4EKLA

Akt1 with gdc0068
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
335
structure length
329
Chain Sequence
RVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPSMECVDSERRPHFPQFDYSASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An ATP-Site On-Off Switch That Restricts Phosphatase Accessibility of Akt.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords RAC-alpha serine/threonine-protein kinase
total genus 100
structure length 329
sequence length 335
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eklA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eklA01
3BLRA 3UBDA 1K9AA 4BWKA 1OL6A 2PZYA 4ZSAA 5A6OA 3U6JA 2R3MA 3U8WA 1UU7A 3EQBA 4S33A 2BR1A 3D94A 4UXQA 4YO6A 4M84A 4WO5A 5CALA 5AR3A 4FK6A 2YZLA 2CDZA 1RJBA 3T9TA 4C35A 3ZTXA 2PMLX 1U54A 3FMLA 3W2RA 2VWVA 3FLQA 2WTWA 5AV0A 3EWHA 3R8LA 4I5CA 4D9UA 2FSLX 3PE1A 2IN6A 4ZMFA 3BYOA 2JDVA 4JDIA 5JQ5A 1J7UA 3WILA 3TDVA 1WBVA 2VWYA 4HCTA 2HWOA 3S0OA 2JAMA 3MVJA 3FL5A 5FEDA 5E8UA 3BGZA 3NGAA 5EM6A 2P33A 1ZOEA 4I0SA 3CKWA 5CI7A 3KA0A 3VS5A 4F0FA 4B99A 5IQBA 3FMKA 4A4XA 2A27A 2W9ZB 3JVRA 5AMNA 1Q62A 5D12A 3TTIA 3VQUA 4HZSA 5FXQA 3WF5A 2WMVA 4JAJA 4S32A 5DA3A 1AD5A 4OTGA 4WNPA 5FM2A 2HELA 2QNJA 1JKTA 5M09A 4C4HA 1YKRA 4LUEA 2PVYA 1A06A 2WTKB 4WG3A 2ONLA 2BZIB 4TYGA 3DPKA 3KK9A 4RJ6A 4NTSA 3ELJA 4RVMA 1S9JA 4EOPA 2YEXA 3QAME 4YC8A 5CF4A 5DMZA 4RT7A 5I9ZA 2QO2A 4I24A 4YU2A 3R8PA 4GVJA 2WMUA 5IA5A 1CDKA 4XLVA 3UZPA 5HEZA 3BRBA 3MI9A 3W2QA 4GYIA 3GFWA 1SNUA 4FE2A 3DT1A 4KUJA 4R5YA 4K11A 4AUAA 3QTXA 4OTIA 4IAYA 3F3ZA 4GS6A 3QTWA 3HMOA 3Q4TA 3QX2A 4U0IA 4ANOA 4FT9A 3DJ7A 2EXCX 3D2KA 1OZ1A 5BUIA 2XNBA 3EMGA 4RFMA 3FHIA 2YACA 3R1NA 4UMQA 3F3TA 5CX9A 4QYYA 1JLUE 1W98A 2J0KA 3A7GA 5E92A 4DCAA 4G34A 3ZHPC 1OIQA 3ZO4A 2HW7A 3EL8A 3TNHA 3FKNA 3TXOA 3UNKA 4ASDA 2X1NA 1XH9A 3OW3A 4JRVA 2IPXA 3QCYA 4MBIA 4ZXTA 4RA4A 5I5ZA 2UZUE 4GFGA 4YJUA 4DFYA 3TKUA 3PUPA 3P08A 1TKIA 3C0IA 3OS3A 4I5HA 4CD0A 2IG7A 4QP4A 4FNYA 4BI2A 3F5UA 4QP2A 4AZWA 3WZDA 4XMOA 3OVVA 4FBXA 5EM8A 4DA5A 4CG9A 5CZIA 3M11A 4JRNA 3G51A 3VHKA 4D2SA 2BTRA 3EHAA 3DTCA 4EL9A 4WG4A 2IZTA 4DBNA 4JDJA 2RIOA 2B0QA 2JC6A 3TUDA 4EQUA 4G2FA 2YZAA 3ZU7A 2WIPA 1J3HA 3ORTA 4GU6A 3V6RA 3ORZA 3DXQA 3FSKA 3I5ZA 3Q4CA 4PF4A 4QP7A 5EYDA 3RAHA 3NAXA 2WOUA 2XKEA 3FMJA 1X8BA 5H3QA 4WUAA 3UVPA 3ZH8A 1CMKE 2GNGA 4R3CA 4YURA 4YTIA 4BGGA 2YERA 3OT3A 4QMNA 1H08A 3JXWA 2UVYA 3ZEPA 3ODZX 3UDBA 2R9SA 4PPCA 4E4LA 2WB8A 3O8TA 4JG7A 4XYFA 5HG8A 4YHFA 2I0HA 4X6QC 5TT7A 4XV1A 3SG9A 4DFLA 3QLGA 4FIGA 4RJ3A 4YZNA 3UTOA 4NCTA 1ZARA 5FTQA 2OBJA 3ALNA 4GJ3A 1XO2B 1HCLA 3QYZA 2XCHA 1Y6AA 4YJPA 1Q8WA 5EI8A 3QCXA 3NX8A 3SXSA 4F08A 5K4JA 5IEYA 4D2TA 5DOSA 4U41A 4CQGA 1WMKA 1U4DA 3FLWA 4IVDA 5CVHA 5IA3A 3FQEA 3TZ9A 1OPLA 2GMXA 4PQNA 3G90X 3K5UA 3TNQB 3LQ3A 5IEXA 4DF3A 2Z8CA 4C61A 2VN9A 5M4FA 2CKQA 5IQAA 5C4KA 4IBMA 3NUUA 4NYEA 2A0CX 4DG2E 2J4ZA 3LMHA 1OITA 3B8RA 4XG6A 4IC8A 3VUTA 4C0TA 3E87A 4YZ9A 2YIXA 4M66A 3MFUA 4I0TA 5AR7A 1MQBA 3UOKA 4CNHA 1SZMA 2WZJA 4AGUA 4O6EA 1PMEA 3TUBA 3GU4A 2OJIA 4DN5A 4MWIA 4XBRA 2ZB1A 3NUAA 4TRLA 5KMKA 4AG8A 4ITIA 4FTKA 3EKNA 2Y9QA 3GENA 5IUIA 3TIZA 4UWYA 3MY0A 3HA6A 4BL1A 4PMPA 4D58A 2X4FA 4H3PA 2CCHA 1ATPE 3QD2B 5B2MA 2BAJA 2C5NA 4PUZA 4LV5A 4IFGA 5EFQA 2PPQA 5FGKA 1OIYA 3H9FA 3QHRA 3FYJX 2BRBA 3DFCB 3H9RA 3E3BX 4DTBA 5HQ0A 4PX6A 1G5SA 4L01A 3DNDA 4ZZMA 4EH2A 2C3IB 3DKOA 3ZOSA 4CFNA 4V05A 2O3PA 1PMNA 3BCEA 3C4ZA 4D4VA 4BZDA 4L3LA 1CKPA 4ZY5A 4BCKA 2WHBA 1EH4A 3Q4UA 3CD3A 3OCSA 3LCKA 2V62A 3F5GA 3AC4A 2VX0A 2ITQA 2XIRA 3HMNA 2OU7A 1UU9A 4A4OA 2C1BA 4O0RA 3CIKA 2G2FA 5AJQA 5J79A 3BYUA 5BVKA 2GHLA 5E8VA 5GIPE 3ZO2A 1VEBA 2GCDA 3KXMA 3HP5A 4IWPA 2NRUA 2WTVA 5CSHA 2VO0A 5EYCA 2YIYA 4E6QA 3DOGA 1XH6A 2BZJA 3MDYA 2VWIA 3O8UA 4YJVA 1ZRZA 3VAPA 5L6WL 4CCBA 5EQYA 5CEQA 3UC3A 2JDTA 3R9OA 4LFIA 5FXSA 3AGLA 4OAVB 5GNKA 4RIWB 2GS2A 1H1PA 4W4XA 2AC5A 4FKRA 4XNEA 4CT2A 5KMNA 5LOHA 3R71A 4MXAA 3FI3A 2WXVA 4FVQA 2PZRA 4ID7A 1H26A 4ZK5A 3QKKA 4DH3A 1IRKA 3LM5A 4LOQA 4DGLC 4MXCA 3RI1A 4ACGA 4EKLA 4FA2A 3SAYA 2VWBA 4GKIA 5BX0A 3BGQA 2J2IB 1Q4LA 3BYMA 2UZVA 4DEAA 3BEGA 2OK1A 4H3QA 3E8CA 4NM3A 3GC9A 3L9NA 3GNIB 3VF9A 4EK3A 1UKIA 5J1VA 1Z9XA 3IDBA 3QTUA 2DWBA 5IISA 5IMEA 3GC7A 3EJ1A 3ZDIA 3SG8A 3IPHA 4BGQA 1H0WA 4XG3A 4EEVA 2GSFA 3C4WA 2JGZA 4G3GA 1JAMA 3QRUA 4BCJA 5AP0A 5CSWA 4I21A 5DRDA 5L3AA 1PKDA 4BDCA 3OZ6A 2GNJA 4CRSA 4NL0A 3GT8A 2YCFA 1JVPP 2B53A 3C4FA 3DK7A 1Q99A 4XG7A 3NNUA 3CR0A 1WBNA 4IMYA 3KMWA 5A4EA 3GC8A 5A46A 1NW1A 1U5RA 2BRHA 3D7TA 3N4TA 1Q8UA 4EK4A 4UWCA 3AD4A 4PWNA 4DLIA 3ROYA 3PA3A 4RJ4A 3F66A 5CAOA 3T8OA 4UWBA 3BHTA 3ZO3A 2PVMA 4C4IA 3Q9YA 3GP0A 5CF8A 4BI1A 3LXPA 4QT1A 2GQSA 2WQMA 5EI2A 4NCTC 1DAYA 3A61A 3A99A 3RGFA 2W99B 5F1ZA 4FICA 2A4LA 3VUMA 4QMPA 3ZLSA 4Q2AA 2GQRA 3GC0A 1WCCA 1MUOA 4XP3A 3PWDA 3ZEWA 2X8DA 4M13A 4EOLA 5IF1A 4HYHA 4UMPA 1J7LA 4GKHA 4MF0A 5T6KA 2X2KA 4K8AA 2UW0A 3QQUA 3MB7A 5TE0A 3C1XA 2OXYA 3RALA 3Q2MA 3CSVA 3DQWA 3SHEA 4TTHB 4FTTA 3RTPA 2QVSE 4G1WA 4I94A 4LM5A 4BHNA 4HVSA 4C36A 3EFLA 2CKOA 3QQHA 5HNGA 1OL2A 2W05A 4BCHA 3NUXA 3KXXA 3CTHA 3QKLA 4E6DA 3R22A 3RZBA 4GT3A 3RPSA 3WZEA 4PDPA 4D1ZA 4DH5A 3ZM9A 2R3IA 2R3FA 5HLPA 4AZSA 4EUUA 1G3NA 3DBFA 2PVJA 1SVHA 2PZPA 4B0GA 4FSTA 1IR3A 3UO5A 4DLJA 4ZY6A 3WZKA 2X6EA 2BRGA 5KCVA 2RGPA 4QYEA 2ZMDA 3FKOA 1BLXA 1Y8GA 4H58A 2VZ6A 4P4CA 4OW8A 1PXOA 4ANLA 2WQBA 5FP5A 3OWKA 5LMKC 2B1PA 2OJGA 1JOWB 1OIUA 3PVBA 3PXZA 4E93A 4ZP5A 4YMJA 3UOLA 3KRLA 5HICA 4FSRA 2R7IA 4P7EA 4O84A 3IGOA 1FPUA 3ZFMA 2BKZA 5M55A 3GI3A 3IONA 5ETFA 3ZUTA 2ITYA 3TIYA 5I0BA 4J1RA 3BE2A 4EOKA 2QKWB 3HECA 3W55A 4CZUA 3GCPA 4LOOA 5CXHA 2RFSA 3QCQA 3OC1A 4M15A 4M3QA 4USFA 3PIZA 3KRRA 3PJ3A 5HO6A 4EBVA 4QMLA 4RIYB 3LCOA 4F0GA 2WKMA 4II5A 2R0IA 4TWCA 5J95A 2WMQA 3DQXA 4R7BA 3D83A 3R7IA 4WSQA 5F94A 5IU2A 4D1XA 4AE6A 1REJA 4AWIA 4QMMA 5E8YA 2GNFA 4FYNA 5HG7A 2IZUA 4XS2A 2GU8A 2PZIA 2HZ4A 2W1DA 2YABA 3EFWA 3V5JA 2JDSA 5FTGA 2WMRA 3S1HA 4L67A 4XRJA 2B52A 3NNVA 4I3ZA 4PP7A 5K5NA 3S2PA 4YNOA 5JN2A 4R5SA 1OKYA 2WQNA 3NLBA 4BCMA 3Q9WA 2O0UA 4YR8A 3ORLA 4FZAB 4YPSA 2IW6A 4GT5A 2XRUA 2Q83A 2BZKB 3R21A 5ETIA 2XNPA 3Q4ZA 3RJCA 2C5OA 2HAKA 3IECA 3QTSA 5FBOA 4Z7GA 2OG8A 1P2AA 1OVEA 1OUKA 4K2RA 3TT0A 3ORNA 4FV9A 2QOIA 3FV8A 4OBOA 4NM0A 2FSOX 3HLLA 3Q04A 3R00A 4IEBA 4N0SA 3RPYA 3R8UA 2EXMA 1R0PA 4WRSA 5HU3A 4HZRA 3LFCA 4HNIA 4NWMA 5FLFA 1OGUA 4FTUA 2R7BA 1JSVA 2ETRA 3AGMA 3DJ5A 4FTMA 1OPJA 3NIZA 2AUHA 3HUCA 1YXUA 3FXZA 2ITXA 2QQ7A 4FL3A 1VZOA 5AP1A 1PXPA 4L68A 4O22A 2F7ZE 4C59A 2YHVA 3AT3A 4B6LA 5K9IA 5HNBA 5EHLA 4YJQA 2I0VA 3LFSA 4A9RA 3H9OA 4FKGA 4AN3A 1GY3A 3LHJA 1YOLA 1WVYA 3PLSA 4IZ5A 4U9AA 4C4GA 4AW0A 4D28A 5A9UA 5JFVA 3CCNA 4HYUA 4K0YA 2W5BA 5F9EA 5CENA 2B9FA 2ZB0A 3LFEA 5CEKA 3NAYA 2OJJA 3ZRLA 5KKRB 4C2WA 2OWBA 4BVUA 1ZLTA 3DBEA 5HVJA 1XKKA 5AAFA 1WBTA 4CKRA 3TV4A 5L6OA 3D9VA 2HOGA 4XBUA 4ACHA 3PXKA 5C1QB 4I6BA 5KHWA 4ZTSA 1QPCA 4NW5A 2G01A 4QTDA 1PMUA 3OWLA 4O1OA 1FOTA 4E26A 3UIMA 5DE2A 4FTCA 3HAMA 3I79A 2R3GA 3NNXA 4PL5A 3DY7A 5JRSA 4U42A 4C34A 2OLCA 3WI6A 5CLPA 4EZ5A 2QI8A 3KXGA 3P4KA 1L3RE 4ZTHA 3O17A 5FDXA 3PTGA 5DGZA 2HZNA 2WTIA 2R5TA 4LL5A 5IQFA 1LP4A 5FD2A 5KZ0A 2O5KA 4D4SA 4OTDA 3QUPA 4EH9A 3UVRA 1JBPE 4LYNA 4QYGA 1W82A 1M2QA 2BAKA 4A4LA 1PKGA 3OWJA 1YHVA 1ZOGA 3HV5A 1OBGA 4BDAA 1XBCA 2W17A 4AZEA 3R0TA 4G31A 4O0YA 2Z7QA 2PE0A 2R3OA 4U81A 3LFQA 4ACCA 4MWHA 3SXFA 2GDOA 2CKPA 2B54A 1H1SA 3MVMA 3O51A 5EKNA 3GCQA 5BVFA 5LMKA 4G16A 4BDDA 2Y6OA 2JFLA 4C4FA 4FV7A 3UG1A 3VVHA 1Y91A 3DGKA 3KK8A 1W0XC 2UV2A 4KBCA 5AR5A 3WF7A 2PTKA 3A7FA 4MQ2A 4LRKA 4V0GB 4TYIA 4F09A 3UMXA 2QOBA 3R1SA 4QTBA 3QCSA 3D5WA 3QUEA 3QZIA 2O8YA 1H8FA 3ZBFA 4FSQA 4GK3A 4FTOA 2UW4A 5L8JA 1T45A 1YW2A 2V7OA 1WFCA 4DTKA 3AT2A 2R3LA 4HPTE 4TZRA 4GL9A 5GHVA 3JS2A 3NW7A 3BHVA 4JL9A 5IPJA 1NVSA 1OBDA 4E20A 4IWDA 4E4NA 3FLSA 5DBXA 4ITHA 4W8DA 5KKRC 2OO8X 3M1SA 4CFXA 4FEQA 3HX4A 5HE1A 3N51A 1H07A 4DFUA 3UP2A 4Y5QA 3AMYA 4DFXE 3KREA 2X9EA 3NVKI 4TL0A 4JS8A 3KC3A 4J7BA 4R3PA 1AQ1A 3DLZA 5E1EA 5AX3A 3ZXZA 4FEVA 4IB0A 3CGOA 4BHZA 3CTQA 3G0EA 5A3XA 1BYGA 3VS6A 4RIYA 4GFMA 4M14A 4PNIA 4ZLZA 1XR1A 3HGKA 3R1YA 4C7TA 3O96A 4UY9A 4Q5HA 2O63A 2R3RA 4MHAA 5LWMA 5E9EA 3DAJA 4TWNA 1ZY4A 5AX9A 4A07A 3UQCA 2CSNA 4F1MA 5BVOA 4F6SA 1U59A 2BUJA 3DDQA 3G6GA 4PV0A 5HOAA 4DEBA 1JKKA 3FY0A 4BC6A 5ACBC 4BTJA 4QP9A 5A6NA 3EB0A 4U8ZA 4QMQA 2HZIA 3DDPA 2WIHA 3QXPA 4U5JA 2YA9A 3QRTA 4DTAA 2HXQA 2F57A 3NUYA 3O50A 5LJJA 3QQLA 3KFAA 5IQIA 1PW2A 3OROA 2ZM1A 4FSWA 4BTFA 3R8ZA 5JFXA 1LEZA 3CQEA 3AC1A 2R3PA 3I6UA 1UNHA 4KKEA 3ZSIA 2YWVA 4DFBA 3RPVA 2UZDA 3ATTA 2I6LA 1LEWA 5C8NA 3P7AA 4TKSA 4YJRA 1E9HA 5BVNA 3DK3A 4YTCA 4QTEA 2GNHA 5CEMA 3ZLYA 2CLQA 3ZDUA 4IIRA 4O7VA 3VN9A 2YCSA 3QYWA 3IW4A 4JR3A 3W8LA 3KQ7A 4U40A 1W83A 4AOTA 2XK8A 3ZXTA 1DS5A 4E8AA 4QQCA 4FG8A 3VUKA 4GW8A 2W96B 4BIBA 3UOHA 2B4SB 5BYLA 1FVRA 2E9PA 1VJYA 4RVTA 1YOMA 2YM7A 4RBLA 4RG0A 3QD3A 2QOOA 2VO7A 4IACA 3AC5A 1XH7A 2F4JA 3RHKA 3H0ZA 4ZOGA 4RPVA 4TYHA 5IQGA 2UZLA 3CJFA 4TWOA 2VTPA 3NYVA 4RZVA 3F5PA 2DQ7X 4HGSA 1WBWA 4KAOA 5DFPA 3UE4A 4EORA 2C6LA 3U54A 2UW9A 4X6RA 2H96A 3KY2A 5H2UA 2WU7A 3PDTA 4OTFA 4X3JA 5CVFA 3HL7A 5L8KA 3EKKA 3EQGA 3E63A 3VBYA 4CTBA 5B2LA 4RIOA 3HRBA 3RPRA 3OW4A 4WD5A 2JAVA 3AXWA 3TV6A 3QQFA 3V8SA 4ASZA 3O0GA 4EOMA 1XWSA 4CGAA 1BL6A 2ETMA 4HCVA 3HRCA 3LLAA 4FF8A 4FX3A 4IWQA 1H27A 1Q3DA 5HTIA 3FI2A 4L52A 4MXXA 4ZY4A 3PXFA 4F1TA 2C0TA 3FC1X 4H05A 5E1SA 4BR3A 4D5HA 5HORA 1J1CA 3C4EA 3A60A 2JKOA 2Y4IB 3KULA 4FKPA 2PUNA 3SVVA 2YAKA 3PJ1A 2PSQA 4ZJJA 3W16A 5IA0A 2DUVA 1H00A 3BKBA 2OJFE 4GIHA 3HEGA 3RVGA 3VBQA 1Z5MA 5L2QA 3FZRA 5CT7A 3SXRA 3U9NA 2XNOA 2W1HA 2F7XE 5CU6A 3QA8A 4X2NA 4GV1A 2WMTA 2VTOA 4IAFA 2CLXA 3IW8A 2HYYA 3TI1A 2P0CA 3NSZA 3PPJA 4UMUA 5M08A 2BFYA 2ZV9A 3G0FA 5CEPA 3PXRA 1ZWSA 4XOYA 3R2YA 1QMZA 2OJ9A 3ALOA 4FK3A 3I7BA 2J7TA 3Q52A 4O2PA 2ITPA 4NZWB 4B9DA 5JSMA 4RJ5A 2ZV2A 1TQIA 4KINA 4CFWA 3UNZA 3ORXA 4NEUA 5J9YA 2VD5A 1BI8A 5BUJA 3FWQA 4M69A 4QMZA 3D0EA 2PYWA 4GJ2A 4A9SA 4F99A 4IAAA 3PRIA 3R7OA 4C57A 2XYNA 2WMXA 3OFMA 1OPKA 1TQPA 5EYKA 1RDQE 5CYIA 3C5IA 3MPAA 4FTNA 5LVLA 3DA6A 4TYJA 5LVOA 5I9WA 5M56A 4ANNA 3CQUA 1R3CA 4FKUA 4JR7A 2O64A 4IM3A 3U87A 4IFCA 1G8SA 2QR8A 3JY9A 5EDRA 3KVXA 5HVKA 3ODYX 3MVHA 3NPCA 4FGBA 2YM6A 4JDKA 4IHPA 4PY1A 3CS9A 4DFNA 3F6XA 4E6AA 4JBPA 4OTWA 3HDMA 4DG0E 5LCKA 4Y83A 4QOXA 3D15A 2XIZA 3OD6X 5AUZA 5CSPA 4AE9A 4MBJA 1SVGA 1JNKA 4M8TA 5AR2A 4AA0A 3FQHA 5HG9A 3OUNB 1FBNA 4AT3A 1MRUA 5IMXA 4MF1A 2YIRA 3P9JA 2BDFA 5KE0A 3A4PA 5HHWA 5K5XA 3FHRA 3A62A 4FTAA 4Y85A 3O71A 4FKWA 4M12A 4IAKA 1JKLA 3MH3A 2BDJA 2VTQA 2Q0NA 4ORKA 2B9HA 4U80A 2P4IA 1KV1A 2O65A 3GFEA 4ASXA 1YDRE 2J0JA 4BWPA 1Q61A 1Q3WA 1UNGA 3QGWA 4G6OA 3QQKA 3C4XA 2HY81 4GYGA 4WG5A 4AA4A 2YM5A 1PYXA 4HGTA 5CTPA 4CKIA 4WRGA 3OP5A 3PP1A 1O9UA 2FA2A 2DYLA 2GNLA 2YN8A 2WFYA 3GCVA 4WKQA 5E8ZA 5EW8A 5CU0A 1PRYA 4EH6A 3LJ2A 5IQHA 3T3UA 4QYFA 2OSCA 4FC0A 3P78A 4YZMA 5CASA 4BTKA 3EQCA 3SA0A 1QPEA 3LM0A 4AW5A 4YHTA 1KE6A 4OBPA 2X6DA 5T68A 1ZZLA 4LMNA 1M14A 3SW7A 4CEGA 3D5VA 5EHYA 4PDOA 4L3PA 4APPA 4HGLA 1UNLA 2YIWA 3EOCA 1JQHA 2A2AA 4FIEA 3MIAA 2YCRA 3Q53A 2PMIA 5JZNA 2UVXA 3RAKA 1Y57A 4NU1A 5J1WA 4EC9A 4D5KA 2Y4IC 5E8WA 2BIKB 1KWPA 4RA5A 4CMTA 4D0WA 3P0MA 3PSBA 3VULA 5B0XA 4X2KA 2WOTA 3FAAA 2OKRA 2X7GA 2H6DA 4J52A 4KS7A 3NZ0A 3FY2A 4LRJA 4OTRA 4OTPA 4YJTA 4EH8A 3FMHA 3SDJA 2J0LA 2QOQA 4RC3A 4X21A 1O6LA 4CRLA 2PZ5A 4KWPA 4FIFA 2HENA 2JBPA 4YNEA 4YJNA 3GB2A 2FYSA 1W8CA 3QQJA 4J53A 4E1ZA 3KVWA 3QA0A 2WTDA 4K18A 1OL7A 3QWKA 1FGIA 4AN2A 3QL8A 2W4KA 2Z7SA 3L8PA 4FTRA 4KA3A 3IDPA 4TYEA 3AD5A 4U3YA 3GGFA 3WIKA 4L6QA 3R8VA 3SW4A 1T46A 2UW7A 3KN6A 4E7WA 2B9JA 5IH4A 3UZTA 4U45A 1M7NA 2CKEA 3DBDA 2XIKA 5KMLA 3E5AA 4AT4A 4NJDA 5AA8A 4UV0A 2EU9A 4DFZE 3R9RA 3KF4A 3E3PA 5CEIA 1Q8YA 4FTQA 5AV3A 4IQ6A 4IB1A 3VUIA 2CGWA 2WMBA 3IS5A 5HBEA 4XLIA 4RIWA 3KMUA 3UVQA 5AV4A 2CNVA 4YBJA 1XBBA 3I1AA 1JSUA 4DGMA 3W2OA 3ZZWA 5LQFA 3P5KA 4ZLOA 3EQHA 3ZUUA 3OOMA 3HAVA 3HDNA 3U6HA 4TPTA 5BVWA 2QCSA 3PJCA 5HX6A 1YWNA 3CD8A 5HE3A 3SC1A 4PDYA 5AFVA 3QTRA 5AM6A 5TOZA 4M68A 3VWAA 3W2CA 4CV8A 1DM2A 2F7EE 1XQZA 2R3QA 4J8MA 3P1AA 4MEDA 4KBKA 3PVUA 2ITTA 3DB6A 2J5EA 3MH1A 4M69B 4CT1A 4FV8A 3L9MA 3C0HA 4BCGA 1NVQA 3NS9A 3DNEA 4H1MA 2QODA 1PY5A 2YFXA 5CI6A 4ANBA 4BRXA 2UZWE 3PP0A 3UIXA 4F9YA 4XH6A 1Q5KA 1QPDA 3FLYA 3KF7A 1CKJA 4YZBA 2W06A 4EH5A 3E7OA 1H24A 2J5FA 5TR6A 3VJNA 3QLFA 4QP1A 4LUDA 1KV2A 3F2RA 1K2PA 3R2BA 2VNWA 3U4WA 4IX4A 5ICPA 4TT7A 2ZV7A 2QO9A 2QOKA 3E62A 4CLIA 3FZTA 4GUEA 4G17A 1DAWA 3R8MA 5JT2A 3BWJA 3BI6A 4I5PA 3H10A 4UBAA 4N6ZA 3VUHA 3NVMB 4IANA 1JKSA 2CPKE 3E8NA 4D2WA 2XF0A 2VU3A 1PJKA 3FXXA 2F49A 4FMQA 3KL8A 3Q5IA 2C5VA 3I81A 4MVFA 3PRFA 5HIDA 4IVAA 4AF3A 3Q6UA 2CJMA 4FTJA 2PUIA 3K3IA 4GCJA 5HO8A 3B8QA 3FMNA 5LMAA 5CVGA 1UVRA 2C6OA 3PXQA 4JAIA 4GIIA 3C9WA 3WOWA 4CCUA 4NK9A 1XBAA 5ANOA 3PY0A 2B7AA 2ZOQA 4OR5A 4FKVA 5HZNA 5AP5A 3EIDA 1OIRA 5DPVA 4FZ7A 4XUFA 5DH3A 5GZ9A 3NW5A 5CNOA 5JK3A 3LIJA 3W1FA 4NIFA 5H8GA 3F3VA 2XK7A 4PTCA 4UMTA 5KZIA 3HV7A 1M17A 5HNIX 4KSQA 4RIXB 5JGAA 4O91A 3FZSA 1F0QA 2JIVA 4FSYA 4FOCA 2V5QA 3PG3A 5DEYA 2QHMA 2P55A 2VX3A 5M4IA 2QOLA 2E9UA 3CBLA 1MRYA 4FSUA 4DEEA 2VX1A 2XYUA 4FZFB 1DI8A 3BLQA 2ZJWA 3LQ5A 4JX7A 3HV4A 2QU6A 3P7BA 4MD9E 3VQHA 4DGOA 1WVXA 4EWQA 4F63A 3IW7A 3BHHA 5FM3A 4IE9A 2C5XA 3BU5A 3V01A 2BKKA 3ACKA 4L9IA 3RWPA 2GFSA 4V04A 4MYGA 4N4SA 4QD6A 5CY3A 2XKCA 2VTHA 3G15A 4AFEA 4R3RA 2VTAA 2VV9A 2AYPA 5G1XA 3BYSA 5M44A 4O0UA 4FODA 3DXNA 2ZYBA 2JKMA 1O6YA 3L9LA 5DT0A 1OECA 5EOLA 2G9XA 5A4LA 3R9NA 2UZTA 4UN0C 5AUUA 3SGCA 3VUDA 1YHWA 4AW1A 4NM7A 4QNYA 4EUTA 2P3GX 3OCGA 2G15A 3QALE 4AACA 3U4UA 1IAHA 4Z7HA 2F2UA 4R8QA 2XKDA 3CY2A 3MFSA 2ACXA 3MS9A 3FLZA 4KKGA 3SRVB 5DIAA 4BBFA 5J9LA 3GQIA 1ND4A 2FB8A 3DBCA 4RC4A 1RW8A 4I6FA 3KRWA 5DNRA 2XZSA 3EYGA 4XG2A 4DC2A 3RKBA 5CF5A 2BILB 1GOLA 2WELA 4WNOA 2CCIA 2E9NA 2XM9A 4B4LA 2YM8A 4ALWA 4QQ5A 3PPZA 4G3CA 1Q97A 1YWVA 4LGHA 5D9HA 5HLNA 5JKGA 4KIKB 5E4HA 1PXMA 1Q8TA 2QR7A 3QQGA 3QU0A 4O86A 2XA4A 4FG7A 5ITAA 2OXDA 2EUFB 3TV7A 1CSNA 3M42A 3S3IA 3VIDA 1CKIA 2PMOX 3DZOA 2BIYA 3PSCA 4FKSA 3GEQA 1MP8A 3FYKX 2X81A 2C6MA 4BBMA 4K9YA 4O7NA 2YDJA 4CFUA 2NRYA 1L8TA 2IO6A 2R3JA 3UIBA 4AZTA 4MQ1A 4EQCA 3OY3A 1P5EA 3OTUA 3HUBA 4AN9A 4C3PA 1JPAA 1OMWA 4JQ8A 2OH4A 4JI9A 3Q32A 2JBOA 2PY3A 3R28A 2O2UA 4W4VA 2VTLA 2X7OA 3A7HA 4O0VA 5EYMA 3R7EA 4BCFA 3IK3A 2QOHA 4PTGA 5CAUA 3EQPA 3TZ7A 4LI5A 2IVVA 3OUKA 4HJOA 4CXAA 3OCBA 1XH8A 2X4ZA 4ANQA 5KMMA 3KCKA 4QMOA 3SLSA 4QP8A 4MD8E 3ZLWA 5CQUA 2BVAA 4ZTNA 3UP7A 5BNJA 1WBSA 3R83A 1KOAA 4O27B 4MK0A 4TY1A 1UU3A 4AOIA 2QG7A 3HP2A 4OUCA 4O0XA 3QHWA 4FV5A 1IEPA 3LMGA 3W2SA 2QHNA 2JFMA 3LFNA 3O23A 4LMUA 2FSMX 5B7VA 3KRXA 4C3RA 4QMYA 5BYYA 4NW6A 2LAVA 4QTAA 4BCPA 1PXNA 3DLSA 4FKTA 4JBOA 4R1YA 4WSYA 2G1TA 3NUNA 4NFMA 4EZ7A 4EK6A 4ZSJA 4GU9A 5HIBA 3LLTA 3D2IA 4RSSA 2PVRA 5AM7A 2IJMA 3G6HA 4NTTA 1ZYLA 4IJ9A 3DAEA 4YBKA 4CSVA 4O82A 4FL2A 1B38A 3JY0A 4YZDA 3SOAA 3ENHA 4MXZA 5L2SA 1QCFA 1OUYA 1BL7A 1IG1A 3GCSA 1UU8A 3UQFA 3F7ZA 1ZMUA 2XJ0A 1CM8A 3A2CA 4PDSA 3LZBA 4Y46A 3RCDA 1SNXA 1PHKA 2QURA 4G5PA 4D0XA 4F7JA 1E1XA 3ANRA 3E8DA 2JDRA 3HMPA 4IX3A 4O0WA 5E8XA 4ZTRA 5AUXA 5C01A 5DLSA 3ZONA 4F9CA 2VUWA 1SMHA 3BEAA 5AP4A 1UV5A 4AS0A 3FPMA 3MH0A 1O6KA 2WU6A 4GH2A 3BIZA 2W1FA 5JZJA 4ERWA 4KD1A 3TM0A 3MA3A 3V6SA 3QD4A 4F1OA 1GZOA 2X8IA 3ACJA 2CGXA 3RM6A 4W4YA 4JIKA 4JLCA 2CMWA 1IASA 4WA9A 4FV4A 3AC8A 4FR4A 3EQFA 2Z02A 3PFQA 5HX8A 5D7VA 1WZYA 3R01A 3BU6A 2F9GA 2P2HA 1BI7A 1M52A 4IB5A 5CT0A 5J5TA 3CTJA 4TNBA 2IVTA 2XNMA 3F9NA 3GXLA 2QOCA 2CN5A 3DKGA 1Y8YA 3ORMA 3Q9XA 4YJSA 4APCA 5KMJA 4FT5A 4FEUA 5AP6A 2X0GA 3KGAA 2RFEA 3U6IA 2FO0A 1WAKA 1YOJA 2BCJA 3W8QA 5HLWA 4EOIA 5JH6A 2QLQA 2PUUA 4BGHA 4L42A 4X2FA 1YHSA 5DI1A 3BHYA 4ACMA 4G5JA 5HTCA 4UZHA 2QONA 2GS6A 3ORPA 2B55A 3ZZEA 3MH2A 2E2BA 3C5UA 2HK5A 4JG6A 4CFVA 3I5NA 2XP2A 3CPBA 3QZGA 2ITNA 3VS7A 3QZFA 4BCQA 3O7LB 2YWPA 5GZ8A 4I20A 3KKVA 4AT5A 4H39A 3JR1A 3RM7A 3OWPA 4ENXA 3F3WA 3MN3A 4C62A 5F4NA 4A9UA 4AAAA 5CSXA 4NJ3A 4HYIA 5CSVA 4UYAA 5CS6A 1YI6A 5E8TA 3TTJA 4DH8A 4F0IA 3BE9A 3EFJA 4O0SA 1REKA 3RPOA 2PL0A 3KB7A 3RNYA 2QC6A 3DAKA 4PNKA 4QNAA 3QZHA 5HESA 2BALA 4H36A 3GVUA 3VHEA 3W18A 3JVSA 4D2RA 1UWJA 4X2GA 4IXPA 3UJGA 1MRVA 4YHJA 3F88A 1H1RA 1F5QA 2YCQA 2R3HA 5AAGA 3UMWA 5AP2A 4BDJA 4EOOA 4ZSEA 1XHAA 3E7VA 3E88A 1PXJA 2WGJA 4EJNA 1OL1A 4RQVA 4TW9A 5AP7A 4LGDA 4IH8A 4PMSA 1P4FA 4HGEA 3RP9A 1YDTE 2VWXA 4BDKA 5IUGA 3FZOA 1A9UA 4QP6A 1M2PA 3IOKA 5IA1A 2Y8OA 2OZAB 4GSBA 2OGVA 4L7FA 3W2PA 4EHZA 5ETAA 3FDNA 1B6CB 2P2IA 2X9FA 4KRCA 4BDFA 4DEDA 4S30A 4RFYA 3WBLA 5L2WA 1R39A 3AOXA 5FUTA 1W7HA 3W33A 4L44A 1GIJA 4IZAA 2YDKA 2OXXA 4JOAA 5J8IA 2CGUA 2G2HA 4ZMEA 4FZ6A 2R2PA 3L8SA 3O8PA 3MFTA 2IVSA 4E3CA 4DINA 5E7RA 3GQLA 4W4WA 3LAUA 3MSSA 4WNMA 5AIRA 2BHEA 4BBEA 4F64A 3MY5A 3NYNA 4AGCA 3BBWA 2CN8A 2EB3A 3IKAA 4FIIA 5EKOA 4D2VA 4IVCA 4XHKB 1H1WA 4OLIA 2RSVA 2NP8A 4J8NA 4TXCA 4DYMA 1OKZA 3D5UA 3OTVA 3DCVA 3R1QA 1OB3A 4IB3A 3ZSGA 5IQCA 1BX6A 3WZJA 3DBQA 3BHUA 3CQWA 3BZ3A 5IZFA 3ZCLA 4U43A 3F2AA 3UPXA 4ASEA 3SV0A 3TN8A 4AU8A 4J97A 4U6RA 4DEHA 5GIOE 2C3LA 4EHVA 1SVEA 4JG8A 5IDPA 3LPBA 3RAIA 4MTAA 4FSZA 3PE2A 4ZTLA 1FVVA 3PY3A 3VBWA 3UO6A 2W4OA 2JIIA 4O7YA 2Q0BA 4CVAA 5AR8A 2V55A 4FUYA 3UNJA 1J91A 1ZAOA 3ZUVA 4XG9A 4J95A 3R7GA 3ZSHA 4Y5HA 4ZSGA 4FIHA 3MPMA 3UYTA 4GFOA 3IG7A 5JGBA 2XRWA 2Z60A 3I7CA 3JUHA 5I4NA 3LMIA 1Q8ZA 5D11A 3TKIA 4CMOA 5AAEA 1SYKA 4ITJA 4BTMA 3F82A 2OF4A 3NCZA 2XJ2A 3NYXA 5G6VA 5BVDA 4R77A 3OEZA 4L46A 2OFUA 3U55A 4Y95A 4RJ7A 5A54A 3MY1A 3UOJA 4DCEA 5AP3A 4AW2A 1FVTA 2I0YA 2YM3A 5FRIA 5AUTA 4DT9A 4QO9A 4FOBA 2XCKA 4G3DA 4XCUA 4DITA 4PRJA 2W1ZA 1BMKA 4DG3E 5DG5A 1ERKA 3PJ8A 4X3FB 5F20A 4XV9A 5LWNA 3QUDA 2YJRA 1YXTA 2QD9A 3L9PA 5DYJA 3A8XA 2PVKA 2C6IA 5D10A 4YGAA 1V1KA 4BKZA 2Y6MA 3MTLA 3VRZA 4EHGA 4EZ3A 2KTYA 5CU2A 2WEVA 5AADA 4I41A 3KMMA 3GCUA 1HCKA 3V8WA 3R73A 5CAPA 3C51A 4FGRA 4MH7A 4FYOA 5HKMA 5IA4A 4FUXA 4NKSA 2J51A 3WIGA 2WMWA 2I40A 2VNYA 4LOPA 2XEZA 5JMSA 1M7QA 2W5HA 3OBGA 3QF9A 4KS8A 4RIXA 5HCYA 2UZBA 3AQVA 5HCZA 1ZMWA 4PPBA 5I3RA 3NIEA 4O38A 3VJOA 4P5ZA 5FP6A 3NMUF 3D4QA 3A7IA 4S31A 4GK2A 4J98A 4AQCA 4A06A 4D1SA 2C3JA 2C6KA 3GU7A 4ANSA 3DFAA 3SOCA 3SQQA 3QTQA 4EI4A 3FUPA 4X2JA 1PXIA 1KE5A 4I93A 4DE4A 4BCIA 3RK5A 3EN4A 4BDIA 2QG5A 5BVEA 2EVAA 2XNGA 3CLYA 4CYIA 2E9VA 4L45A 3FI4A 1APME 5H8BA 2ITUA 1J1BA 2VTSA 1M2RA 4KIKA 3QBNA 3V5LA 4EK8A 4YTHA 3AT4A 3CY3A 1VYZA 4M0ZA 4EKKA 3S00A 5A4CA 4Q9SA 4Z55A 4D9TA 1S9IA 2R3NA 2ERKA 4OBQA 3S95A 3EN6A 4FL1A 4FV3A 4HVGA 4ERKA 2FH9A 2ITOA 3FQSA 3FSFA 3VS2A 2UUEA 4UALA 4G3FA 3ZS5A 3H30A 3L8VA 2Z2WA 1OKVA 3NEWA 1R0EA 5LARA 3UIUA 4FT0A 1NY3A 3VW6A 4HYSA 4P2KA 2WAJA 4RWJA 4RRVA 4MXYA 4R7HA 5FEEA 3R6XA 4G9RA 5CQWA 3WARA 4FTIA 4HPUE 3FZ1A 2R4BA 5K0XA 3VNTA 5LVPA 4YPDA 1ZYDA 1KE9A 3DKFA 3AG9A 4GK4A 4XV2A 2HXLA 4YZCA 3FMEA 3LXKA 4C38A 5D7AA 4ZS4A 4W9WA 3TUCA 2XS0A 2Y4PA 4I4FA 4RWLA 3Q3BA 4I1ZA 4JVGA 3V3VA 1K3AA 4IAIA 4I22A 3EQRA 4CQEA 2ZM3A 4P90A 4ZJIA 4QQTA 5EDPA 3N4UA 3POOA 5CNNA 4GG5A 4YLJA 1KE7A 2HCKA 5K3YA 4USDA 4PL3A 3RK9A 3F69A 2WEIA 4U3ZA 4YLKA 5C4LA 4KSPA 5M07A 4EK5A 4BCOA 3MW1A 2QOFA 4G6LA 1PXKA 5EM7A 3E93A 5TKDA 4HOKA 3FMMA 4B8LA 5L2IA 3TL8A 5I3OA 4LRMA 1QPJA 2OIDA 5KO1A 3N4VA 2A1AB 2IW8A 1YDSE 4M0YA 5I9UA 4ZSLA 4AOJA 4BB4A 3MPTA 4WIHA 3CGFA 4OT6A 4I92A 2JKKA 2XK6A 3TCPA 1PXLA 1URCA 3R7VA 3TNWA 3JYAA 4C2VA 1CTPE 2GHGA 1MQ4A 4Z16A 5ANDA 5HE0A 2JITA 4F6WA 3W10A 2WMAA 2VWUA 4F7NA 2GNIA 3MVLA 3KU2A 3U51A 5GJDA 2CHLA 3UG2A 4BICA 4RX7A 4W8EA 3MJ2A 1TQMA 4AGDA 2JD5A 2RF9A 4GEOA 3MGYA 4ONAA 1OM1A 4JQ7A 2XJ1A 4NFNA 4OGRA 4MXOA 4BI0A 3V04A 4BN1A 4F65A 3KRJA 4C33A 5L8LA 2EWAA 5CXZA 2W9FB 4LQMA 3GOPA 2EB2A 4D4YA 1YXSA 5C8KA 5J7HA 3HYHA 4FI1A 3EQIA 3DU8A 4BDBA 2QKRA 5I9XA 4O7LA 4CFMA 4J96A 4RFZA 4JXFA 5ANEA 4YP8A 5LVMA 3R63A 4ZS0A 3OF0A 5ANGA 5E8SA 2XMYA 3S4QA 3GU5A 5KMOA 2C3KA 3LFFA 3BELA 4G9CA 3PLAE 5AV1A 4X0MA 5EQPA 1YVJA 4BIDA 4O7SA 3OXTA 4BF2A 1YXVA 3PVWA 4FNXA 4WOVA 3G9NA 4NT4A 3FEGA 4EQMA 3OHTA 5AUVA 2WQOA 1DI9A 4GUBA 5IQDA 5FG8A 3POZA 3LCTA 4JX3A 4U97A 3V5TA 4ZLYA 3RCJA 3FPQA 2BZHB 4M67A 4KABA 4O21A 4F9WA 4H3BA 4BDHA 1OL5A 3IW6A 2QU5A 3HMMA 2RKUA 3II5A 4HCUA 2BAQA 5C27A 3QKMA 5L2TA 5M4CA 3FBVA 5FWKK 4HNFA 3C4CA 3ET7A 2BTSA 3EN5A 2RL5A 4RWKA 3VBTA 4UMRA 4FG9A 1V0PA 2UZNA 2ZDUA 3TZ8A 2I7QA 3Q9ZA 4EOSA 3COKA 3QXOA 4N70A 1UKHA 4BCNA 2PUPA 4CFFA 5D41A 3VUGA 1LUFA 3KCFA 3G33A 4DEGA 3OY1A 5IG1A 2OIBA 3ITZA 4JIAA 3V8TA 2VTNA 1A48A 1NT2A 4R7IA 2R0UA 4TNDA 2Z7RA 5CU4A 2JIUA 4FKOA 5IH5A 4QMUA 4NM5A 2WTJA 1GZ8A 2Z7LA 3QRKA 2GQGA 2VWZA 3BPRA 5IQEA 2BDWA 3ERKA 2ZV8A 4YUQA 3H4JA 3V5WA 4RVLA 5DN3A 3PYYA 4H1JA 2C5YA 5DR6A 3F2NA 4OTHA 3IGGA 4KIQA 4K33A 2XK9A 5CWZA 2I1MA 2ZM4A 4FNWA 4ZJVA 2C0OA 3HV6A 5DT4A 3MWUA 4HVIA 3P7CA 3BYVA 3V51A 4YTFA 2V0DA 3ETAA 4QPMA 4C02A 4QPSA 1TVOA 2UZOA 2YAAA 3K2LA 2QLUA 3LW0A 4XX9A 3Q96A 1ZMVA 2ZDTA 3GBZA 4NKAA 5AR4A 5HBJA 3C13A 3ZBXA 3ZRKA 5C26A 5EI6A 2HIWA 2NO3A 5L4QA 4XP2A 1BKXA 2OZAA 3QTZA 4I6QA 4R6VA 4B8MA 4BY9E 2W0JA 2OF2A 3PG1A 4TYHB 4XRLA 2WO6A 5TO8A 5KX8A 2XEYA 2VTRA 2OH0E 4YC3A 2ESMA 2ZMCA 5D1JA 5I9VA 2C6TA 2W4JA 4MKCA 3BV3A 2VGPA 2ITZA 1STCE 4QMVA 4CLJA 2EXEA 3ZMMA 3MA6A 5IA2A 3COMA 1NA7A 4JBQA 1H0VA 2PVNA 4Y73A 3RMFA 3SX9A 3TJCA 3ZFYA 4C37A 3LCSA 4IDVA 3OMVA 4UB7A 1KE8A 4CV9A 3EYHA 3QC4A 4IAZA 2WQEA 3LFBA 1VR2A 2XNEA 4E4MA 3NR9A 3NDMA 2OICA 3NUSA 2PE2A 4MD7E 3V5PA 5A4TA 4IZYA 3R30A 3EQDA 4BWXA 4EOQA 2IW9A 2E9OA 5M57A 3ROCA 2XH5A 3I6WA 3I0QA 2VTJA 1WBPA 1PF8A 2C4GA 1Q41A 3TEIA 5EOBA 1GIIA 2BRMA 3BGPA 2RG6A 1PMVA 3ZYAA 3KN5A 5ACKA 5JGDA 3PA4A 4RLKA 4A9YA 4J99A 1ZXEA 4QPAA 4CMUA 4UXLA 4E4XA 4O0TA 2W7XA 4MNEB 3ZO1A 4BZOA 4AZVA 4TN6A 2C1AA 3FL4A 4AXAA 4F7LA 3B2TA 5HI2A 4AA5A 2RFNA 5CAVA 4QMTA 1FINA 3BQCA 3EZVA 4JT3A 5BQ0A 1GZKA 5GZAA 2C69A 4ZIMA 4GRBA 5BMSA 1ZYCA 4YSMA 3UQGA 4IM0A 2HWPA 2ITWA 1Y6BA 3PIYA 1JWHA 1KUTA 5CANA 1PYEA 4E73A 3I4BA 1GZNA 3ORKA 3QTIA 5DR2A 1H1QA 2R3KA 4KBAA 4FNZA 2H34A 3RBWA 4B7TA 2ZAZA 3Q5ZA 4YSJA 5J9ZA 1Q24A 4LL0A 2BHHA 3HVCA 4FVPA 2OZOA 5HTBA 1B39A 1XJDA 4M7IA 2WTKC 2Y7JA 3AD6A 5F95A 3GUBA 2GS7A 3UGCA 2XVDA 3ZFXA 4NIFB 3THBA 1IAJA 4FT7A 3RINA 3FI8A 4F4PA 4XEYA 2CNUA 4DGNA 4DT8A 3VS4A 5JFWA 1H28A 4JBVA 2PWLA 3A4OX 1YXXA 2X2LA 3DXPA 4AX8A 2GTMA 5DEWA 1OI9A 4FV6A 2XBJA 3LKMA 1RQQA 2WMSA 4BYIA 2C47A 5CF6A 4JJRA 1URWA 2V22A 3OXZA 3PJ2A 4D2PA 1LPUA 5AUYA 5BYZA 4NH1A 4ZTQA 4PP9A 1V0BA 3B2WA 5EH0A 3PWYA 4AGWA 3G9LX 3OEFX 4PPAA 4F9AA 2NNWB 3NNWA 3HKOA 3CP9A 3F61A 3WYXA 1ZY5A 5FXRA 4FVRA 3FZPA 4DGGA 5LXMA 3KEXA 3OBJA 4ARKA 4LGGA 4XG4A 3KXZA 4I5MA 1FMOE 2ERZE 2YM4A 3VBXA 2YITA 3BQRA 3ZM4A 4EH7A 2BMCA 3PSDA 3MTFA 2YISA 3OCTA 3MJ1A 4V0GA 5K0KA 4ZZNA 5EQEA 2WD1A 3VRYA 3MESA 5HBHA 5BUEA 3LJ1A 3O7LD 4IC7A 2PE1A 1IA9A 2PVHA 2PULA 1ZZ2A 1ZYSA 4LG4A 3MYGA 4BDGA 3R9DA 2Y0AA 5DR9A 4IM2A 4F6UA 4RX5A 3VC4A 3F7WA 3UPZA 2UW6A 4C3FA 2UW8A 4PMTA 3T9IA 3W32A 4YLLA 4OTQA 4XOZA 4DAWA 4IJPA 5DT3A 3OG7A 3R9HA 4OAUC 5ANIA 4D4RA 3PPKA 4YO4A 3E92A 2J0IA 3WF6A 2VTTA 4UYNA 3VW8A 1H4LA 3WYYA 4A7CA 4PMMA 4EOJA 3VS3A 5KBRA 1RE8A 5KHXA 2YLEA 2GHMA 4O96A 3WE8A 3NCGA 3LJ0A 4XG8A 3TACA 4O7RA 1GAGA 2PK9A 4IVBA 2ITVA 5HD7A 5H8EA 4BIEA 4EWHA 4ZEGA 3F5XA 5J5SA 1I09A 4UZDA 3N9XA 4QRCA 3DK6A 5E91A 1GIHA 5EM5A 2OW3A 3PVGA 3FE3A 4PTEA 5HU9A 4FZDB 1G8AA 2RFDA 2KULA 5LCJA 5T3QA 3MBLA 3RAWA 3CEKA 4WUNA 3I60A 5AV2A 2X39A 3FXWA 5C03A 4P5QA 3M2WA 2C0IA 5JEBA 3Q60A 3ID6C 4QMSA 2YJSA 2PVFA 3TNPC 3KXNA 2X2MA 4BKJA 5M53A 3VF8A 3WF8A 4IZ7A 2VGOA 4S2ZA 5KMIA 2XIXA 3MV5A 3NYOA 2JDOA 3SRVA 5AIKA 1XH5A 4X3FC 2H8HA 4FTLA 2QO7A 3K5VA 4IWOA 4O1PA 4O7ZA 4I6HA 3TDWA 3UZRA 2PHKA 5GJGA 3P79A 3P23A 3ANQA 4F70A 1FGKA 1P14A 3L1SA 1YWRA 3NWWA 4O6LA 1U46A 2XUUA 4U79A 3HNGA 3Q2JA 5IUHA 5M4UA 3IQ7A 3BX5A 4FV1A 1YRPA 4KB8A 3BWFA 4RX8A 5DVRA 5ETCA 4KNBA 3PA5A 4MNEA 5HVYA 3TJDA 2H9VA 1KSWA 2ONLC 3AC2A 3BU3A 2SRCA 5TF9A 1P4OA 5AA9A 4LV8A 1ZYJA 2XK4A 4HVHA 3LCDA 2XK3A 1H01A 4ENYA 2XNNA 3UYSA 2XM8A 3DB8A 3PIXA 4UX9A 4FKLA 4E5BA 4RX9A 3CC6A 4XJ0A 1OKWA 4DH7A 4EYJA 3LVPA 4C4EA 5FEQA 4L8MA 4Y72A 1BUHA 4Q5EA 4HW7A 2C30A 3JPVA 4K77A 3RHXA 5DHJA 4NUSA 3BV2A 2X7FA 2IZSA 1QL6A 2AC3A 5A4QA 5E90A 3LE6A 4CTCA 2IWIA 4WHZA 4WBOA 2XIYA 3FKLA 1R78A 3ULZA 4YJOA 4BFMA 2OI4X 3LFAA 4EH4A 1I44A 5IKWA 5JFSA 5AWMA 2V7AA 2W5AA 5DWRA 2GTNA 3WF9A 3HZTA 1U54B 3OT8A 1SM2A 3EH9A 3EN7A 4U44A 2OFVA 4CZYB 5CEOA 4ZTMA 3U9CA 4I23A 4OT5A 5L6PA 4FKQA 5GJFA 3LXNA 4AFJA 3QRIA 4BDEA 4QYHA 2PVLA 3H3CA 2LGCA 2WNTA 4C4JA 2YDIA 3ZC5A 3ZRMA 3PY1A 5FBNC 3DS6A 2XB7A 3BBTB 4FV0A 4WT6A 2G2IA 4FSMA 4DH1A 2JKQA 1YI4A 3K54A 2J0MB 5LMBA 3QD0A 4QP3A 3ORIA 5BMMA 4O2ZA 4KRDA 3GOKA 4HVDA 3EL7A 3TNIA 1UWHA 3HV3A 2BRNA 2WTCA 4GMYA 4E6CA 5KUPA 2BFXA 3CE3A 1WBOA 2CGVA 5EK7A 4Z9LA 4C8BA 4EH3A 4L53A 4PL4A 4F9BA 4QMWA 4A9TA 3MB6A 4IX6A 3HA8A 4AZFA 5IDNA 4MX9A 3DZQA 2UZEA 2UW3A 3QC9A 4FIJA 3OOGA 5GINE 4RC2A 3EFKA 4XP0A 2VO6A 3UO4A 5M51A 3HRFA 1R1WA 2ZVAA 3AMBA 4MNFA 3VO3A 4R1VA 3RZFA 3ULIA 1ZOHA 3C7QA 4ANMA 4QQJA 4QTCA 5B2KA 5C8MA 4Q9ZA 3ATSA 3R7UA 2J50A 2VWWA 2YLFA 3WE4A 4WNKA 2JLDA 2FSTX 3F3UA 4FSNA 4XV3A 4G6NA 5I9YA 3MFRA 4FEXA 3VBVA 2F2CB 3NW6A 2FUMA 5AEPA 3UODA 1UA2A 4DHFA 2IZRA 2NPQA 4E5WA 3G2FA 4V01A 4ALUA 4ZAUA 3TG1A 4USEA 3PZHA 5HIEA 4IDTA 3Q6WA 1XH4A 4U7ZA 3LXLA 4JQEA 4TWPA 4X7QA 3LOKA 4UEUA 5ANJA 4ACDA 3HMIA 2GPHA 4K6ZA 4RQKA 3DV3A 3K3JA 5HD4A 1V0OA 4I0RA 4IX5A 1NVRA 3D7TB 3V5QA 2HZ0A 4WBBB 4EJ7A 4CYJA 4YC6A 3EN9A 4EC8A 3FMDA 4RLLA 5IH6A 3C0GA 1NXKA 5K4IA 1FQ1B 4QMXA 1Z57A 4K1BA 2VTIA 4RJ8A 4EYMA 2PU8A 3FJQE 3VS1A 3G5DA 2R64A 3RWQA 2CNQA 5FTOA 2PMNX 3SD0A 2C68A 3CPCA 3CKXA 3L8XA 3IO7A 2HW6A 4N6YA 4DEIA 5KNJA 2FVDA 5A14A 3QX4A 4GG7A 2W1CA 2VO3A 3COHA 5CU3A 4EBWA 4CKJA 3KULB 3IDCA 3COIA 2FGIA 1LR4A 2W1EA 4C58A 5LVNA 1JSTA 1YI3A 3D5XA 4MBLA 4RVKA 4KKHA 3NUPA 4ZZOA 5J7BA 5EW9A 4KIPA 4O83A 4JDHA 2ETKA 3A7JA 3NRMA 3CXWA 2B9IA 5JQ8A 4FKIA 2RG5A 5EW3A 5FDPA 4M97A 2J6MA 4RMZA 5EHOA 4CG8A 5M06A 1E1VA 1F3MC 2C6EA 4RZWA 3BLHA 4JNWA 3E8EA 4BZNA 4IW0A 3VS0A 1WVWA 1GNGA 4W9XA 2VTMA 3TWJA 2I0EA 2WPAA 3DKCA 5ANKA 3LFDA 4KIOA 4O7WA 4GVAA 5H9BA 3EZRA 5HG5A 3WZUA 4O7TA 2XKFA 4EHEA 4I4EA 3ZC6A 3FLNC 3GU6A 3TZMA 2BROA 4DBXA 2YIQA 4CZTA 4N57A 4MAOA 3PXYA 3H0YA 3O2MA 1GJOA 4FT3A 5IEVA 5KBQA 3FC2A 2UW5A 5AUWA 2HY0A 2BPMA 1U5QA 3C50A 4L7SA 4MCVA 5BPYA 5HCXA 3R02A 4BYJA 4G3EA 5FQDC 2IVUA 5CAQA 4E5AX 1VYWA 4ALVA 5EG3A 1J7IA 4L3JA 2C6DA 3CJGA 3QWJA 5CZHA 1FMKA 3SKCA 4O81A 4RWIA 2REIA 2X8EA 4X3FA 3OXIA 2DS1A 5EDQA 3A8WA 3ZLXA 4EONA 2W1IA 3QRJA 4IADA 4D55A 4FEWA 4Y8DA 4S34A 3P86A 4J71A 2J90A 5HGIA 3RNIA 3UC4A 3I0OA 3IW5A 3QGYA 3TKHA 3QFVA 1YQJA 3E64A 4L00A 4FKJA 4F7SA 3PZEA 3DTWA 4L43A 4RGJA 2VAGA 1H25A 4Z3VA 2W1GA 1HOWA 5JRQA 1IA8A 2VRXA 2XBAA 3RK7A 5HO7A 3ENMA 1KOBA 5DRBA 3AMAA 2JEDA 3KXHA 3AC3A 3MIYA 5C9CA 5J87A 4AP7A 4BKYA 3GU8A 5HE2A 3R7YA 2OIQA 3R04A 1AGWA 3T3VA 2UVZA 2J9MA 3D14A 4FV2A 3IOPA 4NSTA 3D7ZA 4R78A 2GFCA 3LQ8A 2A19B 1W84A 3REPA 3DJ6A 4GT4A
chains in the Genus database with same CATH superfamily
3BLRA 3UBDA 1K9AA 4BWKA 1OL6A 2PZYA 4ZSAA 5A6OA 3U6JA 2R3MA 3U8WA 1UU7A 3EQBA 4S33A 2BR1A 3D94A 4UXQA 4YO6A 4M84A 4WO5A 5CALA 5AR3A 4FK6A 2YZLA 2CDZA 1RJBA 3T9TA 4C35A 3ZTXA 2PMLX 1U54A 3FMLA 3W2RA 2VWVA 3FLQA 2WTWA 5AV0A 3EWHA 3R8LA 4I5CA 4D9UA 2FSLX 3PE1A 2IN6A 4ZMFA 3BYOA 2JDVA 4JDIA 5JQ5A 1J7UA 3WILA 3TDVA 1WBVA 2VWYA 4HCTA 2HWOA 3S0OA 2JAMA 3MVJA 3FL5A 5FEDA 5E8UA 3BGZA 3NGAA 5EM6A 2P33A 1ZOEA 4I0SA 3CKWA 5CI7A 3KA0A 3VS5A 4F0FA 4B99A 5IQBA 3FMKA 4A4XA 2A27A 2W9ZB 3JVRA 5AMNA 1Q62A 5D12A 3TTIA 3VQUA 4HZSA 5FXQA 3WF5A 2WMVA 4JAJA 4S32A 5DA3A 1AD5A 4OTGA 4WNPA 5FM2A 2HELA 2QNJA 1JKTA 5M09A 4C4HA 1YKRA 4LUEA 2PVYA 1A06A 2WTKB 4WG3A 2ONLA 2BZIB 4TYGA 3DPKA 3KK9A 4RJ6A 4NTSA 3ELJA 4AQKA 4RVMA 1S9JA 4EOPA 2YEXA 3QAME 4YC8A 5CF4A 5DMZA 4RT7A 5I9ZA 2QO2A 4I24A 4YU2A 3R8PA 4GVJA 2WMUA 5IA5A 1CDKA 4XLVA 3UZPA 5HEZA 3BRBA 3MI9A 3W2QA 4GYIA 3GFWA 1SNUA 4FE2A 3DT1A 4KUJA 4R5YA 4K11A 4AUAA 3QTXA 4OTIA 4IAYA 3F3ZA 4GS6A 3QTWA 3HMOA 3Q4TA 3QX2A 4U0IA 4ANOA 4FT9A 3DJ7A 2EXCX 3D2KA 1OZ1A 5BUIA 2XNBA 3EMGA 4RFMA 3FHIA 2YACA 3R1NA 4UMQA 3F3TA 5CX9A 4QYYA 1JLUE 1W98A 2J0KA 3A7GA 5E92A 4DCAA 4G34A 3ZHPC 1OIQA 3ZO4A 2HW7A 3EL8A 3TNHA 3FKNA 3TXOA 3UNKA 4ASDA 2X1NA 1XH9A 3OW3A 4JRVA 2IPXA 3QCYA 4MBIA 4ZXTA 4RA4A 5I5ZA 2UZUE 4GFGA 4YJUA 4DFYA 3TKUA 3PUPA 3P08A 1TKIA 3C0IA 3OS3A 4I5HA 4CD0A 2IG7A 4QP4A 4FNYA 4BI2A 3F5UA 4QP2A 4AZWA 3WZDA 4XMOA 3OVVA 4FBXA 5EM8A 4DA5A 4CG9A 5CZIA 3M11A 4JRNA 3G51A 3VHKA 4D2SA 2BTRA 3EHAA 3DTCA 3O5AA 4EL9A 4WG4A 2IZTA 4DBNA 4JDJA 2RIOA 2B0QA 2JC6A 3TUDA 3UDSA 4EQUA 4G2FA 2YZAA 3ZU7A 2WIPA 1J3HA 3ORTA 4GU6A 3V6RA 3ORZA 3DXQA 3FSKA 3I5ZA 3Q4CA 4PF4A 4QP7A 5EYDA 3RAHA 3NAXA 2WOUA 2XKEA 3FMJA 1X8BA 5H3QA 4WUAA 3UVPA 3ZH8A 1CMKE 2GNGA 4R3CA 4YURA 4QDVA 4YTIA 4BGGA 2YERA 3OT3A 4QMNA 1H08A 3JXWA 2UVYA 3ZEPA 3ODZX 3UDBA 2R9SA 4PPCA 4E4LA 2WB8A 3O8TA 4JG7A 4XYFA 5HG8A 4YHFA 4DDIA 2I0HA 4X6QC 5TT7A 4XV1A 3SG9A 4DFLA 3QLGA 4FIGA 4RJ3A 4YZNA 3UTOA 4NCTA 1ZARA 5FTQA 2OBJA 3ALNA 4GJ3A 1XO2B 1HCLA 3QYZA 2XCHA 1Y6AA 4YJPA 1Q8WA 5EI8A 3QCXA 3NX8A 3SXSA 4F08A 5K4JA 5IEYA 4D2TA 5DOSA 4U41A 4CQGA 1WMKA 1U4DA 3FLWA 4IVDA 5CVHA 5IA3A 3FQEA 3TZ9A 1OPLA 2GMXA 4PQNA 3G90X 3K5UA 3TNQB 3LQ3A 5IEXA 4DF3A 2Z8CA 4C61A 2VN9A 5M4FA 2CKQA 5IQAA 5C4KA 4IBMA 3NUUA 4NYEA 2A0CX 4DG2E 3W0MA 2J4ZA 3LMHA 1OITA 3B8RA 4XG6A 4IC8A 3VUTA 4C0TA 3E87A 4YZ9A 2YIXA 4M66A 3MFUA 4I0TA 5AR7A 1MQBA 3UOKA 4CNHA 1SZMA 2WZJA 4AGUA 2AEGA 4O6EA 1PMEA 3TUBA 3GU4A 2OJIA 4DN5A 4MWIA 4XBRA 2ZB1A 3NUAA 4TRLA 5KMKA 4AG8A 4ITIA 4FTKA 3EKNA 2Y9QA 3GENA 5IUIA 3TIZA 4UWYA 3MY0A 3HA6A 4BL1A 4PMPA 4D58A 2X4FA 4H3PA 2CCHA 1ATPE 3QD2B 5B2MA 2BAJA 2C5NA 4PUZA 4LV5A 4IFGA 5EFQA 2PPQA 5FGKA 1OIYA 3H9FA 3QHRA 3FYJX 2BRBA 3DFCB 3H9RA 3E3BX 4DTBA 5HQ0A 4PX6A 1G5SA 4L01A 3DNDA 4ZZMA 4EH2A 2C3IB 3DKOA 3ZOSA 4CFNA 4V05A 2O3PA 1PMNA 3BCEA 3C4ZA 4D4VA 4BZDA 4L3LA 1CKPA 4ZY5A 4BCKA 2WHBA 1EH4A 3Q4UA 3CD3A 3OCSA 3LCKA 2V62A 3F5GA 3AC4A 2VX0A 2ITQA 2XIRA 3HMNA 2OU7A 1UU9A 4A4OA 2C1BA 4O0RA 3CIKA 2G2FA 5AJQA 5J79A 3BYUA 5BVKA 2GHLA 5E8VA 5GIPE 3ZO2A 1VEBA 2GCDA 3KXMA 3HP5A 4IWPA 2NRUA 2WTVA 5CSHA 2VO0A 5EYCA 2YIYA 4E6QA 3DOGA 1XH6A 2BZJA 3MDYA 2VWIA 3PUFC 3O8UA 4YJVA 1ZRZA 3VAPA 5L6WL 4CCBA 5EQYA 5CEQA 3UC3A 2JDTA 3R9OA 4LFIA 5FXSA 3AGLA 4OAVB 5GNKA 4RIWB 2GS2A 1H1PA 4W4XA 2AC5A 4FKRA 4XNEA 4CT2A 5KMNA 5LOHA 4LDTA 3R71A 4MXAA 3FI3A 2WXVA 4FVQA 2PZRA 4ID7A 1H26A 4ZK5A 3QKKA 4DDGA 4DH3A 1IRKA 3LM5A 4LOQA 4DGLC 4MXCA 3RI1A 4ACGA 4EKLA 4FA2A 3SAYA 1TZDA 2VWBA 4GKIA 5BX0A 3BGQA 2J2IB 1Q4LA 3BYMA 2UZVA 4DEAA 3BEGA 2OK1A 2X0QA 4H3QA 3E8CA 4NM3A 3GC9A 3L9NA 3GNIB 3VF9A 4EK3A 1UKIA 5J1VA 1Z9XA 3IDBA 3QTUA 2DWBA 5IISA 5IMEA 3GC7A 3EJ1A 3ZDIA 3SG8A 3IPHA 4BGQA 1H0WA 4XG3A 4EEVA 2GSFA 3C4WA 2JGZA 4G3GA 1JAMA 3QRUA 4BCJA 5AP0A 5CSWA 4I21A 5DRDA 5L3AA 1PKDA 4BDCA 3OZ6A 2GNJA 4CRSA 4NL0A 3GT8A 2YCFA 1JVPP 2B53A 3C4FA 3DK7A 1Q99A 4XG7A 3NNUA 3CR0A 1WBNA 4IMYA 3KMWA 5A4EA 3GC8A 5A46A 1NW1A 1U5RA 2BRHA 3D7TA 3N4TA 1Q8UA 4EK4A 4UWCA 3AD4A 4PWNA 4DLIA 3ROYA 3PA3A 4RJ4A 3F66A 5CAOA 3T8OA 4UWBA 3BHTA 3ZO3A 2PVMA 4C4IA 3Q9YA 3GP0A 5CF8A 4BI1A 3LXPA 4QT1A 2GQSA 2WQMA 5EI2A 4NCTC 1DAYA 3A61A 3A99A 3RGFA 2W99B 5F1ZA 4FICA 2A4LA 3VUMA 4QMPA 3ZLSA 4Q2AA 2GQRA 3GC0A 1WCCA 1MUOA 4XP3A 3PWDA 3ZEWA 2X8DA 4M13A 4EOLA 5IF1A 4HYHA 4UMPA 1J7LA 4GKHA 4MF0A 1ST0A 5T6KA 2X2KA 4K8AA 2UW0A 3QQUA 3MB7A 5TE0A 3C1XA 2OXYA 3RALA 3Q2MA 3CSVA 3DQWA 3SHEA 4TTHB 4FTTA 3RTPA 2QVSE 4G1WA 4I94A 4LM5A 4BHNA 4HVSA 4C36A 3EFLA 2CKOA 3QQHA 5HNGA 1OL2A 2W05A 4BCHA 3NUXA 3KXXA 3CTHA 3QKLA 4E6DA 3R22A 3RZBA 4GT3A 3RPSA 3WZEA 4PDPA 4D1ZA 4DH5A 3ZM9A 2R3IA 2R3FA 5HLPA 4AZSA 4EUUA 1G3NA 3DBFA 2PVJA 1SVHA 2PZPA 4B0GA 4FSTA 1IR3A 3UO5A 4DLJA 4ZY6A 3WZKA 2X6EA 2BRGA 5KCVA 2RGPA 4QYEA 2ZMDA 3FKOA 1BLXA 1Y8GA 4H58A 2VZ6A 4P4CA 4OW8A 1PXOA 4ANLA 2WQBA 1G8JA 5FP5A 4O4FA 3OWKA 5LMKC 2B1PA 2OJGA 1JOWB 1OIUA 3PVBA 3PXZA 4E93A 4ZP5A 4YMJA 3UOLA 3KRLA 5HICA 4FSRA 2R7IA 4P7EA 4O84A 3IGOA 1FPUA 3ZFMA 2BKZA 5M55A 3GI3A 3IONA 5ETFA 3ZUTA 2ITYA 3TIYA 5I0BA 4J1RA 3BE2A 4EOKA 2QKWB 3HECA 3W55A 4CZUA 3GCPA 4LOOA 5CXHA 2RFSA 3QCQA 3OC1A 4M15A 4M3QA 4USFA 3PIZA 3KRRA 3PJ3A 5HO6A 4EBVA 4QMLA 4RIYB 3LCOA 4F0GA 2WKMA 4II5A 2R0IA 4TWCA 5J95A 2WMQA 3DQXA 4R7BA 3D83A 3R7IA 4WSQA 5F94A 5IU2A 4D1XA 4AE6A 1REJA 4AWIA 4QMMA 5E8YA 2GNFA 4FYNA 5HG7A 2IZUA 4XS2A 2GU8A 2PZIA 2HZ4A 2W1DA 2YABA 3EFWA 3V5JA 2JDSA 5FTGA 2WMRA 3S1HA 4L67A 4XRJA 2B52A 3NNVA 4I3ZA 4PP7A 5K5NA 3S2PA 4YNOA 5JN2A 4R5SA 1OKYA 2WQNA 3NLBA 4BCMA 3Q9WA 2O0UA 4YR8A 3ORLA 4FZAB 4YPSA 2IW6A 4GT5A 2XRUA 2Q83A 2BZKB 3R21A 5ETIA 2XNPA 3Q4ZA 3RJCA 3AKJA 2C5OA 2HAKA 3IECA 3QTSA 5FBOA 4Z7GA 2OG8A 1P2AA 1OVEA 1OUKA 4K2RA 3TT0A 3ORNA 4FV9A 2QOIA 3FV8A 4OBOA 4NM0A 2FSOX 3HLLA 3Q04A 3R00A 4IEBA 4N0SA 3RPYA 3R8UA 2EXMA 1R0PA 4WRSA 5HU3A 4HZRA 3LFCA 4HNIA 4NWMA 5FLFA 1OGUA 4FTUA 2R7BA 1JSVA 2ETRA 3AGMA 3DJ5A 4FTMA 1OPJA 3NIZA 3UDZA 2AUHA 3HUCA 1YXUA 3FXZA 2ITXA 2QQ7A 4FL3A 1VZOA 5AP1A 1PXPA 4L68A 4O22A 2F7ZE 4C59A 2YHVA 3AT3A 4B6LA 5K9IA 5HNBA 5EHLA 4YJQA 2I0VA 3LFSA 4A9RA 3H9OA 4FKGA 4AN3A 1GY3A 3LHJA 1YOLA 3W0RA 1WVYA 3PLSA 4IZ5A 4U9AA 4C4GA 4AW0A 4D28A 5A9UA 5JFVA 3CCNA 4HYUA 4K0YA 2W5BA 5F9EA 5CENA 2B9FA 2ZB0A 3LFEA 5CEKA 3NAYA 2OJJA 3ZRLA 5KKRB 4C2WA 4BJJA 2OWBA 4BVUA 1ZLTA 3DBEA 5HVJA 1XKKA 5AAFA 1WBTA 4CKRA 3TV4A 5L6OA 3D9VA 2HOGA 4XBUA 4ACHA 3PXKA 5C1QB 4I6BA 5KHWA 4ZTSA 1QPCA 4NW5A 4O4EA 2G01A 4QTDA 5BV3A 1PMUA 3OWLA 4O1OA 1FOTA 4E26A 3UIMA 5DE2A 4FTCA 3HAMA 3I79A 2R3GA 3NNXA 4PL5A 3DY7A 5JRSA 4U42A 4C34A 2OLCA 3WI6A 5CLPA 4EZ5A 2QI8A 3KXGA 3P4KA 1L3RE 4ZTHA 3O17A 5FDXA 3PTGA 5DGZA 2HZNA 2WTIA 2R5TA 4LL5A 5IQFA 1LP4A 5FD2A 5KZ0A 2O5KA 4D4SA 4OTDA 3QUPA 4EH9A 3UVRA 1JBPE 4LYNA 4QYGA 1W82A 1M2QA 2BAKA 4A4LA 1PKGA 3OWJA 4I6LA 1YHVA 1ZOGA 3HV5A 1OBGA 4BDAA 1XBCA 2W17A 4AZEA 3R0TA 4G31A 4O0YA 2Z7QA 2PE0A 2R3OA 4U81A 3LFQA 4ACCA 4MWHA 3SXFA 2GDOA 2CKPA 2B54A 1H1SA 3MVMA 3O51A 5EKNA 3GCQA 5BVFA 5LMKA 4G16A 4BDDA 2Y6OA 2JFLA 4C4FA 4FV7A 3UG1A 3VVHA 1Y91A 3DGKA 3KK8A 1W0XC 2UV2A 4KBCA 5AR5A 3WF7A 2PTKA 3A7FA 4MQ2A 4LRKA 4V0GB 4TYIA 4F09A 3UMXA 2QOBA 3R1SA 4QTBA 3QCSA 3D5WA 3QUEA 3QZIA 2O8YA 1H8FA 3ZBFA 4FSQA 4GK3A 4FTOA 2UW4A 5L8JA 1T45A 1YW2A 2V7OA 1WFCA 4DTKA 3AT2A 2R3LA 4HPTE 4TZRA 4GL9A 5GHVA 3JS2A 3NW7A 3BHVA 4JL9A 5IPJA 1NVSA 1OBDA 4E20A 4IWDA 4E4NA 3FLSA 5DBXA 4ITHA 4W8DA 5KKRC 2OO8X 3M1SA 4CFXA 4FEQA 3HX4A 5HE1A 3N51A 1H07A 1ST4A 4DFUA 2X0OA 3UP2A 4Y5QA 3AMYA 4DFXE 3KREA 2X9EA 3NVKI 4TL0A 4JS8A 3TYKA 3KC3A 4J7BA 4R3PA 1AQ1A 3DLZA 5E1EA 5AX3A 3ZXZA 4FEVA 4IB0A 3CGOA 4BHZA 3CTQA 1TFFA 3G0EA 5A3XA 1BYGA 3VS6A 4RIYA 4GFMA 4M14A 4PNIA 4ZLZA 1XR1A 3HGKA 3R1YA 4C7TA 3O96A 4UY9A 4Q5HA 2O63A 2R3RA 4MHAA 5LWMA 5E9EA 3DAJA 4TWNA 1ZY4A 5AX9A 4A07A 3UQCA 2CSNA 4F1MA 5BVOA 4F6SA 1U59A 2BUJA 3DDQA 3G6GA 4PV0A 5HOAA 4DEBA 1JKKA 3FY0A 4BC6A 5ACBC 4BTJA 3W0NA 4QP9A 5A6NA 3EB0A 4U8ZA 4QMQA 2HZIA 3DDPA 2WIHA 3QXPA 4U5JA 2YA9A 3QRTA 4DTAA 2HXQA 2F57A 3NUYA 3O50A 5LJJA 3QQLA 3KFAA 5IQIA 1PW2A 3OROA 2ZM1A 4FSWA 4BTFA 3R8ZA 5JFXA 1LEZA 3CQEA 3AC1A 2R3PA 3I6UA 1UNHA 4KKEA 3ZSIA 2YWVA 4DFBA 3RPVA 2UZDA 3ATTA 2I6LA 1LEWA 5C8NA 3P7AA 4TKSA 4YJRA 1E9HA 5BVNA 3DK3A 4YTCA 4QTEA 2GNHA 5CEMA 3ZLYA 2CLQA 3ZDUA 4IIRA 4O7VA 3VN9A 2YCSA 3QYWA 3IW4A 4JR3A 3W8LA 3KQ7A 4U40A 1W83A 4AOTA 2XK8A 3ZXTA 1DS5A 4E8AA 4AXCA 4QQCA 4FG8A 3VUKA 4GW8A 2W96B 4BIBA 3UOHA 2B4SB 5BYLA 1FVRA 2E9PA 1VJYA 4RVTA 1YOMA 2YM7A 4RBLA 4RG0A 3QD3A 2QOOA 2VO7A 4IACA 3AC5A 1XH7A 2F4JA 3RHKA 3H0ZA 4ZOGA 4RPVA 4TYHA 5IQGA 2UZLA 3CJFA 4TWOA 2VTPA 3NYVA 4RZVA 3F5PA 2DQ7X 4HGSA 1WBWA 4KAOA 5DFPA 3UE4A 4EORA 2C6LA 3U54A 2UW9A 4X6RA 2H96A 3KY2A 5H2UA 2WU7A 3PDTA 4OTFA 2XANA 4X3JA 5CVFA 3HL7A 5L8KA 3EKKA 3EQGA 3E63A 3VBYA 4CTBA 5B2LA 4RIOA 3HRBA 3RPRA 3OW4A 4WD5A 2JAVA 3AXWA 3TV6A 3QQFA 3V8SA 4ASZA 3O0GA 4EOMA 1XWSA 4CGAA 1BL6A 2ETMA 4HCVA 3HRCA 3LLAA 4FF8A 4FX3A 4IWQA 1H27A 3W0QA 1Q3DA 5HTIA 3FI2A 4L52A 4MXXA 4ZY4A 3PXFA 4F1TA 2C0TA 3FC1X 4H05A 5E1SA 4BR3A 4D5HA 5HORA 1J1CA 3C4EA 3A60A 2JKOA 2Y4IB 3KULA 4FKPA 2PUNA 3SVVA 2YAKA 3PJ1A 2PSQA 4ZJJA 3W16A 5IA0A 2DUVA 1H00A 3BKBA 2OJFE 4GIHA 3HEGA 3RVGA 3VBQA 1Z5MA 5L2QA 3FZRA 5CT7A 3SXRA 3U9NA 2XNOA 2W1HA 2F7XE 2IF8A 5CU6A 3QA8A 4X2NA 4GV1A 2WMTA 2VTOA 4IAFA 2CLXA 3IW8A 2HYYA 3TI1A 2P0CA 3NSZA 3PPJA 4UMUA 5M08A 2BFYA 2ZV9A 3G0FA 5CEPA 3PXRA 1ZWSA 4XOYA 3R2YA 1QMZA 2OJ9A 3ALOA 4FK3A 3I7BA 2J7TA 3Q52A 4O2PA 2ITPA 4NZWB 4B9DA 5JSMA 4RJ5A 2ZV2A 1TQIA 4KINA 4CFWA 3UNZA 3ORXA 4NEUA 5J9YA 2VD5A 1BI8A 5BUJA 3FWQA 4M69A 4QMZA 3D0EA 2PYWA 4GJ2A 4A9SA 4F99A 4IAAA 3PRIA 3R7OA 4C57A 2IEWA 2XYNA 2WMXA 3OFMA 1OPKA 1TQPA 5EYKA 1RDQE 5CYIA 3C5IA 3MPAA 4FTNA 5LVLA 3DA6A 4TYJA 5LVOA 5I9WA 5M56A 4ANNA 3CQUA 1R3CA 4FKUA 4JR7A 2O64A 4IM3A 3U87A 4IFCA 1G8SA 2QR8A 3JY9A 5EDRA 3BLAA 3KVXA 5HVKA 3ODYX 3MVHA 3NPCA 4FGBA 2YM6A 4JDKA 4IHPA 4PY1A 3CS9A 4DFNA 3F6XA 4E6AA 4JBPA 4OTWA 3HDMA 4DG0E 5LCKA 4Y83A 4QOXA 3D15A 2XIZA 3OD6X 5AUZA 5CSPA 4AE9A 4MBJA 1SVGA 1JNKA 4M8TA 5AR2A 4AA0A 2XAOA 3FQHA 2XARA 5HG9A 3OUNB 1FBNA 4AT3A 1MRUA 5IMXA 4MF1A 2YIRA 3P9JA 2BDFA 5KE0A 3A4PA 5HHWA 5K5XA 3FHRA 3A62A 4FTAA 4Y85A 3O71A 4FKWA 4M12A 4IAKA 1JKLA 3MH3A 2BDJA 2VTQA 2Q0NA 4ORKA 2B9HA 4U80A 2P4IA 1XMLA 1KV1A 2O65A 3GFEA 4ASXA 1YDRE 2J0JA 4BWPA 1Q61A 1Q3WA 1UNGA 3QGWA 4G6OA 3QQKA 3C4XA 2HY81 4GYGA 4WG5A 4AA4A 2YM5A 1PYXA 4HGTA 5CTPA 4CKIA 4WRGA 3OP5A 3PP1A 1O9UA 2FA2A 2DYLA 2GNLA 2YN8A 2WFYA 3GCVA 4WKQA 5E8ZA 5EW8A 5CU0A 1PRYA 4LV7A 4EH6A 3LJ2A 5IQHA 3T3UA 4QYFA 2OSCA 4FC0A 3P78A 4YZMA 5CASA 4BTKA 3EQCA 3SA0A 1QPEA 3LM0A 4AW5A 4YHTA 1KE6A 4OBPA 2X6DA 5T68A 1ZZLA 4LMNA 1M14A 3SW7A 4CEGA 3D5VA 5EHYA 4PDOA 4L3PA 4APPA 4HGLA 1UNLA 2YIWA 3EOCA 1JQHA 2A2AA 4FIEA 3MIAA 2YCRA 3Q53A 2PMIA 5JZNA 2UVXA 3RAKA 1Y57A 4NU1A 5J1WA 4EC9A 4D5KA 2Y4IC 5E8WA 2BIKB 1KWPA 4RA5A 4CMTA 4D0WA 3P0MA 3PSBA 3VULA 5B0XA 4X2KA 2WOTA 3FAAA 2OKRA 2X7GA 2H6DA 4J52A 4KS7A 3NZ0A 3FY2A 4LRJA 4OTRA 4OTPA 4YJTA 4EH8A 3FMHA 3SDJA 2J0LA 2QOQA 4RC3A 4X21A 3TMOA 1O6LA 4CRLA 2PZ5A 4KWPA 3AKLA 4FIFA 2HENA 2JBPA 4YNEA 4YJNA 3GB2A 2FYSA 1W8CA 3QQJA 4J53A 4E1ZA 3KVWA 3QA0A 2WTDA 4K18A 1OL7A 3QWKA 1FGIA 4AN2A 3QL8A 2W4KA 2Z7SA 3L8PA 4FTRA 4KA3A 3IDPA 4TYEA 3AD5A 4U3YA 3GGFA 3WIKA 4L6QA 3R8VA 3SW4A 1T46A 2UW7A 3KN6A 4E7WA 2B9JA 5IH4A 3UZTA 4U45A 1M7NA 2CKEA 3DBDA 2XIKA 5KMLA 3E5AA 4AT4A 4NJDA 5AA8A 4UV0A 2EU9A 4DFZE 3R9RA 3KF4A 3E3PA 5CEIA 1Q8YA 4FTQA 5AV3A 4IQ6A 4IB1A 3VUIA 2CGWA 2WMBA 3IS5A 5HBEA 4XLIA 4RIWA 3KMUA 3UVQA 5AV4A 2CNVA 4YBJA 1XBBA 3I1AA 1JSUA 4DGMA 3W2OA 3ZZWA 5LQFA 3P5KA 4ZLOA 3EQHA 3ZUUA 3OOMA 3HAVA 3HDNA 3U6HA 4TPTA 5BVWA 2QCSA 3PJCA 5HX6A 1YWNA 3CD8A 5HE3A 3SC1A 4PDYA 5AFVA 3QTRA 5AM6A 5TOZA 4M68A 3VWAA 3W2CA 4CV8A 1DM2A 2F7EE 1XQZA 2R3QA 4J8MA 3P1AA 4MEDA 4KBKA 3PVUA 2ITTA 3DB6A 2J5EA 3MH1A 4M69B 4CT1A 4FV8A 3L9MA 3C0HA 4BCGA 1NVQA 3NS9A 3DNEA 4H1MA 2QODA 1PY5A 2YFXA 5CI6A 4ANBA 4BRXA 2UZWE 3PP0A 3UIXA 4F9YA 1G8KA 4XH6A 1Q5KA 1QPDA 3FLYA 3KF7A 1CKJA 4YZBA 2W06A 4EH5A 3E7OA 1H24A 2J5FA 5TR6A 3VJNA 3QLFA 4QP1A 4LUDA 1KV2A 3F2RA 1K2PA 3R2BA 2VNWA 3U4WA 4IX4A 5ICPA 4TT7A 2ZV7A 4DHIB 2QO9A 2QOKA 3E62A 4CLIA 3FZTA 4GUEA 4G17A 1DAWA 3R8MA 5JT2A 3BWJA 3BI6A 4I5PA 3H10A 4UBAA 4N6ZA 3VUHA 3NVMB 4IANA 1JKSA 2CPKE 3E8NA 4D2WA 2XF0A 2VU3A 1PJKA 3FXXA 2F49A 4FMQA 3KL8A 3Q5IA 2C5VA 3I81A 4MVFA 3PRFA 5HIDA 4IVAA 4AF3A 3Q6UA 2CJMA 4FTJA 2PUIA 3K3IA 4GCJA 5HO8A 3B8QA 4MUQA 3FMNA 5LMAA 5CVGA 1UVRA 2C6OA 3PXQA 4JAIA 4GIIA 3C9WA 3WOWA 4CCUA 4NK9A 1XBAA 5ANOA 3PY0A 2B7AA 2ZOQA 4OR5A 4FKVA 5HZNA 5AP5A 3EIDA 1OIRA 5DPVA 4FZ7A 4XUFA 5DH3A 5GZ9A 3NW5A 5CNOA 4O4CA 5JK3A 3LIJA 3W1FA 4NIFA 5H8GA 3F3VA 2XK7A 4PTCA 4UMTA 5KZIA 3HV7A 1M17A 5HNIX 4KSQA 4RIXB 5JGAA 4O91A 3FZSA 1F0QA 2JIVA 4FSYA 4FOCA 2V5QA 3PG3A 5DEYA 2QHMA 2P55A 2VX3A 5M4IA 2QOLA 2E9UA 3CBLA 1MRYA 4FSUA 4DEEA 2VX1A 2XYUA 4FZFB 1DI8A 3BLQA 2ZJWA 3LQ5A 4JX7A 3HV4A 2QU6A 3P7BA 4MD9E 3VQHA 4DGOA 1WVXA 4EWQA 4F63A 3IW7A 3BHHA 5FM3A 3VONA 4IE9A 2C5XA 3BU5A 3V01A 2BKKA 3ACKA 4L9IA 3RWPA 2GFSA 4V04A 4MYGA 4N4SA 4QD6A 5CY3A 2XKCA 2VTHA 3G15A 4AFEA 4R3RA 2VTAA 2VV9A 2AYPA 5G1XA 3BYSA 5M44A 4O0UA 4FODA 3DXNA 2ZYBA 2JKMA 1O6YA 3L9LA 5DT0A 1OECA 5EOLA 2G9XA 5A4LA 3R9NA 2UZTA 4UN0C 5AUUA 3SGCA 3VUDA 1YHWA 4AW1A 4NM7A 4QNYA 4EUTA 2P3GX 3OCGA 2G15A 3QALE 4AACA 3U4UA 1IAHA 4Z7HA 2F2UA 4R8QA 2XKDA 3CY2A 3MFSA 2ACXA 3MS9A 3FLZA 4KKGA 3SRVB 5DIAA 4BBFA 5J9LA 3GQIA 1ND4A 4AAYA 2FB8A 3DBCA 4RC4A 1RW8A 4I6FA 3KRWA 5DNRA 2XZSA 4JMQA 3EYGA 4XG2A 4DC2A 3RKBA 5CF5A 2BILB 2AQXA 1GOLA 2WELA 4WNOA 2CCIA 2E9NA 2XM9A 4B4LA 2YM8A 4ALWA 4QQ5A 3PPZA 4G3CA 1Q97A 1YWVA 4LGHA 5D9HA 5HLNA 5JKGA 4KIKB 5E4HA 1PXMA