4EKLA

Akt1 with gdc0068
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
335
structure length
329
Chain Sequence
b'RVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPSMECVDSERRPHFPQFDYSASS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-alpha serine/threonine-protein kinase
publication title An ATP-Site On-Off Switch That Restricts Phosphatase Accessibility of Akt.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 100
structure length 329
sequence length 335
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eklA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eklA01
2R3IA 3D0EA 2JIVA 2NRYA 3MIYA 2PVHA 3ZO1A 4IZAA 2R3OA 4WHZA 1IR3A 2PUIA 3HEGA 5KMKA 4CFFA 5C8MA 3FLZA 5KMNA 5IQAA 3LXKA 3VS4A 4XG2A 4AQCA 2C3LA 4IWOA 4I23A 3SA0A 4LI5A 3POZA 2C6OA 3PWYA 4U9AA 5KMOA 4I5HA 4LGDA 4BBMA 3KN6A 1ZXEA 3LLTA 4YNOA 2WPAA 4CV8A 2F7ZE 5HEZA 4HNIA 5CF5A 2RFNA 2UVYA 2ZYBA 3B8RA 4FSUA 2RG6A 5HORA 2BFXA 4I94A 3JUHA 4Y85A 4GVJA 5FP5A 3BIZA 4AFEA 1NT2A 5HVJA 3OWLA 4WNKA 3RMFA 4C4JA 3QD2B 3QUDA 4MBLA 2YWVA 3HAMA 2CN8A 3D15A 4DEHA 4GS6A 3V8TA 4Z55A 5BVOA 5F20A 3W8LA 4IM2A 4FTLA 3ZRLA 4TL0A 3SG9A 4E6CA 2PVNA 4RMZA 2OGVA 4FL2A 3GP0A 4MXYA 4UYAA 1WBOA 4BCPA 4ENYA 2O3PA 2ITTA 3UOKA 4AN9A 3G90X 4A9UA 4J96A 3I7CA 1MUOA 2XIXA 1QPJA 4EYJA 5DBXA 5HQ0A 2I6LA 3R1YA 5AR4A 3LZBA 5J8IA 4XNEA 4PPAA 3F61A 4C58A 3TZ8A 3GCVA 3NUYA 2ONLA 4C7TA 2UZUE 2I0EA 3NNWA 3KGAA 5JRQA 3ATTA 4QMTA 3OY1A 3QGYA 4UY9A 4XG7A 4GW8A 3N9XA 3UOJA 1ERKA 5EOBA 3ZLWA 5CT7A 4WSQA 2VWWA 3COIA 2XKEA 2C4GA 4AWIA 5HTIA 4IEBA 4GUEA 4O27B 2E9OA 4GU9A 3BEGA 3ODZX 3ZSHA 2WTKC 2PSQA 2CLQA 4O0TA 5DEWA 4QYFA 4K11A 2VTMA 4WG4A 5DLSA 4RJ4A 4ORKA 5A4QA 4FG8A 3KREA 3FMDA 4WD5A 2QR8A 3QD4A 4MAOA 4UMQA 2QOIA 4RRVA 3R2BA 3RWQA 5A4TA 4XV1A 2GNLA 3PDTA 2PVKA 5A6OA 5L6PA 5IQFA 3H9RA 1U54B 1YWNA 3VC4A 4MTAA 2X2MA 4FSRA 5GJFA 3W55A 4D2VA 2EXCX 3Q5IA 3NNUA 4BL1A 1YXSA 4FKTA 3COHA 2VO7A 3QYZA 2YA9A 3UVPA 5JZNA 4R5YA 5CX9A 5DN3A 4HVDA 2HZ0A 2ZB1A 3E5AA 4QMWA 1GZNA 4WOVA 3WF6A 3FUPA 4DG3E 1Q41A 4J8MA 3MESA 4S31A 2X8DA 4AA4A 2BTRA 4IAZA 3V5JA 4C2WA 4C62A 4O7VA 3QKKA 4PL4A 2QOFA 4F70A 4AT4A 3ID6C 2OZAA 4IW0A 2YCSA 1YRPA 3PYYA 3DXNA 5HD7A 1UU7A 3BGZA 3MY0A 3R8ZA 4TN6A 3HYHA 4DFLA 1UNHA 2ETRA 2HWOA 2QOOA 2VWIA 2YIRA 2RIOA 3TNWA 2F57A 2CNVA 3KCFA 1FMOE 4GFGA 4IANA 2XJ2A 4IMYA 2B9HA 3DZOA 4X2NA 3U55A 2X81A 2QODA 4U5JA 3P7AA 4J98A 2VD5A 5AAFA 3MSSA 5C9CA 2PUPA 3QUEA 2XRWA 4FOCA 1UKHA 2JDOA 3LFSA 2ETMA 4ZOGA 3EL7A 4FG9A 3E87A 4YPDA 3ORNA 2RSVA 2WTJA 4L43A 5FQDC 5EKNA 2OJ9A 5DWRA 1Q8TA 4EBWA 2OKRA 3FZPA 3JVRA 3MFTA 3REPA 1HCLA 1WBTA 5EDQA 1URCA 3NIZA 5BPYA 5DR9A 3H9FA 4UEUA 3F66A 5EOLA 5FRIA 3PXRA 3W16A 5FTGA 5IQHA 4RX7A 2HXLA 1MRVA 3FXXA 4X21A 1W84A 3PVWA 2YERA 4QMPA 2UZLA 2G2IA 3KMUA 3SXRA 3R7GA 3NMUF 1M17A 3LFAA 3R30A 1G8AA 3TNQB 4UX9A 3ZO2A 4YLLA 2CHLA 3BQRA 3CPCA 3DKGA 4JQ8A 2WMAA 2A19B 3JPVA 4RZVA 3IGGA 3LJ2A 5HX6A 4CFMA 3RNYA 4NJDA 5BMMA 4Q2AA 4HNFA 5JN2A 5GZ9A 2PVYA 3UIBA 4M69B 3TUBA 3V01A 4I1ZA 5IPJA 1W7HA 3A61A 3SLSA 3FLWA 4LV8A 4X6RA 4HVHA 3MWUA 3T3VA 2WOUA 3HAVA 4DA5A 4QTDA 4XUFA 2A2AA 1FVRA 4RLKA 4ZLOA 3CTQA 1SNUA 5C26A 3MH0A 4N4SA 5AP0A 3OC1A 4A9YA 4KS7A 2QD9A 4W8DA 4CFNA 1M7NA 4YJTA 5CWZA 4E20A 3KKVA 5EYKA 2QOQA 2C3JA 2OJJA 1B38A 2UW4A 5CTPA 3TNHA 3UPZA 5HE0A 2C6EA 2RL5A 4IAIA 2O63A 2PUUA 1Q8WA 3DNEA 4XV2A 4W4VA 2HW6A 2QURA 3F2NA 3U54A 4OGRA 1XBAA 4GYGA 4JBQA 4PL3A 4G17A 3E3BX 4DE4A 4IAAA 2R3RA 3QHWA 1OIRA 3QXPA 4QMZA 3PFQA 4RJ5A 3LMIA 3D7TB 1OGUA 2QC6A 4U43A 5CEOA 2YN8A 2QLUA 4BTJA 5JQ8A 2R0IA 3DKCA 3Q9ZA 4FZDB 5CU4A 5I3OA 3SC1A 3BI6A 4RIWB 1FINA 4I5PA 4D4VA 3MFSA 4GEOA 4YGAA 1U59A 3ZO4A 5IISA 2CNUA 4DCEA 4K0YA 3TUDA 5GIPE 1WAKA 4ASXA 2YM6A 3BPRA 4O38A 5GIOE 3PLSA 3G9LX 3NW7A 4BKZA 3VF9A 4DG0E 5A4EA 1J7LA 4NUSA 4O22A 5CVHA 1Y8YA 3DTCA 4BDHA 5IMXA 4G16A 5FEQA 3I4BA 4FIGA 3TKUA 5DR6A 5JFVA 1DS5A 3V8WA 1DM2A 3QX2A 1FGIA 5KMMA 5JFXA 2WMRA 3R9RA 5EW3A 4ZZNA 2BTSA 3I1AA 3EKNA 3FMLA 2CKPA 2J0IA 5J1VA 5HGIA 2OJGA 4PDOA 4ZK5A 3C4XA 3FQSA 2JFMA 2RG5A 2WD1A 5A46A 5C01A 3UO5A 4CLJA 3FPQA 4F9CA 2WFYA 2PY3A 5IMEA 5K4IA 3EHAA 1LP4A 2XIRA 4JVGA 2C5XA 4FZFB 3AC5A 2KTYA 1R78A 3OUKA 4UWYA 5CZIA 3R1SA 5L3AA 1Q5KA 1XR1A 3OCGA 3E93A 3ZBXA 2PU8A 3SVVA 5M53A 4HW7A 2GTNA 2IO6A 3SV0A 3FC2A 4OW8A 3LFEA 4P5ZA 5CAPA 3QC9A 2BDWA 3ANRA 3FWQA 3AQVA 4V0GB 3CQWA 4KKGA 5A6NA 2BHHA 4PWNA 2UV2A 2BKZA 5HIDA 3TACA 3S4QA 3QWJA 5AV4A 4BB4A 1YVJA 3MV5A 4D1SA 3QTZA 4C2VA 4YC3A 2YM7A 3KC3A 3C7QA 2ITYA 3UGCA 3FY2A 4PMTA 5TO8A 3ZXTA 3KULB 3SHEA 3II5A 4QPMA 3A7HA 2HYYA 1SMHA 3R04A 4RVKA 3O8PA 4DH5A 3FQHA 5DT3A 2ZM4A 1K3AA 4F0FA 1H1WA 3D5WA 4JLCA 3ALOA 5KKRB 3HZTA 4LQMA 2PVFA 4AX8A 2VTHA 3LJ0A 3EH9A 3NYNA 4NU1A 1H07A 5M09A 2BRHA 1GZ8A 3CPBA 3DAEA 3KK9A 1YXTA 3CQEA 4PTEA 2Z02A 2BZJA 4EOOA 4BYIA 2YITA 1WVXA 3P78A 4J97A 2XYNA 3QX4A 3OP5A 3UVQA 3GCUA 4G34A 5EYMA 3UNZA 2BFYA 3R1QA 3NCZA 4FTRA 4FTKA 3A7IA 5B0XA 4J53A 4DH1A 4FTTA 4M66A 1TQIA 4JOAA 1O6KA 1REJA 3E62A 3ZLXA 4OAUC 1Q4LA 2Y4PA 2X7GA 5DOSA 5CSHA 2B1PA 4WA9A 1ZARA 2UZEA 3ZXZA 3F6XA 1ZYJA 4DLJA 3FI4A 3FDNA 1JOWB 2GQSA 4C33A 3WARA 4MX9A 2W1CA 4O0RA 1URWA 3MTLA 4HYSA 4EOQA 5TKDA 2Y4IC 2YCRA 3MVJA 4LOQA 4QYGA 4CZUA 2VX0A 2BRMA 4R1YA 3FC1X 3GQIA 4L7FA 4ZZMA 4JJRA 3HMIA 3MGYA 2I0VA 3W1FA 2A27A 3QUPA 2IVVA 4PP9A 3R63A 4FC0A 5KMJA 3EFJA 4FIFA 1OVEA 4AW0A 5BYLA 3OFMA 4PPBA 4E73A 2IVTA 5A54A 5FXQA 5C8KA 5J1WA 3LXNA 3OWPA 3C4ZA 3EYGA 3LFDA 3DAKA 4M7IA 3VBXA 1H1RA 1XH6A 3GEQA 4GK4A 3R6XA 5AV3A 2WKMA 4EHGA 3RVGA 5G1XA 2X2LA 4ACDA 2HELA 3E7OA 3FSFA 1P4OA 5FLFA 5CAQA 3ENHA 2R3MA 3MVHA 2QKWB 2DUVA 4KSPA 5AUXA 5JH6A 3MFRA 1OMWA 2PMLX 3QL8A 5IEYA 2VO3A 3KXXA 1BMKA 2FH9A 5IA5A 5HG5A 2J9MA 4MNFA 3EN9A 3U9CA 2BIYA 3TTIA 1V0PA 3LM0A 4FNYA 4BIDA 1YOMA 2VRXA 4BN1A 5C03A 4ZJIA 1IAHA 5ETIA 2I0HA 4G6LA 4HYUA 3F3UA 2UUEA 2QR7A 4QOXA 4R3RA 5CQWA 1H1QA 3QXOA 4CQGA 2VWXA 3F5XA 3SW4A 4WIHA 5K3YA 5T6KA 4I21A 1RQQA 3E3PA 3GENA 3RK7A 1PRYA 4EUUA 2XK6A 3DBDA 4PRJA 3PE1A 4YJOA 4J71A 3LOKA 1V1KA 4U7ZA 3DPKA 4M13A 4D2RA 4QQTA 4D1ZA 2HIWA 2VTPA 2BAQA 4FNXA 3EN5A 5EKOA 5CENA 4J7BA 2PHKA 4Y95A 4RBLA 3RAWA 3I81A 3PPKA 2WAJA 3Q60A 5AV0A 3C13A 3R02A 5FXSA 1Y8GA 5IQIA 3UZPA 4PQNA 3RKBA 1M2QA 4EOSA 5DMZA 5HLNA 5AAEA 3U6IA 5IDPA 2HZNA 4I93A 1XH4A 3WYXA 5I9WA 4QP9A 2JDSA 5KHWA 4DGGA 1PMNA 5LVNA 5LJJA 1OIUA 4FTAA 4FVPA 3NUAA 2XK8A 4TKSA 4O7YA 3QQJA 3OWJA 2YIXA 4EWHA 4FEUA 4U80A 4FV2A 3OCTA 3WE8A 5KCVA 1PXLA 3CR0A 2F7EE 4IB3A 4TWNA 3C0GA 1VZOA 2XK4A 4YTHA 2B4SB 2WQOA 1OL7A 3PVUA 4P7EA 4PMSA 3QQFA 4W8EA 4BVUA 5F9EA 1KWPA 4FKPA 3QRUA 4CFXA 3BKBA 2QCSA 3HLLA 3F5GA 4ZSLA 2QO7A 3LFFA 3FLYA 4EOLA 4MD7E 3Q2JA 4I20A 5LOHA 3KN5A 4BBEA 4C34A 5JEBA 4C36A 3QA8A 4IAYA 4RFMA 2VTOA 3DV3A 4YTIA 3A7JA 3R00A 5JGBA 3CGOA 1FQ1B 2OI4X 1SM2A 4I6BA 4JBOA 4FF8A 2UW5A 4BTKA 4E4MA 5CXZA 4XCUA 4XV3A 1A48A 2ZJWA 4XS2A 3SRVA 2XRUA 4G2FA 3RPSA 5EM6A 1KE5A 1XH8A 5CNOA 4WG3A 4XP2A 4IAFA 5AP7A 4YZDA 2R3NA 4GT3A 4AGCA 3RM7A 4FA2A 4YPSA 2UW9A 5DVRA 4ZMFA 3P79A 2V7AA 4RJ6A 4E26A 2BVAA 5ETAA 2VX3A 2XBAA 5AA9A 1IA9A 5AJQA 2IZTA 3Q3BA 4FIJA 4TPTA 4FTUA 3NGAA 1WBPA 4EHZA 1GAGA 3OD6X 2GU8A 5JMSA 4FNWA 3UODA 3HV3A 3R8VA 3F69A 3M11A 3UP7A 4YO4A 4IX3A 2Q83A 2P33A 2P2IA 4J8NA 1XH9A 2GMXA 4QMYA 2X8IA 3EQCA 5EYCA 3VN9A 1T46A 2BPMA 2WB8A 2Z2WA 3H10A 2JKQA 3Q96A 4UWBA 3U6JA 5EDRA 1YHVA 5ANGA 3DTWA 3SOAA 4AW1A 4B6LA 4DEBA 3IO7A 5IEVA 2UW8A 3GU6A 3UC4A 3UTOA 3UIXA 1L3RE 3NNVA 3SX9A 4HCVA 5AR7A 4BI1A 4OT6A 4IM0A 2VWUA 1DAYA 1LUFA 1ZMVA 2WTIA 3MJ2A 2GHLA 3DJ5A 3WF5A 3NCGA 4IC8A 4XRLA 4FE2A 4RWLA 4D4SA 4KAOA 3SQQA 3TM0A 3HGKA 3BE9A 3FZ1A 1SVHA 4ZAUA 3VO3A 4D5KA 2R64A 3CBLA 4HZSA 5EM5A 4XBUA 1GNGA 1OL6A 2GS6A 4YC8A 5L2QA 3VBQA 4LFIA 4QP4A 1MRUA 3DT1A 4I6HA 3MIAA 1WMKA 3UJGA 4B4LA 5JGDA 3CCNA 3LQ3A 3VBTA 3QRJA 3ZH8A 3VBYA 3IW8A 2G2FA 5J5TA 3ZTXA 3UPXA 3HDNA 4Y8DA 3V6SA 2RFSA 4FV9A 3OXTA 3Q6WA 1H01A 4RWKA 5HCXA 4DGMA 4L68A 2YIYA 2IG7A 4O84A 3RZBA 4QMNA 3PP0A 3AOXA 3HL7A 4FKQA 3BHTA 1FPUA 2A4LA 3VW6A 5AA8A 3Q9XA 1XJDA 3T3UA 1XKKA 3L8PA 1YXUA 3LCDA 5L2IA 4X2FA 3RI1A 3PY0A 4GG5A 3RCJA 3ODYX 4IFGA 3NYXA 5ANJA 2HAKA 3AG9A 3UG2A 4BZDA 3H3CA 3V04A 4EHEA 4KIKB 2YLEA 4C4EA 3OXIA 1IEPA 2FSLX 4C37A 3HVCA 5J9YA 5EM8A 4RWIA 2H96A 3HMPA 4XOZA 4AP7A 4L8MA 4CGAA 3QRKA 5TOZA 2JBPA 3FHRA 3R7UA 4ITHA 4FG7A 3FKNA 3Q53A 3OBGA 3QTQA 2H9VA 3DBCA 3EJ1A 5AV1A 4Q5EA 4AN2A 5AX3A 4DLIA 4GKHA 4IB1A 4USEA 3ORMA 3GGFA 3BWJA 1OPLA 3W32A 3LM5A 3GU4A 3C4FA 4AN3A 4FTOA 5HOAA 4BGGA 2OWBA 4CMUA 3W2SA 4OTPA 4A4LA 4AZTA 3QALE 3OTVA 2WQBA 3BRBA 1J91A 2QNJA 5I4NA 2BZIB 3NUPA 3O8TA 4EH5A 2WHBA 4KD1A 4W4WA 2OO8X 4L3PA 5K5XA 5HICA 4BHNA 4I92A 4U3YA 3IW7A 2OG8A 4IQ6A 4KSQA 2UVXA 1PMEA 2XNOA 3KK8A 3QTIA 1KSWA 3DK6A 3HNGA 3OEFX 3TI1A 4C0TA 3MH1A 2ZV7A 4DEEA 1GJOA 2OIQA 4RA4A 4ZJVA 5HU9A 1KE7A 1I09A 2FVDA 3A2CA 5ITAA 3PSBA 1IAJA 2XNEA 2EUFB 3BHVA 5HLWA 2PYWA 3NYOA 3EQFA 2PVMA 4FICA 2WU6A 4EEVA 1CDKA 4M68A 5CSWA 4FZAB 3TWJA 1PHKA 3C4WA 4C3RA 1OIQA 3VS5A 2GNGA 2QOHA 4BF2A 4YTFA 2W4OA 3QLGA 4KBAA 5BQ0A 3PA3A 4EQMA 3LLAA 1PXKA 1S9IA 1WZYA 5D9HA 5HLPA 3NUSA 1Y6BA 3LMGA 2WTKB 4MF0A 2WMWA 3ACJA 4GJ2A 4UALA 3VAPA 5HE3A 3V51A 5E9EA 3K5VA 4EC8A 3VJOA 4IE9A 3AXWA 3S00A 1CKPA 4C57A 4U79A 3BGPA 3C51A 4CRSA 2VTAA 3GU7A 5A3XA 2YACA 5E8TA 2W9ZB 4CYIA 5LQFA 3DB6A 1OI9A 1OUYA 1YI3A 3HMMA 4ZLZA 4HVSA 3GB2A 5AFVA 2G1TA 5DNRA 3GQLA 2EB2A 3KVXA 4FKGA 5EQEA 2DWBA 4LRJA 5TT7A 5M4IA 1QPCA 2V22A 2JDRA 4NFNA 2BUJA 4MEDA 2WQNA 4XLIA 5AM7A 5IH5A 3C5IA 4ASEA 4CKRA 3PUPA 4IXPA 4F6WA 2R4BA 3AMYA 4FV1A 4IJ9A 4MKCA 1TQPA 3I7BA 5FBNC 3TNPC 3EN7A 4G9CA 1M2RA 1ZOEA 2PK9A 4WSYA 5J5SA 1P4FA 3A7FA 4QPSA 4RWJA 3DQXA 3SG8A 3R8UA 4FT5A 1F5QA 3TIYA 4YSJA 4N0SA 4RG0A 2CN5A 1FVVA 4DTBA 3S3IA 3QQLA 3HA6A 1QCFA 1BX6A 2WXVA 3QRIA 3F5PA 1MQ4A 2EWAA 4P90A 1JBPE 4ID7A 4QP3A 3AT3A 2P4IA 1WBSA 2OF2A 2UW0A 2R3QA 3PA4A 3LAUA 3BHHA 4I6QA 3KVWA 3DU8A 4NT4A 5IG1A 2XCKA 3MY5A 4U44A 3LFNA 3ITZA 1U4DA 4MD8E 3PVBA 5HZNA 3CIKA 4M15A 4IZ5A 4LOOA 4EL9A 4EQUA 2F2CB 3TNIA 4QMUA 3IW6A 2C6IA 3I79A 4A4XA 4O86A 3BYSA 4IWQA 5ANKA 3V5TA 3O2MA 4O0UA 4QQ5A 2ZDUA 4D1XA 2IJMA 4ZTLA 2XS0A 3ZLSA 2WGJA 2JIUA 3MFUA 4V04A 1BL6A 3QWKA 3ORXA 3O7LD 4HJOA 2YAAA 4FGBA 2OFUA 2OF4A 3TZMA 3SDJA 4RFYA 3TJDA 3TV4A 3VUKA 4EH6A 3R7EA 3ZOSA 2XNMA 3M1SA 4GVAA 2XYUA 4J95A 4FSYA 4AXAA 3PJ3A 5CF6A 3IGOA 1ZZ2A 4QNYA 4ZY4A 4FV3A 4W9XA 3DB8A 3VIDA 4L01A 4AUAA 2O2UA 4XYFA 1YHSA 3DA6A 5K0KA 3R1NA 1APME 1QL6A 3EL8A 4O6LA 4EHVA 4AGDA 4JRNA 4KKHA 4K18A 3MJ1A 4ANLA 2O0UA 5CU2A 5M44A 1K2PA 4JR7A 4RSSA 2C1BA 2OH0E 5AR8A 4M8TA 1BI8A 2VTJA 2G15A 4OBPA 4U40A 5E8YA 5ANIA 4O6EA 4NM0A 4F63A 3UBDA 4EZ5A 1JLUE 4JL9A 4DAWA 3FZTA 3CGFA 2UZWE 2VWBA 3GC7A 5FBOA 4S2ZA 2XF0A 2F4JA 3RZFA 3ZRKA 3R8LA 5CS6A 4F08A 3D5UA 4UWCA 4E4NA 4O7TA 4YLJA 4IB0A 5FG8A 3R8MA 4ENXA 1M2PA 2J5FA 3HX4A 4O0SA 3LCKA 4DH3A 4A9TA 4I22A 4NSTA 3W33A 3F88A 4Z3VA 3O71A 4OTDA 1PXPA 2WZJA 4PV0A 3BU5A 4GU6A 3W8QA 1YWRA 4DFNA 1S9JA 2X6EA 4FYOA 3TDVA 5BYYA 2VAGA 4U0IA 4J99A 1NXKA 3Q9WA 4GIHA 4AF3A 1SNXA 3B2TA 2HOGA 2QO9A 3AT4A 3OW4A 4UMUA 4CFUA 1SZMA 4CMOA 5IF1A 4AZEA 3FZOA 3FE3A 4TNDA 4TYJA 5CU3A 1IASA 2FSMX 4NW5A 4W4XA 4BBFA 1XBBA 3PY1A 2WOTA 4NW6A 4L9IA 5JFSA 1RW8A 3QZIA 4AZFA 3ULIA 5AP5A 4FL1A 4X2JA 4BDKA 4TW9A 3DBEA 2WMBA 2REIA 3RGFA 2HZ4A 2G2HA 1W98A 3VHEA 5HVKA 4LRMA 2C30A 3RHKA 2C0OA 4FX3A 4M67A 3VW8A 3R9NA 5I9ZA 1JQHA 4OUCA 3UC3A 1YW2A 3SRVB 4EK8A 3D5XA 4BKYA 3RPYA 4BCMA 4Q9ZA 3EFWA 4FTQA 5BYZA 4DN5A 2UW6A 3Q04A 4QTAA 4V01A 4EONA 2J50A 1JSVA 2BRBA 2VNYA 3F7ZA 2CCHA 3F5UA 1E1VA 3UQFA 3BV2A 3LCOA 3S2PA 4CZTA 5DI1A 3U6HA 1EH4A 4DITA 5ACKA 2C6KA 4O7ZA 2B55A 3LJ1A 5DHJA 3IKAA 4HGSA 3CEKA 4G6OA 1MRYA 1J1CA 3F3WA 3N51A 2WIHA 4OBQA 4O1OA 4OTFA 3FEGA 2VX1A 5BUIA 4Q9SA 3ZO3A 2PWLA 2YCFA 3EN4A 4QRCA 3OMVA 3WIGA 3ZUUA 4XEYA 4ZSAA 4O0XA 5ACBC 1VYWA 5BVNA 3C1XA 3TTJA 2X2KA 3CC6A 3TEIA 2EU9A 4D0XA 3GOPA 3OWKA 3PWDA 1V0OA 4L67A 2OK1A 3D14A 4IWDA 4WO5A 4CNHA 4DTKA 5CANA 1Y57A 4CSVA 4BR3A 3FMHA 4G5PA 3DNDA 4O2PA 1PMUA 3PXZA 4GL9A 5T68A 2OLCA 3NIEA 2ZV9A 3O50A 4H1JA 5A4CA 2EXEA 3ZYAA 2NRUA 4XHKB 5DE2A 1H8FA 2YLFA 5AV2A 4FV7A 4AAAA 4H58A 5B2KA 1OUKA 3DCVA 1Z5MA 4FNZA 2CPKE 3QA0A 2B9JA 2B9FA 4R3PA 1OKZA 4MH7A 1G3NA 3WZUA 4O7SA 4DFBA 3THBA 4FT9A 4JDJA 4HYIA 4FV5A 4WRSA 1UNLA 3FKOA 1QPEA 4YHJA 4JAJA 2ZM3A 4E1ZA 3GFEA 4FEWA 1M52A 1VJYA 5CLPA 4B7TA 4IFCA 4AOJA 2XKFA 3PXYA 1TVOA 5T3QA 1HOWA 2O65A 5AP4A 2X6DA 3FMKA 5H2UA 4HVIA 5TR6A 4F1MA 3KF7A 5CSXA 3P9JA 1IG1A 4HCUA 4IZ7A 3ORZA 3MI9A 2I0YA 2PTKA 2WTWA 2ZV8A 3GT8A 4QO9A 4NM5A 3QLFA 4BCFA 4RJ7A 5AADA 3CSVA 1LR4A 3HDMA 5K0XA 3EOCA 3TG1A 4YZMA 3JY9A 3HV5A 5AP1A 1REKA 3R0TA 1YDSE 4B99A 2Y6OA 4ZSJA 4EOKA 2BDFA 2QLQA 3GU8A 2X39A 5BVEA 2C69A 4I3ZA 5ETFA 5AUWA 2Y4IB 3H0ZA 4RIXA 2XJ0A 3ZRMA 4Y5HA 5GZ8A 3EFKA 4CCUA 3FJQE 3TN8A 5M4CA 3HUBA 1FVTA 4ZTQA 5AUZA 5KNJA 3FMJA 2VV9A 4YSMA 4D5HA 4LL5A 4ACMA 3SGCA 3K54A 5ANOA 1TQMA 2PPQA 4FIEA 5HVYA 2C5OA 3HKOA 4F0GA 4Y73A 3MN3A 4NJ3A 5CAUA 1SVEA 4FV6A 3G6HA 5HIEA 4C4IA 3OXZA 3CXWA 3EB0A 4O1PA 1F3MC 5KO1A 1KOBA 3R28A 4ZTHA 2B54A 2FUMA 5B2MA 5L8KA 2VTNA 4UZHA 3UO6A 3AC1A 3BZ3A 4D2PA 3BHUA 3W2QA 3NEWA 5CSVA 3OF0A 4BI2A 4PP7A 3LCSA 4FSZA 1O6YA 2CMWA 5HBHA 4B0GA 5LCJA 1ZOGA 1WBNA 2XM9A 2X4FA 4AE6A 3SAYA 4R3CA 5E8VA 5D10A 3K3JA 3UQGA 5FGKA 1UU9A 5EQPA 1UU3A 4IZYA 3QD0A 3M42A 3R21A 1XH5A 3ENMA 4TZRA 4CG8A 4DGOA 2R3PA 2QOKA 3QZFA 5IQDA 4M0YA 2UZTA 3UOLA 3IW5A 2OIBA 1GIIA 4A7CA 3EQDA 4ZS4A 5DEYA 2QVSE 2W0JA 2JDTA 2RF9A 5I9VA 3AC4A 4FZ6A 3EIDA 3LVPA 4BCKA 4ASZA 5IA0A 5C1QB 1P14A 2A0CX 3E8EA 4MNEA 2WNTA 3CS9A 1PJKA 5HO8A 4RPVA 5HG8A 1CKIA 4WBOA 4FEVA 3MA3A 2JC6A 4F9YA 2QI8A 3P4KA 2Q0NA 2JKMA 4PTGA 3AD6A 3QCSA 2GCDA 2CGWA 2ZMCA 5CAVA 3MYGA 1H0VA 4OTWA 2GNJA 1PXIA 3D7ZA 3F7WA 4XBRA 3ZONA 4KRCA 2R3JA 1UNGA 2UVZA 4H3BA 2IVSA 2ACXA 4BGHA 1YDRE 4KS8A 4CLIA 4D4YA 3DZQA 2VTTA 3ATSA 5L2SA 4A4OA 5CNNA 4CYJA 4EJ7A 4IX5A 3CD3A 3A8XA 4AGUA 3OBJA 2R3FA 3C4EA 3OCSA 4QPAA 4YC6A 4JQEA 4H3PA 5A4LA 4IX4A 3B8QA 3K2LA 4U97A 4ZZOA 4JBVA 4U8ZA 4HVGA 4E5AX 1CTPE 2Z8CA 4EK6A 2H8HA 2ZAZA 4C3FA 5I5ZA 2WEIA 4F9WA 3ORTA 3PG3A 4D55A 4G9RA 3H4JA 4F99A 4KB8A 2OH4A 4FBXA 4IB5A 2F9GA 4FI1A 5J87A 2GFSA 3V8SA 4FKJA 5ETCA 1OKYA 3IECA 1W83A 1JKSA 2VN9A 2HXQA 3BBTB 4YJQA 4CXAA 4A06A 2IN6A 4C02A 3QGWA 4J52A 4L00A 3Q6UA 1YI6A 3R71A 3C4CA 4X3JA 4DFXE 4EBVA 3FLQA 2QQ7A 4CRLA 3AD4A 3OROA 3RAHA 1UWHA 3VUHA 2PL0A 5HO6A 4II5A 4PUZA 3UYSA 4ALVA 3IPHA 2LGCA 1G8SA 3R73A 2ITWA 4BIEA 2YM3A 5I0BA 3SOCA 4B9DA 3C0HA 3K5UA 4EC9A 4ZXTA 4BCIA 3HRFA 1R1WA 3G0FA 3G33A 1GOLA 2HWPA 2WMSA 3QKLA 4I0TA 1PYXA 4FKUA 3WF9A 2OJFE 2OW3A 4RC2A 4N70A 3KMMA 2R7IA 3O96A 2W96B 3NAXA 4MWIA 4EUTA 2YJSA 5BUEA 3DXPA 2HW7A 3VS6A 3EYHA 4X2KA 5L2TA 2PZ5A 3IOKA 5HCYA 3ZUTA 3AMAA 5HKMA 5KE0A 5IH4A 3EQIA 2OXXA 3MA6A 2C68A 5CU0A 4ANNA 5B2LA 3EQHA 4I0SA 2A1AB 3KXGA 4I24A 5HNBA 4BC6A 4P5QA 3NPCA 4QNAA 2BIKB 5DR2A 3UQCA 2B53A 5HG9A 3ZFXA 2PMIA 1OKWA 3MY1A 5CEPA 4OT5A 3QTSA 4NM7A 3RPOA 4NL0A 3FY0A 3Q9YA 5J9LA 4EH8A 3IQ7A 4JQ7A 3UIMA 2PZRA 4ERKA 4F64A 3L8XA 2FB8A 2XIKA 3AT2A 3F3ZA 3GU5A 3QU0A 4NFMA 4BDFA 2ITPA 3NZ0A 5D7AA 4LUDA 1XH7A 4AA5A 1JPAA 5GJGA 4ANQA 3EN6A 4Y72A 4FTJA 2R9SA 3MH3A 2OICA 1R3CA 4L3LA 2ZDTA 1O6LA 1DI8A 4LYNA 3FXZA 1Q24A 3A4OX 3COMA 2OXYA 2JDVA 3UNJA 3AC2A 3AC8A 3MH2A 1R0EA 4PNIA 4R7IA 4OLIA 4PDYA 5D1JA 4RFZA 2W9FB 3W2OA 2OZAB 2XK7A 4AACA 1PXNA 3BELA 3PJCA 4M97A 5HU3A 2YDJA 5K9IA 5BVFA 2GS7A 3CKXA 5LVMA 3D94A 4JT3A 2XB7A 4OR5A 2PVJA 4YHTA 4QP7A 3GVUA 5AUTA 2XVDA 4RGJA 4ACHA 3H9OA 4BDEA 2GQGA 2F7XE 3RK5A 3DKOA 2UZBA 4NH1A 2VU3A 5ICPA 4XRJA 1U5QA 4MHAA 3KRLA 5EG3A 4IWPA 4JG8A 5CVGA 2AC3A 2W7XA 3GCSA 4C38A 3N4VA 1WFCA 2V0DA 3AGLA 2PE2A 5AX9A 3GBZA 5IUIA 4PDPA 1SYKA 2WO6A 4U81A 3BLQA 1PKGA 2JKOA 3E8CA 3NRMA 4WNOA 5AIRA 1H08A 4P4CA 3KXNA 3U51A 3VRZA 5KMIA 4RVMA 2EVAA 4XG4A 4NEUA 4FKIA 3OT8A 5E8XA 5HBEA 3VQHA 3PJ8A 4DBNA 1H1PA 2XBJA 4XG9A 2B0QA 3A60A 3U4UA 5CASA 3FLNC 3D4QA 4YZNA 5TF9A 4AOTA 3V6RA 3ZHPC 4EORA 3NDMA 3GNIB 5EM7A 4IVCA 1FOTA 4ZY6A 2RFEA 4FVRA 1ZZLA 4YJSA 2C0TA 3NNXA 5I3RA 3ZC5A 5EQYA 2BR1A 2FO0A 1Q61A 4ACCA 3ETAA 4ZS0A 4ITJA 4XV9A 1H1SA 1GIHA 2GNFA 4EJNA 4UMRA 5H9BA 3F2RA 3IDBA 1ZOHA 1WCCA 4QYHA 5BVWA 4YR8A 4R8QA 5IEXA 3DS6A 4B8MA 3DFAA 1P2AA 3DLSA 1Y91A 3ORKA 4GK2A 4UBAA 2IW8A 4H05A 5E8WA 3MPMA 2HCKA 4QTCA 1ZWSA 3W2RA 3G9NA 3ZSIA 3KB7A 2WQEA 3IDCA 5IA2A 5GINE 2QG5A 2X9EA 4LGHA 4GIIA 5FEDA 2DYLA 3CTJA 3TKHA 4L7SA 4Z16A 3KQ7A 4L46A 5M06A 2BZHB 5EI6A 3WYYA 2J0MB 3PPZA 4QMMA 3DBQA 4MYGA 5DPVA 5LWNA 2QG7A 3D7TA 4BDCA 4X7QA 3CLYA 4WNMA 3I5NA 4E5BA 4F7SA 5J7BA 3R9DA 5LVPA 4DTAA 3R22A 2ESMA 4FIHA 4D58A 2WMQA 4RIWA 2VZ6A 4PF4A 2E9NA 3EQRA 5CI6A 4YZBA 5DRDA 3A8WA 2R0UA 1SVGA 2XA4A 4DFZE 1R39A 4EOMA 3OS3A 1PY5A 3CY3A 3F9NA 3FKLA 4FL3A 4I5MA 3CJGA 2X8EA 4IBMA 4UV0A 2VTLA 4MXXA 3TV6A 3WILA 3QTRA 4GV1A 4E6DA 1JSUA 2W06A 1H27A 4L42A 2VTIA 2JBOA 4QMSA 3EQGA 4R1VA 4TWCA 2YJRA 4N6ZA 3OG7A 4I0RA 4FZ7A 2GSFA 3FXWA 3UOHA 3WZEA 3FSKA 3MTFA 3A7GA 4RT7A 3BYUA 3ZZWA 3I5ZA 4HCTA 3TT0A 1KOAA 4FR4A 5HE1A 5E4HA 4G31A 4XP3A 3ORPA 3IONA 3U87A 2ITVA 4CTCA 4HGTA 2CKOA 4O7WA 4AFJA 1MQBA 3G0EA 2ITXA 3PRFA 5AP6A 2VTSA 5CT0A 3G51A 3PXFA 3ZLYA 5HIBA 3R7IA 4R77A 4O7RA 2YZLA 4W4YA 5M4FA 3AMBA 5IU2A 2C3IB 5HE2A 3EZRA 1RDQE 5AWMA 4BHZA 3MVMA 3UYTA 4F4PA 4G3GA 1W82A 2CDZA 2XP2A 3LQ8A 4MF1A 4JRVA 3W18A 5EW9A 4KBKA 2ZOQA 4KIOA 3Q4UA 4KA3A 4KWPA 4M0ZA 3ZM4A 2UW7A 2VNWA 3MBLA 4L52A 5DGZA 5GZAA 3SXFA 3P7BA 1WBWA 2FSOX 1ZMUA 5GNKA 4YZ9A 5EI8A 5IA3A 2E9UA 3ERKA 1STCE 3POOA 1I44A 4DEIA 4X6QC 5M4UA 2YM8A 4V0GA 4DH8A 4ZMEA 1KE8A 2C6DA 4BCQA 1ZAOA 3DQWA 5LMAA 2HZIA 4E3CA 5C8NA 3IS5A 5CF8A 4ARKA 4XP0A 4I4EA 4NKSA 4UMTA 4NYEA 3GUBA 4IM3A 4MVFA 1JAMA 5CY3A 5D11A 4USDA 2BRNA 2W5BA 3TDWA 1IA8A 4IIRA 4KIPA 3KXZA 3PVGA 3ZU7A 3KULA 3IOPA 4FVQA 4D0WA 1LPUA 3HA8A 4FODA 4AG8A 4BFMA 4QD6A 3V5WA 3W2CA 3ZDIA 1NA7A 1JNKA 2OBJA 4G3DA 5FUTA 2QKRA 3ALNA 1P5EA 3FYKX 4YO6A 4DT9A 5E7RA 3Q32A 3L1SA 5ANDA 2J5EA 3NS9A 4NK9A 2VO6A 5LMKC 1IRKA 2X0GA 3MB7A 2VGPA 5AIKA 1F0QA 3FI2A 1NVQA 4QMVA 2HY0A 2X9FA 2RGPA 4K9YA 4E8AA 2XJ1A 5I9UA 4RA5A 5JRSA 3LFCA 3P86A 2R3KA 2AUHA 3PG1A 4C4FA 4MQ1A 4BIBA 4PDSA 3LMHA 3BEAA 2QOBA 5AUVA 3FI3A 4IACA 4CZYB 3OOMA 4XJ0A 2X7FA 4KNBA 4TWOA 3RBWA 3O8UA 4O2ZA 3P1AA 4G3CA 4BDDA 5BMSA 3C0IA 2XIZA 4J1RA 2GNIA 1OECA 4MNEB 3R7YA 3QD3A 4XLVA 5HCZA 1OPJA 4TYEA 1FGKA 3VJNA 4ANBA 3E64A 4DGNA 1YI4A 2RFDA 4IH8A 2FA2A 4MBJA 2JKKA 4F7LA 3DXQA 3FBVA 2FYSA 2W1FA 2IW6A 3UMXA 5IQCA 3SXSA 3ZFYA 4WG5A 3DK3A 4YBJA 4AZSA 5FM3A 4ZY5A 2OXDA 4PTCA 5AP3A 5AR3A 4IVAA 1XQZA 2BMCA 4YMJA 4KKEA 3E88A 3P5KA 4PMMA 1U46A 4HGEA 4E4XA 1PXJA 3VS3A 4A07A 3FMMA 4C59A 4F1TA 5DRBA 3PIXA 4XH6A 4WBBB 4ZTRA 5HI2A 3UO4A 4DEDA 2VTRA 4ZJJA 3A99A 3UG1A 4GT4A 1QPDA 2XUUA 3BCEA 2GHGA 2WTDA 3QZGA 4IHPA 4OTQA 3L9NA 5CI7A 4CMTA 2XK3A 3LCTA 4RIYA 4RJ3A 2QHNA 3OHTA 3ZC6A 5K4JA 1NW1A 5E1SA 2XMYA 3EZVA 1JKKA 4WRGA 3HUCA 1MP8A 3F82A 1FBNA 2XK9A 2I7QA 3HMNA 2ZVAA 4E5WA 4CQEA 1OB3A 4JX3A 4LRKA 1OM1A 5H8BA 4QYEA 2QU6A 3QQUA 3R7OA 3CJFA 4DFUA 3EMGA 4U42A 4O0VA 4EZ7A 3AGMA 1PXMA 4OTGA 3MDYA 3U8WA 4AT3A 4DC2A 3ET7A 5LWMA 1DAWA 3I0QA 5DH3A 4R7HA 3TIZA 3U9NA 4F6SA 2VUWA 4FKWA 3U4WA 3NW6A 4XG8A 4PPCA 5H3QA 3SW7A 4DF3A 3ACKA 3PSCA 3I60A 4LG4A 3FAAA 3NX8A 3LXPA 3FL5A 4QTEA 2W17A 4Y83A 2V7OA 3DDPA 3GI3A 3L8VA 4FSWA 4MXZA 4ALWA 2P2HA 2WIPA 3C9WA 1UU8A 4K8AA 4X3FC 4FTNA 2I1MA 5EW8A 4E6AA 3ZBFA 4GMYA 2J0JA 4IVBA 3Q4ZA 4NIFA 4R5SA 3FQEA 5EHYA 4IX6A 5BNJA 4FIIA 4ZTNA 4MQ2A 1OITA 4R7BA 4UXQA 5EI2A 4E93A 2XH5A 2BAJA 3HP2A 3DFCB 4FTMA 4BCHA 5JSMA 4F1OA 3RINA 4TRLA 4JNWA 3NYVA 4FKVA 4F09A 2YABA 3ZDUA 5CXHA 3QKMA 3DGKA 4ZSGA 2AYPA 3E7VA 2WU7A 3NUXA 1H26A 4UB7A 1Y6AA 4L45A 3VS1A 1NVRA 2VWYA 1YXXA 2C5YA 3Q5ZA 5DA3A 4WKQA 4FT3A 4BTMA 4YBKA 5CF4A 3QQGA 3NWWA 4JAIA 5E91A 2CLXA 3QRTA 2J4ZA 2F49A 3BLHA 3DKFA 1J3HA 3Q52A 2NNWB 3MW1A 4A9SA 3ORLA 2OZOA 3O7LB 4ONAA 1DI9A 2QOCA 5A14A 4I5CA 5J7HA 1BUHA 2ITZA 2W99B 2Z7QA 3QYWA 3PLAE 4BYJA 5CZHA 4CD0A 4ITIA 4RZWA 4TNBA 4BCOA 2W1IA 3CY2A 4YHFA 4BICA 5KBRA 2OFVA 4D2WA 2C5VA 4NWMA 3TXOA 3VUGA 2OU7A 3QZHA 4Z7GA 1BYGA 3KA0A 5BX0A 3OUNB 4DGLC 4ZLYA 2JIIA 4LOPA 1ZYDA 4K2RA 5AR2A 5FWKK 3RK9A 3IK3A 2C0IA 3HRCA 3PA5A 5HNIX 5KX8A 3D5VA 3NUNA 5E8UA 2LAVA 4BY9E 5IQEA 4BWPA 4TTHB 2QHMA 2WQMA 3N4TA 3OCBA 1YDTE 2PZPA 2YHVA 3L9PA 2XNBA 4CT1A 4KBCA 5M56A 1B6CB 2I40A 2CJMA 1U5RA 4BCGA 5FEEA 1LEWA 2XNNA 3FPMA 5CSPA 4RX5A 2R3GA 2XNPA 2DS1A 3UVRA 4D28A 5KHXA 3DOGA 2QU5A 4G1WA 4BDIA 1R0PA 4FK3A 4WUAA 5F4NA 4JIKA 4IVDA 2W5AA 3OTUA 4Y5QA 2HY81 1BLXA 3ZZEA 4DCAA 5FXRA 5LMKA 3NSZA 4FYNA 5C27A 4FV0A 4TT7A 1T45A 3PP1A 4BDJA 4ASDA 1AD5A 2IPXA 1A9UA 4AT5A 5EH0A 4EOJA 4EH4A 2ZM1A 4QQCA 3RHXA 4K1BA 5KUPA 5JKGA 4CVAA 2NO3A 3QQKA 4EI4A 2YWPA 5KZ0A 5AR5A 4LGGA 3VUDA 3ZCLA 5J79A 3UMWA 2G9XA 3DY7A 3OOGA 4I6FA 2WTVA 2Y8OA 2W1GA 3BYMA 5E92A 3ROYA 3WZKA 5M08A 3A4PA 4RVTA 1Z57A 3O17A 5FD2A 4CFWA 3LFBA 5IH6A 3ZEWA 5A9UA 3TZ7A 3VF8A 2W05A 2J7TA 3Q2MA 4EH3A 5J9ZA 5AUYA 2JAVA 1QMZA 4FMQA 2X7OA 1ZY4A 3G6GA 4ANOA 2GTMA 3VS0A 5CEKA 1H0WA 4RX8A 5HD4A 3BHYA 4GH2A 2V62A 3ROCA 5FP6A 3SD0A 4GG7A 4EK4A 3JY0A 4BI0A 2P3GX 4C4HA 4DT8A 3KFAA 4UXLA 3WF7A 4KIKA 1H25A 1OL2A 3WOWA 4LMNA 5L8LA 5JQ5A 3PY3A 4LL0A 5L6OA 4FKRA 5D7VA 3GC8A 2GPHA 3ZMMA 4BKJA 2Z7RA 2ITQA 5HBJA 4W9WA 3GC9A 5IA4A 1J7UA 4FSTA 3TUCA 4AS0A 5CYIA 3PTGA 4Y46A 2HK5A 2BAKA 2R3LA 3T8OA 4TYHA 3VBVA 3ELJA 3HP5A 3HV4A 4K33A 3LXLA 2WEVA 3BX5A 4HGLA 4DYMA 3UNKA 4EH9A 2JEDA 3CTHA 4HYHA 5JT2A 4BDBA 4EKKA 3FHIA 4JS8A 5H8GA 5JFWA 2CKEA 3SKCA 4G3FA 4FUYA 4WNPA 1ZY5A 2GFCA 3OEZA 4XOYA 4CTBA 4JBPA 5B7VA 5FDPA 3Q4CA 1M14A 2PZIA 2BALA 2W1HA 1AGWA 3C50A 4KRDA 3UZTA 4FUXA 4RC4A 3FZRA 4EQCA 3RPRA 5M57A 4FSNA 3LFQA 4QP1A 5DT4A 2UZDA 4FOBA 3T9IA 2J0LA 1CMKE 2IZUA 5DIAA 3FMNA 3V5LA 1O9UA 4FSQA 4BRXA 4XMOA 5EHLA 3O0GA 3NVKI 5HNGA 5AM6A 3I6UA 3P08A 1CSNA 4E7WA 3D9VA 4N57A 4M84A 4QMLA 4AGWA 4F7JA 4JR3A 5IQBA 5ANEA 3R8PA 1OKVA 4UZDA 1NY3A 3KY2A 4Q5HA 4TXCA 1BI7A 3BV3A 3TKIA 4YURA 5LMBA 2CGVA 1KUTA 3VVHA 4FT0A 4PY1A 4PX6A 1KV1A 3WE4A 3AC3A 4APCA 3P7CA 1AQ1A 1H00A 3LHJA 3L9LA 3PZHA 1RE8A 1RJBA 2PMNX 2V55A 1E1XA 5CVFA 4LV5A 1V0BA 3FZSA 4ZTMA 2VWZA 5LVOA 3BE2A 3ANQA 4X3FA 2Y7JA 1ATPE 5C4KA 4I41A 2ITNA 3VULA 5HO7A 3NW5A 2PVLA 2YM5A 2WELA 4USFA 2Z60A 3LIJA 3NUUA 3BYVA 5I9XA 4X2GA 1ZYCA 3CD8A 5LARA 1YOJA 3VNTA 2PVRA 4BDAA 3H0YA 4D4RA 1J1BA 4IDTA 3RP9A 2C1AA 5M51A 1LEZA 4ZP5A 5H8EA 3WZJA 2IVUA 4M14A 1Q99A 2UZVA 2C3KA 3I0OA 3HV6A 3KL8A 4L44A 4DEGA 3P0MA 4EH2A 4EKLA 3E8NA 3FV8A 3TJCA 4H3QA 5EFQA 2YAKA 2BCJA 2YISA 5TE0A 3E63A 1W0XC 2FGIA 2VGOA 2QO2A 4CEGA 4F9BA 2Z7LA 3BLRA 1VR2A 3L8SA 3HRBA 3QTWA 1Q8YA 2OIDA 2C6TA 3VUTA 2E9VA 3DJ6A 3GOKA 2ERKA 4FV4A 4YLKA 4FEXA 3UZRA 4RC3A 1YQJA 2YCQA 3KXMA 3FL4A 3MPTA 4S32A 5E1EA 2XIYA 3KCKA 3RM6A 3I6WA 4H36A 4EOPA 4MK0A 3COKA 1H28A 4YJNA 4DG2E 3BU3A 2JGZA 4S33A 3QCQA 4PNKA 5C4LA 2X4ZA 1KE9A 2QOLA 3O51A 3UDBA 3QHRA 2EXMA 4OBOA 2JLDA 4D9UA 4ERWA 2FSTX 2GHMA 2W1ZA 4TYGA 5CEQA 4YJUA 5CAOA 4YNEA 1Q62A 3GXLA 2BDJA 3MS9A 4FKOA 4N6YA 3MVLA 5CALA 5EDPA 4NCTC 4MXOA 2CSNA 4YJRA 1KV2A 4FKSA 4RLLA 5D12A 4BWXA 4XX9A 4DEAA 5E8ZA 3QFVA 3RPVA 4AW5A 5M07A 3A62A 4G6NA 4IAKA 3PIZA 3PJ1A 5HX8A 4CKIA 3KF4A 2PMOX 4DBXA 4EYMA 1JKLA 4MXCA 5I9YA 5FTQA 4CT2A 5EYDA 3UP2A 2IWIA 2B7AA 3ORIA 4IC7A 3KU2A 5JGAA 2Y0AA 3JXWA 2ZMDA 4MBIA 4DFYA 3R7VA 3W2PA 1FMKA 1GIJA 3LE6A 2NP8A 1VEBA 3TZ9A 5AAGA 3DBFA 2YIWA 2PE1A 3QF9A 4OTIA 5GHVA 1ZYSA 3UE4A 2O8YA 4JG6A 3PXKA 1GY3A 3QTXA 2X1NA 4NTTA 2BKKA 4ZTSA 4ACGA 2O5KA 4RIYB 3WIKA 3E8DA 4E6QA 2C47A 3RNIA 3RALA 2PE0A 4PL5A 1PXOA 2C6LA 3T9TA 2HENA 3OZ6A 1PMVA 3BBWA 4BZOA 1Q8ZA 3WBLA 4QP2A 3ZS5A 4ALUA 4DHFA 1PKDA 4LMUA 4FGRA 2UZNA 3PRIA 1U54A 4C8BA 4EZ3A 4I4FA 3DAJA 4S34A 3B2WA 3TCPA 3TL8A 5CEIA 4AE9A 4PMPA 3PIYA 5HTCA 1GZOA 3BGQA 4EK3A 4FEQA 3S0OA 5M55A 4FKLA 4HPTE 2CCIA 4YJVA 4P2KA 4O83A 3HMOA 2OJIA 4O82A 3MPAA 5HG7A 2B52A 5BVKA 2WMVA 2WMXA 4RQVA 4TWPA 5KKRC 1ZYLA 2PZYA 1E9HA 2R2PA 4WUNA 4ZIMA 3LKMA 4BWKA 4TYIA 2XKDA 4WT6A 4QYYA 1XWSA 3KRXA 2P0CA 2XZSA 5DT0A 3VRYA 1YOLA 3VWAA 4QQJA 5BVDA 3IW4A 3KEXA 4KABA 4ZSEA 3PSDA 4FSMA 5JK3A 4MWHA 4RJ8A 1UKIA 4NIFB 5K5NA 1XHAA 3OW3A 4ANSA 4CCBA 3DJ7A 3UIUA 2YM4A 1W8CA 4JDKA 5E8SA 1H4LA 2YDKA 3EWHA 2YIQA 2XNGA 3KRRA 2Y6MA 5FM2A 3JYAA 3W10A 3R9HA 4YTCA 3RTPA 2JAMA 5KZIA 4DH7A 2SRCA 2GS2A 3QQHA 4AZVA 5E90A 4UN0C 4F0IA 4HOKA 1PW2A 4IDVA 3KXHA 4B8LA 4YUQA 1JWHA 1YHWA 4BGQA 2YDIA 4C61A 3ZEPA 4FV8A 4EH7A 2CGUA 3PE2A 4RQKA 4D9TA 2JD5A 3Q4TA 3OT3A 4S30A 1VYZA 1YXVA 4O7NA 4GCJA 1ZLTA 2OSCA 3JR1A 5IQGA 4AU8A 4A9RA 3VUMA 2R7BA 3R2YA 4GJ3A 3H30A 4OAVB 4R78A 4LUEA 3EKKA 1K9AA 5IUGA 2W4KA 4O0WA 4CV9A 3CE3A 3ZFMA 1OBDA 1JKTA 3OY3A 1WVWA 3PZEA 3NVMB 3QBNA 3HECA 3IG7A 4F7NA 4O7LA 4C4GA 1B39A 4JX7A 2WMTA 1H24A 2CGXA 3PXQA 4GSBA 5HTBA 4QP6A 5KMLA 3M2WA 3ZUVA 3C5UA 3G2FA 5L4QA 2RKUA 4JDHA 4KIQA 4YJPA 1Z9XA 4QMOA 4XG6A 4AA0A 3K3IA 3KRJA 4HPUE 2BILB 1Q97A 4M69A 4DINA 4BCNA 2XM8A 4H1MA 4HZRA 2CNQA 5AP2A 4AOIA 3G15A 3QC4A 2ZV2A 5L2WA 1Q8UA 3FLSA 1Q3WA 4APPA 5IDNA 5KBQA 4V05A 5CEMA 5DFPA 1BL7A 4EWQA 5HHWA 2BHEA 3RAKA 1XBCA 2ONLC 4NKAA 3BU6A 3F3VA 1JSTA 1JVPP 2C5NA 3E92A 4G3EA 3DDQA 3RAIA 4Z7HA 1OBGA 1YWVA 2XCHA 3JS2A 2UW3A 4MXAA 5F94A 3R01A 4G5JA 4YP8A 1WBVA 1ZMWA 5IKWA 4BDGA 4YU2A 3VUIA 1PYEA 3MB6A 4IADA 1WVYA 2VTQA 4YZCA 4ZEGA 4O81A 1BKXA 5EHOA 3VHKA 1YKRA 4CFVA 4M12A 4K77A 2YZAA 2R3HA 4C35A 2VWVA 3VQUA 5GJDA 5BUJA 1OIYA 4RVLA 3IDPA 2XEZA 3ULZA 2EB3A 3FMEA 4FT7A 2JFLA 1HCKA 2KULA 3BQCA 3DK7A 1A06A 3KMWA 4XG3A 4GKIA 3ZM9A 3QTUA 2Q0BA 2J0KA 3D2IA 2ERZE 3NR9A 4O96A 1GZKA 4BTFA 3BYOA 2V5QA 3PPJA 4QT1A 2GDOA 3AD5A 3QAME 2E2BA 3FYJX 1ND4A 2B9IA 3TV7A 4FTIA 4JDIA 4CG9A 5CQUA 4AW2A 5IUHA 1M7QA 3FI8A 4R6VA 4QTBA 4UMPA 5HESA 4EK5A 3JVSA 2BZKB 5AUUA 4QP8A 3DLZA 3GCQA 3HV7A 2J2IB 2YEXA 2R5TA 3D83A 5F1ZA 3V3VA 1CM8A 2O64A 1UA2A 1UV5A 2GNHA 4U41A 4Z9LA 4D2TA 4F9AA 5JZJA 3S1HA 5EK7A 5DYJA 4MD9E 4NCTA 2Y9QA 1UWJA 4GFMA 4GUBA 1OL1A 4IJPA 5G6VA 2DQ7X 3ZSGA 4BCJA 5FDXA 4KINA 5IA1A 4GK3A 3RCDA 4KUJA 4GRBA 2YFXA 3D2KA 4MCVA 4H39A 3RWPA 1OL5A 2H34A 3PJ2A 2QONA 5AEPA 3EFLA 4ANMA 4NM3A 3VS7A 1PF8A 2XKCA 3GCPA 4NTSA 2W1DA 2E9PA 2IZSA 4RIXB 4L3JA 4OTHA 1L8TA 3OVVA 4TYHB 4O21A 5L6WL 3CKWA 3VBWA 1G5SA 3EQBA 4JG7A 4GT5A 2IW9A 5LVLA 4LM5A 4U45A 4L6QA 4UYNA 5LCKA 4M3QA 4F65A 2WTCA 3NAYA 4JI9A 2Z7SA 4QMXA 2PUNA 3O23A 3BWFA 3V5QA 3VS2A 2J6MA 1Q3DA 3S95A 3WZDA 4RX9A 2G01A 4FTCA 3G5DA 3QCYA 3CQUA 1KE6A 1XO2B 3CP9A 3KRWA 2GQRA 3WI6A 3LQ5A 4AZWA 3P23A 3NLBA 4OTRA 2WMUA 3QCXA 4U6RA 4GYIA 1J7IA 3R9OA 1ZRZA 2W5HA 2XEYA 4JIAA 4U3ZA 3N4UA 4NZWB 4K6ZA 2BROA 2C6MA 4JXFA 3F3TA 2UZOA 4D2SA 4CKJA 2J90A 3EQPA 3LW0A 1UVRA 4RIOA 1X8BA 3WF8A 5IZFA 4FK6A 4C3PA 4BZNA 2IZRA 1OPKA 1NVSA 2VO0A 5J95A 2CKQA 3GC0A 4TY1A 3F2AA 5LXMA 4O91A 2PULA 5L8JA 4E4LA 4EOIA 2J51A 5FTOA 2JITA 4F6UA 4X0MA 5D41A 2W4JA 4GFOA 2H6DA 3LPBA 2AC5A 4L53A 3RJCA 1CKJA 1TKIA 2BRGA 3V5PA 3GFWA 2F2UA 2ZB0A 4O0YA 3L9MA 5DG5A 2ITOA 2P55A 5AMNA 4QMQA 4X3FB 2NPQA 3R83A 2ETKA 2ITUA 5F95A 5CU6A 2W1EA 1OZ1A
chains in the Genus database with same CATH superfamily
2R3IA 3D0EA 2JIVA 2NRYA 3MIYA 2PVHA 3ZO1A 4IZAA 2R3OA 4WHZA 1IR3A 2PUIA 3HEGA 5KMKA 4CFFA 5C8MA 3FLZA 5KMNA 5IQAA 3LXKA 3VS4A 4XG2A 4AQCA 2C3LA 4IWOA 4DDGA 4I23A 3SA0A 4LI5A 3POZA 2C6OA 3PWYA 4U9AA 5KMOA 4I5HA 4LGDA 4BBMA 3KN6A 1ZXEA 3LLTA 4YNOA 2WPAA 4CV8A 2F7ZE 5HEZA 4HNIA 5CF5A 3UDZA 2RFNA 2UVYA 2ZYBA 3B8RA 4FSUA 2RG6A 5HORA 2BFXA 4I94A 3JUHA 2XAMA 4Y85A 4GVJA 5FP5A 3BIZA 4AFEA 1NT2A 5HVJA 3OWLA 4WNKA 3RMFA 4C4JA 3QD2B 3QUDA 3W0RA 4MBLA 2YWVA 3HAMA 2CN8A 3D15A 4DEHA 4GS6A 3V8TA 4Z55A 5BVOA 5F20A 3W8LA 4IM2A 4FTLA 3ZRLA 4TL0A 3SG9A 4E6CA 2PVNA 4RMZA 2OGVA 4FL2A 3GP0A 4MXYA 4UYAA 1WBOA 4BCPA 4ENYA 2O3PA 2ITTA 3UOKA 4AN9A 3G90X 4A9UA 4J96A 3I7CA 1MUOA 2XIXA 1QPJA 4EYJA 5DBXA 5HQ0A 2I6LA 3R1YA 5AR4A 3LZBA 5J8IA 4XNEA 4PPAA 3F61A 4C58A 3TZ8A 3GCVA 3NUYA 2ONLA 4C7TA 2UZUE 2I0EA 3NNWA 3KGAA 5JRQA 3ATTA 4QMTA 3OY1A 3QGYA 4UY9A 4XG7A 4GW8A 3N9XA 3UOJA 1ERKA 5EOBA 3ZLWA 5CT7A 4WSQA 2VWWA 3COIA 2XKEA 2C4GA 4AWIA 5HTIA 4IEBA 4GUEA 4O27B 2E9OA 4GU9A 3BEGA 3ODZX 3ZSHA 2WTKC 2PSQA 2CLQA 4O0TA 5DEWA 4QYFA 4K11A 2VTMA 4WG4A 5DLSA 4RJ4A 4ORKA 5A4QA 4FG8A 3KREA 3FMDA 4WD5A 2QR8A 3QD4A 4MAOA 4UMQA 2QOIA 4RRVA 3R2BA 3RWQA 5A4TA 4XV1A 2GNLA 3PDTA 2PVKA 5A6OA 5L6PA 5IQFA 3H9RA 1U54B 1YWNA 3VC4A 4MTAA 2X2MA 4FSRA 5GJFA 3W55A 4D2VA 2EXCX 3Q5IA 3NNUA 4BL1A 1YXSA 4FKTA 3COHA 2VO7A 3QYZA 2YA9A 3UVPA 5JZNA 4R5YA 5CX9A 5DN3A 4HVDA 2HZ0A 2ZB1A 3E5AA 4QMWA 1GZNA 4WOVA 3WF6A 3FUPA 4DG3E 1Q41A 4J8MA 3MESA 4S31A 2X8DA 4AA4A 2BTRA 4IAZA 3V5JA 4C2WA 4C62A 4O7VA 3QKKA 4PL4A 2QOFA 4F70A 4AT4A 3ID6C 2OZAA 4IW0A 2YCSA 1YRPA 3PYYA 3DXNA 5HD7A 1UU7A 3BGZA 3MY0A 3R8ZA 4TN6A 3HYHA 4DFLA 1UNHA 2ETRA 2HWOA 2QOOA 2VWIA 2YIRA 2RIOA 3TNWA 2F57A 2CNVA 3KCFA 1FMOE 4GFGA 4IANA 2XJ2A 2XANA 4IMYA 2B9HA 3DZOA 4X2NA 3U55A 2X81A 2QODA 4U5JA 3P7AA 4J98A 2VD5A 5AAFA 3MSSA 5C9CA 2PUPA 3QUEA 2XRWA 4FOCA 1UKHA 2JDOA 3LFSA 2ETMA 4ZOGA 3EL7A 4FG9A 3E87A 4YPDA 3ORNA 2RSVA 2WTJA 4L43A 5FQDC 5EKNA 2OJ9A 5DWRA 1Q8TA 4EBWA 2OKRA 3FZPA 3JVRA 3MFTA 3REPA 1HCLA 1WBTA 5EDQA 1URCA 3NIZA 5BPYA 5DR9A 3H9FA 4UEUA 3F66A 5EOLA 5FRIA 3PXRA 3W16A 5FTGA 5IQHA 4RX7A 2HXLA 1MRVA 3FXXA 4X21A 1W84A 3PVWA 2YERA 4QMPA 2UZLA 2G2IA 3KMUA 3SXRA 4DHZA 3R7GA 3NMUF 1M17A 3LFAA 3R30A 1G8AA 3TNQB 4UX9A 3ZO2A 4YLLA 2CHLA 3BQRA 3CPCA 3DKGA 4JQ8A 2WMAA 2A19B 3JPVA 4RZVA 3IGGA 3LJ2A 5HX6A 4CFMA 3RNYA 4NJDA 5BMMA 4Q2AA 4HNFA 5JN2A 5GZ9A 2PVYA 3UIBA 4M69B 3TUBA 3V01A 4I1ZA 5IPJA 1W7HA 3A61A 3SLSA 3FLWA 4LV8A 4X6RA 4HVHA 3MWUA 3T3VA 2WOUA 3HAVA 4DA5A 4QTDA 4XUFA 2A2AA 1FVRA 4RLKA 4ZLOA 3CTQA 1SNUA 5C26A 3MH0A 4N4SA 5AP0A 3OC1A 4A9YA 4KS7A 2QD9A 4W8DA 4CFNA 3UDSA 1M7NA 4YJTA 5CWZA 4E20A 3ML1A 3KKVA 5EYKA 2QOQA 2C3JA 2OJJA 1B38A 2UW4A 5CTPA 3TNHA 3UPZA 5HE0A 2C6EA 2RL5A 4IAIA 2O63A 2PUUA 1Q8WA 3DNEA 4XV2A 4W4VA 2HW6A 2QURA 3F2NA 3U54A 4OGRA 1XBAA 4GYGA 4JBQA 4PL3A 4G17A 3E3BX 4DE4A 4IAAA 2R3RA 3QHWA 1OIRA 3QXPA 4QMZA 3PFQA 4RJ5A 3LMIA 3D7TB 1OGUA 2QC6A 4U43A 5CEOA 2YN8A 2QLUA 4BTJA 5JQ8A 2R0IA 3DKCA 3Q9ZA 4FZDB 5CU4A 5I3OA 3SC1A 3BI6A 4RIWB 1FINA 4I5PA 4D4VA 3MFSA 4GEOA 4YGAA 1U59A 3ZO4A 5IISA 2CNUA 4DCEA 4K0YA 3TUDA 5GIPE 1WAKA 4ASXA 2YM6A 4AXCA 3BPRA 4O38A 5GIOE 3PLSA 3G9LX 3NW7A 4BKZA 3VF9A 4DG0E 5A4EA 1J7LA 4NUSA 4O22A 5CVHA 1Y8YA 3DTCA 4BDHA 5IMXA 4G16A 5FEQA 3I4BA 4FIGA 3TKUA 5DR6A 5JFVA 3AKLA 1DS5A 3V8WA 1DM2A 3QX2A 1FGIA 5KMMA 5JFXA 2WMRA 3R9RA 5EW3A 4ZZNA 2BTSA 3I1AA 3EKNA 3FMLA 2CKPA 2J0IA 5J1VA 5HGIA 2OJGA 4PDOA 4ZK5A 3C4XA 3FQSA 2JFMA 2RG5A 2WD1A 5A46A 5C01A 3UO5A 4CLJA 3FPQA 4F9CA 2WFYA 2PY3A 5IMEA 5K4IA 3EHAA 1LP4A 2XIRA 4JVGA 2C5XA 4FZFB 3AC5A 2KTYA 1R78A 3OUKA 4UWYA 5CZIA 3R1SA 5L3AA 1Q5KA 1XR1A 3OCGA 3E93A 3ZBXA 2PU8A 3SVVA 5M53A 4HW7A 2GTNA 2IO6A 3SV0A 3FC2A 4OW8A 3LFEA 4P5ZA 5CAPA 3QC9A 2BDWA 3ANRA 3FWQA 3AQVA 4V0GB 3CQWA 4KKGA 5A6NA 2BHHA 4PWNA 2UV2A 2BKZA 5HIDA 3TACA 3S4QA 3QWJA 5AV4A 2X0QA 4BB4A 1YVJA 3MV5A 4D1SA 3QTZA 4C2VA 4YC3A 2YM7A 3KC3A 3C7QA 2ITYA 3UGCA 3FY2A 4PMTA 5TO8A 3ZXTA 3KULB 3SHEA 3II5A 4QPMA 3A7HA 2HYYA 1SMHA 3R04A 4RVKA 3O8PA 4DH5A 3FQHA 5DT3A 2ZM4A 1K3AA 4F0FA 1H1WA 3D5WA 4JLCA 3ALOA 5KKRB 3HZTA 4LQMA 2PVFA 4AX8A 2VTHA 3LJ0A 3EH9A 3NYNA 4NU1A 1H07A 5M09A 2BRHA 1GZ8A 3CPBA 3DAEA 3KK9A 1YXTA 3CQEA 4PTEA 2Z02A 2BZJA 4EOOA 4BYIA 2YITA 1WVXA 3P78A 4J97A 2XYNA 3QX4A 3OP5A 3UVQA 3W0PA 3GCUA 4G34A 5EYMA 3UNZA 2BFYA 3R1QA 3NCZA 4FTRA 4FTKA 3A7IA 5B0XA 4J53A 4DH1A 4FTTA 4M66A 1TQIA 4JOAA 1O6KA 1REJA 3E62A 3ZLXA 4OAUC 1Q4LA 2Y4PA 2X7GA 5DOSA 5CSHA 2B1PA 4WA9A 1ZARA 2UZEA 3ZXZA 3F6XA 1ZYJA 4DLJA 3FI4A 3FDNA 1JOWB 2GQSA 4C33A 3WARA 4MX9A 2W1CA 4O0RA 1URWA 3MTLA 4HYSA 4EOQA 5TKDA 2Y4IC 2YCRA 3MVJA 4LOQA 4QYGA 4CZUA 2VX0A 2BRMA 4R1YA 4AAYA 3FC1X 3GQIA 4L7FA 4ZZMA 4JJRA 3HMIA 3MGYA 2I0VA 3W1FA 2A27A 3QUPA 2IVVA 4PP9A 3R63A 4FC0A 5KMJA 3EFJA 4FIFA 1OVEA 4AW0A 5BYLA 3OFMA 4PPBA 4E73A 2IVTA 5A54A 5FXQA 5C8KA 5J1WA 3LXNA 3OWPA 3C4ZA 3EYGA 3LFDA 3DAKA 4M7IA 3VBXA 1H1RA 1XH6A 3GEQA 4GK4A 3R6XA 5AV3A 2WKMA 4EHGA 4FRFA 3RVGA 5G1XA 2X2LA 4ACDA 2HELA 3E7OA 3FSFA 1P4OA 5FLFA 5CAQA 3ENHA 2R3MA 3MVHA 2QKWB 2DUVA 4KSPA 5AUXA 5JH6A 3MFRA 1OMWA 2PMLX 3QL8A 5IEYA 2VO3A 3KXXA 1BMKA 2FH9A 5IA5A 5HG5A 2J9MA 4MNFA 3EN9A 4O4BB 3U9CA 2BIYA 3TTIA 1V0PA 3LM0A 4FNYA 4BIDA 1YOMA 2VRXA 4BN1A 5C03A 4ZJIA 1IAHA 5ETIA 2I0HA 4G6LA 4HYUA 3F3UA 2UUEA 2QR7A 4QOXA 4R3RA 5CQWA 3PUFC 1H1QA 3QXOA 4CQGA 2VWXA 3F5XA 3SW4A 4WIHA 5K3YA 5T6KA 4I21A 1RQQA 3E3PA 3GENA 3RK7A 1PRYA 4EUUA 4O4FA 2XK6A 3DBDA 4PRJA 3PE1A 4YJOA 4J71A 3LOKA 1V1KA 4U7ZA 3DPKA 4M13A 4D2RA 4QQTA 4D1ZA 2HIWA 2VTPA 2BAQA 4FNXA 3EN5A 5EKOA 5CENA 4J7BA 2PHKA 4Y95A 4RBLA 3RAWA 3I81A 3PPKA 2WAJA 3Q60A 5AV0A 3C13A 3R02A 5FXSA 1Y8GA 5IQIA 3UZPA 4PQNA 3RKBA 1M2QA 4EOSA 5DMZA 5HLNA 5AAEA 3U6IA 5IDPA 2HZNA 4I93A 1XH4A 3WYXA 5I9WA 4QP9A 2JDSA 5KHWA 4DGGA 1PMNA 5LVNA 5LJJA 1OIUA 4FTAA 4FVPA 3NUAA 2XK8A 4TKSA 4O7YA 3QQJA 3OWJA 2YIXA 4EWHA 4FEUA 4U80A 4FV2A 3OCTA 3WE8A 5KCVA 1PXLA 3CR0A 2F7EE 4IB3A 4TWNA 3C0GA 1VZOA 2XK4A 4YTHA 2B4SB 2WQOA 1OL7A 3PVUA 4P7EA 4PMSA 3QQFA 4W8EA 4BVUA 5F9EA 1KWPA 4FKPA 3QRUA 4CFXA 3BKBA 2QCSA 3HLLA 3F5GA 4ZSLA 2QO7A 3LFFA 3FLYA 4EOLA 4MD7E 2AQXA 3Q2JA 4I20A 5LOHA 3KN5A 4BBEA 4C34A 5JEBA 4C36A 3QA8A 4IAYA 4RFMA 2VTOA 3DV3A 4YTIA 3A7JA 3R00A 5JGBA 3CGOA 1FQ1B 2OI4X 1SM2A 4I6BA 4JBOA 4FF8A 2UW5A 4BTKA 4E4MA 5CXZA 4XCUA 4XV3A 1A48A 2ZJWA 4XS2A 3SRVA 2XRUA 4G2FA 3RPSA 5EM6A 1KE5A 1XH8A 5CNOA 4WG3A 4XP2A 4IAFA 5AP7A 4YZDA 2R3NA 4GT3A 4AGCA 3RM7A 4FA2A 4YPSA 2UW9A 5DVRA 4ZMFA 3P79A 2V7AA 4RJ6A 4E26A 2BVAA 5ETAA 2VX3A 2XBAA 5AA9A 1IA9A 5AJQA 2IZTA 3Q3BA 4FIJA 4TPTA 4FTUA 3NGAA 1WBPA 4EHZA 1GAGA 3OD6X 2GU8A 5JMSA 4FNWA 3UODA 3HV3A 3R8VA 3F69A 3M11A 3UP7A 4YO4A 4IX3A 2Q83A 2P33A 2P2IA 4J8NA 1XH9A 2GMXA 4QMYA 4LV7A 2X8IA 3EQCA 5EYCA 3VN9A 1T46A 2BPMA 2WB8A 2Z2WA 3H10A 2JKQA 3Q96A 4UWBA 3U6JA 5EDRA 1YHVA 5ANGA 3DTWA 3SOAA 4AW1A 4B6LA 4DEBA 3IO7A 5IEVA 2UW8A 3GU6A 3UC4A 3UTOA 3UIXA 1L3RE 3NNVA 3SX9A 4HCVA 5AR7A 4BI1A 4OT6A 4IM0A 2VWUA 1DAYA 1TZDA 1LUFA 1ZMVA 2WTIA 3MJ2A 2GHLA 3DJ5A 3WF5A 3NCGA 4IC8A 4XRLA 4FE2A 4RWLA 4D4SA 4KAOA 3SQQA 3TM0A 3HGKA 3BE9A 3FZ1A 1SVHA 4ZAUA 3VO3A 4D5KA 2R64A 3CBLA 4HZSA 5EM5A 1XMMA 4XBUA 1GNGA 1OL6A 2GS6A 4YC8A 5L2QA 3VBQA 4LFIA 4QP4A 1MRUA 3DT1A 4I6HA 3MIAA 1WMKA 3UJGA 4B4LA 5JGDA 3CCNA 3LQ3A 3VBTA 3QRJA 3KIOC 3ZH8A 3VBYA 3IW8A 2G2FA 5J5TA 3ZTXA 3UPXA 3HDNA 4Y8DA 3V6SA 2RFSA 4FV9A 3OXTA 3Q6WA 1H01A 4RWKA 5HCXA 4DGMA 4L68A 2YIYA 2IG7A 4O84A 3RZBA 4QMNA 3PP0A 3AOXA 3HL7A 4FKQA 3BHTA 3TYKA 1FPUA 2A4LA 3VW6A 5AA8A 3Q9XA 1XJDA 3T3UA 1XKKA 3L8PA 1YXUA 3LCDA 5L2IA 4X2FA 3RI1A 3PY0A 4GG5A 3RCJA 3ODYX 4IFGA 3NYXA 5ANJA 2HAKA 3AG9A 3UG2A 4BZDA 3H3CA 3V04A 4EHEA 4KIKB 2YLEA 4C4EA 3OXIA 1IEPA 2FSLX 4C37A 3HVCA 5J9YA 5EM8A 4RWIA 2H96A 3HMPA 4XOZA 4AP7A 4L8MA 4CGAA 3QRKA 5TOZA 2JBPA 3FHRA 3R7UA 4ITHA 4FG7A 3FKNA 3Q53A 3OBGA 3QTQA 2H9VA 3DBCA 3EJ1A 5AV1A 4Q5EA 4AN2A 5AX3A 4DLIA 4GKHA 4IB1A 4USEA 3ORMA 3GGFA 3BWJA 1OPLA 3W32A 3LM5A 3GU4A 3C4FA 4AN3A 4FTOA 5HOAA 4BGGA 2OWBA 4CMUA 3W2SA 4OTPA 4A4LA 4AZTA 3QALE 3OTVA 2WQBA 3BRBA 1J91A 2QNJA 5I4NA 4LDTA 2BZIB 3NUPA 3O8TA 4EH5A 2WHBA 4KD1A 4W4WA 2OO8X 4L3PA 5K5XA 5HICA 4BHNA 4I92A 4U3YA 3IW7A 4QDVA 2OG8A 4IQ6A 4KSQA 2UVXA 1PMEA 2XNOA 3KK8A 3QTIA 1KSWA 3DK6A 3HNGA 3OEFX 3TI1A 4C0TA 3MH1A 2ZV7A 4DEEA 1GJOA 2OIQA 4RA4A 4ZJVA 5HU9A 1KE7A 1I09A 2FVDA 3A2CA 5ITAA 3PSBA 1IAJA 2XNEA 2EUFB 3BHVA 5HLWA 2PYWA 3NYOA 4QDEA 3EQFA 2PVMA 4FICA 2WU6A 4EEVA 1CDKA 4M68A 5CSWA 4FZAB 3TWJA 1PHKA 3C4WA 4C3RA 3BL9A 1OIQA 3VS5A 2GNGA 2QOHA 4BF2A 4YTFA 2W4OA 3QLGA 4KBAA 5BQ0A 3PA3A 4EQMA 3LLAA 1PXKA 1S9IA 1WZYA 5D9HA 5HLPA 3NUSA 1Y6BA 3LMGA 2WTKB 4MF0A 2WMWA 3ACJA 4GJ2A 4UALA 3VAPA 5HE3A 3V51A 5E9EA 3K5VA 4EC8A 3VJOA 4IE9A 3AXWA 3S00A 1CKPA 4C57A 4U79A 3BGPA 3C51A 4CRSA 2VTAA 3GU7A 5A3XA 2YACA 5E8TA 2W9ZB 4CYIA 5LQFA 3DB6A 1OI9A 1OUYA 1YI3A 3HMMA 4ZLZA 4HVSA 3GB2A 5AFVA 2G1TA 5DNRA 3GQLA 2EB2A 3KVXA 4FKGA 5EQEA 2DWBA 4LRJA 5TT7A 5M4IA 2IEWA 1QPCA 2V22A 2JDRA 4NFNA 2BUJA 4MEDA 2WQNA 4XLIA 5AM7A 5IH5A 3C5IA 4ASEA 4CKRA 3P5JC 3PUPA 4IXPA 4F6WA 2R4BA 3AMYA 4FV1A 4IJ9A 4MKCA 1TQPA 3I7BA 5FBNC 3TNPC 3EN7A 4G9CA 1M2RA 1ZOEA 1W2FA 2PK9A 4WSYA 5J5SA 1P4FA 3A7FA 4QPSA 4RWJA 3DQXA 3SG8A 3R8UA 4FT5A 1F5QA 3TIYA 4YSJA 4N0SA 4RG0A 2CN5A 1FVVA 4DTBA 3S3IA 3QQLA 3HA6A 1QCFA 1BX6A 2WXVA 3QRIA 3F5PA 1MQ4A 2EWAA 4P90A 1JBPE 4ID7A 4QP3A 3AT3A 2P4IA 1WBSA 2OF2A 2UW0A 2R3QA 3PA4A 3LAUA 3BHHA 4I6QA 3KVWA 3DU8A 4NT4A 5IG1A 2XCKA 3MY5A 4U44A 3LFNA 3ITZA 1U4DA 4FJVA 4MD8E 3PVBA 5HZNA 3CIKA 4M15A 4IZ5A 4LOOA 4EL9A 4EQUA 2F2CB 3TNIA 4QMUA 3IW6A 2C6IA 3I79A 4A4XA 4O86A 3BYSA 4IWQA 3W0SA 5ANKA 3V5TA 3O2MA 4O0UA 4QQ5A 2ZDUA 4D1XA 2IJMA 4ZTLA 2XS0A 3ZLSA 2WGJA 3W0QA 2JIUA 3MFUA 4V04A 1BL6A 3QWKA 3ORXA 3O7LD 4HJOA 2YAAA 4FGBA 2OFUA 2OF4A 3TZMA 3SDJA 4RFYA 3TJDA 3TV4A 3VUKA 4EH6A 3R7EA 3ZOSA 2XNMA 3M1SA 4GVAA 2XYUA 4J95A 4FSYA 4AXAA 3PJ3A 5CF6A 3IGOA 1ZZ2A 1VLRA 4QNYA 4ZY4A 4FV3A 4W9XA 3DB8A 3VIDA 4L01A 4AUAA 2O2UA 4XYFA 1YHSA 3DA6A 5K0KA 3R1NA 1APME 1QL6A 3EL8A 4O6LA 4EHVA 4AGDA 4JRNA 4KKHA 4K18A 3MJ1A 4ANLA 2O0UA 5CU2A 5M44A 1K2PA 4JR7A 4RSSA 2C1BA 2OH0E 5AR8A 4M8TA 1BI8A 2VTJA 2G15A 4OBPA 4U40A 5E8YA 5ANIA 4O6EA 4NM0A 4F63A 3UBDA 4EZ5A 1JLUE 4JL9A 4DAWA 3FZTA 3CGFA 2UZWE 2VWBA 3GC7A 5FBOA 4S2ZA 2XF0A 2F4JA 3RZFA 3ZRKA 3R8LA 5CS6A 4F08A 3D5UA 4UWCA 4E4NA 4O7TA 4YLJA 4IB0A 5FG8A 3R8MA 4ENXA 1M2PA 2J5FA 3HX4A 4O0SA 3LCKA 4DH3A 4A9TA 4I22A 4NSTA 3W33A 3F88A 4Z3VA 3O71A 4OTDA 1PXPA 2WZJA 4PV0A 3BU5A 4GU6A 3W8QA 1YWRA 4DFNA 1S9JA 2X6EA 4FYOA 3TDVA 5BYYA 2VAGA 4U0IA 4J99A 1NXKA 3Q9WA 4GIHA 4AF3A 1SNXA 3B2TA 2HOGA 2QO9A 3AT4A 3OW4A 4UMUA 4CFUA 1SZMA 4CMOA 5IF1A 4AZEA 3FZOA 3FE3A 4TNDA 4TYJA 5CU3A 4AXDA 1IASA 2FSMX 4NW5A 4W4XA 4BBFA 1XBBA 3PY1A 2WOTA 4NW6A 4L9IA 5JFSA 1RW8A 3QZIA 4AZFA 3ULIA 5AP5A 1W2CA 4FL1A 4X2JA 4TW9A 4BDKA 3DBEA 2WMBA 2REIA 3RGFA 2HZ4A 2G2HA 1W98A 3VHEA 5HVKA 4LRMA 2C30A 3RHKA 2C0OA 4FX3A 4M67A 3VW8A 1G8KA 3R9NA 5I9ZA 1JQHA 4OUCA 3UC3A 1YW2A 3SRVB 4EK8A 3D5XA 4BKYA 3RPYA 4BCMA 4Q9ZA 3EFWA 4FTQA 5BYZA 4DN5A 2UW6A 3Q04A 4QTAA 4V01A 4EONA 2J50A 1JSVA 2BRBA 2VNYA 3F7ZA 2CCHA 3F5UA 1E1VA 3UQFA 3BV2A 3LCOA 3S2PA 4CZTA 5DI1A 3U6HA 1EH4A 4DITA 5ACKA 2C6KA 4O7ZA 2B55A 3LJ1A 5DHJA 3IKAA 4HGSA 3CEKA 4G6OA 1MRYA 1J1CA 3F3WA 3N51A 2WIHA 4OBQA 4O1OA 4OTFA 3NFGB 3FEGA 2VX1A 5BUIA 4Q9SA 3ZO3A 2PWLA 2YCFA 3EN4A 4QRCA 3OMVA 3WIGA 3ZUUA 4XEYA 4ZSAA 4O0XA 5ACBC 1VYWA 5BVNA 3C1XA 3TTJA 2X2KA 3CC6A 3TEIA 2EU9A 4D0XA 3GOPA 3OWKA 3PWDA 1V0OA 4L67A 2OK1A 3D14A 4IWDA 4WO5A 4CNHA 4DTKA 5CANA 1Y57A 4CSVA 4BR3A 3FMHA 4G5PA 3DNDA 4O2PA 1PMUA 3PXZA 4GL9A 5T68A 2OLCA 3NIEA 2ZV9A 3O50A 4H1JA 5A4CA 2EXEA 3ZYAA 2NRUA 4XHKB 5DE2A 1H8FA 4DHJA 2YLFA 5AV2A 4FV7A 4AAAA 4H58A 5B2KA 1OUKA 3DCVA 1Z5MA 4FNZA 2CPKE 3QA0A 3O5AA 2B9JA 2B9FA 4R3PA 1OKZA 4MH7A 1G3NA 3WZUA 4O7SA 4DFBA 3THBA 4FT9A 4JDJA 4HYIA 4FV5A 4WRSA 1UNLA 3FKOA 1QPEA 4YHJA 4JAJA 2ZM3A 4E1ZA 3GFEA 4FEWA 1M52A 1VJYA 5CLPA 4B7TA 4IFCA 4AOJA 2XKFA 3PXYA 1TVOA 5T3QA 1HOWA 2O65A 5AP4A 2X6DA 3FMKA 5H2UA 4HVIA 5TR6A 4F1MA 4BJJA 3KF7A 5CSXA 3P9JA 1IG1A 4HCUA 4IZ7A 3ORZA 3MI9A 2I0YA 2PTKA 2WTWA 2ZV8A 3GT8A 4QO9A 4NM5A 3QLFA 4BCFA 4RJ7A 5AADA 3CSVA 1LR4A 3HDMA 5K0XA 3EOCA 3TG1A 4YZMA 3JY9A 3HV5A 5AP1A 1REKA 3R0TA 1YDSE 4B99A 2Y6OA 4ZSJA 4EOKA 2BDFA 2QLQA 3GU8A 3W0OA 2X39A 5BVEA 2C69A 4I3ZA 5ETFA 5AUWA 2Y4IB 3H0ZA 4RIXA 2XJ0A 3ZRMA 4Y5HA 5GZ8A 3EFKA 4CCUA 3FJQE 3TN8A 5M4CA 3HUBA 1FVTA 4ZTQA 5AUZA 5KNJA 3FMJA 2VV9A 4YSMA 4D5HA 4LL5A 4ACMA 3SGCA 3K54A 5ANOA 1TQMA 1G8JA 2PPQA 4FIEA 5HVYA 2C5OA 3HKOA 4F0GA 4Y73A 3MN3A 4NJ3A 5CAUA 1SVEA 4FV6A 3G6HA 5HIEA 4C4IA 3OXZA 3CXWA 3EB0A 4O1PA 1F3MC 5KO1A 1KOBA 3R28A 4ZTHA 2B54A 2FUMA 5B2MA 5L8KA 2VTNA 4JMQA 4UZHA 4O4EA 3UO6A 3AC1A 3BZ3A 4D2PA 3BHUA 3W2QA 3NEWA 5CSVA 3OF0A 4BI2A 4PP7A 3LCSA 4FSZA 1O6YA 2CMWA 5HBHA 4B0GA 5LCJA 1ZOGA 1WBNA 2XM9A 2X4FA 4AE6A 3SAYA 4R3CA 5E8VA 5D10A 3K3JA 3UQGA 5FGKA 1UU9A 5EQPA 1UU3A 4IZYA 3QD0A 3M42A 3R21A 1XH5A 3ENMA 4TZRA 4CG8A 4DGOA 3BLAA 2R3PA 2QOKA 3QZFA 5IQDA 4M0YA 2UZTA 3UOLA 3IW5A 2OIBA 1GIIA 4A7CA 3EQDA 4ZS4A 5DEYA 2QVSE 2W0JA 2JDTA 2RF9A 5I9VA 3AC4A 4FZ6A 3EIDA 3LVPA 4BCKA 4ASZA 5IA0A 5C1QB 1P14A 2A0CX 3E8EA 4MNEA 2WNTA 3CS9A 1PJKA 5HO8A 4RPVA 5HG8A 1CKIA 4WBOA 4FEVA 3MA3A 2JC6A 4F9YA 2QI8A 3P4KA 2Q0NA 2JKMA 4PTGA 3AD6A 3QCSA 2GCDA 2CGWA 2ZMCA 5CAVA 3MYGA 1H0VA 4OTWA 2GNJA 1PXIA 3D7ZA 3F7WA 4XBRA 3ZONA 4KRCA 2R3JA 1UNGA 2UVZA 4H3BA 2IVSA 2ACXA 4BGHA 1YDRE 4KS8A 4CLIA 4D4YA 3DZQA 2VTTA 3ATSA 5L2SA 4A4OA 5CNNA 4CYJA 4EJ7A 4IX5A 3CD3A 3A8XA 4AGUA 3OBJA 2R3FA 1W2DA 3C4EA 3OCSA 4QPAA 4YC6A 4JQEA 4H3PA 5A4LA 4IX4A 3B8QA 3K2LA 4U97A 4ZZOA 4JBVA