1GSHA 2R8RA 2ROQA 1RPNA 1ZUGA 1QGED 3EXEB 5CM2Z 1NJ5A 2ZM5A 2AEJA 2RHLA 3AVPA 3QW4B 4HDMB 5JIBA 4IVZA 2V5UA 4KR7A 1QF6A 1VBKA 4NFHA 4C0QC 3KOYA 1O6ZA 3H0EA 2QOEA 1PL7A 5EIHA 4DLUA 1SVSA 4UEJA 1WB9A 2OD7A 1PK9A 2CXUA 2G71A 3IUEA 1Y34E 3NJ4A 3PF8A 1BXKA 4IAOA 4RXUA 4F3YA 5AVRA 1QK5A 1KERA 1ONOA 3E9CA 2G5TA 4HLDA 2O0HA 3DEIA 1T1RA 3QY9A 4Q9NA 2Z4SA 4U6SA 5EN4A 4CKCA 5IT5A 5KNDH 1NJ6A 4MARA 4QOFA 1SUCA 4GSYA 1OH8A 2HQOA 3FF1A 4QBGB 4F6LA 3VAZA 3JQ7B 3AFIA 5K3EA 3VJRA 1L7VC 1ABEA 3M6FA 3PWKA 2Z83A 2FPXA 2EJVA 3CNOA 3RYFA 1RJWA 3RRJA 3I45A 3JASB 2Q6TA 1ZSYA 1V16A 1RPAA 4MH0R 2YASA 2YCBA 5GVSA 2SKDA 1D4FA 5DBOA 4EA8A 3I30X 2O3RA 4QPDA 3T5PA 3DVRX 4MUEA 3DLPX 4K6HA 4WZAA 2OLEA 1SVLA 3M3DA 2XMBA 1PGJA 4UATA 4DNOA 1MO6A 3ZCVA 4ZDJA 3U1VA 3P0RA 4FR5A 1HG0A 5HM8A 1EVQA 1V1MB 3DOOA 4YRZA 5IZCA 4JXZA 1LBHA 3DLIA 2PWBA 2C5LA 3MWDB 2BBSA 4KYIB 5EL0A 4A5SA 5GIOE 3AR9A 4EHHA 2WT4A 4EKNB 1SXQA 2VHZA 2P30A 2PUJA 1I6WA 2EGUA 3MWJA 5EJ2A 1Y7PA 4D0LB 1IXKA 1QNFA 2OZPA 3QJYA 4LWQA 1IZZA 6AT1A 5HRCA 5L40A 4OBXA 5TC4A 4BX8A 2CHQA 1PO7A 4JCYA 4NOMA 5A7FA 1Z26A 3N6XA 3S55A 2PS1A 1KIAA 3RUCA 5DTRA 3KEMA 4ARIA 1R00A 5J4HA 1FBTA 1X86B 1ISMA 3N3BC 5K99A 1XP5A 1FFBA 4MDEA 1S2NA 3F6YA 1DC7A 4ZVUA 3RSHA 5JU6A 1GILA 2ORWA 3H16A 4CMCA 4D3SA 3QG1A 5EWLB 3Q88A 1FXSA 5LBTA 2VA8A 1ZIXA 1E92A 1A4IA 1FJ2A 1ZZ8A 2AFHA 2QR3A 2CBXA 3KPVA 3TZCA 4RORA 5HIMA 2ZYRA 4FB4A 1NMZA 3IVMA 4ZHQF 2V6FA 1VLQA 3Q40A 1RD4A 3T7DA 3VZBA 3B82A 3NRJA 2NQTA 3JYOA 4PZPA 2AGVA 1BMFA 4GM1A 5ARBA 3A3PA 3C98A 4ZPJA 1AMOA 5IULC 3LHIA 3OQPA 3UWMA 2DFLA 3SIXA 1FS4A 1LBTA 5HS6A 3EUFA 4C3OB 3JW8A 1ZIPA 3DNVB 4FLMA 3T7IA 4BUJA 4D0GA 4JAVC 5BSUA 1V5GA 1QYCA 2I7XA 4RPIA 4ZDWA 1L5HB 4HDSB 4UTPA 4FUTA 3F49S 1HOXA 4NARA 1OLUA 3KJNA 1OLUB 2VAXA 1C3LA 3LDGA 4PAMA 5AJYA 4ZAWA 3TVTA 3W8EA 4BLQA 5C9ZA 3W7AA 2C61A 2OVBA 4MX8A 4KR2A 3ZJ4A 3DAYA 1P2DA 2BKVA 1W75A 2A9QA 4NAVA 2E7ZA 1DQNA 2IV7A 1YZNA 3ML1A 4AX4A 3BCRA 3FCSB 2M9MA 1T36B 1GL6A 1Z28A 3KXDA 3VFDA 4L8GA 1JR3A 2AZXA 2NYUA 1P1HA 3AB7A 3CVXA 1EK6A 3LLVA 1FFSA 1MB0A 1QH9A 4I1VA 5HF6A 3U39A 4QBFA 4I9UA 3DEFA 3ZGZA 3RIXA 1EHCA 2BELA 4HVAA 3IUMA 4EQ6A 1UPXA 2Q07A 1CZUA 2G0AA 4PTYA 3UN1A 1UCFA 1LBEA 3IALA 4I4LA 3IUSA 1C2YA 4C14A 5T4HA 1NLMA 3I5AA 4BIMA 4KYUA 1QG6A 4URWR 2VXBA 1OXVA 4G0NA 4X3OA 1RI2A 3M9WA 3PUKA 2YW9A 4HUQA 2Q29A 4RL6A 4HQLA 5JSHA 2E4UA 3DDNA 1W4ZA 2XF2A 5AI5A 3INNA 3TI9A 4C5BA 4C7VA 2QBYB 3JYNA 3ZLJA 2C2ZA 1JFSA 3B5EA 2ATIA 4OY3A 3HHEA 3RSSA 4CNBA 4Q4JA 3OIWA 2X7XA 3DH0A 3EVNA 3JQEA 3T4PA 4LMRA 2QLJA 2J6BA 3PFGA 3JQ9A 1VLVA 3BC1A 3QPWA 5DGTA 3RHZA 3RQSA 3VR1A 5JAUA 3D3QA 5CBPB 3GLGA 2J8ZA 3AHCA 1XPRA 3GQBA 4D9KA 1V3UA 5KVAA 2C9DA 1G9TA 4ZVPA 3LHKA 1SXHA 4PRKA 3CCCA 3T7KA 5IWAB 1L5FA 2OHOA 4GT1A 3ZIDA 2CY0A 2YWEA 3EWIA 2VK2A 3THSA 1I1HA 4RKWA 1K7XB 1U9IA 4EG4A 1C7EA 2F3RA 3H5WA 2P7IA 4MI3A 3LT2A 2NTEA 4Q12A 1QQBA 4N18A 1YVUA 1MAHA 2Y9PB 3PHJA 1H05A 2IUYA 4BU0A 1JR2A 4XYMA 1X6VA 5EHIA 5GAHi 1M2KA 5FF9A 1FQWA 3CIFA 3HEAA 1LB1B 1QIKA 4JZYA 4ZQGA 3ZH2A 4DBZA 2J3KA 2QZ4A 1W7AA 1GFZA 4BNZA 1LLDA 2C99A 5T5QA 4CCAA 3AI3A 5K3FB 3OZRA 1TUBB 4J6FA 4GM0A 3ES9A 4L16A 1NQOA 1OKKA 1QAOA 1XV5A 1NWCA 1U7XA 2RHRA 2V55B 3TEMA 1YB7A 2O7VA 4BO0A 2XYHA 2ID7A 1LWNA 2IBMA 5K0TA 1ZJJA 1Z62A 2NG1A 1T5DX 2YQZA 1DXHA 1T1EA 1S01A 2X8WA 4P32A 4C0WA 3AVXA 1Z35A 1XAJA 1I01A 2EKPA 2WHRA 3B60A 5P21A 1CQJA 4M9XA 2VF2A 3AF2A 1LUAA 3ZHVA 1INLA 4FNGA 5FEUA 4AJOA 1RPZA 3RVRA 4CDRA 1AXRA 4MCIA 4RGQA 2VSNA 3OECA 2O4AA 5FBLB 1FMFA 1WCV1 2HWWA 3OEYA 3SJ7A 4BN5A 4OP2A 4XQEA 2AR9A 3FPKA 2VJYA 4PRLA 4TLEA 1AT1A 3HJHA 3EZXA 1GL9B 2DYKA 2R4TA 2WU0A 4IFIA 4RM2A 4B71A 4M6WA 5A3RA 3IP8A 1Y5LA 4Y2GA 5GJBA 1E6WA 2WPNA 4YJGA 5G40A 1XZEA 4GI2A 3E82A 4OKIA 3ZDYB 3IPLA 4BS9A 4OBMA 1Z83A 3F9RA 3TXXA 4BQSA 5DFAA 2Y4OA 3AJRA 1Z8DA 2A78A 1UK6A 1Y4ZA 1TW2A 2OO5C 1PD1A 1CR2A 2YJTD 1YJCA 4Q9AA 4U2BA 5THXA 1PYOA 1QKJA 1E2HA 4KL8S 2H11A 4O2AF 3SS9X 3CZRA 1WZUA 1O77A 3K05A 4FNAA 1QQAA 3LISA 1B1AA 2FEKA 4HGYA 2AEFA 2ZYSA 3O73A 4TZTA 4ZOQI 1ZD3A 1XCLA 2BHNA 5FAXA 3TX2A 1Q19A 3D4IA 3G7UA 4MTLA 2PCJA 2K5UA 3K15A 4LDJA 4RWEA 1UPUA 4DR3B 5DTEA 3A70A 1KJYA 5LDDC 4KBFA 1KMNA 4ASUA 3DFZA 4GPTA 3SM3A 1C8BA 4JJIA 5KWIA 2YVLA 4BO9A 2IEAA 3I9V1 3D5QA 4P4GA 2WIDA 3NTXA 2PPLA 1CY1A 1RNLA 2JAUA 1QO0D 3TF5A 4PVCA 3TZEA 4BMVA 2B61A 1R6AA 4D4GA 2IYSA 2IZ6A 2LXNA 2WVGA 3DTVA 2XLBA 2J0EA 2CSFA 1MJHA 4OLBA 5CITA 2Z6UA 2QNRA 3BMQB 3RT7A 3A1NA 2GRUA 3ONEA 5SY4A 5L3VA 4X1IB 4TSFA 4X1IA 2VNHA 3G1WA 3PQ8A 4HDKA 2J45A 4ARVA 1G5FA 1CR6A 2PTGA 4A2PA 4Y3UA 1L5OA 3MJTA 1CW2B 4HQ6A 4IVQA 3JWJA 1KVQA 4RSMA 1X57A 2JATA 2DLCX 4GOOD 4AJKA 4QPNA 4U9IS 4DE5A 3FNGA 2FHPA 1VSQA 4HPWA 2X4DA 4BO8A 821PA 1W5TA 3DE5X 2BM9A 3L46A 2QW8A 2ZYTX 4O4JB 4ZCLA 1EVEA 1BXGB 1QO9A 1DWOA 4R51A 1Z3IX 4A5OA 4CCYA 2GVDC 3I8SA 1U8XX 2Q6OA 2IF2A 1J22A 1KI3A 1M2VB 1QVRA 1X7ZA 3EZLA 3HYTA 3BQ9A 1QAMA 2CCJA 3MJ4A 3OIDA 4U02A 4UQOA 5J2UB 4PYJA 4YIKA 1EUCA 5K3CA 1UMDA 4QARA 4UEWA 3H2IA 1KJWA 4ZO7A 1AOXA 4JI8B 1EP1B 3N70A 2QWXA 4WPGA 1TGYA 2P91A 1LBQA 3RG8A 5F9FA 2LP4Y 2DRIA 1YC2A 1X8LA 3MOSA 4MQ6A 3ER8A 5CTJA 4FFNA 4A1OA 4B4UA 2GN8A 4FN4A 4YP6A 4AN4A 3WRYC 4Z8XA 4EVRA 4PIMA 3BQNB 3JQ9C 3M49A 1OCEA 2O0JA 1WE2A 2RGXA 4WGGA 1FDWA 3GLKA 3V1UA 1GZ3A 3HBJA 2R6JA 5LMZA 1FNMA 5FTNA 1M2GA 2WAXA 4GGMX 3O8LA 5FT9A 2W2MA 2V9ZA 1M8GA 4DMHA 5AIAA 1T0PA 1G8AA 1EUQA 1Y7YA 2CBGA 3WL5A 4L51A 5F23A 5FX2A 1OXSC 3WIOA 3IKVA 4AF6A 4V1CI 2X22A 4HFMA 5KOHA 3EYAA 4UU1A 2PV7A 4BKMA 2FOIA 3KVRA 1ZNYA 3ORSA 4PC7A 2X5OA 2WDZA 3CRW1 1HA3A 2ZCVA 2B1QA 2J4CA 4XFJA 2LBPA 4IDBA 4IHKA 4MS4A 2B20A 5ALWA 1TQ2A 1ZISA 2ID8A 4MGYR 2O3TA 1ZH8A 1RCTE 3P9PA 4XWAA 1PQWA 3AUSA 5HCNA 3VSAA 1T34A 4PNHA 4CV1A 3F47A 1JDJA 2B7BA 2C3UA 1PNVA 3DBIA 4JJ7A 4YTEA 2WZDA 2AJDA 1T5OA 5B2EA 4ALJA 2H4HA 3F97A 1CERA 1JPUA 1XZKA 3KTAB 4RFSB 1GXSB 4XPIB 5GGYA 2BYTA 2V7BA 5JATA 2HV9A 3RUDA 5KWVA 4Z1OA 2VP2A 5EVJA 3RVJA 4U6QA 4AJ2A 1L7EA 2BRUA 4MMZB 2VPXA 5GINE 1ZI6A 1P0MA 2B2CA 3GEHA 1EP2B 3PT9A 2CSXA 1RKXA 2BZGA 3FN4A 4FOPA 4NHOA 3OLWA 4N54A 3U4DA 3L0CA 1P9RA 1X8KA 4V2UA 2F8TA 2WUEA 3EISA 3GNTA 4C0LA 2I6QA 1FA9A 1KTIA 3MNFA 1NTRA 4IQ8A 4P53A 5TF4A 2X7HA 3F71A 3OKCA 2VZ9A 1L3CA 1JIVA 4IRXA 4M0PA 4XW2A 5D1NA 1UZNA 1L4BA 1A5AB 4X93A 5E1MA 4ZI7F 5KWSA 3KXLA 4YUVA 5CH5A 2RHGB 3NPAA 2UDPA 1U5AA 1TT5A 4HC4A 1P7YA 4FS3A 2HJGA 4Q34A 4BO2A 2P1DA 5KB3A 4YAEA 1OPXA 4D3XA 3LA8A 1B2RA 2VLBA 2OD2A 1ZGZA 2ZZKA 5KYYB 2ZXUA 3UAVA 3ERCA 2Y1WA 5H16A 4PCUA 4I9GA 4RPLA 3CKMA 2QD3A 3IVXA 1JDZA 1HTBA 3TTVA 4K3UA 3O8CA 3A6GA 1R88A 3DUFB 4G0WA 3LI2A 3HPQA 2MYTA 2HMYB 3MCVA 4QJ5A 4RQBA 4K7JA 2DBQA 1SK8A 4WBNF 1H22A 1W5AA 4RUKA 4AQYB 4NCAA 2A0XA 1PIWA 3KLMX 3PE3A 5FI1B 4FGLA 1HT3A 5E1BA 1OH7A 1T5TA 3ESDA 5BN3A 2AEEA 4IHQA 2RGRA 5E7JA 2EL9A 4HEA1 3L8YA 3P5SA 4TLCA 1MLDA 4ZOBA 2X1LA 5F12A 1FP4B 3UG7A 4RM3A 3RIHA 3OSUA 1RLUA 3H9GA 2DUUA 3IEPA 5E9AA 1E5LA 1YVRA 3IQZA 4I1SA 4I19A 1M1ZA 1K7YA 5KYXA 1PL0A 3U7FB 3RFCA 3HCRA 1NUTA 1X7XA 1DNPA 1N8TA 2BCGY 4LSGA 4PLWA 4TMWA 3W9UA 4CQNA 4KI0A 3VC7A 3FOCA 4B3BA 2F1OA 1TZ2A 2Y1OA 4KE7A 1HLFA 5BVHB 5KYYA 1CY7A 5C46F 5EJ8A 1JWLA 3GRPA 2R8XA 3MOGA 1SXJE 3C39A 2QW0X 4RWZA 2NW6A 3AR8A 4LTNA 1TYDE 1QRRA 2JI8A 3A25A 3L84A 4NNPA 5ESWA 3CT4A 3MS7A 4JLNA 4UBMA 3KD2A 2PXPA 3T8YA 3TNFA 4BFLA 4LJ5A 3M2TA 5CB6A 5LOVA 1RQLA 3FPSA 3PPIA 5AW3A 2E4ZA 4AWAA 4FLFA 4M2LA 2HC9A 2HEIA 1JHAA 3T9BA 4L6IA 2NO9A 3AUJB 3CURA 5L7TA 1RKUA 4D9HA 3G0HA 4MW1A 221PA 4CT5A 1P5RA 3X2EA 5U9CA 1GDTA 1M66A 2NO5A 5JFTA 1QRAA 4YVFA 3WQSB 3IUJA 3D1NI 2BFPA 1W2WB 4YAGA 2QLBA 2JLQA 5B3LA 4IX9A 4DIOA 1VPLA 2UZ4A 1W19A 2X23A 2XUOA 3RO7A 4D3DA 4G9GA 1Z4PX 5KBYA 1CR4A 3LDAA 3R6WA 4RFSA 1XL1A 1F48A 2GYWA 3S2EA 3CWQA 1A9XB 3AU9A 4IHJA 2QQ0A 3GA7A 4UBOA 5AW9A 1EEHA 2IY8A 5CB4B 2PIDA 1TLLA 5BSVA 5F21A 4G8JA 1KH2A 4JI2B 4H18A 1ZMBA 4XLTA 2BJWA 2OZEA 3WB9A 1IG0A 3D7LA 3ZDEA 3GGDA 5KKCA 1EVLA 1PZHA 1LVGA 1QRTA 3MLBA 3OQJA 4G97A 4E94A 1JVSA 4MS4B 1W46A 2WM9B 3FFTA 3OPMA 4HD8A 4ZCIA 2JEYA 4GIBA 1MENA 3FHOA 3O4RA 5I4CA 5AKLA 1MHPA 3A3OA 1NJ2A 1YQ9A 4GLBA 4DCMA 1J90A 3B6MA 4TYNA 3WMEA 2YRFA 4P2GA 4LDNA 3WP0A 1SUPA 1VP3A 1DBRA 2O06A 3WK5A 3KT3A 4XIYA 4B6JA 1SJ9A 4XVCA 1PUIA 2W2TA 3NBMA 2QM7A 3GLIE 1LCDA 4DREA 3HJUA 3R9XA 1LSUA 3S5JA 3UH1A 2HIGA 3K35A 2CVFA 1NNI1 2O8DB 2Q1UA 3T61A 1RXVA 2IYVA 3N6VA 4IYJA 2OK7A 2B35A 1VA4A 3PGMA 2CZGA 1VHQA 1T5SA 4II2A 3BSWA 4GBGA 4IFTA 3S6JA 4HS4A 3WL7A 3PIIA 4C06A 8GPBA 4FFPA 2A88A 3RRNA 3VO1A 3WLLA 2FPPB 5L4NA 4DOMA 1LPBB 4NEQA 4QNMA 3CC8A 3FNRA 3I52A 4HDQB 4OCZA 5TT0A 2Q1WA 1T91A 2VWPA 5CYOA 5ECDA 1PJQA 1YTLA 1V41E 3BEDA 4NNOA 3ND7A 4MR7A 2PJRA 3OZXA 4PONA 4P7GA 4IL5A 3LKVA 4YACA 4OJYA 3M6AA 1HI9A 1VLJA 1M74A 3PI6A 1Q6ZA 1BX1A 1P31A 1QZ3A 1H66A 1GGJA 3PHIA 5LP6C 3UHFA 1UEIA 2BGTA 1ZITA 5IBQA 3OCYA 4Z8YA 1HKHA 5ED0A 3GCGA 1H8HA 2FWAA 3GJYA 2FW1A 3KRTA 2NVBA 5E6RB 1BEEA 5BN5A 1N6LA 4C0BA 3CYFA 1MD9A 2V8BA 1T0IA 2OZVA 2DOKA 2BZ0A 1BDJA 1GRNA 1KMIY 4U9HS 5EWMB 1OTYA 2AZDA 4UNQA 3WKEA 4BKRA 1N1MA 4D9FA 4DJJA 3EEYA 2E21A 4QELA 1KI9A 2P6MA 5K4AA 1IEVA 2OAEA 2YMMA 3DDOA 3GXOA 2XGOA 3EIWA 3QI2A 4FGSA 4TL6A 3ZZNA 2C9OA 4C4RA 5FDFA 1UBFA 1VKRA 4UJ5A 2FP4B 3SCZA 4BV3A 4GPIB 4D0RA 4D9NA 4EW6A 1HH4A 1D7OA 3FHLA 1A88A 4KRGA 4N9WA 3WLSA 1MJNA 4G1CA 2Q6VA 1XQ1A 3FUWA 1UMKA 4JUAA 5E9QA 2ZRIA 5F1YA 5E4FA 3UAWA 4YMUA 3BKXA 4RCZA 3HKDA 3AZPA 4ZQFA 3MG9A 2SICE 3NO4A 2Z1MA 2BJCA 1FYWA 3ST7A 1H2AS 1VGVA 3ORYA 3OZBA 4M36A 3AP2A 2FMTA 3GJ0A 3H5NA 1J8FA 1L5MA 3T3PB 1NXPA 2R2AA 2OK8A 4WZZA 4Z7QB 4LQDA 3R7BA 3CONA 4QEKA 4RZUA 1NUPA 1XVLA 3KU1A 1AS0A 5KEIA 4JBNA 4QL3A 4R2IA 4LUCA 2C82A 2ZATA 2VTEA 2O2YA 1GPJA 4W5OA 10MHA 2WWXA 1GT6A 1MT0A 2BCJQ 3KTAA 2NZ8A 4UCFA 3S2SA 1B16A 2VKTA 2BFMA 1VHLA 2PT7A 3FRIA 4WLOA 5KUTA 3BTOA 4QU5A 1MA0A 5DEIA 4GSKA 4NCJA 5CA1A 4H9GA 2QUIA 4PYLA 4HGRA 2NX2A 2VBFA 3WLMA 4N6GA 2DPMA 3AESA 3R4VA 1HFEL 3K0AB 3UC9A 5M04A 5H82A 3KUDA 1QHIA 4PXYA 4BYMA 4OBEA 2RHWA 3NNDA 4BKPA 4C4AA 2R1JL 2V7PA 1E3TA 4R05A 3R8CA 4BLOA 5F98A 1G0NA 1ST2A 5EKSA 5JRDS 2HAEA 2NVWA 4MYSA 3HDJA 1CZLA 3X1MA 2ZJ3A 4OD0A 2CDCA 3KQPA 1MQSA 3VR6D 3UMCA 5AW4A 3KB1A 2CN1A 2LYQA 2V96A 3GHHA 2UVPB 3FSGA 4B84A 4C04A 2WIAA 1VMEA 3OOSA 1CUHA 4MCJA 4WOJA 1UQRA 3H5AA 3QW2A 4BQRA 3NAGA 3J81A 2R00C 4F8YA 4W9MC 2N3ZA 5CM9C 3PL1A 2ZOSA 3CIOA 3EC1A 1WHTB 2PYIA 4IWYA 3FMIA 4M0LA 5CXUA 4LTMA 2RE8A 3ETCA 5ESRA 4JUBA 4Y1RA 3CZPA 3T3DA 2IX3A 1TUEA 4ZT2A 4JXJA 1BYUA 3OUZA 4Q9DA 4N8DA 3TRHA 1JQ5A 4P33A 3VPAA 5KOHB 3T9DA 4J7XA 1YKSA 1J0AA 5KNDA 5BRNA 2C42A 2LCVA 3D6AA 4TTJA 3U0BA 5LU8A 1J9GA 2I3GA 4LYGA 4YROA 4MPRA 4NFSA 3TBFA 1VCIA 1Z25A 1TVKA 4MYTA 2BFOA 1Z56C 4WCVA 2LLVA 4YJKA 5FPQA 5GM2A 4DBLE 3ON5A 3GLFE 2LYSA 3BWCA 1E94E 3DC2A 3KUCA 1E3WB 3PHBE 4E32A 1XLTA 2EKBA 2JCSA 5HUHA 2DWOA 2GLUA 2II6A 1EU1A 2I7TA 1JWAB 3EQ7A 4LG1A 5D3MB 2QX8A 1CUZA 1QC5B 3AKDA 2P3LA 5JC8A 3QXGA 1Y4AE 3D1VA 1WQ1R 3I6IA 2PU7A 1C1YA 1B6TA 3GP5A 3GCXA 2IHVA 2EKDA 1GFSA 3U49A 2L1PA 4E2XA 4MJLA 2GT1A 1WL8A 4BQOA 4V3CA 2P40A 4IOJA 1BU8A 2RH4A 3JQAB 1SC6A 2HPZA 4BDTA 4Z0TA 5C5CA 3KKMA 2K87A 1QLJA 2EG9A 4KGVA 1DBQA 3GROA 1IJBA 2FTKE 2ZBGA 1C7RA 3DAHA 2YQ4A 3MF4A 3O4JA 4G85A 4U8HA 4BLRA 3CM0A 1E62A 2YYYA 4JV5B 2NGRA 1X8JA 3UYLA 4AU1A 4EVIA 3F73A 4LRSB 4PC3A 4CMEA 4TZ0A 2OAGA 3D81A 5T41A 2ODWA 1FRNA 1PGOA 4H2DA 4NR0A 5IVHA 4UEQA 5BV2P 2ZCJA 5ECYA 3WRXA 4KYVA 1ZX1A 4TL8A 4H7JA 3TG8A 2GO7A 2YVAA 4Z2YA 4MHTA 1SUFA 3MD9A 1YHNA 1UXCA 1KY3A 4EG8A 4KQ1A 1ZUHA 1QV7A 4EX7A 4LX8A 3FBWA 1QFSA 4CLDA 2PLFA 4JROA 2I1WA 1SKQA 2CLMB 1PFKA 3Q3VA 2AFIA 1XD8A 5FPHA 2J85A 1KJ8A 3CZ5A 4ZI2A 2B2XA 2BEUB 2PVCA 3ZWDA 1XU4A 4RA9A 1V6SA 3OQOA 1IBKB 4YWHA 2EARA 2W71A 2OQ2A 2F2TA 1NJ8A 2G17A 2QN8A 3AKEA 3KNZA 3RASA 3V2IA 1GQOA 3WGTA 3IRUA 3OWQA 3V4FA 2V7VA 4WVFA 4KE8A 5AVUA 5H5JA 2IEIA 2IK8A 3JZDA 3QWAA 2O8DA 3TQCA 4EHFA 5HCIA 2O1WA 1SXJB 4CIVA 3PGLA 5BR1A 1L4FA 4OUKX 1XMQB 1ZEMA 5FA8A 2HIHA 3MCWA 1G7RA 3O7MA 1C9DB 1XYGA 1V25A 4NZMA 2Q5FA 3ZLBA 4DMKA 5ER9A 3BH6A 3ECCA 3GNSA 1L7PA 2WNIA 3O8NA 2IKSA 3O3CA 2SCUA 5DYYA 1Z5PA 5HF5A 3SZMA 5CVCA 3T5BA 2H4WA 4DJDC 4CLRA 2Q4DA 4P92A 5IMSA 4F6RA 1QO0A 2IOYA 2JNWA 3P97A 5FP0A 4F8EA 1POXA 1XTJA 4TQ9A 3FDZA 2A9RA 2ZUSA 3CVOA 4Y2VA 3QVGB 4QEDA 4QYWA 2B9EA 3ET5A 3KYIB 1JAHA 3BL8A 3N0RA 1HE2A 1RSZA 4G1VA 4CT0A 1NJ1A 3G88A 2Q1YA 4YCLA 2NU9B 2AMYA 2O7SA 4OMDA 4C7OB 2IBSA 1RZSA 5AW8A 3UBTA 3INGA 3OZGA 2QMOA 2W6ZA 4ES6A 1U5BA 4C7MA 1WVIA 3LPMA 3A3NA 3VSBA 2XCQA 1J7JA 3IDSA 1J2UA 1VLMA 1YB5A 2RGYA 3OPYI 2FX3A 2ORIA 3WFJA 1AO0A 1P4GA 3QZUA 5CX1B 2EFCB 4BNJA 4BV2A 3EHEA 3HRKA 2QX7A 2C7VA 3TBKA 2P5YA 1IE3A 1S3IA 4I8XA 3K72B 3IIKA 4Q9JA 5CVEA 1VFNA 1GT91 2WD9A 4ZXFA 3Q0EA 2J7PA 2VPWA 1MABB 3MZ0A 2QAIA 4INAA 2CWDA 1HRKA 3SYKA 3RC2A 5ULLA 3PE6A 3T06B 3ENZA 4D6XA 1RVV1 4LRTB 4YHHB 4YAOA 4G89A 1XP8A 3HVKA 1S7EA 1SXJD 2N42A 1QK3A 4L6AA 2J48A 5AK4A 1SCUA 2QTBA 2XWJI 2JEZA 3DE1X 4QAQA 1K0FA 1U2PA 1NE2A 2GZ2A 2O2EA 1CZOA 1Z2DA 1Y3IA 2VOJA 3CUEF 4K26A 3MELA 4WINA 3VKHA 2PAAA 2I4MA 4UBJA 2O3QA 4O0LA 1DEHA 4BZQA 2WD7B 1NUSA 2C3OA 2ZPTX 3C4QA 4CIAA 4FBGA 3D7NA 3QFSA 1B8VA 1Y3AA 4HXYA 4XA8A 4ENPA 4R0MA 2YHAA 2C4HA 3SBEA 3P4YA 8AT1A 4HB2A 2GM9A 2QJWA 1QOPB 4B3SB 2PVPA 1KGSA 3U13A 1NP7A 1U6JA 2UYCA 1KBZA 2JA1A 2WJ6A 1IPFA 1XNQB 4BXOA 1KP3A 2LCFA 4NBVA 3DOCA 3JTEA 1OI2A 3RAJA 1WKBA 3FYAA 1ADJA 1WCIB 3HO6A 3TCNA 5KVQA 1MX5A 2A0WA 2C7PA 5AM4A 3GJ3A 3QJGA 1KIMA 4BMSA 1I3MA 1NASA 1U5CA 2V45A 5P8WA 4CR7A 3CROL 2IH5A 2KPJA 2QLTA 2IOHA 1F8XA 4QA9A 1WD7A 1DL5A 3EMKA 3R4CA 5I6DA 4P0QB 2Y99A 4XIIA 3BXEA 4XTRA 5KWJA 5FJIA 4B5KA 3S29A 4GC5A 1KQPA 2QQEA 4WK2B 3M0EA 1YE3A 1EE1A 4NG4A 3DW1X 1FX1A 1K8XB 1PHPA 2IFTA 3HCWA 2Q8PA 3JPWA 3JYPA 4GI7A 4IW3B 4F60A 5B30A 1YZUA 1SU7A 1Y98A 2LNDA 2XOEA 1X7GA 3SZGA 5C1BA 2VKQA 2IEDA 5FUVA 3UMMA 1VM6A 5HJ7A 2R86A 3TK1A 2JFXA 2ZBUA 1O58A 1VCNA 1WNFA 1U8FO 2BSAA 3BRWA 1YONA 3CJRA 3B1ZA 5JCPA 1N57A 1E3QA 2ZUUA 4KMSA 4MWDA 4L8VA 1QGUB 1OB5A 1FFAA 2QU7A 1XJ0A 2PR7A 4QJ4A 4B85A 2WWRA 5K4GA 1SB8A 1FMJA 2OORA 5DHPA 1U8CB 5JECA 5C81A 4PRYA 4LF4B 1M1YB 1RMQA 3IT1A 3RVBA 5AJZA 2FYTA 2IP1A 4ZAVA 3GIWA 1ZZ7A 1F51E 1T4DA 2HZBA 1BXZA 3V8PA 3O1LA 3NH6A 1AKEA 4A0QA 4JJAA 1W88B 3HXPA 3M6VA 2OCAA 1OBFO 4KRYA 4MGHA 5C4GB 4D3ZA 2MWMA 3PC8C 4NZNA 4DIBA 4NYJQ 3WI7A 2VJQA 3UXHA 1I1OA 1OI3A 1UFRA 2BMAA 1WZNA 1CR1A 2DKOA 4MQEA 3DZIA 3JRNA 5JANA 2EF0A 1B0AA 2XZTA 1NBIA 4RY8A 2R6GA 2A7XA 3IIEA 4NXMB 3TOCA 1CIPA 1JU4A 2INGX 1Z06A 2QTMA 3KK0A 3O93A 3U4QB 4Q6BA 2BFFA 1RJ9B 4PXSA 4RIGA 1NG1A 3PNKA 4LGCA 5IHXA 3GFVA 3Q5GA 1C1HA 5FPYA 1SPBS 3CNHA 1XZGA 5HUQA 5NULA 3SLKA 3HN2A 1EUDA 2W4IA 3NXKA 3Q0TA 3T7RA 4B09A 1HE5A 1R74A 2PUWA 1T9BA 2YTZA 1RYHA 1GNPA 3D6MA 2IPAB 4HAYA 4X60A 2IU6A 4YI5A 4JLWA 4LYAA 4GMDA 1ZMRA 3AK4A 1J49A 4X1YA 3TRKA 3AEUB 2O50A 1JQDA 3H4IA 1QANA 1UIMA 2C2OA 1PX2A 1W85A 3ABQB 3D6HA 4J6EA 3JATB 4ND8A 4FIDA 3U17A 4I5DA 1GFIA 1KSJA 2LLWA 2CXPA 1QYRA 3K7EA 1J0EA 3ZVNA 4GS5A 1PUJA 3G59A 3I9FA 1Y1TA 3IP9A 1LXCA 1Y9QA 5IC4A 3LF2A 2EFEB 3ZWYA 2BFBB 4HUJA 1DV2A 2IU4A 1NVAA 3IMFA 1GPNA 1R9GA 1KK0A 2P9BA 3UPDA 2OHIA 2OCIA 4F93B 2VYVD 1Q95A 1RYMA 4HAXA 3VOSA 4D42A 2PXDA 2GPWA 5BR8B 1F5SA 2AR7A 2EQBA 2I6SA 3LMKA 4H08A 4XEUA 3ZU4A 1K4YA 2PYDA 3DKIA 4EI8A 4ZCRA 1GPKA 5A62A 4LECA 4LCBA 3OEHA 1EFVA 2AG1A 2WU4A 4H4EA 5EZYA 1AN9A 1OC2A 3FCCA 5JNSA 3C70A 3DDZX 3CZCA 3NVMB 1KAEA 2BDEA 1JEAA 1F06A 1HNNA 2XYQA 2FMXA 3NHMA 3RGWS 3OLQA 3OURA 3NBXX 4JVOA 3SE7A 4UM9D 2FWMX 3AI1A 4RAOA 2FK7A 1DG3A 1LCIA 5LJIA 5K0NA 4QXPA 4HEHA 4K40A 3ZLUA 4GBED 3W3AA 1AUPA 2G8NA 1ML3A 1QZTA 3R74A 1GUBA 1AZSC 4NE2A 2NZVG 5A3VA 4I6TA 1T2EA 5HF9A 1XD2A 3VRHA 5J3JA 1L7QA 3GBFA 1RWPA 1OLSB 3KXAA 1XKLA 4QUJA 5T67A 1ODCA 3EG5A 4ANFA 1TF5A 1V6AA 2FUKA 3U31A 3X1WA 5JH7A 2NUAA 1NOKA 1KEEA 1HG1A 1GN9A 3DM9B 4JKIA 5CM8B 4O59O 4ERXA 3C7DB 4JP8A 4DV0B 1MW9X 3UJPA 3SEQA 1UJMA 1ACJA 3UTDA 3W5BA 5KAPA 2G3YA 4YT2A 1MFPA 1N78A 4XFKA 1D2RA 1MH9A 1F20A 2GN1A 1DBVO 3HL0A 4LRQA 3TRJA 1U98A 4HO1X 3NEPX 2HHAA 3I04A 1ACMA 4K6MA 1KPGA 2ZDGA 2P9YA 1P1FA 2MSWA 2ONYA 4R1PA 5DCLA 5GOZA 3STHA 1Y80A 3N8DA 4JDUA 4MV0A 2VYNA 1VE1A 5ELLA 1U8YA 3Q7PA 3EAGA 5ALPA 5B1SA 3RK4A 2VDMB 2NADA 4KXYA 4WLVA 4Q9HA 3SICE 4AG6A 2FQXA 1XU7A 3DDWA 4G1FA 3IJ5A 2QTNA 4WKPA 2CJYA 1Z6XA 3AFOA 4OA5A 4WZAB 2HRZA 2AG6A 2IYRA 2AN5A 2QTHA 3NYRA 2I3BA 1E4EB 5FNVF 1F17A 2YL2A 5MGNA 1XPOA 4F6CA 4IV0A 3HLYA 5DYGA 4ETIA 3UJNA 3MC1A 3F74A 4Q3CA 1F0PA 4DC1A 3GEEA 3D9QX 4QXRA 4FJ0A 1RZRD 4LNHA 2V58A 5EHGA 2JLWA 1FYDA 1KDPA 4WVLA 4N82A 2DR0A 4XYEA 1PFVA 3DEHA 4K87A 5IX8A 4LAFA 4LSWA 4PS0A 2L2QA 2A9PA 3NVDA 4X9XA 5ECGC 3ZX5A 4RIIA 4KMRA 3RFUA 1V5EA 1KPIA 5GGXA 3BD9A 1JTVA 2VSOA 3EFOB 1X7WA 5CLQA 2VQDA 3WMFA 3IJRA 2PZFA 3I6BA 3W5UA 4YG1A 2WT8A 3R3JA 3CLRC 3ACDA 5AXCA 4B34A 2WP0A 4LHSA 4YLGA 5SY9A 1WB5A 1Y9JA 5B12A 1QHSA 4ENSA 3GEPA 4IFEA 1T9GS 3UJ9A 3ZDCA 3KJEA 1OAKA 4TLDA 1T4CA 3UQYS 1NN3A 5GQSA 3UANA 1FPQA 3IPYA 3B9BA 1Q3HA 3JVVA 3ANXA 4A73A 1YMUA 4R6XA 1PNQA 2HMUA 4MP8A 3FCXA 3L43A 5ADUS 4DJEC 1XVVA 1JDVA 5TQ0A 3WG9A 1DT5A 4I6GA 4X4DA 2BMEA 2JDIA 3DFKA 4R8MA 2CHVA 4FFLA 3PGXA 4D9CA 2DGDA 4O4HA 3A9TA 4YMIA 1OASA 3GEMA 4ER5A 1Z36A 2MJLA 5F73A 4NCHA 1YRLA 4KQIA 3IP6A 1H42A 3P5BA 6GPBA 3LHSA 4GMHA 1YT5A 5AK3A 2BUBA 3VPDA 5KX5B 1N7JA 4L4XA 2VLIA 4KQEA 5CK4A 4ARSA 4O2BF 4B1FA 3FOBA 4HRVA 1K7CA 1KO4A 3F6RA 2QDXA 3G0GA 2J33A 2KM1A 2QT0A 3DQQA 8ABPA 1QKKA 1HDIA 2NYAA 1YDEA 2V7GA 2PRIA 4I36A 4KLZA 4Y1RB 3VJKA 1W4AA 2OWDA 2ZQYA 2QORA 3I28A 2XI4A 3ENNA 3ANYB 3R7FA 2NSLA 1V9CA 3GPIA 1RLIA 1SRQA 2FWIA 5DNVA 2EP7A 3GIDA 1MP0A 1JLSA 4DR7B 3GJTA 4NCKA 4BNTA 1PVDA 5KTKA 2PLWA 3OX4A 1SBNE 2OSVA 3H2BA 5EKTA 4H0NA 4RXTA 1ORWA 1N36B 3OLXA 2VJMB 2QP4A 1KO1A 1SOMA 1ZN7A 4BMXA 2BFBA 1N3LA 2H1SA 1P0IA 4PQGA 4X4CA 4WAUA 3W5IA 3RQIA 4CQLB 1M2NA 4V0OA 5D84A 2OOKA 5DP1A 4GECA 2JKVA 3BXFA 3E05A 5IMBA 3BDAA 2ZAOA 2PSFA 3Q8KA 1IRIA 1HL3A 2G09A 3OTQA 1T2UA 3Q10A 2G07A 5AK6A 1L1RA 3RDPA 2CZCA 3UMYA 2HLDD 3MGAA 2C4WA 1DJMA 1J8QA 1GUAA 1SRRA 1NYTA 4GLFA 3BDNA 2TSYB 3PJEA 2DB3A 2EXXA 1QHFA 4PCVA 4W82A 4YO7A 1DMRA 3L04A 4CM8A 1PLLA 1SQ6A 1ENOA 3EZ9A 2QAGA 2CMHA 3FPAA 3HDHA 3O8BA 1F8GA 4C4ZA 2O5RA 5KSOA 1UJ6A 3VYRB 3V1KA 3FMYA 1TIBA 3BGIA 3FSEA 1MRSA 1IIRA 1DCFA 2D5CA 2EGGA 4US1R 5JXJA 2F00A 4FYHA 2BI8A 3A4TA 2CLCX 3FFXA 1RFGE 1ZONA 5DHFA 1ULUA 3V8MA 2QSUA 4BWYA 3U40A 2X5XA 1E64A 4EYSA 4UM7A 3QVXA 3BSFA 1VB5A 4QOEA 1VLHA 2CUZA 3SSNA 4EGQA 5CFNA 1G16A 3C1AA 4BGEA 4EL5A 5K0CA 2ZBFA 1U2TA 2GYVA 5J2UF 3U5TA 2DJ5A 1I7QB 1KXJA 5AYVA 5F77A 1TI7A 2VEOA 2VHYA 3WWCA 2PS0A 4RLFA 1FTQA 2P35A 3CF4G 4QICA 3K8QA 2VOEA 3HBLA 3KM0A 2IKQA 2XNCA 4ZVOA 4K9NA 4OA8A 3WGGA 1M0TA 1XD9A 1M34E 1U3VA 2IXGA 4UMFA 4Y2UA 4ZQCB 5FI5A 4YRDA 3SX0A 1LX7A 2WM2A 1R18A 3GMDA 3MTDA 1P8JA 3SS8A 4DG8A 5K6RA 3LL7A 3CSUA 5DU2A 1GTMA 1L7XA 2BNOA 3MCAA 4PRZA 2O8FA 2C4VA 4J03A 2PAFA 4Z7OB 3QLUA 5T4FA 3SQOA 3E22A 3UHOA 3UHAA 3VNRA 2VHQA 4BPRA 4DLBA 5J2TF 2OQRA 3B85A 7REQB 4ZGWA 3W5HA 2PH7A 1GNVA 2Y1KA 1EG2A 3P7MA 2HA3A 3ZE6A 2XVMA 3FAKA 4MPPA 2Q7DA 3OOHA 4JJ8A 4S12A 5ALNA 3ZCTA 2ZB3A 3B12A 3HCEA 4RIEA 5IBRA 3ZN2A 4GNKA 4NF2A 1PJBA 5I4KA 3A1FA 1CS0A 4F5WA 1XEXB 1EHIA 3DMGA 4LW8A 3FWKA 1IM5A 4YMSA 4ZT3A 4JENA 1WTCA 2VXYA 5LQCA 4QPCA 3PV0A 3R7AA 1QU3A 2PLRA 3LP5A 5AFSA 4P4SA 3JVUA 3HJFA 5LZ5A 2FG7C 2VNKA 2W0SA 4Y6SA 2FY8A 2QTCA 4QG3A 2ALJA 2HDHA 3EA5A 2Q46A 1ESDA 1BJRE 2FW6A 4MUGA 3RYHA 1P0QA 1J2TA 2HRRA 1PR2A 4GX1A 3IEKA 3E7WA 4EO9A 1E2MA 1HLPA 3PNSA 2WIUB 2AJ8A 4UD2A 3I83A 2I29A 1H4SA 1FFYA 2GK6A 2QIOA 4DW8A 4HJXA 3UGJA 2LPMA 3K92A 1KA9H 1WVMA 3EQZA 5ALXA 3N58A 2BE9A 3C2QA 4F3CA 3EFBA 4FGWA 3ZUPA 3EPJA 3H83A 4C4OA 4MEJA 3LUJA 4E22A 1LC0A 4MW5A 4M9QA 1SKUA 3IMCA 4QXAA 3ZHRA 4RZQA 1JA0A 2R87A 4D9EA 1PKEA 3EZ2A 3WSWA 3R0IA 3JQFC 5ISMA 2B4AA 3TCKA 4QGAA 3DVLA 3V48A 1MO4A 1UPFA 4JX8A 3ZYZA 3UH0A 1M3SA 2J30A 2YMLA 4NJOA 2IEBA 3OT5A 1HETA 1V35A 4EW2A 3SXUB 1A9PA 1QP4A 4KR0A 3O3MB 3QPBA 2ZRBA 3BREA 4UTZA 5DF1A 1G6KA 2MU1A 3NIWA 1L1FA 4ZZ2A 3QVKA 4WJZA 2VYQA 3H04A 4B83A 4QUAA 5BP7A 3UB2A 1YDGA 4ZTBA 3VUFA 4UBNA 4KR9A 2WSLA 2PX8A 3K70C 4B79A 5LR6A 3F4LA 2OCBA 3F78A 4WN9B 4FVTA 5A3JA 5CFMA 1UINA 5J4LA 5TQJA 5DBHX 2R6FA 3A9UA 1AGYA 3V4PB 3LGSA 4C2AA 1OFVA 9GPBA 3D3WB 3DCJA 2PIJA 2QRKA 1VG1A 3OZUA 4GL4A 3PF9A 3TO5A 3WLIA 5HWSA 2YWBA 4E51A 2ZJ0A 5CLJA 1VKNA 1K3FA 2DCUA 1RYDA 3OIYA 1LVUA 3AR2A 3QFRA 4OHPA 5DISB 1QV6A 2GD0A 3F7NA 3R2JA 1CD5A 1TYBE 5GOTA 1KK1A 1XZBA 2MYPA 5A4KA 1H0SA 3AM4A 5H3HA 3UUEA 3RAEC 1Y7TA 4HX2A 2HA5A 3AVQA 4X6XA 4NU8X 1L5QA 4P22A 4Y9TA 4S2UA 3NJ8A 3SHFA 2B3DA 1D5CA 3DE0X 1FFEA 2OG2A 3AUKA 1HT1E 1UDBA 3LQ2A 4XDZA 2IQIA 3R40A 4G41A 5IJZA 1YXMA 3N2GB 3IUYA 4S0ZA 3ZY3A 4FYJA 1Q57A 1KZYC 1N0HA 2OQVA 4GZMA 4ZOLA 2H1CA 1I8TA 3FMPB 4E2FA 1BWPA 1X0VA 1ZK2A 2NU6A 4NCNA 4HDOB 4P3PA 4QUGA 3VHQA 3HB7A 3ENKA 1N2CA 1IBSA 3NBQA 4ALKA 1D8AA 1M8JA 3A32A 4TUYF 2X86A 1KAGA 1RJEA 2QMYA 1WTAA 3KJHA 3BMXA 2JASA 3B5JA 4MPDA 2ZBQA 1Y3CE 5KNBD 2IYXA 4EHJA 2A1TS 5KX5F 5L51A 2BFCB 1ZLXA 2PRSA 1TVCA 2WSYB 2YY5A 4MLDA 3OU6A 2QX9A 2A30A 1SCAA 1VHTA 2ZP1A 1EGQA 3F5SA 2SKEA 3IDAA 4FZVA 5BWLA 1RAEA 2PNFA 3Q7QA 4PYNA 2WMOB 2ZUFA 1H1DA 1ZHOA 2FFAA 4XARA 3CNBA 4ZVTA 3F3MA 5DMHA 1CS0B 2PXHA 1U7HA 2GZSA 3QVOA 4QNRA 1BCSA 2R6CA 2HU5A 4A0SA 1P5ZB 3KVNA 4LHWA 1YSEA 4Q18A 1JAZA 1MTOA 4Y6QA 3C3CA 4W5NA 2HDNB 3ELBA 2GB4A 4AROA 4WMLA 1RWXA 2K4MA 2R1TB 4Y2TA 1ZD1A 2ZI6A 3SQWA 1PJLA 1NR7A 5HX7A 4TZ6A 3A6ZA 2QROA 4KXXA 4HDNB 1BKYA 5LA6A 3IBCA 3ZXSA 1CUVA 2HSDA 3OM0A 3NKLA 1RC1A 1SUBA 3HK2A 4Q3BA 4ZTUB 2WKSA 4EYOA 5IT9A 4I4CA 3RCBA 4CZ2A 4UHDA 1BMFD 2ILTA 2Q0HA 4LZWA 2YV1A 3QUSA 3KHSA 2BFEB 2PL3A 1NLZA 4UOZA 1MA3A 4OGFA 5FXMA 4C07A 4OSEA 3EQ2A 2DWUA 2C2KA 2O5CA 3E23A 3FUTA 5BUQA 2FV8A 4O5OA 1EFDN 4KLRA 3HCNA 4LCEA 1VSTA 5KMGA 2PMDA 3HZRA 3N0XA 3ZGYA 1V2HE 5ICGA 3TPFA 4HDCA 5BUSA 5IJ0A 2IXEA 1P39A 5AVJA 4TKVB 2KBEA 5M34A 2JLAA 5DN6D 2G28A 3VISA 5BWMA 3RYCB 3MJDA 2VZ8A 3BWMA 4CR6A 4F96A 2WV9A 1NQWA 2HQRA 1JKMA 1TMKA 3CY6A 4JN6B 1IUNA 1OPRA 3IL2A 4L28A 5ETJA 3LC1O 4MEBA 1XK6A 2RKWA 1RHRA 5EFOA 3UENA 1YNSA 1N0VC 3DA8A 2RC5A 3DHVA 3NTUA 4WIAA 3OPQA 4F21A 3TTYA 4ZEXA 5B7PA 1O8CA 2O3UA 3MPOA 1QB2A 3T41A 4DG9A 2XMPA 2ZTVA 2QXUA 4EG3A 2DSNA 3KB6A 2O05A 5BSFA 3EUWA 2F8LA 1JHZA 2RG7A 1KJZA 2KPOA 3CH7A 1W94A 4DR5B 2I22A 1AVTA 1OIVA 1X1BA 1NHGA 1VZ3A 2WB4A 3K9GA 4CEHB 4KVFA 4Z59A 3WGIA 1GLVA 1YULA 4F12A 3R5SA 1OTHA 4NS4A 1RYBA 4CFZA 2D2IA 2ATXA 4JMLA 3W5JA 3GMIA 5A5GA 2DFVA 3ADBA 1AZLA 3MSCA 1C50A 3LS2A 1D2HA 2VJMA 3PIDA 1LLCA 3WV5A 2JAQA 2DG2A 2YYZA 3OWHA 4X95A 3FMOB 3IAAA 2GHTA 1E2GA 2B8EA 5TPWB 4ZZIA 3QHQA 2MSKA 4M21A 4E5DA 1IVSA 1N6HA 1RWQA 4L72A 4NKRA 5L4SA 4O2LA 3KSAC 3KFVA 4KFRA 4M0KA 4MMYB 5DLYA 2BBTA 2VYVA 1SG6A 2Q2WA 3HPRA 1NJSA 2D5IA 2GRLA 4HN4B 4TWZA 1N25A 2A8YA 4R01A 4UUOA 3SX4A 5FFMA 1NW9B 2OGZA 4JR1A 1HZZA 1FUYB 3QBJA 4IRUB 5ERYA 4RK6A 4O3MA 3L02A 5CFLA 2ZE8A 3T1YB 1QQ7A 4DILA 1I0IA 4OXYA 3CLKA 2FSSA 3IULA 3LX8A 2XYPA 2ZI3A 3M8KA 3OQBA 3PUXA 4LWPA 4BFUA 4D3YA 4BB5A 1PRYA 5BW8A 2Q8NA 4GBJA 1G55A 2Q3LA 3EHDA 3DHEA 3LC7O 1VRWA 2IU7A 1ZK0A 3ETHA 1YBMA 3KU4A 4S3MA 2JGJA 3GCWA 4ZCQA 2VATA 4OQYA 1ZVVA 2WKWA 4IUBS 1WLYA 5H02A 5LDHA 1CE8B 3BDIA 2EWVA 5K8IA 1MAAA 1T9GR 1YDMA 1B0ZA 1D1QA 3KYDA 3NTOA 4HAIA 2EZ9A 3IAFA 4L4UA 1HTWA 3JALB 4B3XA 4MQ4A 1IOLA 1PKXA 2C2XA 3OLZA 4M3NA 4YP5A 1CWUA 1CNFA 4IJWA 3TD2A 1J1UA 1Z8FA 3FDJA 4Q7QA 3GHYA 3WLOA 3CO0S 3DE2X 4BQQA 3E15A 3WNCA 4NJMA 4FMCF 2IP2A 1NX9A 1EGAA 1NBMA 3BQMB 5KWEA 2R7KA 4ODIA 3H2HA 4YXWD 3UCXA 3FDFA 5EP2A 2FSHA 2ZJ7A 4Z9YA 1U04A 3OE5A 5CU7A 3ZHOA 2ISQA 2HRCA 4FJ1A 3WIVA 5LZ7A 4JOQA 2V6JA 3T3MB 4EJFA 1RYYA 4ZALA 1MB9A 5LUBA 3UBMA 1QQ5A 3PA8A 3VH2A 1FVXA 2N0SA 2ZIUB 3CLHA 5I9IA 3MYYA 4G2TA 1GGFA 3PXGA 4AZTA 2BGWA 1UIRA 1U2QA 2H0RA 2NUPA 4UFOA 1E2BA 3EC7A 1Q77A 2Q41A 3AJ9A 2JD1A 3DLCA 3NRCA 4PSVA 5AI6A 1WKVA 3R3HA 4IUCS 4RACA 3TCXB 3B7PA 4I5FA 1ICIA 3ZEAA 1PT9A 4GKBA 2FG5A 4GW3A 1E1CA 2XF8A 3FTDA 2RI1A 5A9SA 2GWRA 5AW1A 4XKJA 4ABTA 2HLHA 4GPD1 2HWKA 3ECSA 4UMDA 1CEYA 1TRKA 3G13A 1S8OA 2X1VA 4JT9A 1DRWA 4W9RA 1KQGA 3K6SB 1X2LA 2B5OA 3FPEA 1X15A 2CXTA 1QP8A 2QE7A 1GAJA 2VDNB 3HJGA 4OH7A 4DB4A 4HQKA 4PYIA 3PSAA 3QKIA 1QIIA 3M6WA 3A36A 4S2EA 1GAWA 5FUQA 3D8RA 3NYQA 5FLKA 2DKNA 2JGDB 1SC9A 3B6KA 4HB0A 2XUPA 1EJ0A 3A3KA 3K9WA 2NN3C 3NIGB 4K9SA 4JSRA 1TJ5A 1A9ZA 2YHIB 1U8AA 4FZ5A 4AUKA 2FPOA 3GLIB 4YCNA 4I1PA 3ZDBA 1D1PA 4FDAA 2XUZA 1E5XA 3PCXA 1TADA 4YK7A 5CW2A 5EZQA 1KOGA 1LRKA 1OXXK 1W0CA 2I2DA 2HSJA 3AO0B 2AX3A 4UQPA 4XJVA 5AQEA 2UZ1A 1WSAA 3ITNA 3ZTYA 3F6WA 5AI9A 2ZSDA 4X63A 3TW6A 4M55A 3U5ZB 3PFKA 1CQIB 4MROA 3QFCA 4XD7A 5HKOA 4ACAA 3BZWA 1I51A 3NXHA 4G0QA 3NTQA 3ZNOA 4JYZA 3LA6A 1T9DA 1Z2CA 2FUG1 2NXJA 3G79A 4NEHB 1PR5A 4G84A 4QGBA 2X2OA 3FCOA 2I2BA 4C4YA 3OTWA 1XI2A 1KEWA 1E9SA 3NPMA 3CRZA 4YRNA 4PR0A 1U28A 1GP2A 4O8CA 2PX5A 1O9HA 2HRBA 3I2HA 3M5PA 3QP9A 4M1ZA 4BMCA 1QO7A 2VDUE 3D6JA 4AP9A 5D1HA 2G0NA 1OGJA 3DHNA 5CLIA 3ZDAA 4ILKA 1LDYA 1K8YB 4DSTA 3NC1C 2ZWIA 5SZHB 1YR6A 3T94A 5KOYA 4ZI3A 1BVHA 5FJJA 1KFJB 4MQMA 5BNIA 3DDCA 1L7MA 1A7JA 3SK0A 3UAXA 4AS3A 1SKAA 4XD2A 3QEAZ 1N5IA 1LZLA 1PG0A 3FSJX 4D82A 2SNIE 1QGUA 3K1AA 2ZS7A 3GV0A 3ROEA 2Q3MA 5CLFA 5IAOA 3NFYA 3D3JA 4KQGA 4A2WA 2CE7A 4XVUA 1DGQA 2D13A 3DWGA 3PQ2A 3L5KA 4NATA 2GR9A 2C0CA 4YRFA 4QPPA 4DSOA 2EFGA 2Q9AA 2XE7A 3QVSA 1T1JA 1P60A 4D9BA 2AHOA 2JF0A 3RKUA 4BO1A 1Y7LA 3F9CA 4I4TB 1FS5A 4F72A 1BH6A 2J0QA 2PSSA 2HLDA 4ZVQA 3ME5A 4EPWA 3WA7A 2I03A 3CB2A 3PQDA 4H6WA 1T2DA 1SAYA 1HQ1A 2OXCA 3QXCA 4RTPA 2ASEA 2WRZA 3LLSA 4BX3A 4CMBA 1H6DA 5JH7F 5CXQA 2RBGA 3ASYA 2OKGA 1TYEB 3ASVA 3A26A 4XLZA 4MVWA </