4EKNB

Structure of the catalytic chain of methanococcus jannaschii aspartate transcarbamoylase in a hexagonal crystal form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
304
structure length
304
Chain Sequence
MKHLISMKDIGKEEILEILDEARKMEELLNTKRPLKLLEGKILATVFYEPSTRTRLSFETAMKRLGGEVITMTDLKSSSVAKGESLIDTIRVISGYADIIVLRHPSEGAARLASEYSQVPIINAGDGSNQHPTQTLLDLYTIMREIGRIDGIKIAFVGDLKYGRTVHSLVYALSLFENVEMYFVSPKELRLPKDIIEDLKAKNIKFYEKESLDDLDDDIDVLYVTRIQKERFPDPNEYEKVKGSYKIKREYVEGKKFIIMHPLPRVDEIDYDVDDLPQAKYFKQSFYGIPVRMAILKKLIEDNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate carbamoyltransferase
publication title Structure of the catalytic chain of Methanococcus jannaschii aspartate transcarbamoylase in a hexagonal crystal form: insights into the path of carbamoyl phosphate to the active site of the enzyme.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 109
structure length 304
sequence length 304
ec nomenclature ec 2.1.3.2: Aspartate carbamoyltransferase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
B PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4eknB02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4eknB01
2FZKA 1ORTA 4H31A 1FVOA 4EKNB 4BJHB 3L06A 3M5CA 2HSEA 2OTCA 4E2FA 3KZMA 1R0BA 5G1OA 4AT1A 1DUVG 1RAHA 1C9YA 3LXMA 1RAFA 3M4NA 4JHXA 3R7LA 1JS1X 1Q95A 1ACMA 4FYVA 5G1NA 1R0CA 3D7SA 1RAIA 2G7MC 3NPMA 3Q98A 4AMUA 1PG5A 2IPOA 3SDSA 4FYWA 4ANFA 2FG7C 2AT1A 1TUGA 2I6UA 4OH7A 4KH1A 1TTHA 1EKXA 1ML4A 1AKMA 3KZKA 1ZA1A 3R7DA 1EP9A 2ATCA 4JFRA 3KZNA 3CSUA 2BE9A 1FB5A 3M4JA 3R7FA 3GD5A 3E2PA 9ATCA 2P2GA 1EZZA 8AT1A 2FG6C 2FZCA 4EP1A 3KZOA 3MPUA 1RABA 2W37A 1ZA2A 4IV5A 3AT1A 1XJWA 3TXXA 2RGWA 4KGZA 7AT1A 1SKUA 4FYXA 1DXHA 1PVVA 3L02A 3M5DA 5ILQA 1RACA 2FZGA 6AT1A 4JQOA 3L05A 3TPFA 4A8PA 3D6NB 3KZCA 2AIRA 1OTHA 4NF2A 3GRFA 1RAEA 4KGXA 4A8TA 1AT1A 4AM8A 2QGFA 8ATCA 4KWTA 4WTOA 1RAAA 1A1SA 4F04A 2YFKA 4FYYA 5AT1A 3UPDA 4A8HA 1I5OA 1RAGA 5G1PA 2H3EA 4KH0A 4F2GA 1F1BA 2EF0A 1NBEA 3L04A 1TU0A 2QG9A 1RADA 1VLVA 2A0FA 4KGVA 2BE7A 1D09A
chains in the Genus database with same CATH superfamily
2WAXA 5I45A 4U6NA 2JAUA 3H17A 5BQPA 4NZ9A 1KTVA 3C8UA 3O83A 4QPPA 4K5QA 3O82A 2E21A 3H4TA 1GNTA 4MVJP 4DUPA 4EHIA 3NOOA 3HLTA 5DGTA 3DKRA 4Y18A 5FBKA 5F2OA 1XTBA 5C81A 4WOKA 4ENVA 4WVFA 2C96A 3BL8A 3NYIA 2QI9C 3LD9A 4PC1A 4EG7A 4G5SA 3UM9A 3HJTA 1NDQA 4TYQA 3N6VA 1P8JA 2VWGA 5KS2A 3ZLTA 5I9TA 3IP7A 3K72B 3PG5A 4J7AA 4L27A 4UD6A 3RC9A 3PFIA 3WGNA 1EXVA 1ISSA 2QMUA 1AGNA 3ZWQA 4BFXA 3DD1A 1E5TA 4U2DA 3B1JA 4U9HS 1U5BB 1E59A 3COYA 1HQCA 3RFFA 3WGMA 3QHQA 2XKBA 3ROTA 4MS4B 1S8OA 1U3GA 1BYIA 1GKIA 3BXOA 2JBHA 3WIDA 4WFIA 4Q9IA 1KI2A 4JENA 4EHAA 4FLFA 3EY9A 4QICA 2CXHA 4A6XA 4LOLA 3VO8A 3U5ZB 1E3DA 3ZPXA 1Y6QA 2W8ZA 4KQ9A 4V0OA 3QW2A 1XU9A 4P5EA 1CULC 2ZTUA 2J46A 4QPDA 2GF0A 5GPBA 3ZTWA 3ZXUB 3T8YA 3HN6A 1NF3A 3CURA 3TH5A 4DSAA 2HX1A 1ZIDA 1E1RD 3WY9A 1FFEA 1SCIA 1I7LA 1NKTA 3EDRA 5CHYA 4CT4B 2WNSA 2XA2A 2R11A 2VPWA 2ZE6A 3KSMA 3PHHA 4J2TA 4XB6B 4AMGA 4TQ9A 3LGXA 3QG1A 5HIAA 4G89A 1EVJA 1JBQA 1SU7A 3AHEA 3DLIA 1W6RA 4P5PA 2CY0A 3TLXA 4J76A 1HNXB 4S35A 3GPCA 1RXEA 2GZAA 2FSVA 3QF4A 4EMSA 3OPYA 1QZXA 3F5SA 1XRLA 1WPQA 1N4AA 4DSNA 4NAHA 4OYRA 2BDTA 3DW3X 4RF5A 2WT8A 3OE1A 4HGNA 1D9ZA 2PRIA 4IMPA 4OXXA 5FWDA 3UNXA 3THXA 1DE0A 2NO0A 2HZBA 4KNVA 1SZCA 4D5EA 4R1PA 3AP1A 3ESQA 5K2OA 3DBOB 3P2OA 5JAOA 3MCWA 1PGPA 1T2EA 2Y76A 4MPJA 4K7JA 3CVUA 2AEFA 4IZHA 4Y2VA 2J5XA 2XNKA 4YC7A 4YAIA 1F0YA 1KMHA 2IP2A 5G4KB 3U5TA 1QVWA 1TNDA 2AR9A 1JWLA 2X0KA 4FU0A 4B3MB 2OYSA 2B69A 2JJ2D 4R31A 2VBGA 3OJLA 3X2SA 3ZY5A 4GPIB 4BNDA 1AUQA 2GBLA 3WRVA 3DTVD 3TTTA 2ON6A 3I62A 3GNQA 2VSFA 3N2ZB 1F2UA 3OQVA 1SG9A 1RLTA 3FRIA 3U6KA 1GTMA 2JEZA 4FZRA 5K4AA 3H2KA 4JYBA 1OXUA 5F12A 5A9TA 3ZV7A 5LMCA 3HL0A 4EG0A 1UM9A 1J8FA 1T1SA 3IAUA 1MN6A 3OLQA 3SF8A 4O33A 4Z7QB 1L7XA 5G53C 3JCZA 1NVGA 1AZTA 2DULA 3VPHA 1JA1A 4DUZB 1QIHA 1YJQA 4MR8B 3CE9A 1XZMA 1PR0A 1FW8A 1UBUS 2WBLC 2QT0A 4R8LA 4DLBA 2F7SA 1LDNA 2BEVB 2C92A 4RTRA 5DP2A 1QG4A 5B1SA 5AVJA 2QLFA 4FW9A 4ND6A 3UYKA 2B8NA 1P0FA 4UFPA 4E2FA 1CUDA 4L51A 1TEHA 1QE3A 3BXGA 1CYEA 5G40A 3BMOA 1TF2A 4MCJA 4NPHA 2FX2A 4EL5A 4I99A 1U9IA 3TLGB 1H0HA 4E5VA 5JZ9A 1VL0A 1QRDA 2R6JA 4J6EA 4FGWA 3ZWVA 5DN6D 2WSYB 1Y1SA 3NPMA 3RSOA 4W5HA 3TRFA 3ZV4A 2H4YA 5FUQA 3V48A 1GPUA 3IGFA 1KDTA 3DV0B 2C3YA 3ZDZB 4P54A 3ADCA 1DAPA 3E18A 5HIJA 1DHRA 2BFFB 2EDAA 4ZMRA 1FRZA 1QS0A 1E7MA 1E79D 1WB9A 3EGWA 2E6UX 2X9NA 1T0JB 3C3AA 5A4KA 3GLIB 1OZGA 4O4JA 1PL7A 4NBSA 3PC7A 4UBOA 3EBOA 2R9VA 2DUNA 2QJFA 4UREA 2YRFA 1OI7A 2XBMA 2PKQO 3HM9A 3GV0A 2HL6A 1UMDB 3G1WA 3UAXA 2FQXA 4DLWA 4ECAA 2O54A 1IIBA 1ZICA 2CXTA 3HGTA 3AF4A 4ITVA 2D59A 8LDHA 3GMSA 4PQYA 5AP9A 3CVWA 1FDUA 3ORHA 5JH7B 4QBFA 3GA0A 2G83A 2CE2X 1YFZA 2FOLA 1ZD2P 2X22A 3C8DA 1FSZA 4QPNA 3QIVA 3ENKA 4QFDA 4ZFNA 1OU0A 3RIYA 1JR3D 3HYTA 3NIGB 2YIDA 4KOEC 4CDRA 3PNSA 4MQUA 4LXGA 4G36A 4I9FA 5IJ9B 1OE0A 4Z1OA 3PRKE 5TE9A 1WCIA 1KNQA 5AWFC 2XQFA 1C0EA 2OV6A 5CLHA 1N5JA 1P2DA 4LQDA 5C1BA 1C9KA 1SQ5A 2HFJA 4OHWA 1FX0B 3ED1A 1KP2A 4LW8A 1SELA 2HRCA 3CW2A 5CVVA 4ENQA 5ITSA 2ARKA 2Q21A 2LIPA 2D13A 3K4QA 2BISA 4ZVUA 2Q3LA 3TJRA 3I32A 4KWCA 4O4LB 3E05A 2GA8A 4D25A 4O2LA 1Q91A 4E2ZA 7REQA 3WGHA 1Z36A 1T5HX 4LZJA 4P3OA 1WM1A 3D6FA 2WJWA 2IXGA 4XUEA 4BC1A 4DJTA 1YDWA 3ZBPA 3CVOA 4ZIRB 421PA 2OV3A 1U7OA 1JHVA 2QTAA 2XUKA 2V1UA 5HM8A 2VZLA 3Q9NA 1O96B 3STVA 4UU7A 3HXLA 5D3MA 4JI5B 1XEXA 2JLVA 3IPLA 3TKLA 3LRPA 3PL1A 5ESDA 1PLLA 2FDXA 2RH8A 6Q21A 5KWSA 1H5UA 1V41E 2YVUA 3Q7IA 4REMA 1Z08A 5JVDB 2BW0A 2KLBA 4MV5A 1AGYA 4RSMA 5I7AA 1RQXA 1S8FA 2GI4A 3H19A 4ISBA 1TYZA 2V54A 5E4TA 1PG2A 3WQRA 3HQ4O 1G8HA 3FMOB 3IUSA 4IV8A 4NHEA 4BEJA 1V3VA 3AUKA 4QRDA 4B3DA 1VGRA 1B6RA 4QT0A 3ZIDA 3VSCA 1U3WA 1LQTA 1UZUA 1G9TA 1MF7A 2O0LA 3DVLA 3NG1A 3O31A 3QVXA 1FK8A 1OWMA 2YCLA 4FOLA 3BGIA 3EC2A 1R8QA 2WK1A 5GMOA 2KW5A 3T41A 3WNCA 1VBFA 1HH4A 1ZJ5A 2JIOA 3FZEA 4HDRB 3O4VA 4ZO6A 4Q3LA 1DG1G 2R00A 4QG3A 1MDFA 4P8RA 3DMYA 3KZ1E 3SQLA 1NHGA 2DCMA 3U13A 1TQ8A 2ERYA 4ND1A 4AS1A 2H29A 2YV2A 3EFOA 2I62A 1BQ3A 4XARA 4UNRA 3THYB 5DM1A 1EUQA 2DY0A 1ZOIA 2J4CA 2JAXA 4XQGA 4KIWA 2MR5A 3AHJA 1H4SA 1E6KA 1RMYA 2O7QA 1ZVKA 2QL6A 3TTXA 2GF2A 3DEFA 2OM6A 2J67A 1YMUA 2IWHA 1EFPB 1J7JA 5K0LA 5J23A 1IY1A 1N7GA 1Z2DA 1J1UA 1Z6TA 2VHWA 4OI1A 3SS9X 5I9BA 2F67A 5KNBD 1PFQA 2G6BA 1PR5A 4FYPA 2FQYA 3AEXA 1J0CA 1UXHA 2ZB3A 1YO6A 4MW7A 1OD6A 4OFBA 5E2AA 1N3YA 1PZGA 3C5CA 3HWWA 3VBEA 2X7JA 2QIPA 3BE8A 1H6BA 4PICA 1DFHA 2VDKB 3IBTA 4LMRA 4FMCB 4KYUA 3O38A 4NZOA 2JAPA 3R7DA 1XZPA 3LY7A 4D8TA 1E6EA 3RTCA 5BUSA 5E7IA 2D06A 4C08A 2DMRA 2FPPB 2O7RA 3A1NA 3NM4A 4PW0A 2VXYA 3FVWA 2OQVA 3JQQA 1GGNA 2FSFA 4WADA 3ZGLA 4G23A 2XWPA 8AT1A 1W73A 5THQA 1WXIA 4NJMB 4QIHA 1QHHA 5DX8A 1SXJB 1WF6A 4E4TA 1IPHA 1GARA 3GX1A 2NNLD 4MS1B 1WHTA 1DCFA 1YWGO 2F64A 1VJ1A 2WABA 3IBYA 4BZPA 5IT4A 1M2FA 2PCLA 3DOJA 5C4IA 4PONA 4B09A 4RZHA 3SC4A 2GM4A 3PA8A 3FKQA 4XIJA 4HUJA 2WTMA 4PVDA 1PWEA 2Y1EA 2RK6A 1H5NA 3FLBA 4DIKA 1VHWA 2F55A 1P3DA 4HFRA 3DCJA 4ARZB 2GCOB 4BLPA 3FMGA 2XD9A 3B6EA 3DBLA 2JLXA 3CEJA 2NVWA 3X1KA 5CLJA 1H05A 3DZDA 3PFGA 4V1CB 1VSTA 3GGCA 5I5GA 2DHCA 1UQTA 5FFMA 4F6RA 4C4TA 4I5IA 5SICE 5C37A 1FMTA 4OK5A 2ZCJA 5C1PA 4ZEXA 5DMXA 1OROA 1SA0A 1NJ8A 1ZNWA 5LQSA 3UMFA 5K4GA 1VL1A 2VIIA 3JTEA 1P7YA 1TAHA 1HSZA 2HWXA 2F3PA 2V6BA 1QRTA 1YR6A 3QVVA 4BFUA 1BS1A 2PUWA 3CUWA 1BXKA 1CIVA 4PZLA 4KR6A 3PGMA 4NIMA 3VYRB 5GVSA 3PUZA 3GH1A 1JHZA 1FSFA 3HNRA 4BVKA 1Q6ZA 1QH8B 5H8WA 2ZSBA 2UXBB 3DZIA 1N3IA 1ZN9A 1E1KA 2WVJA 4IQFA 4D81A 2M98A 2PSFA 5CEEA 2F4VB 3NDBB 1K6MA 2QN1A 4MUBA 1B3RA 1C1XA 3KHKA 3LPLA 4EKGA 1DU4A 1SVUA 4CUKA 1RADA 5IVPA 1MJGM 4D0NA 1KH3A 4FHEA 2JFZA 4LS3A 3VR6A 3NIBA 1N32B 3TLMA 3L8EA 2I0FA 3L06A 3OE5A 3VH3A 5E38A 5IF9A 4KRGA 2JKYA 4NV1A 1F4PA 1DO2A 4JB3A 4A2PA 4URXR 3E1SA 4ZARA 4WUTA 1JDJA 2WM9B 1YRWA 2QM3A 3ENWA 4QYIA 4MGKR 4GL2A 4G1BA 3MUFA 4PG5A 3DKIA 3W4IA 4LCJA 3KZMA 1RYDA 2MINB 4JJAA 1P29A 2UDPA 4FFWA 2XUPA 4Y1GA 4CKBA 1ZC3A 4FSHA 3TTYA 3V1KA 5KTNA 5SZIA 3HJGA 4UCQA 3UK0A 3TEFA 4C3ZA 4D46A 1BCSB 1QQTA 2VQ6A 2XMBA 2YWCA 4D7AA 1S3IA 2EU8A 2GHTA 3HTXA 1EVEA 1F6DA 2AEMA 2H59A 3GLRA 5ENDA 1C1YA 4HEJA 1F14A 1XNGA 5CLQA 3W05A 1LRJA 2WT9A 3OFVA 5CH3A 3S2SA 2JIBA 4JLMA 3DDCA 3PNKA 4EB0A 3FMPB 5J58A 5I4BA 2V7TA 1DKOA 1IQPA 4MLZA 2NPOA 1QVRA 3CUTA 4HQOA 3ONEA 3JATA 1ZN7A 4DREA 1F51E 2MSNA 2Q7OE 1NW9B 2NZWA 1KEVA 2A3RA 5CFNA 3RUFA 2I4LA 1Q17A 1UJMA 2P67A 3A70A 3D6UA 4NCIA 5ELXA 2J30A 4ZTZB 2QX6A 2OILA 4RGVA 3JTMA 3Q3JB 3GLFB 2QHXA 5IEBA 2AMJA 5EJ8A 2I6SA 1CY2A 1LZKA 4DQVA 1QG0A 4QUKA 2XIQA 3KYDB 1SUAA 4JJGA 1YR1A 2QQGA 3HCDA 4JB0A 3WL5A 2BKUA 5EIWA 3WYCA 5ETJA 2YOGA 4P7JA 4NE2A 4JD5A 5AKXA 1C9JA 5JAUA 1ECBA 3FUTA 1Z9BA 1DUIA 3H2HA 4NBRA 4EW1A 4C1BA 1GSOA 3CEHA 1Y37A 5CAEB 5LP1A 3HGMA 2BEKA 1G98A 3LO5A 3QGMA 1H2AS 3NIWA 3MT0A 3ZQ4A 2YJ4A 1JDBB 4X94A 2YJ6A 2H07A 5LLTA 4GSKA 1RXSA 4UAGA 5ILQA 4CKWB 5LMNB 3GZNA 2A1UB 2QLMA 4Q7MB 3AUJB 3IP3A 1EHYA 4A8JC 4CI9A 3OEHA 3EQ2A 2BKXA 3MINA 4V0SA 1NNUA 3C7CB 1XZEA 3RUCA 1QLWA 3ETCA 1LPAB 1R6VA 4KGXA 3K20A 1XTTA 5B2FA 2Z5GA 4QYWA 1Y7IA 4DS3A 3G85A 3UBMA 1B43A 1NJ6A 3IEUA 1CRZA 1QRAA 1UDXA 1UK8A 4H15A 1YD7A 4JB2A 4S1OA 4UUPA 3ZQJA 4BO2A 4CG1A 1XZDA 2VZ9A 2GPWA 4WHMA 1MPXA 2OORA 1EGQA 5C53B 2BZGA 5SYMA 3UPDA 1U0NA 2EFGA 3JQFA 1Q15A 1IB6A 2QZZA 4BVAA 3GRPA 1COWA 4KN9S 3HXQA 5JXHA 3ZCXA 2Q2NA 3JQEA 4G01B 4WKPA 1HUQA 3M1IA 3OH8A 1Q0RA 3M1LA 1E1LA 4DMKA 5HWSA 2ZIXA 5IAGA 4LXHA 1RW4A 4P9NA 5CVTA 2F2TA 1AZLA 1W1IA 1V8ZA 2OV8A 2D4AA 5CDSA 4ZCPA 2A9QA 2EX1A 1X1BA 1Y1PA 1PD1A 2F90A 2ZZKA 4H31A 1H0SA 4I9UA 4EKNB 3ENVA 4PSVA 1YS2X 1Y0BA 4Q4DA 5FOTA 4BE7B 3W2FA 1JYFA 3UXHA 4R98A 3FAKA 1ZWKA 3KKLA 4X3OA 3THWA 1U0OC 1V1JA 3CB4A 1XKLA 1R7RA 3EUFA 4M9SA 3T4UA 3WGVA 1MH9A 4MWSA 4TN1A 5A02A 1BGVA 3GT7A 1IXKA 1DC8A 3B8HA 1EXMA 1N8KA 2HR1A 2Y6VA 1REQA 2DPHA 3A26A 2R1VB 5DBOA 5F35A 1EP3B 3LBYA 2V97A 1PG5A 4MGEA 5KU7A 4NYMR 2BTQA 2ZP1A 1E2QA 4GVPA 4RYDA 4Q0MA 4XYBA 1NHWA 3B8EA 3HRHA 3HN2A 3W8RA 3ZZTA 4GM4A 1JG2A 1N0IA 4A92A 1E8MA 4BLTA 2O48X 1M33A 1NJ1A 2EKZA 2X1LA 2X76A 1FXUA 3P0RA 3JYQA 3WLSA 2HCJB 1FS6A 1ZIOA 2VL7A 2WF5A 3KC2A 1XMOB 1EQ2A 2ZR8A 3EVFA 4U2KA 1KPIA 2NV0A 4LRXA 1WZIA 4C4XA 2W6ZA 1N2SA 2WP8J 2H06A 5B4UA 5KSWB 3AF6A 5LC1A 5FUXA 5IWAB 4YMIA 2GTPA 5DCLA 2P5YA 4BB0A 2DKOA 2R6ZA 4ZMSA 3ZR4B 1L9KA 4C7OB 5L3ZA 4GF5A 4ZZIA 5MF6A 5G0TA 3WQHA 1R3UA 2IZ1A 3IH5A 3O8CA 1F2VA 3FUUA 4JI0B 1DXQA 3KDSE 4OLBA 3ETDA 3ND6A 1LY1A 3T7JA 4CZ2A 1RQPA 2QLLA 3GJ6A 3S99A 3ZUPA 1FFCA 5AI9A 3PFCA 1RU3A 1Z2PX 1DBWA 1XRMA 4NAVA 4OVKA 1QCYA 3BHJA 4PNHA 4DVGA 4WSOA 3FVVA 3EXEA 3UHJA 5AD1A 1YQWA 2OFOA 3ICEA 2IDKA 1W5AA 3DE1X 1THZA 3EPPA 3E9RA 4DA9A 2AKEA 2DWPA 1ZMTA 4H17A 3L4JA 3SXJA 4ZJPA 3WSVA 1U90A 4ZOLA 2HU7A 4QFMA 1W0KD 4MUIA 5KJ6A 4L5JA 1H2EA 2PKEA 3ENZA 2XMZA 1T2UA 4LKRA 3TB6A 3LNTA 3SHOA 2YWJA 2DTXA 3MERA 1MJHA 2P5TB 1QGUA 1IHOA 3H9BA 2A84A 3LC0A 5B6JA 1WD7A 3GEMA 4BB9A 5ICCA 3AUFA 3NHLA 4NBNA 1M6HA 1JLLA 1MB3A 4QE3A 3K70D 1XQ9A 2O23A 1SUCA 3F9RA 1KKMA 1RRVA 1E4EA 3B2EA 2ZROA 3FIJA 1U0GA 4KUHA 2A78A 1CUBA 3GIDA 1UKEA 1B4DA 4XYGA 4YUVA 1VQ1A 3ASVA 1D2HA 2ZAOA 5I7RA 2VQDA 3GMDA 1RR6A 3GQVA 1EH5A 4N48A 2BN4A 2WHQA 4E6EA 2RHDA 3T7SA 3L5OA 1DMRA 1SCUB 3ZWKA 1JDVA 2C97A 3SNHA 4ALIA 2FUNB 3ZS9A 1IY9A 1MAHA 2C9BA 1FP7A 4F1WA 1KJJA 2PQ0A 4LSWA 3G5UA 1XZBA 1FP6A 1CUSA 4D9BA 2FPLA 1TPZA 3C1UA 1L5KA 1KQFA 4DF3A 4HFMA 3P19A 4I55A 4RKFA 2C82A 4JLJA 3LKDA 2HYDA 2Q7DA 2H2GA 2V45A 1T8PA 1LX7A 2NUPB 1RP1A 4O4LF 1NMYA 4NESA 4S3MA 5FA8A 2M2IA 4EUNA 1AQNA 3B6KA 3GGPA 3N86A 5EKXA 2GD6A 3FAZA 3KAPA 1ULSA 2VH5R 4CF4A 4DJEC 3MSCA 1UINA 3NT2A 4B4VA 3CIFA 3LQQA 1KJZA 2VDQB 1CUXA 1LJ8A 3RARA 3UB4A 2HIHA 3RT7A 3AKZA 2Q1UA 1JX6A 3EGDA 3MJTA 5EMNA 4V1CI 3OZIA 4J2HA 3CZQA 3HCAA 2DR0A 4H7HA 3U3RA 1Z17A 3QNUA 4Q5IA 1EJ0A 1OAOC 3TUIC 5BW8A 3HVHA 2BBOA 4I1RA 5JVDF 2YUIA 1VMIA 1Y3CE 3RRJA 3ZE6A 1JA0A 4BJ5A 3TBFA 4C3OB 3E6AA 2CK3D 2ZT7A 3S40A 4KQKA 4PNZA 5DSXA 4XWWA 3RTEA 4PZUA 4W4TA 1QV9A 2QD4A 4BX8A 4HQNA 4WKCA 2YZNA 1O8BA 3DZBA 2JFYA 3ET4A 5K8LA 2FFJA 1PFKA 1NQWA 5CT4A 3V4OA 1XAHA 3EWIA 3TNDA 2GKSA 4HAUA 2Y1LA 1XC7A 1E1YA 3QKRA 1LK7A 4GI7A 1KMCA 3C15C 3AINA 3FMIA 1GIAA 4B4OA 4EB6B 1Q7GA 1QZTA 4HQ0A 3UOAB 1WV0A 2D2EA 3QLVA 1YRHA 4P7BA 1LV8A 4HH1A 3QU5A 5IANA 2EKPA 5IASA 5TSDA 5JMTA 4KR7A 1I5EA 2MSKA 1F48A 5H9WA 1X80B 2J08A 2BT4A 4IL5A 5JS6A 3NHAA 2YYZA 3T5CA 3LP6A 4HADA 4MH0R 2IQ5A 4K8RB 2EGUA 4GRDA 1CT9A 2EHJA 1D4AA 1WO8A 2JLRA 1DAGA 5IXYA 2C1XA 4TUYA 4K0KB 1TO1E 4Q03A 2C84A 2EZUA 2IELA 3TQFA 1G19A 4XVHA 2HQOA 3EGEA 2Z08A 2Q9UA 4HUQA 4MVXA 3LG2A 5C32A 1U0JA 1BHSA 1OI2A 2EJVA 1ECJA 1Q20A 1C8KA 5DM0A 1PIWA 2E4WA 5FBZA 1MOQA 3RROA 3MT9A 2O2YA 2QD5A 3JAWB 4EJ2A 1ZX1A 4X85A 2LRHA 4RMGA 4UU0A 1AHHA 5I7OA 2ODAA 3CEAA 3AEQA 4PWZA 3DO5A 1KZ4A 1NQVA 2AL7A 1AM4D 1AIPA 4NZZA 4KXWA 1L8AA 1UK6A 4ZOEA 4YUZA 4ME6A 1RWQA 1PZFA 5D00A 3TGWA 1ZQ1A 2PRSA 3ETJA 3EZFA 4OATA 1BMFA 1PFWA 4ZANA 5JZOA 1TTTA 5BYKA 4DLKA 4NOKA 2W48A 4BNZA 5EYPA 1E0SA 2LXNA 2WJPA 2O2EA 3MMSA 2GRJA 5FAXA 1TEXA 1XSEA 4ACAA 3PPWA 3TR5A 2UU9B 4M83A 3FKSD 4K9QA 4LJ5A 1TA9A 2OLJA 3TN7A 2VOEA 2Q2OA 1K86A 1FLAA 2RC5A 1SULA 5DNDA 3O7WA 3CNHA 5K1ZA 1AHPA 1NVFA 4EI9A 1IU9A 1NJSA 2JI6A 3LX4A 4DWVA 3GVCA 2WYIA 1UBTS 2FWAA 2CV0A 1JQLB 1ZM3A 2CB0A 2W6NA 1BXRB 1GKKA 1NN5A 3EY4A 4ALNA 5L4SA 1LH0A 1T0HB 2PDAA 4DWOA 1VLVA 1OU4A 1XELA 1WU8A 4AZ0B 1G8PA 2ZQZA 3JYPA 1MQSA 1ORTA 4RENA 3S29A 1B0PA 5NULA 4JROA 4XD7D 3V7UA 4YT5A 5H59A 2P4EA 1GN8A 3IKJA 3PKZA 4RHYA 1PR9A 1JXQA 5EXTA 3BF8A 4BZXA 4C4OA 1X8LA 3AK4A 1L3IA 2XLBA 5L7WA 1HC7A 5JMPA 4N40A 4RV4A 1TDJA 2YQ5A 5CLIA 1ES9A 2BRUA 1ADJA 3I1FA 3O8OB 2WILA 5ITVA 2XWJI 3KPWA 1XNHA 3EPRA 3DOCA 3PEFA 4IJQA 4ITUA 3ZWWA 2BP7B 3GEDA 1FTQA 2BCJQ 2ZRIA 4Q1EA 4MVJG 2VAWA 3MJDA 1JEOA 3AWIA 2OCPA 4OQLA 1I4TD 1V9LA 1WDMA 4WFQA 5TS3A 3S6JA 2Z6VA 4DOMA 5CPFA 4PZEA 3UAYA 5LQUA 2QGNA 3GPIA 1YQUA 2ETXA 3BXXA 5IJZA 1E3QA 2ECPA 2HFKA 1ADFA 1YVRA 2VDMB 2YS7A 1M0WA 2X8LA 3SZMA 4KVAA 1NPYA 1TYDE 1X1TA 2JIDA 5LLSA 1QK4A 1JGTA 3KS9A 1AO0A 5CJJA 5K6AC 2D5BA 4M22A 2IHTA 1K7XB 3SS8A 1VC2A 5A5EA 5EP3A 2AA3A 3LVBA 4M8KA 5F4ZA 3QVLA 1YTLA 3S44A 2QAIA 3RASA 3UQYS 2C7OA 3O4IA 2VJPA 1Q1ZA 3L7JA 3A10A 1B3BA 1QIIA 3FOBA 2FLKA 2E82A 2PLRA 3L01A 5GM2A 4II2A 1N6NA 5IARA 5EMJA 1U2GC 2C9ZA 1FDRA 3RT1A 1RABA 1SNYA 1RBZA 1A4UA 1YOVA 2W37A 3LIPA 4KSBA 4P4GA 1J8QA 2JFFA 3GFGA 4WNYA 1GAJA 3BJZA 4H3HB 4A6EA 4PZYA 3H04A 4DYDA 1ID1A 1QYIA 2GAJA 3PA6A 1D2CA 2QTMA 1KXZA 3CSDA 4G1FA 2L0XA 4GLLA 2C03A 4M3NA 3OWOA 4RIGA 3KOMA 5IVKA 4F21A 3A9CA 5KNDA 4WZBA 5M2QA 2NG1A 3BTVA 4I50A 5ALOA 5IMBA 2BELA 2P3LA 3V00A 4P83A 1CFZA 4YCJA 2OBXA 2R2AA 2E7ZA 2ZUUA 3MIIA 4W5JA 3HXPA 4PHGA 4TQGA 1DAFA 3OPNA 1VA4A 5A0FA 1AZWA 3SMQA 2C4NA 2CHUA 1XK6A 1HDEA 1JU3A 1VIAA 4KZKA 2IYTA 2VZ8A 4MOWA 2IWRA 1CUWA 2XNCA 4CG2A 1SUBA 2X3FA 4JV5B 521PA 3TLAA 1FDVA 3KAJA 2EGHA 5EJGA 3RSQA 3V8BA 1GKYA 3G8YA 5B64A 1UEIA 2IYQA 4OXNA 2EJTA 4EKYA 5JYBA 3A4IA 4RGBA 4BNTA 4HQ6A 2VF7A 1B0AA 4GOKA 4BNKA 2Y1XA 4OXQA 4YDHB 5KQSA 4AO8A 3Q9UA 3PNBA 4BHTA 2OEPA 5CU7A 3MS2A 3PXXA 4FHZA 3T1TA 2TMDA 4F4CA 2E4UA 1VBNA 1NJ2A 1QFJA 4KQ6A 4KR9A 5DTMA 3E70C 4IIDA 1WTCA 3IL2A 3EA5A 2GPYA 1R64A 2VDJA 3FPFA 3FOFC 1LUAA 2HWUA 4L16A 5BQ5A 4B7XA 4FINA 3MWGA 3RABA 3I39X 5CDFE 4O3MA 3GFPA 1NBME 3LBHA 2PT9A 3OFKA 3PI7A 1Z38A 2H4JA 3A1TA 4QPCA 3TRKA 2AFRA 2VHTA 3ZE1B 1AKEA 1G9XA 2D5IA 2WAMA 2XE6A 3IAFA 3M6IA 2FPKA 2AZMA 3O1IC 3OKCA 5EIFA 5C18A 2Y99A 2VNKA 1XD2B 1DSSG 2NUBA 1MC5A 3T99A 4Y2GA 1E2DA 1JSZA 2F8MA 3NTXA 4G8DA 1IUNA 4AWBA 4ATNA 4DEVA 2C7RA 3WGJA 4ZOQI 1Q0HA 3BGVA 3CNLA 2PX6A 4DJ5X 2GFIA 2HHHB 2EKQA 1JI0A 4MEAA 2YHSA 3WIUA 3N2EA 1YTUA 3EMBA 1QR2A 2Y68A 3ZIAA 5C31A 4JUBA 5C51B 3V4RA 4LSGA 1V3TA 2JKZA 1JIVA 4MKFA 1KYIA 3F78A 4EYOA 2P78A 3FHLA 5T6BA 1VIMA 1OZ0A 2YQ4A 1PVDA 4UMEA 3U3ZA 4RZ2A 2JH3A 1ZVJA 4GICA 2QTNA 4KO8A 1Q6YA 4NU5A 3V80A 3D4PA 4FPXA 1D6MA 4G4SO 1CUGA 5KHAA 3BFKA 4BMCA 1H2FA 2PZMA 4RVDA 1LC3A 5CGZA 2D1YA 2B0CA 1OX6A 2WTAA 1OWLA 3TECE 3G0DA 2UV8A 1PK7A 3LHSA 2OCAA 1IDN1 3B9QA 3TTSA 4JKOA 3H1EA 1LDMA 3OQBA 3BE5A 4KDRA 4E51A 1VG0B 2REOA 3Q5GA 2OXTA 5FWXB 2PKRA 1E1NA 3Q7RA 3LCMA 4JBLA 5EZYB 1L5ZA 3A2MA 3T52A 2WSMA 3CRVA 4HPXB 1LTKA 4J75A 1RRFA 2Y0PA 1T4MA 2ZBFA 5BOVA 1H2RS 4RHUA 1I32A 1ELOA 2AEJA 3AI2A 2HPAA 3GB9A 1DWUA 2A5YB 3VKFA 3O93A 3I0NA 2A94A 4GZLA 1OFUX 4NZYA 1VI6A 5BPHA 4HAZA 5J9FA 1VGVA 3A28A 1ZK2A 5AKYA 2YVLA 4MUJA 4MICA 2P11A 5SYNA 2CL0X 1JLRA 2Q1WA 1DC7A 3W7BA 4YAEA 5BSEA 1LJLA 2QGFA 3I9OA 1ENPA 3VMFA 4DA0A 4EH1A 1ETHA 2C5FA 4EY4A 3GFBA 4ZYXA 3TAXA 2VXCA 2ZRBA 4MHTA 4YAJA 5E8JA 5JJBA 3IBGA 2HC9A 1A2OA 2J6CA 4QREA 1NRWA 2O7NA 1WABA 2SKEA 2ZU0C 3I76A 3KQPA 4FQ7A 4ZHQA 4ENTA 1P17A 1WY7A 2DEUA 2QRVA 1LPSA 2DFKB 3KKMA 3OIDA 2ZYIA 2O3TA 2FW9A 3C45A 2HPVA 3QA9A 2O06A 3A1SA 2IYPA 3KT3A 2PV0A 3GEIA 3UHOA 2MWMA 3RFCA 3GLHE 4NCNA 2F4NA 4AO7A 4D99A 1E20A 1I1NA 1SVOA 3KT6A 4OUDA 2XITA 2H1HA 1D09A 3QNMA 1A8PA 2CBZA 1FP4A 2A86A 5G41A 3BD9A 3FNBA 4NL4H 1JKJB 1QIFA 1XZGA 5E1DA 2BJWA 4F4IA 3C98A 2JGDB 2ODQA 1EVKA 1BDJA 1EUDB 4MPDA 2PH7A 2F48A 4TYYA 3ZHCA 1OFTA 5C8DA 1EXDA 1IPEA 3X1MA 5K3FA 1CB7A 2XYGA 2GWRA 1UBRS 2YY5A 3SICE 4BCBA 2C7BA 2R6DA 1YACA 3BH0A 3EIOA 1I7DA 1MX9A 1SBTA 3A6FA 5IC5A 5IUKC 3SOZA 2CLMB 4RTOA 2GN1A 3NXSA 4KSYA 2DXIA 4RKRA 2ZI6A 3WHIA 2Z57A 3CZ5A 2FEWB 4MQFA 2J9RA 2XVMA 1M75A 3LRXA 5CDGA 2XUOA 1AKNA 3TXYA 1PUIA 3D59A 4LCBA 2QI9F 4MPRA 4NYIQ 3ROGA 4LFBB 2X23A 4A2QA 2AD5A 4DUYB 4IUDS 1JEJA 1SXGA 4OX9B 2CXXA 1YI1A 4JXKA 2IHYA 2ZXEA 3V42A 3EUWA 2FDCA 5DEIA 3HO1A 3H9UA 4AJHA 3U4QA 4D9KA 4P3XA 3GH3A 2YBDA 3K2EA 2CLOB 2D2VA 4Q02A 3UT5A 1E64A 3OZWA 2AE1A 1ZBDA 3T5BA 4C4YA 5CFPA 2RGBA 5M29A 2PV7A 3AB8A 1P1IA 1ZGCA 2QTFA 1M2OA 4HX2A 4HMQA 1RJ9B 2C5LA 4ENSA 1BS9A 2PNJA 3RSHA 3CUYA 5ALVA 3GJTA 5HA5A 4W9NA 4A8JB 2DERA 1RI3A 4L85A 2Q6IA 4RAQA 1PZHA 3SK0A 4HBGA 2ZCUA 2OZKA 4GI3A 4PGGA 5GQSA 4JVLA 3CVXA 4B9EA 2FHPA 2B1JA 4MVJF 4Z99A 4XUCA 1ZY2A 3E3MA 3NASA 4N0DA 4F6CA 3CMMA 5A1TA 3FSEA 1FC0A 4FK8A 4IJMA 5A06A 3ZDXB 1F60A 1L4LA 3QKSB 3W4KA 4GMHA 2IZ7A 4RS3A 3KAKA 4HDCA 4JLVA 5TT1A 4R68A 4AG5A 5F1KA 4F4DA 5K0JA 4BLQA 1ABBA 4KI7A 3DDOA 4XZ3A 2FE4A 2NZJA 3CVYA 1DC5A 1MEJA 1NPDA 3GXBA 4DXDA 4AP9A 2ZRKA 1RPJA 1SUEA 1VJGA 2O3JA 3ELDA 1R4MA 4EYSA 3OTWA 1ZH0A 4LPKA 4UD2A 3VPSA 4CMEA 3Q6MA 3AUUA 2W22A 4FQ8A 5AW4A 1T29A 2DBYA 5TMDA 4MRMB 4TXNA 3K70C 3TLCA 4QA9A 2JW5A 1NUAA 1AQ6A 3GLSA 1CERA 2C2MA 5IH3A 3ZD8A 4GKKB 3ROPA 4AN4A 4YMUA 3T5DA 1G17A 4GBGA 3IQIX 5EERA 1M1YA 3TJMA 4CM6A 5TX7A 1DIRA 4C0XA 1TJYA 1N8SA 1TM2A 3VJKA 3HKCA 4KKXB 3F6BX 1NOJA 3IDFA 1IHYA 3U3MA 3MUEA 1RYEA 3HJUA 4RIEA 2VDRB 5CFQA 2ZJYA 1SC1A 5BSVA 3OLCX 2PCJA 3MMPA 5HR5A 1YBAA 2V7XA 3L6RA 2RHBA 4HH4A 5HS6A 5L40A 1KR2A 1FPMA 1BX3A 4DN6A 1X1AA 1C81A 3LDUA 5HS4A 5JCOC 2R60A 1VA5A 1G5PA 1USKA 4BNUA 2I2CA 4WA8A 5BN4B 1QFYA 2BE7A 2XGOA 3DAHA 2BEWA 1IBSA 2D5LA 2BEUB 2WE8A 5REQA 3RS4A 1JFFB 2CMGA 1EIZA 1D2AA 1NWHA 1CJUC 1ISGA 3RRZA 1J21A 2AI3A 4JEMA 4Z51A 5C8ZA 3Q3HA 1V96A 4CGZA 2OTCA 2Q0XA 5BNFA 1TUBA 4BL5A 1P1RA 2G1UA 4B9AA 1Q14A 1CC1S 4II3A 1GTSA 3PGA1 3M2TA 1X3SA 4AYXA 3W5AA 4PLYA 3KUUA 5JPIA 4TKZA 4PY2A 2AWOA 4O2BF 5AI0A 1QGOA 5FUBA 1ZZEA 3BZUA 5J40A 3X1YA 3BORA 1C7IA 2XHZA 3TOZA 2FHSA 3E5MA 1NP3A 1BFUA 3H9QA 2D7CA 2C88A 1ZR4A 3DMTC 1JR6A 2GAOA 2RHJA 3W6ZA 4A1OA 2W00A 4J91A 4KXLA 4RMIA 4MKIA 4ND3A 4ZEWA 2BHRA 4N3AA 2LGJA 2NWQA 2PYIA 1YZNA 4UHHA 3CUVA 5HFJA 3RWOA 3WWZA 4ND8B 4WJZA 1YUNA 2VHJA 3CU5A 2FWIA 1U2DA 3B1XA 4BNJA 4BO1A 1K4KA 1W25A 2WT4A 3V4VB 5CB4F 2ZBRA 4MKGA 4WKBA 3VI3B 1P5ZB 1L4UA 2J6HA 3HZZA 2I1VB 3IKVA 2JBWA 4W99A 3AVTA 4DA6A 2NUAB 1TAGA 2BY4A 1BWQA 2NZ2A 4XXHA 2OPHA 4R2XA 5KB3A 2RD2A 2OZVA 4PXYA 1XWWA 3P97A 3W7VA 2YNMA 4DC9A 1CJMA 4NTZA 4AMBA 3GEPA 5AM4A 4XDZA 3USCS 3K9LA 3W8NA 3KVOA 4KQCA 4LVNA 1XZQA 3VZPA 1L5HB 3FBGA 2D1QA 1X42A 3VNVA 3ZCPA 1R27A 3ABRB 5FPYA 2Y1WA 3SLGA 3T38A 4GGOA 1CUEA 4YCBA 2Z83A 3B48A 4QU9A 3I12A 5CA1F 2Z4RA 3PD1A 2JLCA 3V9PA 1P1HA 4PAOA 4RA6B 4CG0A 5K01A 2ZE8A 1KBOA 4QUAA 2JLUA 1GR1A 5EIBD 1SWVA 5HCUA 2JGIA 2ZTMA 1X1QA 3BREA 3R6WA 4LC9A 1Q92A 4HX5A 3RADC 3JVVA 1WULS 3H2BA 5GJWC 1RFGE 4ESEA 2EW8A 1KIAA 3SHFA 1JIQA 5T4HA 1EINA 1QF9A 3DHVA 3URKA 4U2EA 2Y93A 3LCCA 5IJ0B 3L02A 5JAHA 1TQHA 3M5DA 2ZRPA 3WGLA 5FEUA 2BFEA 3RCBA 3IUEA 3N8IA 8MHTA 1QTNA 4CIWA 1KVRA 5JHGB 4V39A 4K9OA 4LFAB 1MT3A 3K3PA 4JFAA 3RVSA 2J3MA 5FLKA 2R4TA 3P9QA 5FOVA 3SMVA 5BOSB 1NG9A 4Q82A 4OOFA 1QOQB 4BJ1A 2R751 1KDYA 5K8CA 5DN9A 3PEYA 1KERA 3P0HA 4OFWA 1RYBA 3QKIA 1VB5A 3SXUB 1ZHHA 1RAAA 1GUFA 4KR2A 1M83A 1Y42X 1YJCA 2JFPA 3H5IA 1TQ6A 1KSGA 3E84A 3SLRA 2GJSA 4DMGA 1FSPA 1O5TA 4YUXA 2N42A 4DC0A 1L7VC 4B44A 3BICA 1F1BA 4D4KA 5FEMA 3EULA 4XR4A 2C2GA 4Y0VA 5A3SA 3JSXA 1Z4NA 2OCKA 4J1TA 3VM6A 2Q4EA 3IRUA 1YGYA 2Y71A 4M7WA 1LPNA 4HR7A 4KGVA 5KNDH 1HGXA 4Y8VA 4LF9B 4OA8A 4B4KA 4CUZA 5KVCA 3VSDA 4OI4A 4MUEA 3RNOA 3HCBA 1TVKA 1JW9B 2V7GA 1Z2CA 5DRTA 1F06A 4IWXA 3BA6A 5GY7A 4DZRA 1JSCA 5B1YA 3GFRA 1DL5A 1S2IA 3IIEA 3OQNA 1S5PA 1Y1RA 4JGGA 1DRJA 3VC2A 1FFDA 3EXFA 3N0TA 4KQIA 1D4FA 3I6YA 3D0OA 3PEEA 2PGOA 2WFZA 2IX9A 4FYVA 5C34B 2ZBPA 4LY6A 3IUBA 3K0FB 4PR3A 5ALTA 4PIMA 1I2BA 1N5MA 1A5TA 2O3QA 3GN2A 4FVTA 4L2IB 4M0CA 3VOBA 1PGJA 3M6VA 4Q1BA 2N3ZA 2VRNA 2K4MA 2OAEA 4I81A 4WZZA 2JLBA 4PHTA 4DMRA 3GLVA 3HL4A 4K81B 3BAFA 4MRPA 1VPEA 4RFLA 1OBHA 1YZVA 3ON5A 4LPSA 4M7PA 3FPJA 4J4TA 4P5DA 4WZAE 3RAPR 1V7ZA 1Z12A 2GK3A 2HTFA 3K8QA 3IJPA 4I4TB 4Y1RB 2A4KA 4K9SA 4KMMA 4RSRA 4AY5A 1XIVA 3H16A 3I9KA 3V46A 5AXBA 3X43A 5FLYA 3GNTA 3S8YA 2GA9A 4IS3A 4LNUA 2FMFA 4DZZA 4R6WA 4JLKA 3ADPA 3OUTA 3TW0A 5LZ9A 2IW1A 3ME5A 2ZT6A 5C80A 4M9XA 5ADVA 2H3HA 4DLSA 1JXOA 2VQ3A 3A9SA 3SDBA 2LDBA 3A2KA 2JKVA 3LUAA 4BN5A 1CNEA 2Q3FA 5TMPA 5HQ3A 5G0VA 1RRMA 1NLFA 3DBHB 1CR6A 3FCYA 3EVGA 3M4JA 4S2UA 3HU5A 4BZWA 2EKBA 3RUEA 1JIIA 1M2GA 2HLDA 3CRRA 3UH1A 4KPUB 4BU0A 2QRMA 2I78A 3DCYA 3E35A 4O4IA 1HDGO 4MQEB 1QGAA 3RYFB 4JMPA 4JXJA 3OOJA 4RPHA 4BCCA 1N2JA 2ZXUA 1JTEA 1JALA 2H65A 4HLQB 5AHRA 3WBFA 2Z4TA 3DJFA 4ENUA 1JEYA 1H0RA 3FYUC 5P21A 4U8HA 7AT1A 4MQ6A 3ITDA 1S2NA 2PUAA 5DF1A 2A92A 3GRVA 2IS6A 3GJ3A 3ZBTA 3B36A 3STTA 2CLHB 2LVBA 2IOQA 4LJ6A 2LPMA 4L72A 3UFBA 4L5YA 3JZAA 1KSFX 3UGQA 4EGQA 4FILA 3F4BA 3TMAA 4EHHA 1TU4A 5EHNA 3EEOA 1XMQB 2Z6AA 2SKCA 1ZDMA 2E5WA 1YJAA 4NBWA 4P2GA 3A6HA 3EDCA 1M1NA 1AY0A 2PH5A 2ZDGA 1O03A 1VYVA 2VPPA 3QUAA 2WSIA 2FVXA 4N6NA 4NSNA 4Y98A 3WWPA 2DLCX 4EUSA 4CM8A 4JS0A 1H2WA 2HCTA 2NP7A 3B3JA 4RU1A 1YB6A 1ZM2A 1E1CA 2CB9A 2ZPUA 1DAIA 3F6EX 2OCYC 3NW9A 1DAEA 1G21A 2FZ4A 3L7YA 4C5CA 3OCCA 2CUNA 3E1KA 3GLGE 2W2LA 4DR3B 5EEGA 5G1PA 3JQ8A 4YIHA 1EJBA 3I0ZA 2NV2B 1USVA 3LC1O 4PFJA 3SVLA 5C8YA 1OXKB 3CJTA 1QC5B 3HYRA 3FWPA 3KXDA 2X5JO 2KBFA 5EZYF 4Q1FA 1YRAA 5B2EA 4K40A 1VB3A 1X9IA 3KSDO 4RYLA 2HUNA 3WV5A 5JY1A 1Q5PA 1MOZA 2WICA 4HSEA 4A2WA 5DMHA 2FR8A 1AU9A 5AIBA 4C0QC 3ISVA 3JYOA 1WP4A 4R83A 2KI5A 2BEJA 1Q12A 2YOHA 1XCBA 2COEA 3WC4A 4JUAA 1ZL0A 4I2VA 5ALMA 1T0PA 1ANKA 5GM1A 4IV0A 2FAXA 5LOVB 3LZ6A 1EX1A 1PJ8A 1S9HA 2DU8A 2FU5C 2BI8A 4V24A 1R0RE 2AYZA 3R6TA 2BZ1A 1UAYA 3P9SA 4NC9A 4CEIB 2AFHA 3C14C 1LB1B 2HMAA 3EA4A 1SGWA 1SHUX 4ZVNA 1D3AA 4BTLA 4G1UC 5KOIA 3FTQA 1RJFA 3QOXA 2QUIA 3CR8A 1GU1A 4JASB 2XNJA 5E6SA 3ZKWB 3W77A 1EX9A 1S6YA 5J5AA 1E5LA 2YWGA 2IRWA 2Q6LA 4LOAA 3MTAA 3FOZA 2B94A 4H6PA 1W7AA 3DV2A 4Q48A 1DQZA 1KMIY 1JKFA 2BMFA 2WSLA 5FR1A 3CKKA 3CN7A 5B3AA 2EF1A 3NGMA 1B1CA 1QIGA 4G1CA 4GPZA 1XFDA 1J33A 3N0VA 4FNMA 3RE1A 4KH1A 4L6IA 4OJNA 1WKBA 2R96A 4FKZA 4X20B 5HRCA 2VKTA 4Q7KA 4ROSA 3PGKA 1FZTA 4XIFA 1VPWA 4UMDA 4ZQFA 3CPJB 2O2JA 4JEHA 1CY6A 2P2CA 4IIJA 4AAYA 2PH3A 4FEGA 3K35A 5TQ2A 1NTOA 1OKKD 3PNOA 1SVLA 3WK4A 3WRWA 4TWAA 4HNSA 1VE5A 3JAMA 1OYWA 2V7EA 5AVQA 3RIGA 4F3NA 1VCHA 4I2NA 4DRZA 3LS2A 3FOEC 2J48A 3D1VA 3E15A 4G65A 4KODA 3MF4A 5B3JA 3H8VA 3WLMA 2R2GA 1WUKS 1WXHA 1I5RA 4C0LA 1XCGB 4AY6A 3AL0C 4HDKA 1YDGA 3SR3A 2Z8XA 4J4HA 1T26A 2XTNA 5E2BA 4BBPA 4DE5A 2NO1A 4R1SA 1NWCA 4CPDA 1T2NA 2MT9A 1Z4QA 5AVYA 5AFSA 3DBIA 1FPQA 4PNPA 1HT0A 4QEDA 5CDTA 2WC1A 3U3KA 2I3ZA 3QSYA 4OGLA 4G26A 1G20B 3G2OA 2H9YA 4CLOB 1NJ5A 4N3GA 1ABFA 1WUJS 3UUEA 3UENA 3VZCA 1EG7A 2VDWB 4Q4HB 2MHCA 5TB5A 4GS5A 2HMSA 3C4JA 4ARAA 1WBBA 1CUAA 1YL7A 2GBFA 2VHCA 2RJNA 3H8WA 3BE4A 3OCZA 4IIHA 1F17A 4MR7A 4L4RA 4ENWA 2IEYA 1YB4A 2FZLA 4OKNA 3AMVA 3LECA 2O3SA 1RCTE 3NP7A 4Y7DA 1DKUA 3KSRA 1M74A 1VE7A 2WG2A 5CUQA 5JWOA 1VLQA 1Z7WA 3EK2A 4L9SA 3VPGA 2H1FA 1ENYA 3JRNA 2X4IA 1UPAA 3R40A 5H80A 1G8JA 2Y1GA 4D74A 1PK8A 2YL2A 1Z0KA 4G0PA 1Y1TA 4CLEA 1HTWA 1A96A 1YFKA 2R86A 3TFQA 4YFYA 1KOFA 1PNTA 3FJOA 2OD7A 2O0MA 4ZVTA 2OCXA 1P19A 4U5XA 3U9TA 5BVHB 4QQRA 2BD0A 4F8YA 4CTNA 3DWIA 4G8BA 5E4YA 3O8QA 3NEPX 5CM8B 2WHXA 1RPTA 2Q4OA 1IXSB 5FUVA 4ZRNA 5MGNA 1PTJA 4ITRC 5HCNA 5EHGA 2OXIA 3ZXXA 1VMDA 4LF4B 3LZCA 1RRGA 3BJEA 1ISJA 2NSLA 2XDYA 4LGCA 1NN3A 5GADl 4KRXA 1ODTC 1GNQA 2QZPA 4XYEA 1LDGA 1NDHA 1KFBB 4JR2A 2RKOA 4D9IA 4N65A 5JXWA 3NTOA 1D0IA 4YQFA 1EFRA 2I4TA 2QJOA 2Z56A 3IVAA 3R76A 2WNIA 3AR8A 4K6MA 2OHHA 3H05A 3VR6D 4QTXA 1J2TA 1K6JA 4L0CA 4RK7A 1Q95A 3ST7A 2NO7A 1GQYA 1RAIA 4ZMBA 2ZIAA 3ULKA 3TL6A 1OT3A 3D6MA 4WERA 2YTZA 2NSJA 1HT1E 4HH3C 4JC4A 4DCCA 2J3JA 4RPGA 2WWHA 1L7MA 5EAIA 4PLZA 4QVIA 2UUCB 3JR7A 5AVTA 4KQMA 3S2YA 1BRMA 1ULBA 2I7DA 4X44A 1CF4A 3P9XA 2O3RA 1KJWA 2KMLA 2X8WA 1ZBQA 1BRTA 4MQ4A 1P2VA 4MUKA 1OZHA 2EKDA 2ZAYA 3W78A 2GPNA 4Q1AA 4R8SA 4EAAA 3H0CA 4KSCA 4E70A 4DT1B 4QJ4A 1AVTA 1AQLA 1YJBA 1U9JA 2NTEA 2BV3A 3ZNOA 4R3UC 1N2IA 1GUDA 3O4HA 2WIDA 1ZISA 3QFTA 3D3EA 3ZGOA 1T5LA 3ER6A 3VR1A 3UMYA 4WAUA 3KXPA 1GPYA 2ZTHA 1PE0A 5KTPA 2QKYA 1N2GA 1MH1A 1TB4A 4U7GA 3SM3A 1E2NA 4CM4B 2R8EA 2MMGA 3Q9LA 3HLKA 4X54A 5FOSA 3BGDA 5EHXA 4AMYA 2XE7A 4P4UA 4JP3A 1UKCA 3NC4A 4MARA 4TYWA 3PLNA 3RGWS 2WV9A 3SEZA 1L9XA 3U16A 3TKYA 5F78A 3GJZA 1Y8QB 4Z0TA 3G7SA 4D9EA 4AC9A 1EUCB 1ZGGA 2AG6A 3DNPA 4WASA 5I51A 3MB5A 2IK8A 4B5LA 2XYHA 1TPYA 1YUMA 1Z4IA 2CVFA 5AHXA 5ALYA 2R47A 3ROXA 3QV2A 3O7MA 4RD1A 3EIHA 2JFHA 5DI3B 4HWTA 4MUNA 3TPFA 5JR3A 1T3TA 1K7CA 4D9JA 2FPUA 4IINA 3HVKA 1L7DA 2OCDA 4ZWNA 1TA0A 3E9CA 3KQYA 4W7IA 5FI0B 4AS2A 5JJKA 4UQPA 3KYCA 4AICA 4DAOA 2GVNA 4IGFA 1C3OB 1W2GA 4EJMA 1E69A 5L3QA 2HMTA 2MYNA 4AROA 2YKGA 1EGVB 4TXLA 1UAAA 1II8B 1JIKA 1HYGA 4OJTA 4UM5A 4YJDA 3ZQUA 4B3SB 2CN1A 3RIHA 1AV6A 5LFAA 2CWDA 1X7DA 1KE1A 3OEHD 5KU1A 3T4PA 3F1LA 3UW1A 2FFRA 3WL3A 4B3IA 5ICGA 3IAHA 3PQFA 3DE6X 1P4GA 4GUAA 1RQRA 1LLCA 2LZ0A 3C3JA 3GEGA 3N7UA 4PAMA 3ABQB 1ILWA 1EDEA 4C4PA 1TFRA 4EA9A 3TIVA 3L41A 1YB2A 4Q7QA 2FPGA 1Z47A 5KYXB 1U5CA 3VOAA 1GQFA 3STHA 5KWEA 3LQYA 4O08A 5LXTB 1CD5A 3EIQA 3DFKA 3K8OE 4URUR 1R0LA 1OH7A 1Z22A 3TOXA 4RIIA 3EHDA 5FLXA 3K2BA 3AXTA 4YTEA 3KSUA 4B32A 1DKMA 5CA0A 1COWD 3MXOA 3FR7A 5C0OE 3NUGA 1U2RA 4S05A 3NBAA 3WL6A 2NN3C 4EHLA 3A4NA 4YCSA 1JEQA 3D4BA 3MCAA 2FQQA 2Q99A 2VRBA 3DG9A 4LX8A 4IQ4A 3PDHA 2IZ5A 4ZPJA 2OKCA 2ZYWX 4R2IA 1OXMA 1V7QA 1OXVA 3BJMA 5MN6A 3UMVA 1V1MA 2VPTA 4K9NA 4D41A 3Q5DA 1CB0A 2J45A 2PMFA 3HC7A 4J3NA 4ZAVA 2G17A 1U6KA 2R8YA 4FCWA 4XVRA 1HORA 1R9NA 4ID3A 5K8JB 1IPFA 2ZIWB 3WDMA 5JI2E 3P4XA 1E3JA 3R0QA 5DLQC 3DJYA 1C9EA 1FJ2A 4PQGA 5KX5A 3ACCA 2CNBA 4Q00A 5BR4A 5JXGA 5F9FA 1YDEA 1ZM7A 1UC4B 1NFQA 3LBFA 1H65A 1E0JA 1X87A 3QEMB 3PUWA 5BMVA 5FI3A 1P39A 1USGA 3AUTA 3CLKA 4TQUS 1VRWA 2NU6A 3UOGA 1TM7E 3F2VA 1MLDA 5C46F 1XEFA 2Q3EA 1MAVA 3G2PA 2QM0A 4FHDA 5IM5A 4MI9A 1UKVY 4L7VA 3V2UA 5DASA 1XAIA 5J2TB 4LKOA 3H75A 1V8FA 2Z98A 5DCYA 3G0BA 2O8BA 1JP7A 4MEBA 1KBQA 4HQKA 1TVEA 2A1TR 3O73A 1E6WA 2PR2A 2OGTA 2P6OA 3O03A 4MAFA 3ZWNA 3H8JA 4EKDA 4BX3A 1QANA 3PUXA 3QTLA 2DWOA 3E03A 4NONA 3ANSA 5SYAA 1HKHA 4BX2A 5ITWA 3GPBA 3I30X 5FBQB 4RJTA 2DWCA 2E4VA 3X1DA 4NE7A 3RH0A 1NPTO 4HVAA 2GEVA 3W3AA 3DPIA 1MOPA 2QEQA 4JSYA 4RVSA 2PRKA 3IP6A 1G60A 3GP5A 4Y6LA 2X2EA 1J70A 4BFLA 3DNMA 2YHBA 2Y1OA 3SX2A 4CLHA 3D6NB 2DFVA 4R9UC 1PRYA 3ZC3A 1PZXA 2OBFA 1RD4A 2ZS8A 3L0BA 3E53A 1RXUA 1VG8A 3PWSA 1GFIA 4GRAA 2GEFA 3P52A 4HWRA 1NU8A 3ICOA 2A2ZA 2V03A 2L19A 1HDCA 1DWQA 3RVDA 4X8MA 1RZVA 4RQAA 2H2AA 5LN1A 1ODKA 4FZ3A 3G79A 4UEQA 1ZI8A 4D3ZA 2AR0A 4JVNA 4HWKA 1JR3E 3GCDA 2B9VA 1L5MA 1NY5A 3K0KA 1MIHA 3NFYA 1KMMA 3V2IA 3VOTA 1Y63A 3PDIB 5FTJA 3K30A 3WYAA 4B73A 3UWKA 2F43B 1XMJA 4AKIA 3BB3A 2UYYA 3DC7A 3RI3A 4U7HA 3P0IA 4E21A 4F38A 1J1IA 1WF3A 4G1EB 2X9GA 2ZR9A 1DEXA 1T5TA 2WYWA 2IEGA 3AKCA 3B1WA 3OAAA 4IY1A 3V3KA 2Y1FA 4TWZA 3GRUA 1XDWA 4C0SA 1PGQA 2BKVA 2VYND 2P62A 1UH5A 1W8DA 1WBDA 5IHPA 3EZ2A 3UJDA 1S3SA 2OLEA 3HMQA 1QB8A 1MJFA 2C2OA 4D56A 1HG0A 5MFZA 3BB1A 4DV3B 4LN1A 4D0GA 3RT9A 1E0AA 2MSDB 1NKVA 1JBEA 2IHZA 3BIWA 1UFRA 4GPBA 5FHRA 4Z0PA 3RTDA 5EJ4A 1LDBA 4PHHA 2PL9A 1Q0ZA 1SKAA 1FMCA 1GCGA 1GZVA 4JHXA 3R7LA 3AESA 2RHHA 1RJGA 2CLSA 2HV9A 4M8LA 4YRZA 4LZAA 3RRFA 5I4CA 1I7QB 1P7CA 4JUCA 1IMOA 1S8AA 2BGRA 4AO6A 1T36B 2Q0QA 1ESCA 2VC2B 5A5GA 3OCUA 3WGQA 5AKGA 3H5TA 2JIQA 5KCMA 4ZGGA 3FGOA 1MXHA 2V8BA 4E4YA 4G07A 2R0QC 1KZ7B 3TW8B 4WPGA 1UJ4A 2A0XA 3DXXA 3C70A 3PZRA 5AMXA 3SE7A 2YMMA 3KTAB 3F4KA 5IDVA 1HO3A 2POQX 4HH0A 3VTAA 4PLCA 4NYMQ 4IH4A 4MITA 2UZIR 3MGBA 1Y8CA 3AFHA 3BD8A 3EGIA 1P81A 3GZJA 4PGFA 5E6RB 2YBEA 3BT7A 3KXIA 3RS7A 2FMUA 2IDMA 2PL1A 4FZ5A 4E32A 3RBZA 4Z7NB 2JHFA 1JHAA 5H3LA 3OZ7A 5LOVF 1ZD9A 2PGXA 4XWYA 5JS7A 1YS4A 4A9AA 1H69A 3RJZA 3UJ8A 2C4VA 1NVDA 1TMGE 1BCRA 3CS3A 4M38A 4BVGA 1M5RA 3H9GA 3LO8A 3M6LA 1U65A 3MPUA 5HBGA 3U62A 3ODGA 1GRNA 4BP3A 3D3NA 3C5EA 3LUHA 1A2KC 3S55A 4CMIA 1JILA 3I3SR 1HOXA 1ZCZA 2QD1A 4LJYA 1X2BA 4UEOA 4FYMA 4JXXA 1P6XA 2APJA 1ILEA 3QLJA 1WSWA 3ZWAA 2D1TA 2WFLB 1S2DA 3M3DA 1WG8A 5FWYB 1QHEA 3ANYB 3D5QA 1W2WB 3JYNA 4X1IA 5LZ2A 1ODIA 4D5GA 3NAZA 3VUEA 2IC5A 3QWAA 3MCUA 3PPIA 4RD2A 3ZK8A 4G4GA 2AI2A 2J6IA 5ESWA 3SYKA 3RKRA 5M3BA 3W6PA 1AH2A 3DAFA 4LCEA 2ZATA 4A91A 2WA2A 2ASEA 1JU9A 2GEJA 4J03A 4YX9A 4XB1A 2J3KA 4Q01A 2IYLD 5EHQA 1RWKA 4ZT2A 1V8PA 3KQTA 3P1JA 1CQZA 3EF1A 4MS3B 4DG9A 4JB8A 3HRKA 6ABPA 3NHUA 5KYKA 4PR0A 3WLIA 2PEZA 4IKEA 5AK0A 3SLKA 3A11A 4B3GA 1ZOOA 2Y67A 3LNCA 4BJ6A 3E9MA 1Q1EA 2N0SA 5D1HA 3F6PA 1J00A 2GDZA 1HDRA 1TIBA 2AJCA 2JFGA 3OWXA 4J3JA 4KXQA 4XWTA 4C87A 2YFHA 3RANA 4NCAA 5DHRA 3L18A 4HBZA 3CH7A 3H4MA 2IT1A 5HJ7A 1NKSA 1KC3A 1Z0SA 3BWYA 1RM0A 1XUOA 3EGXB 3CPHA 3L6EA 3LGAA 2BUCA 1BMFD 1DS6A 3PRYA 1RPZA 1OTXA 2OO3A 4QJBA 3PYLA 4XPIA 4EABA 2FPRA 1DZ3A 1JB9A 1C7RA 4LYEA 1CY7A 4TLMB 3EXAA 4Y2YA 1Z0UA 2BMVA 5B7PA 4AKGA 1MQAA 3QBTA 1GNRA 1X7WA 5AIAA 2QK4A 4BO9A 3C24A 3KT0A 1TT5A 3D81A 2B5OA 5D86A 4AX8A 5JZSA 1F9EA 2JC3A 1NUUA 1TVMA 2M32A 3EZ7A 3Q7QA 4ZP1A 2W6MA 3QYJA 1K2VN 3KD2A 1N2HA 1CQJA 1I2AA 2H7CA 3WSWA 4B48A 1VHQA 3R74A 5EUBA 1BTOA 1J22A 2RI6A 2PLFA 2GT1A 5H4GA 4WGFA 1JKMA 2FXVA 5ECYA 4BZQA 3G9XA 5HZMA 4MUGA 3RKUA 3E9NA 3NRJA 4OMFG 4B80A 2PUVA 4BUJA 3CY6A 3MMNA 1Z33A 2QL7A 3MTBA 1U8UA 1XXHA 2BDEA 4RGQA 4UUNA 5JFTA 1KFJB 3KEOA 4PX2A 1M34E 3QOFA 1C3JA 4MUHA 3FYUB 4PVCA 2O8CA 4B7UA 5TPWA 1XMIA 5DLDA 2OECA 3E3NA 3OM9A 1EVZA 4Z86A 3BWMA 3CLHA 3H83A 4RADA 4BFCA 5B36A 3BWDD 3OX3A 4B3FX 2QMOA 1GVHA 2QJRA 1V4VA 5ALFA 1S0UA 2J3EA 3KYIB 3JASB 3CA8A 3D6JA 1XEWX 2EHDA 4FE4A 1HDZA 3C3BA 1KNXA 1AUPA 2A0UA 2FG6C 4A73A 3PDUA 5CCXA 1USUA 4EQ6B 3NPAA 2W6JA 1KY3A 3TVDA 2NW6A 3FPEA 4KQWA 2XA9A 1GOTA 2GPTA 3KFLA 3QYFA 4DIFA 1NV9A 5JCJA 2UZ3A 1ORWA 3IKLA 4GYJA 1L6IA 3E4CA 3ESYA 5DXAA 2P9JA 3FDZB 2JLWA 3KPUA 3NWJA 1GYQA 4HYEA 1XALA 2COKA 2FUG1 3OIGA 1SHLA 3PZBA 3W04A 3FF1A 4E3ZA 1BOFA 3KB6A 1Z25A 4OKIA 2VHUA 2RIPA 2WD7B 4YI5A 4DFDA 5K3OA 3N87A 1NMZA 1QTQA 3LPCA 5HIMA 4NJEB 3G7UA 3WYDA 4GAEA 4DA4A 5IZCA 3N7AA 3WA7A 1OFGA 3O1HB 1XZLA 2ZUTA 1VBMA 1A3CA 1DADA 2NXEA 4O8ZA 5LNK1 4UMVA 4LOKA 2CV1A 1HOTA 1GYPA 2LCFA 1FFWA 3FI0A 1CEYA 4WKNA 2J32A 2DPMA 2PGIA 1VE9A 2H85A 2QM8A 2A14A 1G55A 3FDXA 3IE2A 4IJ6A 4MW6A 3RBXA 5KNDD 4GYYA 3G9TA 3PXEA 1BW9B 1UP4A 5LKAA 4Q3AA 4Q7EA 1EFHA 1KOJA 3GRRA 4I66A 3CGGA 5CJ2A 2H2WA 4XYMA 1H2XA 4UVIA 3WVNA 5ALDA 1WPXA 3VU9B 4JLBA 1FYWA 3BCUA 1ISPA 5AO9A 3B6JA 1RT9A 4I8DA 4LSZA 2YASA 4XM1A 2FUEA 4HTFA 5WRFA 5HMMA 1SR8A 4IW3B 1NI4A 2ATXA 2YDYA 2OHOA 4TVOA 4F2WA 1RE0A 4UTRA 3NLLA 4MDYA 2PS0A 1GDDA 1T9ZA 1UWLA 1H1TA 1BHO1 2JHCA 2RMKA 4O2AA 5AW5A 5CEFA 3C3XA 1TGYA 4RXTA 2XA1A 1F2TB 4INOA 3WIEA 1UZLA 3GYBA 4GKBA 3NTLA 2PA0A 1JQBA 2JGFA 5EXXA 1W4RA 1YA8A 1UKAA 3HDGA 3R7SA 4B3TB 5LQJA 2ZJ1A 1MEOA 2QR3A 1ZGHA 2RKWA 2YQZA 3TE6A 2CLLB 4BLOA 2AVNA 4PAWA 4PG8A 4Q37A 2WM8A 4YJHB 3DL2A 4JA0A 1NVBA 2QRKA 3NHWA 3GEBA 2XBUA 4M1SA 4AZTA 2VP9A 4HNAB 1CIJA 2PJRA 3ESRA 3IDAA 1W4BA 3GEHA 4JKIA 3ADOA 4R9NA 5GZ6A 5HDQA 1X77A 1YVEI 1H4QA 4X1YA 3AR7A 2QVGA 3ASUA 4HVCA 4RTPA 4QUGA 4LIPD 1Z4JA 4QO8A 1NVVQ 4NDAA 1EU1A 1U8EA 3D7SA 3I9JA 2MYPA 4GC9A 4YP9A 4BO0A 4F4HA 4PPGA 1KYQA 3RS9A 4WNAB 3V34A 1HQDA 2V7VA 1JHUA 2XCTB 1UIMA 5TNXA 1OLUA 4IH9A 1DCTA 3DL0A 2YZGA 3OE7A 4JT4A 3AEUA 3BTUA 3L4BA 1IJEA 1FLVA 4BFZA 3RS5A 3V8RA 2FCRA 4R7TA 4EG6A 2NLOA 1AF7A 2BGMA 3ZHUA 4DDHA 3DLBA 1T6BY 4GI2A 3OBBA 1VL5A 2X0JA 3GVXA 4MIYA 1ODFA 5DPMA 5LXTF 5IWCA 1C80A 4GOMD 1QKIA 1SAYA 5ICMA 4X5OA 5CHEA 4HDSA 3JRWA 3SG0A 2OYRA 1UBCA 1Z8HA 2XZDA 1ABEA 4M55A 4I9HA 3AP2A 4NICA 5E4JA 3IPRA 2GX6A 3ZHOA 3C6KA 1V6SA 4XDHA 2OP1A 3BK7A 4UARA 4X3CA 1QQ6A 4KOAA 2XUIA 1O77A 2OG2A 4HK4A 5DISB 1KJNA 1UP6A 2H4HA 3DZJA 4QARA 4BMZA 5FH9A 2V6MA 4GXNA 1HDXA 3BN3A 1K8YB 2FG5A 3OQ6A 1WDWB 2GN9A 3RYCA 2C5HA 3F49S 3HO8A 1QH1B 4L4UA 2EAUA 3A9WA 1VJRA 3H5VA 2A33A 5EQFA 4JOSA 1C7EA 4YRJA 4RF3A 3PDJA 1X3LA 2WHEA 2CLIB 3C1AA 4KEAA 4FM9A 1J2EA 1KI6A 1CE8B 3R5FA 4MVWA 3TUZC 3HZHA 2YJ3A 4TL9A 1Z0FA 4M1TA 4TWRA 5CH8A 4AY3A 3AIOA 3H13A 5DNEA 1G8YA 2CHEA 2BI4A 4INAA 4FMDF 3NHRA 3L40A 5F1OA 3LPAA 1PEDA 1VLHA 4Y67A 3R7WA 2GXSA 1Y6RA 2ZWIA 2QWXA 3D3WB 3EQ8A 3GVIA 3GYGA 4JH0A 4KO3S 1GZ5A 2J0VA 3U44A 1QV6A 3QNWA 1GXSB 3OBIA 1I3CA 3JQAA 3K5PA 2P9CA 1GGHA 2VTVA 2LNDA 3KE8A 5FNVB 2GD0A 1D8TA 1PL6A 1QF6A 1GG8A 1SEVA 5JSZA 2AGVA 2D1SA 2OFXA 3AETA 3WK5A 2GYWA 3WRXC 2BCGY 1XI2A 3IE1A 5J2TF 2L82A 5CD1A 3EPKA 3B20A 3W6OA 3IIKA 1H9BA 2BGIA 4OKSA 1D04A 1E2JA 1DMSA 1R37A 2HK9A 2D2IA 4YECA 3VO2A 5A9SA 3QSGA 3EC1A 4MPTA 2REBA 5UKDA 2O6HA 3KQNA 4AP6A 4ZAFA 3PX7A 2JJYA 4HDNA 1U28C 3I4FA 1QHYA 16PKA 4HOYA 3UGKA 4UTPA 3W3AH 3BUSA 4C5AA 2GCEA 1IHXA 2F00A 5LZ8A 2II6A 3MRXA 1IOWA 5JZMA 2IIPA 1E5VA 1NP7A 1Z6QA 1TJ3A 4OGKA 1SZPA 4ZYZA 2G9VA 1LSSA 5CIYA 1U7ZA 2ODPA 1LVUA 2X19A 1DPGA 3OTIA 3TE7A 2VSXA 1SK8A 4CMBA 1ZD5A 1ZFNA 3E7DA 2XDWA 2O1XA 3LXMA 3L0PA 4GIBA 4O0MA 4O3FA 1T0BA 4R1TA 5TGZA 4MKHA 3A14A 4K0RA 1JS1X 2C58A 3HI4A 4MR9A 4NY1A 1PYOA 1RXYA 1XRSB 1FY2A 1XU7A 2AFIE 2VATA 4I6JA 4PZ0A 3T12A 3FB4A 4DMCA 2PZKA 3BQNB 4KIGA 1WOYA 3IDZA 5SZHB 2WNHA 3C6ZA 2CUZA 4QTYA 2W2KB 2WZBA 1U8ZA 4UE3S 1R5BA 2DHDA 1NC3A 4JODA 3MEQA 1WHSB 2AMLA 3F5QA 4H0CA 5FOUA 3W2GA 4BO7A 5AM0A 4ZT3A 4EATA 1STOA 1UZNA 4P93A 1VZ3A 1L4NA 5BNIA 3EQ9A 1OCEA 3OOHA 3PKIA 2CUKA 4CNQA 4DMMA 3F47A 2I91A 1CP3A 3AKYA 2G5CA 3L7KA 2QAGA 3CLTD 3JALA 3P9PA 1H1LA 4QDXA 5U4QA 3RJ5A 5F2NA 1VCIA 1DBPA 3L82B 4D82A 4P7FA 2IEAA 3IOCA 3JWIA 2EIXA 4EDHA 4GOOD 1X38A 1Z4LA 3MCTA 4ND4A 3D6VA 4IIEA 4Q3DA 5CDYA 4MDFA 2F8TA 1F0KA 3EOAI 4GMKA 5CURA 4F2DA 2BH9A 4R01A 4Z7OB 3NIFB 4B3XA 1ZOPA 1PWHA 1Y5MA 5IAEA 5LIRA 4YS6A 3ZD9A 2XRYA 3NALA 1GCOA 5F51A 2O0HA 1FS5A 3SXPA 3WK8A 4MP6A 3FPSA 4YXWA 5LB4A 1LLDA 1RCFA 1VYHA 1G7CA 3IHLA 5BP7A 2QBYB 1GZHB 1ZS9A 3QWBA 4X1KB 1OX4B 1P0CA 4ZHSA 1W88A 2O8DB 3HB9A 2CEKA 3EWSA 4OB6A 4QDTA 1YF3A 3GFQA 2VWHA 3IP8A 4Q24A 2P68A 4E12A 4TRJA 2IP4A 3ROQA 1FQWA 3CH4B 2FRXA 3N0XA 4BIIA 5AVWA 5CXUA 3QPWA 3HV2A 4L76A 1U94A 1CBUA 1GUYA 1K63A 2ZJ2A 1VJDA 1D5WA 2X3UA 1RRKA 2GAAA 3N8HA 4CQMB 4QULA 2HGSA 1E4OA 3FZGA 2PS1A 5CIQA 3OICA 1Q21A 1L1QA 1EFAA 3X2EA 2ANBA 3ZZ1A 1DRKA 4F6LA 1R4ZA 5KOHB 5IM4F 1YHNA 5I48A 2NU7B 3GCGA 4LHEA 2UZ1B 1KRWA 3A1FA 2VNSA 4Q12A 1RC8A 4EYKA 1XVIA 4NYJR 3A0RB 1M9NA 2ZOSA 1PFUA 2ZWPA 4PX3A 3B7PA 3DWEX 3MNFA 3ZDEA 4RH1A 2G28A 5HFNA 4XA8A 1QO0A 4DLAA 2C8JA 2O59A 3JQ7B 3DLTA 4YJFA 1WVGA 1RI5A 3JZIA 2RAPA 3OZRA 3NC1C 3Q6NA 5YASA 1T91A 1J06A 4AB1A 1OTYA 1KFEB 2PZ8A 3FTPA 4C2UA 1PJSA 4EMTA 1WZ2A 2WR8A 4RLHA 5L4NA 1RP7A 3FLMA 2W2MA 1F7VA 3VA7A 4EHJA 1G5QA 1J7KA 4M99A 5JWHA 3K1AA 5IDYA 1Y80A 1A5AB 4OQMA 2JGKA 2WD8A 1Q7TA 4O4HB 5KOJB 2J3HA 3DHWC 5CDHA 2JARA 4RKWA 1TCBA 3DFZA 1O5IA 2CVHA 3N39C 2B35A 1IOZA 1SKYB 5BWNA 1C14A 4ZT4A 1RKUA 2ADOA 4UBNA 4M9QA 3S2ZA 3WGGA 3JD1A 1XZJA 4Z2YA 1L5LA 5KQRA 3RS8A 3VU3A 2PTHA 1A27A 1DOAA 1EVLA 1UDAA 1DFGA 1VSBA 1WVMA 4K9RA 4M0KA 2QJWA 1YR9A 4QEKA 3HWX1 3EA0A 5I8PA 4JK3A 2AOWA 1Z62A 4JC0A 4HHEA 3LDHA 5CNKA 1ZN8A 4G84A 4N41A 5LA6F 2GCNA 1SG6A 2CNLA 2OESA 2BZSA 1WSBA 4G67A 4N03A 1QK5A 4PU0A 3VR5A 3ZW8A 2HU2A 5CK4A 2PO5A 4R2JA 4UEKA 5DO9A 5FPHA 1TZKA 2HA7A 3TDKA 4TM7A 4BX0A 2I6XA 4WBNF 2DB3A 4N0QA 6LDHA 2QUAA 3D2AA 2Z6QA 2Y4OA 2PUDA 1DQYA 2Q27A 2W0SA 4I19A 4BXOB 4AJPA 1N2EA 3TQRA 3SIRA 1Q3HA 1AOXA 3TTWA 2RGXA 2JFVA 2DWQA 1ZN2A 1E60A 1KYYA 3MLEA 2LCIA 4MCAA 3FZYA 1MAAA 4W8OA 2F3TA 3TUJC 5LCXA 1GILA 3E0QA 3ZQ6A 5JSUA 4CEJB 3BL6A 2KLHA 1WD5A 6GPBA 2NU9A 1L5WA 4PS1A 1ID8A 2VUUA 3CX8A 4RXUA 4IHJB 3RHTA 1MDBA 1PFVA 3D4NA 4P08A 4YRIA 4DJFC 2V55B 1ZI9A 2CVQA 2I1WA 4Q4AB 2QX4A 5I9IA 1K5PA 2ID4A 2YNMD 4RAOA 5F33A 5ENZA 3AF3A 5EWMB 3W5IA 1NLMA 4KQGA 2WWFA 3PD0A 1T4CB 4EI7A 1KJ8A 3LHKA 3F96A 2XODA 4K87A 1E9BA 1ISMA 1XR3A 4L6AA 4XVQA 2NT3A 3HM2A 3TQSA 3ZDDA 4LJRA 3OCWA 3V6LA 2VNIA 4X00A 1AXEA 4BWVA 3B2NA 3BMCB 4L9AA 1EK2A 3TVTA 3AB7A 1SH7A 1F7UA 1C3VA 1E0DA 1KI9A 1YQQA 4FTWA 3TLKA 5TQVA 3ZNNA 2VDVE 4UHCA 2VPZA 2B8EA 2QXYA 5COAA 5KOYA 1ICIA 4DLXA 2VLIA 2IF2A 3DS8A 3ROKA 5F2KA 1P2UA 2O05A 4EKEA 5SV2A 1OGYA 1SMKA 4P81A 3R9XA 1N2CB 2XT0A 2F3UA 1A4RA 1UZAA 2FEOA 1WPGA 4UW9A 4CTOA 2ZBUA 4FFSA 2GPJA 2QN7A 2QD2A 1ARZA 2YWHA 3MTJA 3WHPA 3KOYA 2XV1A 3EXHA 2B4QA 4MYUA 3HVRA 5HQJA 4JQSA 4Z0HO 1N6RA 2B4TO 4WXEA 1QIJA 3CLRC 4FXPA 5T7BA 3PD7A 5AJTA 4OAOA 5CK5A 2J0QA 1UBMS 2H8KA 2YZMA 5D5HA 4EBFA 2WQ7A 2Z5LA 1JUDA 3ECSA 3CNOA 5GV8A 5J4HA 4M1EA 1UPXA 4F5DA 3SCZA 1N0VC 3LYHA 5LKRA 2G04A 2VPXA 4DBVO 2W93A 3CMCO 4DCJA 4FGKA 5H4HA 3O90A 1Z5OA 2I1QA 2XNDA 4CT5A 2CF5A 5CDUA 2WTEA 4DCMA 121PA 2IZZA 2VO1A 3DQZA 3HU2A 3I9FA 4L08A 4FZJA 1M6VB 1WCXA 2PS9A 3CXRA 1UMBB 1U1EA 2A67A 3OPMA 1EFLA 3OPXA 1IG3A 5BN5A 2QX9A 1Q74A 4IVNA 1EVQA 4TOIA 5THXA 2ZWOA 3QUQA 4IQ0A 1QYXA 4Q4LA 1PT8A 5DV9A 4WESA 1Z6YA 4UBIA 1UMCA 3M1YA 4RTSA 3OZCA 2RFLA 3PX2A 4QRHA 2Z2XA 1D7AA 1GU0A 4DLUA 4X92A 1BJTA 3K6SB 3KCQA 1KJ9A 2XX3A 3N1UA 1A8HA 1E7YA 1TM5E 2HJHA 2QVYX 4U63A 1HBJA 2IHKA 4HGPA 5FJIA 2B4AA 3FRJA 3NDPA 1PEYA 3FWNA 3CPSA 1A9YA 1RZRA 3HK2A 2DETA 3MPOA 3PQ8A 3F3MA 4UNPA 5DP1A 4K28A 4LWPA 5BQXA 5JFGA 3EVDA 1KL7A 5K20A 3MTDA 4NBTA 1MFPA 2BFCB 2L18A 1R5OA 5F9MA 1M0TA 1AQIA 2IYVA 1ZA1A 3BDVA 4IIXA 5IJWA 4RXMA 1O7JA 2G7ZA 1A8IA 3B51X 3ANMA 3U7RA 1GAEO 5IN5A 4NQZA 1QGZA 2GQ0A 4LXXA 4M4SA 1IK4A 1KYZA 3FE2A 4HATA 1AN9A 3O92A 1E8NA 2H1IA 3IP9A 3MWFA 2J1LA 1I51A 1QLJA 2ZUVA 1T9AA 5CXSA 3FWKA 3WG9A 3QLTA 1GZ3A 1V16B 1JRLA 2XHEA 3AXSA 4UAVA 4BEVA 4E88A 4OXKA 4Z4CA 1I0LA 5IULC 5CFMA 1ZM4A 3VC3A 4CVNA 4Q9AA 1G8AA 3ZY4A 3WWOA 3DH0A 2LKDA 1NQTA 4BBJA 2RSLA 2RAFA 4DR5B 1DX4A 2HSDA 1J5PA 2PLNA 2JJMA 1VP9A 1U5BA 2JJ1A 3CWZA 1DGQA 3KTOA 3AFGA 4MS4A 5B5SA 9LDTA 4Z5XA 1HT2E 4ZXFA 3NBZC 5DGXA 1Z8NA 2B4KA 4AZ3B 1EK1A 2DM6A 2HLDD 4ENRA 3PPYA 4ZI2A 3WOHA 1Z88A 3VPDA 3N2LA 4JQOA 4YRPA 5IK2D 2AIRA 4QAQA 1PG0A 1ZLYA 1EHIA 2GM3A 2Y6UA 5FOWA 3DOEA 4QBTA 3C3PA 2PT7A 2YR0A 1OBFO 3IURA 3V7WA 1IAQA 1XLTC 2WTBA 4CFSA 4AQ7A 1W48A 1P6UA 3G7NA 1SXHA 3IE0A 5EP1A 4EYQA 5IPFA 4EA6A 3NBQA 5DK4A 3N28A 3HXMA 2OD9A 1L5GB 1TUEA 2C5SA 2GARA 3A4MA 1ZL2A 3E7FA 4P4LA 3VNUA 3A58B 5TVGA 5C5EA 2JEYA 2DG2A 5LP6C 3TWOA 3OUZA 1P2BA 1N5IA 1NF9A 1UXJA 3AUXA 3QVMA 3LP8A 5B3KA 1KO8A 1K27A 3BXFA 4P7GA 1G64A 3K5IA 4F7WA 3LV8A 1SC4A 1NN0A 4BS9A 1PHRA 4QWWA 5G0UA 5IXSA 4YI3A 2W2LD 3ASZA 4JYMA 5GAJA 3U60B 4I4LA 4B3BA 3WI7A 3FKJA 4BFVA 1PV4A 1N7HA 3VDNB 5LQAA 1OF1A 5CPBA 5G4KA 1T4GA 3EOZA 4M36A 3WAKA 3UOWA 1I6LA 3SSOA 2C00A 4L5CA 1CRQA 5FNVF 2ST1A 4FD2A 1L8LA 1OXBB 4P4SB 2IHJA 4ZYVA 4DIOA 4BLWA 1ONNA 1CDDA 2JGJA 5IRCD 3GW8A 4V0ME 1CJSA 1KQPA 1TA4A 3RVRA 4EUFA 1QZUA 3CV3A 1N1MA 3RF7A 4X64B 1JHRA 4J0QA 3CW8X 3D7NA 3WTBA 5KHLB 2BGWA 4Z4FA 2QL9A 2DPGA 4RS4A 2ZYTX 4Y9DA 5CH5A 4ZDIA 3Q87B 4EECA 4G5YA 1MUUA 4KXVA 3CPEA 1DBQA 3T7CA 3D7LA 4TYMA 1NN1A 4AX4A 1E2FA 3NTQA 4W82A 1SZDA 4MR8A 1E9CA 1W29A 3N2GB 3QXCA 4YGYA 5AYVA 4YP7A 3I6ZA 2ECFA 3VNQA 1AGPA 4FKMA 3PQ5A 1U2ZA 2BEVA 4R9SA 4YUWA 1GRCA 1R10A 4ZAWA 4F11A 1ODLA 3VGPA 3E7WA 3WB2A 1H2BA 1ZUWA 4EPXA 3PXDA 5GJCA 3BG5A 2V0CA 2HCFA 1KHTA 2R3SA 1E2HA 1KEWA 5KMGB 1AX9A 4XGQA 1JTVA 3HHPA 3ID6C 4LHSA 3UH0A 2GN2A 4W5NA 5J1TB 4OIMA 2K7FA 4KXXA 1XVVA 3OO0A 3TLGA 2HJRA 1BMTA 4YJGB 3SKYA 1THGA 1KKUA 2C4KA 2WJYA 1JDZA 4COKA 4QT4A 2YVKA 3TL3A 4HX9A 4H35A 5CG1A 1AA9A 1ZJ4A 3RSSA 2X8AA 3L7IA 4WNIA 3SJZA 4CM9D 3DV0A 1OBCA 2MDTA 5EVJA 3SYTA 1TECE 4EI2A 2YY6A 1CVLA 3CLVA 2BFFA 1UFOA 3B85A 3DE4X 3IULA 3OWHA 4R84A 1O94C 4P31A 3U4GA 4CDMA 3FVQA 4B35A 1E3SA 3CN9A 4M0UA 1XE3A 5DCWA 1IH8A 1KK3A 1ST3A 3U3JA 1JR4A 1QORA 3R6LA 4IG4A 3AM3A 5DCUA 3GLIA 4CQNA 3SZRA 4OB7A 3QF7A 1YR3A 4P3KA 1WB5A 4OJKA 1XQ6A 2C5AA 1U7UA 3G0IA 5L3SA 1WMAA 2PVPA 2P30A 3STXA 2H1VA 3C1TA 1MCZA 1UMDA 3TPCA 2WU8A 3IA7A 4B46A 4DSUA 3KEQA 1ZD3A 4B4DA 2B7BA 3EQZA 3K1ZA 3V3TA