4ELKB

Crystal structure of the hy19.3 type ii nkt tcr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
242
structure length
242
Chain Sequence
PKVLQIPSHQIIDMGQMVTLNCDPVSNHLYFYWYKQILGQQMEFLVNFYNGKVMEKSKLFKDQFSVERPDGSYFTLKIQPTALEDSAVYFCASSFWGAYAEQFFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hy19.3 TCR alpha chain (mouse variable domain, human constan
publication title Type II natural killer T cells use features of both innate-like and conventional T cells to recognize sulfatide self antigens.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 45
structure length 242
sequence length 242
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4elkB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4elkB02
3BGFB 4X6DB 4P2OD 1AQKH 1HIMH 2XPGA 3MRCB 4IOIB 1LQSR 3O81A 4ZO6A 3B6SA 2V5TA 3D3VB 3KYAA 1FL6A 3PV7A 1MFCH 2O5YH 2ADIB 1NANH 5F3BB 1GGBH 2QV2A 1M7XA 5JXAH 3KNBB 2BNQA 4GLRH 5EU5A 5ITFA 3QDJA 1NGPL 4R7DA 3FJTA 3LV3A 5FYLD 1IC7L 4NT6A 1RK1A 2EIDA 1IEBB 4XNXL 3PL6A 4P46B 1EO8H 3CFDA 2EC9U 1KCRL 2I5YH 3IKCB 2NXYB 5DJAB 3KPRB 3L7FB 3MXVL 1CFQA 4PRHB 4KRPC 3QIBA 1HHKA 1AE6L 3NCJL 2VIRB 2E7HA 3LSOB 4NN6B 4Z0BL 2P49B 3QHTC 4V1DA 3OG6B 3SJVE 1CDUA 3CK0L 3LN9A 4PRIA 1QSZA 5I1KL 2FEEI 4BSWA 1H3PH 5HJ3B 4NZRH 1EBPA 1ZHBB 3RL1A 5FYJU 5HGHB 4EVNB 5FYLH 4XCNA 1OAZH 4OCNC 2GJZA 1QVOA 2BNUA 3UCRA 3OB8A 5FIEA 1KCUH 4Z7WF 3V4VH 1U8KA 2VMFA 4XP1H 5D1XB 2VO5A 3S4SG 2J12B 8CGTA 4JQXC 3D85D 4NOBA 5FV1L 3U36B 4TNVF 3KVQA 1G7PB 2DYPA 5BCAA 4Z8FL 2JF1A 4U6VL 1MFAH 4LL9A 4ONOA 4XHJD 5CEYB 5C9JA 3FRPG 2X9XA 4HK0A 2EKSB 4OZGA 1CBVH 3PWLB 2CUMA 2BSED 2OM5A 3IFPA 2ICEB 3OAYH 3PP3H 4GMTL 4C4KT 4NCDA 3VFPB 1N64H 3MRHA 4HH8A 4NO5B 1UGNA 4LQFL 4P9HC 2UZYB 3MROB 3IDMB 2BX5A 1A8JH 1Y6KR 4M4PA 4PTTA 5E99H 5F72S 1K8IB 5JHDE 3VFNB 3O6FC 1VENA 5I1IL 4ERSH 2SEBA 3UXFA 2DJ4A 3ARGC 3GGWB 1F8TL 2PW2B 1MI5B 1L9NA 1F3JA 1MLCA 5ISZD 4PB9L 4IMKA 5E2JA 3CFCH 4HS3B 4NCC2 5DVMA 3MV01 4NFDA 4OF5A 3HLAA 2FD6L 3L3IB 2YWYA 3MLRL 4I8DA 4PJHE 4WI4A 4OLUL 5SWSB 3GSVB 3MRBB 3LPGA 4OI8A 4YNYB 1SBSL 1KPUA 4OBRA 5F7HA 4LGSB 3SDXB 4LKXA 3Q5OA 1JHTA 4A2LA 3HMXA 2F5BH 3GSRA 2XZAL 5MI0C 1F6AB 3TJEL 4UT6L 3MUJA 4QWWD 3D0VA 2ARJQ 2JIXD 3IDNB 4J3VA 4U1GB 5CD3B 1G7MA 4WO4B 3B9KD 1XGQB 3MO1B 1NC4A 2NY6D 4LU5L 1IT9L 3O9WD 4ODVL 3SE9L 3SQOL 1T1WB 1W72L 3QHFL 5HYFA 1EEUA 5EN2B 1DFBH 4PR5B 4PD4J 4L8SA 1ZHNB 4V2CB 2RGSA 3HZVA 4WI9A 3WCYA 4XPGL 2YS4A 1NCAL 3X3GH 1AFVH 4MJ5B 1NGWA 3BKYL 2F8VA 5JW3L 4AQ1B 4MB4A 4PJCF 5L2KE 3SGKA 4ZXBA 3RJQB 2Q7YA 1CYGA 1H3UA 2P8MB 5JHLH 2KZWA 2IANB 2PYFA 3D9AH 1J5OH 2NX5B 1XF3A 2IH1A 1I8MA 3ARFD 3PP3K 4LPUA 2DD8H 3OAYK 4LDEB 1TETL 4QRTB 1HXMA 3BVNB 1JNLH 5ANMA 4HQQL 1QFUH 3GSQB 5M7QA 1IGTB 3O2WH 1ZXQA 3I75A 3QDGA 3RGVD 3VGDA 4QHUA 3GMLB 4W6XB 3F62A 3S3SA 2R8SH 4CADA 3ULVC 3ARBB 2FECL 4YXKH 2NZ9C 3REWA 3RDTB 4YWGH 1QFPA 5E24E 2ZUWA 3C08H 3MV9B 4MQTB 3GRWL 1JN6A 4GAJL 4HH9B 4K3DL 1VFBB 2CQVA 3CNKA 4M7ZB 5C09E 5LCVH 5GGVH 1IGFH 4G7VH 3RUGA 3RY4A 5JXED 4ODBD 4Q9QH 4X9IA 4PV9A 1FZKA 2BY2A 1ZT1A 2X1PA 2CK0H 4M93C 1NCCL 3BIKA 4MNQA 4ZAKC 2VL5B 4YXLL 1AY1H 1S7TA 2UY6A 3SO3B 4JHBA 2YK1H 5IROC 3U0PA 3S37L 1RUAL 1XIWA 3QI9C 1Y6MR 4M00A 2ZNXA 3SE8L 1A4KA 4S10A 5IBTH 4AG4H 2VLRB 2XFXA 3ZE0F 1T89C 4LPYA 5SWZD 1A7RL 3QNXB 5I30L 4DVRH 1UYWL 4OLVH 2BSRB 4NNPH 4Y5XB 4GAGH 5C0JA 3VXQA 4NKIL 4LEOA 2NZIA 2ZCLL 3UBXG 2P5EB 4QEGA 4PJDB 1RZKL 4UBDC 5F3HB 4ZFGH 4YHIB 1YN6A 2BVOA 2CXGA 1YQVL 5FK9A 2ZCKH 3R1GL 1CDIA 4QRRA 3L7EB 4GW1B 4U6YA 4DGIL 4P2OA 1AI1H 1HDMA 3VXNB 4WW2A 1RAMA 2F19L 4IRSB 4XMPH 5ABDE 3BUYB 3OKLB 1I3RB 3BDBA 4YPJA 5E2WH 1C5DB 3V9FA 2CLVA 5GS1A 4YHOH 2OL3A 1QFHA 2ICWA 5C0FA 4PS4H 5J4MA 2FEDD 3PWPD 1T20A 1ACYH 5FUZH 4POZD 4PUBL 2JB5L 4U0RB 4D94A 5F93C 2HFGL 2EIEA 4Q74A 4OZFB 5C08E 3A0OA 3EJYC 2JTDA 4F37F 1TJGL 1ZWIA 1CDBA 3STZA 2FJGA 4ZODA 1FNHA 4RISH 4RGND 4HWZB 4G9FD 3ARPA 1HYSC 4I3SH 4J7RA 4M03A 4UUJA 4WTWA 1MVUA 1A6UL 1IILE 5KVGL 3U0TB 4MYWB 2YA2A 1NBVL 1D6EB 1JGDA 1BJMA 4X5XB 3MRMB 3SDYH 5I15L 3K1DA 5KW9L 2BRQA 3QDME 1NJ9B 4PJGF 5CEXB 3UZEA 2R4RH 4WEBL 4XMLL 5JO5B 1EEQA 1BEYH 4HZLB 2IC2A 5CUSH 5BO1L 1LEKA 4E42B 5EO1A 3CSYA 1OP3H 3OKOB 5BZDA 3FT2B 5IJVA 3DX8A 3G6JA 1CLYL 2YEZB 4S1DD 2X10A 4JEGB 3OF6A 5CJXC 5D71H 3ARSA 4ALAH 1RUKL 5E8OA 1TQCB 3X13A 4M02A 5KSBA 1WCQA 2F53B 4WCYL 1A9EA 1PYWB 2AJ3A 2X4NA 2HFEA 1NGZA 4PJBA 2CKBA 4FZEL 4UQ2B 4LKCB 1UEMA 2HTLD 3FONA 4CU7A 3EZ8A 1PG7X 5HSFA 1F3DH 2XZCH 3DRQA 3T08A 5DVOA 4RWYH 3TZVA 5SX4I 3T1WA 3IVKA 4HG4K 5DEGA 1UKTA 1RPQA 2H8PB 3TYGH 4L9DA 3DV6A 4FFYL 4LPTA 2GITB 2Z35A 2NY4C 3CFEA 3K74B 1DE4A 3MODH 1SVZA 3EDKA 3HFMH 4HUUA 3LRSB 4QOKA 1GAFL 2QSCH 4ORGB 1MSPA 1Z9LA 3DVGA 4LSPH 1WBYA 2B0SL 4YR6B 4DW2L 3H3KA 5ISZA 2Q6WB 4H0IA 4E9LA 1VPOL 1JVKA 2A6JB 3C9NB 1T6VN 4Y8DC 1JWUA 3MACL 5I1GH 5IBLD 1P6AB 4KRMB 3E2HB 1T03H 4LCWB 3MBXH 4AL8H 3IFOB 2CIKA 4XVTH 5SV3A 3WFCL 5DD5H 2EZ0C 2XTLA 1XT5A 4WHCA 3VW3L 4BZ1H 4HFUL 3P4OA 2CIIA 1ZSDA 5I1EH 1U8IB 5D7IB 1IAOB 1WWBX 5E0QA 4WTXA 4WV1B 4TSCL 1U8NB 2CUHA 3MRPA 2JIXA 3SN6N 4HFWA 4LARH 4P4RB 3X14B 1OW0A 3PWJB 5HDOA 4HWBH 2C3VA 2VISB 4KQ4H 2C7UB 3O9WA 1Q38A 4NRZA 5D2LA 4QRQA 3ZYIA 3BKJL 1A6VH 5F9JB 1UM4L 4GBXB 3WUZA 1SEBB 4H5SB 2EYRB 4KRPD 4PP2B 5D4QA 5JMOC 4OCMC 2IH3A 5GJSH 5IW1B 3ZMRA 4K2UL 1MREH 5AAMA 4E0RB 5MEOA 1T1XB 4WFGD 3BW9A 1BFOA 1N5AB 3QWRD 4QTIL 3W2DL 1RK0B 3IDIA 4GXVH 3QIWB 1IC5H 3K4AA 2C4FU 5HPOA 4LLVB 3SO5A 5D6CB 1OSZB 5IT2H 2BP3A 4HT1H 5IWLC 5FYKE 1A1NA 1VADA 4AM0A 3ARFA 2FHCA 1FGNL 1F4WH 5I1CH 3RGVA 1U8MB 1Q0XH 4Y4FB 3AUVA 4NYLA 1MIEH 2VDMH 3QUKB 5DURD 3IJSB 4RMQA 2BERA 1CGYA 4PPTA 3GBMH 4GKNA 2FZ3A 4KVCL 2GSGB 4OI9A 4ETYA 3GMNA 5T5FL 4OLXH 1C16B 3EGSB 2AGJL 4BKLA 2BDNL 1K4CA 3OZ9H 5ETUA 3QEQB 4GO6B 4XPFH 5IG7B 1CE6B 3WKML 2CDFB 1GPOH 1MCPH 1PKQA 5D2NB 2FHBA 5IESH 2ZG1A 3CVHB 3IU3A 4JFYA 1BVLA 5HHOD 2D03L 3MV8E 1E4XI 5SX5H 1S7QB 4NO0D 1EJ6A 2G5RA 3O6FD 4APQC 3V6ZA 1Q9KA 1HHHA 2MKLC 4H88L 2H2PC 5JPNB 2Q87A 4XCFH 5JDSA 5SWZA 1HQRA 3PE9A 5CGYC 1FZOB 5TPWL 4NQCB 3JV4A 3SKUD 4ZFZB 1FBIH 1S3KL 5GS3A 4CN4A 4DCQA 1JGEB 3QUMH 4YAQB 2MCPH 2OMNA 4NNYA 2BVPB 3LMJH 1WF5A 2JE8A 1IAIL 3TBVA 4L3CB 5BOPA 3SOBH 3TN0D 1VFMA 1AIFA 4ZUVB 3RKDC 3HB3C 3OBAA 2R4SH 2HVKB 3BPCB 4HGWA 3ARWA 3T2PA 2EDBA 1AD9A 1RURL 2XN9D 5DVKA 5I73C 5J6HB 2J6EL 1EMTL 3UYRL 1RJLB 2FGWH 3M07A 4KI5E 2X7LA 3WFBH 4HZAA 1ORQB 4FQCL 1ROWA 1GZPA 5EZIH 5DJCB 2FWOB 2GUOA 4QKXB 2Y06H 3L9RA 2FH6A 4P2RB 5JW4R 4HAGA 3VFSB 4NJ9H 1SYSA 4Z6AT 4BZYA 4L9LB 4UILH 4XP6H 3QXDA 1GHFH 3G5YA 3PWPA 4NKQB 2Y72A 4XTRC 1DUYB 2V17H 1XF5A 1K85A 4P5MA 2YPLA 4JO4H 3HG1D 3IDGA 4RAUB 3M17A 4G9FA 5B4MC 3H9SE 1BFSA 3V5KA 3OAUL 2IPUG 5LGKA 2ZJSL 4KKAD 1E27A 2VXVL 1TZHA 4U1LB 1N6QL 3ELAT 4DEPB 3S97C 4F37K 1QA9B 4ZO7A 5I0ZA 2X1WL 1JGVH 4JG1L 4GXUM 3D3VE 2W60A 3RWJB 4M1GH 2AKRA 5GRJL 3NGBC 3GM8A 4LRNL 3QO1A 1NCDH 1BJ8A 1YN7B 4KAQL 4PJIA 15C8L 5SX5K 1HXYB 3C60B 4UDTB 3ULVD 3H0TA 4LVNC 3NFSH 1B88A 2YD1A 3Q6GH 1C7SA 1CTOA 1EGJA 4IRJA 2R0KH 1YJDC 2ZOKA 1RUQL 1A5FH 1CICB 4WUUD 3O6KH 4ZUWA 1CLZL 5D1QB 1QFWH 4DTGH 1G7QB 3BSZH 4FQIL 3E3QE 3TT1L 4D3CL 3QDJE 1NAMH 3KPRE 4ZAKD 1VDGA 5JA9A 5A2JH 2APBA 2NY5C 3VD9A 1CXEA 1ZA6A 2A73B 4K7PY 4EXPX 4HBQA 4U1MB 1YYMH 5JR1L 3KXFA 1UXWA 1NCBL 4GRWE 4U0QB 5B3NA 4QTHA 4N9OB 1KYOK 4R90L 4KMLB 1K4DA 1D5ZA 4G8GD 3U7WH 3O4OB 3JUZA 2MTPA 1EK3A 3PDDA 2D2OA 2ZG3A 1J0KA 5HDBE 3N1PC 3ULVH 4HS8L 5ACZA 4OCWH 4I0PC 2VH5L 2G2RA 1P7HL 2OJEB 2P24B 4UBDD 3X3FH 3BE1H 2APXA 1WBXA 1WTGT 3VFGH 4PRIE 4IDLA 2AJYH 1BQSA 3KS0H 4ODUA 1V8HA 1BZ9A 3MBED 1A4JB 1AKJB 4LCCA 3W11C 5C0EB 1ND0A 3WE6B 5EB9A 4NDMB 3ARUA 3CVHL 1S5IL 3K2MC 1KEML 1KB5B 3T4AB 1GC1H 2CMRL 3BI9X 5F88A 3SGDI 1JYWA 2E27L 4JDTH 4JZNA 4PJHF 4U6HB 2W9EH 3P40A 3VH8G 3T0WA 4KVNL 5DQ9B 2CGRH 3NH7H 2GJ6B 1T22A 1GGCL 1IM3B 3P9MB 5F7NC 1O7VA 4JFFE 2HLFC 1L7IH 2GK0A 3EDDA 3QUZB 3AY4C 2B1AL 2LQRA 1LWRA 3HAEB 4TUJA 5EC1A 2IFFL 3VG9C 1Z9SA 2RR3A 2X4SA 4X7TA 3KPLA 4XPTH 1INQB 1HYSD 2F58H 1RMFH 4R97B 4XI5C 1FIGL 1TJIL 3T0EA 1IGJA 3DX9B 4MAYC 3DIFB 3BRFA 4AZ8A 2EDTA 5CEZD 2OZ4A 4GUPB 5DS8A 1S7VA 4Z0XB 4RFEB 4Z95L 4P23C 3ZKXC 1QBML 5FV2A 3S88H 2P45B 5SWSE 5B39G 3N85H 2HRPL 1BQUA 3S35L 4TUKL 4HGKC 5HHNA 3CH1B 3QWRA 2OSLA 2EC8A 3RA7H 5DTFB 3C6SA 1JHKH 4Z77A 5C07A 1FAKT 4X7SL 2D31A 3UJTH 4YDJA 3QHZL 4Y89A 3NZ8A 1PG7W 4ORZC 4DUVA 3FAXA 3A6CL 4MA1C 4RGMC 4R7NB 3DX7A 5MHSE 3UJIL 5MEQA 1LDPL 4KZEL 4F7MB 4DAGL 1EFXB 3PUCA 2GAZB 4NGHH 4E41B 4KPHL 4ENEC 1V7NL 2DLIA 1BZ7A 2AXHA 2A1WL 3BZEB 3HE6C 4NCC1 5HPMB 4QRPA 5K9JL 1NCWL 3MRJA 5GS0C 1UQSA 1CU4L 1OGAB 1I9IL 2NY4D 3QCUL 2YOCA 1TFHA 4K3JL 1MHCA 5HHOA 1RJYA 1QRND 1YQ2A 2NX5E 3UPAA 2F15A 3EOTL 5IVZA 4NO0A 2CRIA 3S5LB 2M1KA 3O6FA 3WDIA 3C5ZB 5AWNL 2VLKE 3ARGA 4NQDA 2ITDB 1BM3H 1CR9L 4WI5A 5IIEB 2NY2C 1FZMA 5BVJB 3CDGA 4YDIL 2P44B 1MCLA 4CKVX 2X09A 3S9DB 4HXAL 2B2XH 4MXQD 2DLTA 1KN2H 2EDQA 5E9DD 3MGAA 1AGEB 5CCKH 3BAEH 1FE8H 1EH9A 2EZ0D 2DKUA 5IJKC 3V7AE 4Q9RH 3KYMB 1MCJA 3ZL4L 3HZYB 2DQJL 2P5WB 2XN9A 3EO9L 4F2MA 3IETA 4RAVB 5EU6B 1CL7L 2BC4B 3AB0C 5KG9A 4Y1AD 4HBCH 3HZKB 1RHHA 1UEYA 3D69B 2XZQH 3VXRD 2MKWA 1K2DA 1IQDB 3EYUL 1VACA 1TCRB 5FM8A 2Z91B 4LVOC 5ID1A 2HJLB 4MA3B 4BFIB 4P4KD 5F1KC 4EI5A 6CGTA 3H6JA 1DBAL 3NCYP 4HUKB 1KCKA 2Y36L 1OGTA 5J06A 1KC5L 2WSKA 5JLZB 3DUSA 5DJXA 1CD1B 1JF1B 1YEFL 1KB5L 3JUYA 5JW4M 3E1F1 3VFRA 3VRLE 3HG1A 1QLEL 4WI2A 2CDEB 4LLWA 3ALPA 1G9ML 1HH9A 4UDUB 2WINA 2W92A 2NMSA 3BYTA 3HRPA 1M71A 3EYSL 4HIHB 2QEJA 4M8VA 1SJEB 1UCBH 1F02I 2IGFH 2WP3O 4H0GA 4LDLB 2XNAA 2P8LB 1JRHI 1QZ1A 2R2BA 2E9WA 2ZUQC 2WLYA 2BOCA 1U3HC 4MB3A 5I1AA 3QCVL 5C92A 3ES6A 3BDYH 4NN5B 4RMRA 1MJ8L 1EUTA 4HC1A 5KS9A 5DR5H 4YZFE 1EV2E 4K7FB 1XGRA 3UPRB 4K3EH 3GSOA 3VXMB 5IHBA 5D96C 2H2SC 4WUUA 3RX8A 5A2KH 4O9HH 3VXUD 4C58B 1YDPA 1J0ZA 4NUGH 1JMZA 3ZYZA 1QR1B 4Y5YB 1JGUH 5IROA 4K94C 1BGXH 4X7CC 1X5GA 1ZT4B 2DF3A 3QI9A 1MRFH 4LSDA 4KUZL 5F21B 4APQD 1A1MB 3BEVA 3CU1A 1JWMA 4JHWH 5T3XL 3VFUA 2H2PD 2PR4H 4JM4L 1IQWH 4S1SL 3ARZA 3UJJH 4JKKA 5CGYD 1A14H 5T1DH 4NZDA 3U7YH 3G5VB 3CXDL 5E03A 3FT4B 5J1TC 3T65A 4CVWA 1JPSH 4QY8B 1HH6B 1UZ8A 2D4FA 2CH8A 1PZ5B 3RKDD 1X44A 3HB3D 1II4E 4JZOA 3QNZB 3TO4A 1P9MC 1KIQA 1XGTB 3SHSA 3EIFA 4JANA 4OB5H 4XPAL 2DDQH 1KLFA 1UG9A 2D0FA 1CTNA 3TCLA 1DTUA 4WFEE 2FIRT 2FEEL 4JFZH 2GKIA 5BJTB 5CGTA 1LE9A 1TXKA 4XTRD 1AO7D 4Y19B 1JPGA 1WGOA 3DX6A 4KMTL 3NN8B 2CO7B 4O51B 5IMOB 3J7HA 3Q1SL 5IB4B 4I2XB 3VD3A 1S9VA 1KELH 5GSRA 4I77L 3U9PL 2C1OA 3VXOA 1DBBL 3H7BB 5E2TL 5C0RH 4KHTH 1CGXA 3MNZB 1XCTB 4H25A 3LN5B 4QOKE 3HS0A 4LCWE 1KENH 5T1LB 1W8OA 2V5RA 1G9NC 3X17A 2XRAH 3MSPA 3TH3T 5FO7A 2DKSA 5D7IE 1RULL 1JFQH 3MCLL 2AJVH 4G6AC 3LH2H 1PGRB 5FO8B 5CJXA 1S7SB 5AD0B 5ESVB 1DQQB 1R5IB 4DOHE 5GGSA 2QQLL 3VXPB 3BRGC 2XI9A 3RIAK 1OAQH 3KAAA 4UIKH 4ZSOB 4OKVB 3S3PA 3VFTA 4MQ7B 4AEIL 3VCLA 2F54E 4FQXC 4QRUB 1ADQL 5FYKU 2DQCH 4YQXH 2DI7A 4JFEE 1XGUA 2NR6C 1UA6H 4X6FA 1UB6B 3P4NB 3RL2B 1VGKB 5EOTA 3LD8C 4PJXA 3BH8B 5JPMA 4MVBC 1U8OA 5DJZB 2YA0A 4OQ1A 5DQDH 3LEXA 2ICCA 4LHQB 5A2IH 1UWEL 3BP6B 1CE1L 1EZVX 3GHEH 2BOBA 1FLRH 5FCUH 5L0QC 4I0PD 2Q86A 1DQML 1FL6B 1TNMA 1MEXL 5AEAA 5D9SA 5CSBA 3GB7A 4N0YL 1T0MA 3GMMA 4PV8A 3QQNA 5DRWA 3U7AA 3CXHK 1FSKB 3W11D 4R7DB 4LPCA 3LV3B 3B3IB 4O00A 5DA4A 5EZLB 4N0CC 2NY5H 4IBLT 5F7EL 2FX9H 1XF4B 1MF2L 3CFDB 4HS6B 4AIZA 1J05B 5E9DA 1OD9A 4U3CA 4X4XA 4S1QL 1Q0YH 1CK0H 3LN4B 5A16B 1UWGH 3VFWA 3FB5B 3STLB 3KYOB 1IC4L 1C1EH 2HLFD 1A6ZA 3RY6C 5D2NE 5C6TL 2OJZL 2E7CA 2V7NA 3DMMD 4R4FH 2JELL 3LZFL 1CIUA 2DJUA 4EQ2A 1M05A 2AERT 3VXRA 1AGBA 4FQPA 4BSWB 4KI5F 4ZUSA 4C83B 3RL1B 4XI5D 5EORL 2C26A 4OCRH 5E6IC 4XCNB 1QTYT 2I27N 4MAYD 4QHLA 43C9A 4KJYB 3G5XB 4IEFB 4S1RL 2HG5A 4BK4A 3BKMH 3FRUA 4K7PL 4P23D 3CFBB 3LAFA 5GGRA 4I18C 5D7JC 4QRSA 1KN4L 4AMKL 2WMPA 3ROOB 4YHYC 3N1MC 3R8QA 3MRLA 4NC0B 4I9WE 2VR9A 5D1ZB 1QSFD 3QRFM 4PG9B 5IW6A 3FB8A 5TF1H 3U30C 4OCYH 1AQDA 1NKOA 3DVNA 4HK0B 4OZGB 3HUJE 2OP4H 1N2RA 4M62L 1A2YB 2NTFA 1AXTH 3MFFB 3IFPB 2H1PL 4FTVB 4HSQA 4X6DF 5GGQH 3OXSA 2K9UA 3MRRB 3B9VA 4PB0L 4H26B 1NC2D 1LILA 3CC5A 4P2RE 1OARH 4KTEH 1C08A 1MJUL 3B2VL 3L95A 2FNBA 4O2EA 5CBEA 4PRBA 2FBJL 2SEBB 3WXWH 4N9GA 1V3MA 1VCAA 4Z76A 5CD5C 1K6QH 1MLCB 5DZLA 5F7LB 1JYNA 1MQKL 1AGCA 4LCUA 2PCPA 4RMWA 3VXUA 2YKLH 4XCEB 2P8PA 2AJZA 5TE4H 4EN3C 2FYYB 2B4CC 3CZFA 8FABA 4U31A 2DWDA 4HMCA 4APQA 1B9ZA 3FZUC 1JHTB 1L0YA 1OP9A 4JY4A 5GGVY 1NGPH 2VABA 4G6KL 1GZQB 4N8CL 1GH7A 4GRWF 2NY2D 1MFEL 4XNXH 3FN3A 5DRXB 3MRNA 1G7MB 3G5ZA 2HT3D 4CNIB 1KCRH 5DC0A 3ALWA 2B1HL 1ETZA 3RTQC 3MXVH 2GY5A 1J0JA 4J2XA 1BBDH 2WIIB 3BWUC 4MSWA 1I3UA 3I3BA 4C56E 5GHWL 5DC4B 3TP4A 4N0UE 2YD9A 1AE6H 1EERB 3NCJH 1INDL 5A40E 3PWVB 5HYJE 1T80A 1RD6A 1NH6A 5D7KE 3NOIA 1T5WA 1BD2D 3UTQA 5JOFA 4ZXBB 4XBEL 2JLLA 1ZAGA 3DSFL 4XMKH 4FABL 4NKMA 1HKFA 1I3GL 4AT6A 5C9KA 2EDEA 5TH2A 1G0XA 4MJIB 1XF3B 5D5MB 1I8MB 4Z18A 5C3LD 2C3GA 1X5IA 4L3ED 3WEXA 5IW3A 5IHUL 3QDGB 1J1PH 4QHUB 4XC1H 4OUUA 4Z8FH 4OAWA 4DZBB 5B8CC 4U6VH 1I7TA 4JGUA 1R24A 3REWB 1PLGH 2BHUA 3UTTA 3QPXH 1A7QH 3DBXA 2C3HA 1SY6L 4GMTH 5C0CB 3KLAA 5FA3A 3DYOA 2KZ1B 4LQFH 5C0BB 2ICWJ 1ZT1B 5MP6L 4PJ8C 3ZHDA 1S7TB 4W4OC 2GJ6E 4Q58C 3U0PB 5FHBL 1ZGLA 2X2YA 1RIUL 3D48R 4EUPH 4KTDH 3P77B 5A2LH 1XIWB 3FFCD 4FP8H 4NZTL 1A4KB 3GSUA 2FX7L 5FXCH 4PB9H 5AZEL 1MCBA 5DA0B 4KJWC 1TITA 1SJXA 1VFUA 2XQBL 2FD6H 4HWNA 2I9TA 2G75B 2H2SD 1KGCD 4ODWA 3LY6A 4LVHC 5GGTA 2VDKL 4OLUH 5E94A 3T09A 2N7AA 4L4VA 3IYLW 1SBSH 5C0JB 4N0RA 3VXQB 2N1KA 3FQRA 4X6EA 5EUOB 1Z3GL 2FGZA 3U2SA 5A3IC 5C0GA 2Z31B 1YN6B 2XZAH 1OWWA 3FTGA 3TJEH 4PTUA 4UT6H 2JJTA 5IEKB 3C09C 1IL1A 1R0AL 1RUML 2E8ZA 4J23A 4JO1L 5DSCB 3T0EE 3D25A 2XKSA 4QRRB 3DXAD 4YC2C 3TVMB 3VMNA 3D39D 4FXGB 4P2OB 2AQ2A 4LU5H 1A6AA 4ZQKA 4WW2B 4F7CA 4JFHD 4W81A 3MGTB 1W72H 3BPNC 2LTQC 3WL9A 3MUHL 2ESVE 2YMXH 4BUHA 2DQHL 1IAKA 3WIHA 3MJGX 2LFGA 2J8UA 1ZLWH 3EW3B 5T3XE 5GS1B 1NCAH 1ZLVH 1NGQL 3BKYH 2BXYA 3MJ9H 5C07E 3IDUA 4F9PC 5LJYH 3JWDL 3FO2A 2VN7A 3DGGB 4TVPE 4LLQA 2GIYA 4P59L 2QHRL 5DMKA 5DRZA 3STZB 3VRJA 4MDIB 1G9EA 3RVVC 4H8WC 3ULUE 4KK5C 5M94B 3HMXL 1TETH 3HKFA 2H26A 1MAJA 3V4UL 2ATKA 3AY4A 3WMSA 3O41A 5KZCD 1N3NB 1F58H 3BD3A 5I1DA 5EIQA 3IFLL 5I6XC 1AP2A 1EHLH 5GJTL 4O58L 4MD0A 1LEKB 2MQCA 5IFHL 1E4JA 1KSRA 1ZANL 5BZDB 5L7XL 3O2VL 5IJVB 2GSIA 3G6JB 5HVHB 4DKAA 3GRWH 5C7XL 4GAJH 4MAYA 1DBJL 3GKWL 3S37X 5E8OB 2AS5M 4CAGA 1CVSC 2AXGA 1LD9B 4YBLC 5F7WC 3NFPA 2RQ8A 3D85B 4NQDE 2BNRE 1NGZB 2AV1A 4IHOA 5FM5M 4YXLH 2ZNWA 4WHTA 1QSFA 5EWIL 4PJDF 5TE7L 3TF7C 3VRLF 3VD7A 1FNFA 3D18B 2VJXA 5AYQA 5J9PB 5J8OA 4K23H 3DRQB 3OPZL 2VZ3A 1RUPH 2AJUL 3IFNL 1JHLL 1BFTA 2UWEA 3TIEB 5I30H 5DEGB 4U1HA 1UYWH 4KZDL 1HKLL 4WHDA 1E4XL 4X4YA 3RNQB 4LCIH 4HXBH 3MYJA 3DV6B 4IIQC 5MERA 4FQXD 3KGRA 5E4EB 5TQ0L 1CCZA 1RZKH 3CFEB 4AEHL 2EEDA 5L8KB 1DE4B 3EYQC 3UX9B 2GJJA 1X7QB 2Y1VA 1ZLVK 1M6OB 1MIML 4ONGL 1YQVH 3V5HB 3ZDYE 4GH7B 3R1GH 4MVBD 1R3KB 5FM4A 3HE6A 1L0QA 4NKOA 3UTZA 5ISZB 4YZFF 3GJFA 2JJSC 1C12B 2FL5B 4LLAA 4TRPH 2X6MA 4LSVL 3U1SH 2V2WA 2F19H 6FABH 4UAOB 4EOWH 3LDBB 3F8UB 4ZPTA 5FKPA 1LHZA 4LSUH 3LQZA 2FR4A 4MA8L 4B7LA 4NPYB 1UCTA 2FJHA 3BPOB 4NRXA 1ZSDB 3QXUA 1MFCL 2O5YL 3FOLA 3MFGB 2Y5EA 2GK2A 4N8VG 4PUBH 1GGBL 4UTBH 5ESQA 5I1JH 3BIAX 1HEZB 3CDYA 1EO5A 3C8HA 2JIXB 3MRPB 5ICXB 3EO0A 1UM6L 2VKWA 3B9KB 4HFWB 4NN7C 5L6YL 3JWOC 4LSQH 3QEUA 3U79A 4X6CB 2NY6B 4ZYKB 2VTFA 2I26N 5D2LB 2PW1A 1A6UH 4P2QA 4QRQB 4NQED 3FKUS 2FHFA 3N1GC 1EO8L 3OJDA 4BQ9A 2VAAB 5IJKA 3GIVB 1BIIA 1TVHB 2QADC 3PNWA 3VXME 4BH8A 5I15H 2XQYK 3LKSA 3V95A 4DKDC 1QSED 4AIXA 4XMLH 3CX5K 5JZ7D 4L29A 5BO1H 4UNVA 3B8SA 3V6BR 5MEOB 4UINL 3NCEB 1BFOB 4X7EC 2OTUA 4P5TC 5J6GB 3IDIB 3WLBB 5E95B 1RUKH 1H3PL 3QULA 5E6ID 4NZRL 3DROA 1DP0A 4D0BB 4Y4KC 1VADB 5FYLL 3TPUB 2PXYC 1NUDA 2GT9B 2B5IC 3RZWA 4L3EA 1KCUL 3RKPA 1I8LC 4RQQA 1H5BC 3RGVB 4MX7A 4WWKC 4NYLB 3TH4T 1XF2B 4KDWA 4O2CB 4Z7WA 1J0IA 1TIUA 3IDXH 4RRPA 3CH8A 4L4TD 2FZ3B 2AXFB 3GMNB 4PRNA 1D9KC 3ARQA 2PKDA 1NFDB 3IDJB 1I1YA 1UKQA 1CVRA 5IFJB 1MFAL 4BKLB 4E5XB 2IQAA 1H0DA 3JTTA 1RFDH 4FFYH 4QXGH 5ETUB 1PKQB 4XNZB 3IU3B 1U8HB 2WUBL 3MTRA 4JM2A 7CGTA 1U3HA 3QNYB 3BRDA 1N64L 1B0GA 2G60L 1ORSB 3O4LD 4DW2H 5D7IF 3MNVA 5F8QC 1H8OA 1FFNA 1FO0H 5ERWB 5CD5D 1VPOH 2E9IA 5SWZB 4ERSL 1HQRB 1EVUA 3BP5B 4HV8B 5DHVA 2DQDL 3CFKB 3SKMA 3HC0B 4G5ZH 4NOFA 1MCOL 3WFCH 5IP4A 3CFCL 4OIIL 3P0YL 4NNYB 1DQJA 4HFUH 3QH3A 2IADA 3PF2A 3L5WA 3TBVB 1FJ1B 4HGWB 3FZUD 4LNRA 4OLWL 1AD9B 5JOEA 4KXZI 2Q8BH 4UQ3A 4CU6A 3D39A 3VXSA 1DQDL 5ACLA 1FFPA 1CT8B 2X7LB 5IVXB 1UM4H 4POYA 1J8HB 1CFSA 4GMSL 3PGFH 3RTQD 4A6YH 5CKGA 1Q9LA 3QG6A 5DI8A 3SBWC 4ZSOE 1JL8A 3MA7A 4YHNA 1SYSB 3T2OA 3GSWA 3QXDB 3PWPB 1DFBL 4FA8A 5CINH 3U9UA 5HDLA 1P9MA 2R2HA 5DF0A 3X3GL 4YBQC 1G7IB 5MEND 3F7VA 1H3TA 1S7WA 1ZT7B 3W2DH 4RGNB 3M17B 3T2QA 3BT2H 5LQBH 2NXZD 3P11H 1NFIA 1FCCA 1E27B 4PJCA 4D0CA 4ZD3H 4ZOBA 1TZHB 5JHLL 5KSVB 4Y4HC 2EICA 5DJYB 4NQUA 3D9AL 4FQJH 4HKBA 3H2WA 3L3KA 1YEGH 1JZ2A 1NBZA 2VXUH 4RA3A 3KG5A 5EO9A 4WGWB 4AY0A 2DD8L 4HUWA 5I8CA 1YEDA 1JNLL 2R2EB 1N6UA 5HHME 3QFJD 1R3IH 4PJIB 3VXTA 4LMQI 1Z5LA 4S0SD 3K4DA 4ONFH 2VXTL 1DBKL 3FN9A 4JQIL 4XB8A 4FQQB 3NACH 4YXKL 3EYOA 4YWGL 2X40A 4PD4K 5EBMA 3WKMH 2X42A 3C08L 4EUPG 5FKAA 4XAWL 3TBTB 3VWKC 3W9EA 2PO6D 3FQTA 1YPZA 5LCVL 1KNOA 5EO0A 1IGFL 1MUJB 4G7VL 5FOJA 5GGVL 3RAJH 3OR6A 1ZEAH 4MCZA 5CHNB 4Q9QL 1SHMA 1WZ1L 4J8RA 3FQXA 3MZTA 2I07A 2YK1L 1UXWB 4HF5L 5DLMH 3V5DA 4JQVC 3UP1A 1D5ZB 1QLRB 3OJMB 1DL7H 1S3KH 5KAQF 3HUJF 5IBTL 4FQXA 3FN0H 3FO9B 4OQTA 4DVRL 2XYCA 2Y5TB 1IAIH 5C1MB 3PQYD 4GAGL 4ZO8A 4N1HB 5BZWA 1I1AC 5IOPA 4P0DA 2ZUSA 4XRCA 3IJYA 4ODUB 3VGFA 1RURH 4XX1G 1FYHB 3TA3C 1BZ9B 4RDQF 4MNHA 4ZFGL 4HKZA 1OF2B 2R69H 4LCCB 3UYRH 4JKMA 5JIHA 1L6ZA 2ZCKL 4U6XB 3TIDB 5ICYA 1QO3B 2X4TA 3QQ3B 2BSTA 2WUCH 4CVXA 3V0WL 2OK0H 3HR5B 1A3LH 2VKXA 4JZNB 3MC0A 1MLBA 1EA9C 2UVFA 5HHVL 4XMPL 2NW2B 4YDVA 2CRYA 2FO1A 1RZ8A 3MRQA 2KQNA 5DUMH 5C8JA 3LHPH 4OGYH 4YHOL 3EHBC 4ZO9A 1DEDA 5ENWA 1Y0LA 4PS4L 4M7LH 5CJBA 3QJHA 5FUZL 5GGSY 5JORA 3BZ4B 1P7KA 3OAUH 4ODHL 3LIZH 5DFVD 3VJ6A 4G42A 3O3BA 2O5ZH 5J11C 4X8JA 4X7TB 3KPLB 1JZ7A 3DV4A 4N1CA 3RVVD 2XV6B 1MVFA 3MREB 4RISL 5FHAH 3CGTA 1IGJB 4KK5D 3KPMB 4KRPB 3KWWA 3EYFA 4I3SL 3T3ME 3HNSL 1ES0A 4FFWC 2ZKHL 4JG1H 3RY6A 3HPLA 5HHPA 4GW5A 4YK4C 4RFOL 2YRZA 3A6BH 2EH7H 3SDYL 3BP7B 4KAQH 2RJMA 5HI4C 1U58A 1JUFB 2HN7A 4PJGA 5T1KD 5CUSL 3C6SB 4PJFE 4Z77B 4J6RH 1CZ8L 4PRPD 5E6IA 3RNKA 2HFFA 1JRHL 2D31B 4YDJB 3MOQA 1LK3H 4RMSA 3NZ8B 2A6DA 3OGCA 5D71L 3SJVD 1Y18B 4MQSB 3IDYB 4D3CH 4H8WH 3F7YA 4AJ0A 3O3AA 4XNQA 1LE5A 4I18A 5D7JA 5HY9A 3RVWD 5TDPA 5DURB 4YPGA 1PQZA 2VDPH 4A2MA 1I7UB 3W82A 3LEYL 3D1MC 4RSVA 4FNLL 3CFJA 2HMIC 4DZ8A 3MRIA 3VFVB 2ZUUA 1LGVA 3I85A 4Y16C 4HS8H 3PHQA 4RWYL 2Z4QB 4YIQA 1BAFL 1RZGA 3PJSB 2D7OA 2X89D 3TYGL 1BWWA 3DO7A 3PWUA 5F1SA 1FFQA 1MHCB 4XNMB 5TDOA 5BRZB 5HHOB 1FP5A 3H3BC 3EYQD 4Z7VE 4NO0B 1S9XA 5D5ME 3MODL 3O6FB 1EGJL 1IFHH 3NPSB 5IV2B 3HFML 5HGBB 1KJMB 1IM9D 2QSCL 2ORBL 1FZMB 1DANT 1I8IA 3CVHH 1S5IH 2CMRH 3S7GA 3IF1A 3TNMA 1P4IL 2PF6A 2VZUA 4EN3A 2EYSB 1ZHLA 5I8KH 4KVNH 5I1GL 1J7VR 1FAIH 2A6KA 1GGCH 4EQ3A 1T03L 2YN5A 3MBXL 5GGRY 1AGDA 3TN0B 4AL8L 4I3RL 3RWCA 3AREC 5IKCA 2VZTA 1S8DA 2B1AH 4BZ1L 2XN9B 5MI0B 2GHWB 4F2MB 3IETB 5C0BE 4RNRB 3NCMA 4HW6A 3R8BB 2EDWA 2IFFH 4M9OA 4F57H 1X5HA 1OAUH 4PFEA 3T0AA 4JRYA 1S9YA 2NW3B 3DRTA 5ACMA 4AK1A 4LARL 3S35X 3RTQA 1FIGH 4H0HB 4KQ4L 5ID1B 1A6VL 2QADD 1EPFA 4X8XA 4WDIB 1QBMH 4KI5C 1WUNT 1MCRA 2JK5A 3S35H 3VMOA 1PKOA 1CGWA 5ESAA 1TCMA 2VSCA 3K7UA 5F9OH 5MENA 1FVEA 3VFRB 3EOBA 1MREL 5H35A 1S7RA 4P5TD 1TZIB 5F44A 4N68A 5DJDA 2X9WA 3EUUA 2WINB 4IDJL 5D93B 2GFBB 5LBSH 1F11B 2MQ0A 3EDFA 4Y4KD 4GXVL 4JLRA 5L2KD 4M5ZH 4PY7A 5IT2L 4HT1L 4OD2A 3O3EA 1L7TH 5DD3H 3UJIH 3CLEH 1QOKA 3RWHB 1BMGA 1KG0B 3X11A 2R2BB 1H15A 1LDPH 1HI6A 3QFJA 1U3JA 1M7DA 2BOCB 4O2FA 3SDDC 4KPHH 5E8EA 1V7NH 1MIEL 5IB3B 3BP4B 1M7IA 2VDML 5KS9B 4CDHA 4ONHA 5FYLE 1CXKA 1D9KD 3WIFA 4BSVA 5IMMA 3KPOB 3HRZA 4NJAH 2XOTA 1ED3A 3HNTL 4WUUB 1G7LA 43CAA 1I9IH 3OZ9L 3C5SA 4K3JH 2A6IA 1YDPB 2DMKA 2R0WH 4M93B 4XPFL 4ZAKB 4PJ8A 2P46B 4W4OA 4G43A 1MCPL 4S2SB 4LLMB 5IESL 2IAMA 4I4WB 2FIKA 1A7OL 4KJPC 4BM7A 1LK2B 3KPSD 1TVDA 4QHNA 1K3IA 4LLUB 5C09D 5FGCB 3BEVB 1CQYA 3QEGH 2EDYA 3BZDA 4XVJH 4EI6B 4G8GB 5ICZB 3E3QC 4M5YH 4KKNA 3UMTA 3V52H 2XKNA 1YMMA 3P3YA 1YMHB 4JJHA 5EBWB 1U92A 3PQYA 1FBIL 5DFWH 1DSFH 4NN6C 5I74B 4FXLA 1ZA3B 4OCSH 2MCPL 2I60H 3EO9H 3D5OF 2HJKB 4WI6A 3MBEB 1MQ8A 4DGYH 2R4SL 1KXVC 1S5HA 2VAJA 5FO9A 5INDB 1A47A 2FH8A 4QT5A 3E6HA 2OR9H 4RZCA 4JANB 4WUKH 4ZNEE 3EYUH 4D9RD 5CAYB 2FJFB 2FGWL 5JNYB 2VITA 1AXSA 1MWAH 2OMBA 1LNUA 2DI9A 2Y36H 3SDAC 2BVQA 4NNXA 3V6FA 3WFBL 2KKQA 2Y07H 4LIQH 5EZIL 4PJAB 3VGHA 2Z0BA 5J13B 3ARYA 4G8EA 4X99A 4F9PA 4NJ9L 2F8XC 4XP6L 1GHFL 3RVUC 1JPGB 4JO3L 3DX6B 4DGVH 4YBQD 4X80H 4G8FA 2V17L 1I1FA 1T21A 4CGTA 4G6JH 1G9MH 5GSRB 1WFOA 4F8TA 2C1OB 3VXOB 3QUYD 2EYTA 3MA9L 2EE2A 5I66A 1G1YA 1U91A 5C6PB 4Y4HD 4H25B 5C08D 9CGTA 3HAEH 1XZ0B 3HS0B 1KB9J 3F5WA 3JV0A 2K3TA 32C2B 4JFOA 2BMKB 2XG4A 3MLVH 2UZIL 4MD4A 1JGVL 3QCVH 5B21A 2LE9A 2RBLA 3KJ4B 5FO7B 3B83A 5EPMA 5T1KA 2EXWC 2ZCHH 4RBPH 4GJTB 4QYOB 1I85C 2ZSVA 2J2ZA 5IMKA 5GGSB 4JB9L 3QDMD 1YEHL 2DM4A 1H8SA 1EEYB 3NFSL 3Q6GL 3SJVA 3AXLB 3WFZA 2R0KL 3VWKD 3VCLB 4BQCA 4JDVB 3L1OH 1A5FL 2C3WA 3O6KL 2EDRA 1QFWL 4DTGL 4U1GC 4X6FB 4KUZH 1QQDA 1MHEB 1I9RH 2UVEA 4WO4C 4D8PB 4XWOC 1MELA 1JI2A 3Q48A 2W07A 4PJXB 5BQ7A 4P2QE 4JFPB 2D9QB 1YYML 3G04A 4JAMA 4GT7A 3MCKA 1OY3B 5A43C 2AEQH 4D9QD 4GG8A 1DQLL 4IIQA 5HYSA 3U7WL 3HNVH 3DETC 4D0DA 2NY4B 3TCXA 2A9ML 3ZHKA 1QRNB 3C2SA 4NO3A 2Q86B 3ULVL 1VFAB 4HC1L 3L3OA 5D9SB 1DQTA 1I1AD 3MLYH 1P69B 3GB7B 3DURB 1T0MB 2MHAB 3GMMB 2EIZB 3PP4L 4PV8B 4WEUD 5DRWB 1WISA 1XR8B 1F42A 2DTSA 2R23B 5F7DB 3BE1L 1FN4B 2JJSA 4XGZB 5HTSA 3HZMA 3L3HB 3VGAC 4WW1A 4OFVA 5JHDA 1URLA 3P0VH 1QG3A 1IGIH 4LBEA 4X4XB 1NFDE 5C0AE 2IG2H 2AK4D 4JY6A 4JDTL 4C57C 1RVFH 2W9EL 3BZFB 1A6ZB 2CGRL 1U8LA 4HHAB 4PJHA 4PREA 4KMTH 4LK4A 3W39A 2XKUA 4Y1AB 4QXUH 1L7IL 3Q1SH 1BQHA 2YD6A 1AXIB 5EUKA 3BQUD 5GRZA 1RZJH 3VXRB 3MUGA 1R3LB 1AGBB 4XH2A 3W9DA 3CMGA 4NRYB 4RBPK 4ZUSB 3LKRA 1Y6NR 1X4ZA 2HT2C 4Y88A 4P4KB 5EU3A 4OGXH 4XPTL 43C9B 1ODAA 2F58L 1RMFL 1U8PB 2H32A 1V7MH 4FFWD 5C0IB 1WZKA 4CJ1A 3UAJC 3BN9C 4MMZC 5GRVK 4HLJA 2M2DA 3G6AA 5GGRB 4NC1E 1KCLA 2WP3T 2ZUXA 1YNTA 4QRSB 4UIMA 5IVOA 5HI4D 1EJOH 1W0YT 3T2NH 5SWQA 1UZ6E 2C9AA 4P5TA 5CSZA 1MCKA 1MH5A 3B5HA 5BS0D 5KSUA 3RA7L 4ETQA 4OF0A 2ADJA 1FG2A 4P48A 5L2KA 2A2QT 4PJ5E 2ED7A 2VDLL 2PXYA 3MLUH 5IVXE 1J8HE 1ADQH 3IAPA 2N7BA 1I8LA 3OXSB 1H5BA 1FRGL 4GW4B 4WWKA 1HINH 4M4RA 4YHLL 1KV3A 3ESUF 1AD0A 3OL2A 3OJ2C 3VXSE 1NEZG 3L95B 3SCMB 5IR1A 1UH3A 4O2EB 5IUSA 5FYKD 5CBEB 1HILA 5CEZL 5B22A 2W0PA 4ELKB 2LVEA 4OM0L 4IRSC 4QHMA 3VFMA 4NGHL 2HMID 4LCUB 2VB5A 3S36H 3VXUB 4WI8A 4PGEA 2DQGH 3V79C 5DMIL 3HR6A 3CZFB 5JDJA 1ZLUK 2H3NA 3O2DH 2A77H 2GCYA 5C09A 1LO2L 4APQB 3LRGA 1MWAA 4HMEA 3WHXA 1CFTB 1JNJA 4HIEA 3FFDB 1Z9OA 5F7EH 1BM3L 3MRNB 3BGMB 3FQNA 5E6ZA 3MV8D 3ZYJA 2DOCA 1KIPB 4S1QH 2EC9T 3GJEA 1ETZB 5DDHB 3RZCD 2B2XL 1JPFA 1K8DA 1KN2L 1F5WA 3C8KA 3ARED 1U6AH 5C6TH 5CCKL 2OJZH 3BAEL 3BJLA 3S96B 1FE8L 1SBBA 4KUCF 1BF2A 4Q9RL 5I73B 3LZFH 4H1LA 1CS6A 5I19H 1BECA 2WIMA 3KYKH 1TQCC 4K7PX 1KIUA 4HBCL 1UC6A 5F70A 4AT6B 1YPZE 3BO8A 4NP4H 4EBQH 4BFGA 4S1RH 3SBWA 3RWDB 2O5XL 5AYUH 1OVZA 4K7PH 4NQTA 4U4BA 3MLWH 4KI5D 1AO7B 2VLLA 4LPVA 1HCVA 1KN4H 2VERN 4ESKA 4AMKH 2HLAA 3P0GB 1YC7A 3DI3B 2VE6A 3L6FA 1HHIA 2X1XR 4OUUB 2IBZY 1C8PA 5CP7B 4O5LL 3C87A 1I7TB 5B38G 4EDXA 2UUDH 3PHOB 1R24B 1CGSH 4LHUG 3CU7A 4J1UB 1NDGB 3UTSA 3GO1H 3TNNA 1B0RB 4Y4HA 3IS1X 4KROC 2XY2A 1CXIA 2AEWA 3WXVL 2RCSL 3KLAB 3T3MF 4M1CD 4ZPVA 1UCBL 3STBA 5KOMC 2WBKA 4M8QB 4OFDA 2YBRA 4UU9A 4YHPA 2IALB 4FQHA 2IGFL 2NNAA 1YEJL 1I4FB 3NGBB 2CR6A 5EH1A 3B2VH 2FBJH 3SDDD 1D5XA 2RFXA 1NGXB 4ZDHA 2BVUA 3JXAA 3WDHA 4MD5B 5E00B 5K9KA 2YC1A 3GSUB 5INCA 3BDYL 3D3VD 1MQKH 4PJFF 4LFHG 2I9TB 1TVBB 3VWKA 3MNWA 5DJ6B 4ODWB 3MR9A 5KBNC 4K3EL 3MRKA 3NCBB 2WM0A 2VR4A 1JIBA 3IRPX 4QNPE 4WV1C 4O9HL 1HOCB 5KVEL 4WVRA 4QHKI 3GNMH 4NUGL 3U2SB 5CILH 5C0GB 1JGUL 4KJPD 4G6KH 4K3GA 1BGXL 1X5ZA 1IL1B 1MFEH 4JQVA 3W0WE 4KTYA 2BNQD 4MNGE 3U4BH 1MRFL 1X5XA 3OKEB 2ZWLT 5GQBA 3D25B 4JHWL 3FB7A 3QDJD 3VDBA 1RV6X 3KPRD 1D3CA 1A6AB 4ZQKB 3UJJL 5T1DL 1A14L 1FYTA 1JZ8A 4NIKB 3FO1A 1MFDH 4I0PB 3CIQA 5IHLB 1B3JA 4N0FA 2PNDA 2C1PA 3TBYA 5FF6A 2A0LC 1B6DA 1JPSL 3VI3E 1INDH 3P2TA 4Z7VF 3TA3A 1G7JA 5D5MF 1WC7A 5JQHC 1HE7A 1ZKAA 4YHZL 1U93A 4FABH 4WFHE 3GBNH 3FB6A 3VRJB 1U95B 2UUDK 4PRID 2QQKH 4OB5L 2DDQL 4Y2DA 3OSKA 3SDAD 4FXKA 4Y4FC 3DVFA 4RX4D 2CSPA 4R8WL 2R39A 5SV4A 1JYVA 4JREC 2F9BT 3DMMB 1FNAA 4JFZL 4GRWH 5BRZE 3QZWG 3KYNA 1AP2B 3B5GA 3HCVB 4X6BA 3HAEG 1P84J 1EIBA 2I9LA 2R1XB 4PRDA 1FNEA 4LLYA 2GSIB 4JFFD 2DYPD 5DT1H 5D2NC 4MAYB 2AJSL 1KELL 3F58L 3CAFA 5CWSA 3IJHA 3NCFB 5E4IA 3ARDB 4P23B 4KHTL 4RGOL 1P1ZA 3NFPB 5MP6H 5DJ2A 2W9DH 1X5JA 5KANI 4KI1A 2AV1B 3AU1A 2DM7A 2HWZL 4WHTB 3QEHA 3ZKMC 5EUOF 1KENL 3ESVF 3M1BB 1LDSA 2ZSWB 3GFUA 4YFDB 2AABH 2X4QB 2XRAL 1T2XA 1GGIH 2P7TA 3P30L 2FSEB 3CMOH 1D6VH 1IARB 3O2DA 4FG6C 3MOBH 1E28A 3LH2L 3BWAA 2X44D 1QSVA 3LKPA 4MA1B 4XWGH 3F12A 4RGMB 4X4YB 5HBBA 1WZLA 3MYJB 3K46A 3QRGL 1NC2B 4CW1A 4KHXH 5I16A 1KBGL 4WTZG 4GKZB 4XPBL 3L3JA 4YQXL 1AR1C 4JRYE 5TE6L 4WO4D 4MGXA 1R0AH 1RUMH 3PGCA 5DJ8A 2ZZUT 4GG6E 2CD0A 5FDWA 3X12A 4NKOB 1DDHB 5DMGC 3RWFA 5MHSD 4Y16A 4BQ6A 3I2CL 4G80A 5DQDL 1HQ4B 4NFBA 5GSVA 1HHGA 3TH2T 2DQHH 4ZPTB 1NC4D 5DZNA 4X9FA 5IHZA 4Z7UE 1KF9B 4P3CH 4M61B 5FCUL 3WNPA 2FJHB 2Z92B 2PYEB 5E8PB 1YJDL 4HLZH 1DN2A 2V5MA 1MRCH 2CPCA 5ESQB 1F13A 3JWDH 1U42A 2NY2B 1JGLH 4X4ZA 7FABL 4P59H 5GGTL 3EO0B 4WI7A 1JCKA 2DWEA 5JMRA 3MV8A 1VKXB 4DEPC 3QJFB 1GIGH 1UXSB 3D2UD 1M4KA 1WEJL 2NY5L 2BJMH 2VLKD 1FV1A 3HMXH 1OM3L 3OJDB 4EZMA 1N8ZB 3TO2A 2YPKA 3SE4A 2NY3D 1BIIB 1YEKH 3T4YB 3AREA 3V4UH 2WWMC 3VRIA 3LKSB 3WFHB 2R1WB 3DO3A 4WGVB 4JZJA 1UWGL 3Q5TA 4AQOA 3B43A 1BD2B 1C1EL 1WT5C 5GJTH 3TV3H 1AHWC 1ZANH 4R4FL 5EIIA 4YO0A 3WIHL 5C7XH 5FGCE 3FQUB 4LVOB 4JPWL 2HT2D 3V8OA 4G8GE 5DD0H 1ITBB 4ZG1A 2VL4A 4QXTB 2ATPA 1DEEB 2YSSA 1LO5A 1CWVA 4OCRL 4EUPB 3UAJD 1T0NB 1T2JA 4JCLA 3BN9D 5F7YC 4L3EB 1B4JH 1G0DA 4MX7B 3BKML 5F1NA 5TE7H 5DD6A 4XZUA 4MNQD 1BX2A 2CLZB 4AIOA 3OPZH 5IVNA 5ADPH 3VG0H 1DJSA 3EO1A 2AJUH 3IFNH 2BSSA 1JHLH 4PJ9C 3B5TA 4PRNB 1I1YB 1E4XH 1JNNL 1S7XB 5TF1L 3EZJB 1BVKA 4NUJA 3VWJC 3H9SA 1O7SA 4KDVA 3LPFA 4L8CA 2ZUQB 5GGQL 3LVEA 3BXNB 4U1JB 4WIQA 4ONGH 5FOBB 4PJAE 3RVXC 3FFCB 1NGYA 4X6DA 4XXCA 3JV5A 1T83C 1OARL 4IOIA 4KTEL 3MLZH 4MWFA 2W9LA 3D3VA 3MNVB 5DK2A 4MDJA 1I7ZB 4U1KA 4RWHA 3OAZH 5DHVB 2ADIA 1FORL 5F3BA 4HUXB 3GHBH 3SKMB 1K6QL 3KNBA 1SJVA 5J1SC 1J1XH 4X6CF 1FQ9C 1T04A 4UB0H 5E2VL 2IF7A 4MA8H 2YKLL 2JB6A 1GSMA 1DQJB 4MS8C 3QH3B 5JW5B 4GOSA 3L5WB 5EOCJ 5TE4L 1P7QD 1IEBA 1QBLH 1RIHH 4M6MH 4R0LB 3IKCA 1UM6H 5L6YH 3DXAB 5DJAA 3KPRA 3D39B 4JE4B 4OKDA 4PRHA 4L5FL 4AH2B 1YNKH 4C55A 3WDJA 2HJFB 3LSOA 3QG6B 4CN6A 1TQBC 2Q1EA 3T0EC 1H9VA 3UTPE 3MA7B 2DBJA 1BBDL 3GSWB 4KK8C 1T1ZA 3U9UB 1IKFH 5HGHA 2R2HB 4EVNA 5EU4A 4UINH 4HD9A 2OXGA 1P53A 5AUMB 2ID5A 1BZQK 3QQ4A 3WNNA 2OL3H 4XMKL 3SDAA 4RX4A 1PDKA 3WO4C 5A1AA 2C4FT 4JKLA 2ZUTA 1B2WH 3OF6D 4K71C 1NFDF 1CF8H 4QXWA 1G7PA 2P47B 5KZCB 5J12B 2DJSA 1NBZB 4OIBA 1QRNE 5CEYA 5I2IB 4TN9A 2EKSA 3ULUC 5I8CB 3PWLA 4WFED 3B9AA 4JFFA 2ICEA 4JFQB 1J1PL 4XC1L 2X1OA 3MLXL 3OAZK 3MUY1 3EYOB 1PLGL 4KROD 5EBMB 5HHQB 3IDMA 3TBSA 4OV5A 3QPXL 1A7QL 3TZVD 4JM2F 4UOW0 1DLHA 2FO4B 1T4KB 2WUBH 3GGWA 2PW2A 4KRNA 2G60H 4ZOCA 2GTZB 3N1FC 1X9QA 2X4UB 4HS3A 1G1CA 2UV3A 3FQXB 3L3IA 4HULB 3F65A 1I85A 4MCYB 3WJLC 2YWZA 5HGDA 1UZ6F 2HKFL 4QOKD 3GMOB 5SWSA 4Y1AE 3GSVA 2DQDH 3MRBA 4KTDL 4YNYA 4FP8L 2X70B 4HEPG 2CKBH 1MCOH 3IGAB 4OF7A 5ITBL 4FQXB 4OIIH 4X9HA 1F3RB 3P0YH 4P9ML 5IVXF 3UDWA 1F6AA 1FGVH 1R6VA 2BFVL 3IDNA 5BZWB 3SGDH 4WO4A 1XGQA 4OLWH 5IF0A 4UZGA 1KLUB 5KOVC 3G08A 2DIJA 4M9PA 2WBWB 1T1WA 2F54D 2JCCB 1DQDH 2XTJE 1MY7A 3MRGA 2DQEL 1EAPA 4JFED 2YUXA 4PR5A 5ICYB 2OTWB 1ZHNA 4GMSH 2O61A 5L0QB 2E6QA 4MJ5A 3PG2A 1IVLA 2NY1D 1XH3A 2IPTL 4YDVB 5IB5B 2A0LD 3MRQB 2YMXL 4EI5C 2VXSH 2OR8A 5FA4B 1BHGA 5ENWB 5BV7C 1Y0LB 5C2BH 2NX5A 3NMEA 3MJ9L 3SKJL 3CSGA 3D2UA 1TDQA 3O3BB 4NQEB 2VLKA 4X8JB 4QRTA 3DV4B 1FNGB 3I50H 1W0WB 2ERJC 2XXCB 1IGTA 5I1LB 4WU5B 3KWWB 4NQXA 5D8JH 3GMLA 1QSEB 1A7NL 1JV5B 3HPLB 4HCRH 5HHPB 4NN5C 1Q9OA 3RDTA 3ZSSA 1QBAA 2WLZA 1VFBA 1F58L 4R2GC 1YA5A 1RZFH 4NQSB 4W4NA 2HN7B 2VXTH 1EHLL 1DBKH 1PY9A 2P43B 4JQIH 4PJGB 5E8NA 1YYLH 3RWEA 3TJHC 3RNKB 3ROLA 2HFFB 2VL5A 1YPZF 4Y5YC 4XAWH 1OSPL 3LPWA 5IMLB 4YFLF 5BXFA 5K9QI 1I9EA 3F7YB 1FO0B 4GSDH 1D5MB 5EBLB 4P2CG 2VLRA 3BESR 5TDPB 3UTOA 1WZ1H 4JHZA 3THMH 3ZKMD 4YHYB 2DIAA 4RFNC 4L4TB 3ZO0A 1WWAX 4HF5H 2BSRA 2LU4A 3G9AB 4PJEB 1PG7L 5IK3B 2DS4A 3MRIB 2E6JA 4PJDA 4XBPA 4K23L 4YHIA 5EOCL 5H2BA 3IU4H 1RUPL 2QHLA 1KPVB 1RZGB 3KDMB 4I9WD 5HHXL 4LCIL 4HXBL 4KKBC 1QHOA 5TDOB 4PRAB 4GW1A 3O4LB 3VXNA 5L8LB 1XGPB 4LSSL 1AO7E 2XWTB 4HWEH 4IRSA 4YUEL 4A6YB 3BUYA 3OKLA 1I3RA 1C7TA 1C5DA 3ZE2E 1I8IB 5DMGD 3TO4C 2RB8A 3E8UL 1QLFB 4MB5A 2BVYA 4N1EA 1G9NL 4HLZG 4ZNCD 1BQLH 3T3PE 4XNYH 3V0WH 4TRPL 3U1SL 4GKSB 5DD1L 5HHVH 1AC6A 3R06A 6FABL 4EOWL 3HPJA 2R9HC 3RWIA 2A6KB 5ALCL 2J3SA 4RIRA 1P7QA 2AK1L 4QNPF 4OZFA 4LSUL 3E6FB 3RWCB 5IKCB 4WI3A 4NWTL 1S8DB 4HWZA 2W65B 5LXGH 2IPUK 4JFDE 3UTSE 2X9YA 4UTBL 3U0TA 5I1JL 4ODHH 3CPLB 1T7ZA 1D6EA 1S9YB 3VD5A 1WWWX 4X5XA 1GYAA 3DRTB 3MZGB 4ELME 2YPLD 1PAMA 4Z9KB 4LSQL 1SJHB 4HIJA 2ITCA 3HNSH 5JO5A 2V6HA 2ZKHH 2V7HB 2WWMD 3Q3GA 4DUXA 4RFOH 1FNSH 3VD4A 3FT2A 3VI3F 2JK5B 2EO1A 2YEZA 2DN7A 1PFCA 5MENB 2PTTB 1OT1A 1W0VA 1J8KA 1J1OH 4Q7DA 5H35B 2NXZB 4C56D 5DEFB 4MLIA 1CZ8H 3V0VB 1JRHH 1Q94B 5HYJD 1HYRC 4D9LH 4YDKH 5D7KD 1A0QL 1FPTH 3CFIC 4UQ2A 5AZ2H 1BOYA 1JPST 4IRJD 4Y5VB 5H94A 3GUTA 1MOEA 4LKCA 1CXLA 4PY7B 3D87B 3V4PH 1WK0A 4PGDB 2H45A 3X11B 4AYFA 3C5JA 2OX5A 1YZZA 3QFJB 2H8PA 5B8CB 4OZHE 4OTXL 3LEYH 3MGOA 4FNLH 1FYTE 2J6EA 2Y4SA 3LQAH 2GITA 3IDXL 3TESA 5DHYB 1RZ7H 4YLQT 4PJ9D 3WIFB 3GDBA 5IMMB 3KXFD 4S11A 4K8RC 2AEPL 1MCDA 4DKFL 3CUPA 2ZOLB 1BAFH 2G9HB 1TTGA 43CAB 2PO6B 3VWJD 2J5LC 2A6IB 1RFDL 4QXGL 3QG7H 4YR6A 1OB1B 4X5WA 1EGJH 2A6JA 2FIKB 3C9NA 3MRFB 3RVXD 4LCWA 2ORBH 4NZJA 3EJJX 1I3VA 1YEIH 2AAVA 5IM7B 4C59B 4NBYB 4J3OC 1P4IH 4NZUH 4LVHB 1FO0L 2YD8A 1NBQA 1U8IA 5D7IA 5GISL 1IAOA 1F6FB 5C2UB 4WV1A 2PN5A 3WFEH 1U8NA 1U92B 3PQYB 5D7LE 4G5ZL 1OAYH 2A38A 3HE7C 4QHKJ 4Q0XH 4I3RH 5C0NC 4MS8D 1VESA 5DK0A 3KLDA 5F96L 2O93L 3PWJA 1U2HA 4ZMAT 2C7UA 2F54A 3WJJC 5F9JA 4BQ8A 1I1CA 4OD3H 2VRAA 4GG6F 3MV11 1T1YA 1SEBA 4H5SA 4JFEA 5FO9B 1CG9A 2EYRA 4UOJA 5I71B 2Q8BL 4HCRA 3BMWA 3OKKB 2Q76B 5IW1A 5FUOH 1OP3K 3EDJA 2K1MA 4JFXB 1YY8B 3RBGA 4Q6YA 3RFZC 4E0RA 3PGFL 1T1XA 4Z7UF 4A6YL 3T0ED 2H9GB 3L3GB 4OFPA 2RAMA 1N5AA 2XXMB 1K9TA 1RK0A 4PBVC 4PLKC 1WFNA 1VEMA 4X99B 1KPRB 5DJ0B 1PJ9A 5HVFB 1J9CT 1T5XA 2QL1A 4LLVA 1C5BL 3LCYA 1OSZA 5CINL 5D6CA 2ESVD 3QFDB 1EFQA 2V5YA 2A9NH 5I76A 3RP1A 3GBLA 1TNNA 4NM4H 2QBWA 4IDJH 1U8MA 3BT2L 4Y4FA 5LQBL 3P11L 5C07D 2IMNA 4BFBD 2YUWA 2WV3A 4TVPD 3QUKA 4ZD3L 3IJSA 1ZVYA 2GSGA 1E4WL 3SPVB 4FQJL 4FQ2L 5F7FA 1C16A 1YEGL 3ULUD 2VXUL 3FO0H 2PYEE 1NEZB 2V2TB 25C8H 5EPMB 4TQEH 2MWCA 3GSXA 3QEQA 5T1KB 5IG7A 1CE6A 2YA1A 3RPIA 3OV6A 1VB9A 2OZ4H 4PRPB 5D2NA 1R3IL 1RJZA 5C70A 4G9DB 3HNTH 3A6OA 5HYQA 4ONFL 1EAJA 4PLJC 3NACL 4YBLB 4Z7NE 1JPTH 4R3SA 1KTLA 3DTXB 4QRPD 3UC0H 3O8XC 1A7OH 1FZOA 5GS2D 2W0KA 4NQCA 5CGMA 3RAJL 1ZEAL 4ZFZA 4GRMB 3WS3A 1JGEA 2YD5A 4UV7L 4JCMA 3VGBA 3ARGD 4YAQA 4NQDD 3WIIH 4FMKA 3ULUH 2BVPA 2BNRD 5DLML 4NC2B 1JI1A 4GG8B 4ZUVA 4BJLA 4IIQB 1LP9E 5HYSB 4TNWK 1DL7L 4D0DB 2A74B 4PBWD 3BX7C 4XXDA 2E5EA 4NO3B 4U1NB 5J6HA 3WD5L 3FN0L 3HUJA 3L3OB 4JJ5A 1VSCA 5CJOH 4BH7A 3PGDA 3WS6C 4PJAF 2VDOL 1IM9B 1ORQA 4JRXE 4PGBB 5DJCA 3I6GA 2FWOA 4OIAA 2R69L 4HEME 4P9HH 3VE0A 4P2RA 3VFSA 2BK8A 2J8OA 4L9LA 2Q20A 1HNGA 4L3AA 4XBGA 2WUCL 4PGCA 4JY6B 3VFOB 2OK0L 4UT7L 4OD1L 1A3LL 5IQ7L 4EI5D 4RAUA 4TTDC 3IXTB 3WO3B 4GRLB 3MXWL 4YGVA 5DUML 3LHPL 4JO3H 3E0GA 4PREB 3GMPA 2EE3A 4OGYL 3O45B 4NN7B 3EOAB 2CRZA 3O3DB 1JF5A 3FFCE 4M7LL 4F7EB 4XCYA 5B38B 3MA9H 4LHUB 3LKRB 3LIZL 3C6LC 5EU3B 2O5ZL 4R26L 2QADB 1JWSB 4OSUH 1CDYA 1IC1A 3C2AH 3I84A 4OI7A 1YN7A 5FHAL 3ZKSD 4NHUB 4YBHA 1HXYA 4X6DE 4KY1L 4U7SA 3WUWA 1WSST 4UDTA 2UZIH 2ICES 2ED9A 4R4BB 1WT5A 3G6AB 5LWYL 4OZIB 1AHWA 3LOWA 5L9DL 5KTEL 1YNTB 2BCKB 3A6BL 2ICWI 5EU7E 2EH7L 4R2GD 2QSTA 4C56A 2EXYC 5I75C 3Q6FB 4P5TB 4N0UA 4H20L 3U82B 3MUZ1 4JB9H 1YEHH 2W0FB 5HYJA 1G7QA 2NZ9D 4LNVA 3DXAE 5CZKA 5BV7H 4ETQB 4MA7L 5CFHA 4Y4KB 4J6RL 4KQ3H 5L2KB 1E4KC 5LGJB 2A73A 1QACA 4U1MA 2Z31C 2B5IB 2DLHA 4HDIA 1LK3L 3HI1A 5FUCE 3OMZA 1H5BB 5DC9B 4H8WL 1AD0B 4GFTB 4PRHE 1S7UB 3MRDB 5AAWA 3TVMC 1WWCA 1CFVH 2CKNA 4PJ9A 1D9KB 3QI9D 2VDPL 2GI7A 4QHMB 4Q6IB 4F3FB 2JJTC 3I6KB 4MJ6A 4DK6A 2P24A 3O6ML 1DQLH 4J3TA 3FOMB 3VWJA 2A9MH 4V2BA 1QBBA 1AKJA 1A3RL 4HC1H 1Q72H 4KKBD 5C0EA 4KRLB 4B50A 3PP4H 4HUNB 2H3NB 3WE6A 2AXJA 3KPSB 4P3DA 5C09B 1T83A 3GMQB 1KB5A 1MWAB 2VZ1A 1KLGA 5CBAB 5JQ6H 1IFHL 4HIEB 5E1AA 4TUOB 4LRIC 4N5EC 5DQ9A 3DWTA 3TO4D 1VEOA 2GJ6A 2JJVA 1XAUA 1KJVB 4JPIB 3RWGA 2R9HD 1K8DB 1BJ1J 5I8KL 3PDOB 1EXUA 3SGEI 1FAIL 2NY7H 2O26U 1IJ9A 1INQA 1NMAL 1RU9L 4QCIB 2MCG1 5HVHC 4WNQA 3QZWB 3DX9A 3DIFA 3ZTJH 1MHHA 3G6DH 1U41A 4Q9CA 3EJYD 1XGYH 4F57L 3WV0A 1OAUL 1HN1A 1U8QA 3WSQH 1MI5E 4PJ7B 3CH1A 3MMEB 4LSRH 3EYVA 3IKKA 2LAAA 3UO1H 3K3QA 5DQJA 2D4DA 1T7VA 2E6PA 3MLPA 2ESVA 4PP1C 3H8NA 3S34H 2VE6B 3RIAF 1HHIB 1CDJA 1CXFA 1VA9A 3MJ7A 5F9OL 3C8DA 1CD0A 1L6XA 2Q3ZA 3SDXE 4R7NA 3WFDH 1TJHH 3QUYB 3SGJA 5I17A 2JCCE 5E4EC 1KJ3L 1P4BL 2J4WL 2IPKA 4Y4HB 2VDLH 1HK6A 5C08B 3GMRB 4F7MA 5LBSL 1FRGH 4ZPVB 3WUWG 2GAZA 3OKDB 3P73B 4YHLH 3TC9A 2YBRB 1ZTXH 4FQHB 4M5ZL 3BZEA 4WEMB 1Q1JH 1L7TL 3L3DA 3O11B 1AGFA 4PYHA 5DD3L 3CLEL 4ODXA 4WY7H 1DN0A 5CEZH 5HPMA 3RHWK 4OM0H 4YE4L 2YZ8A 3QT2A 3EKCA 5D70H 4U1IB 3QDMB 1BFVH 2YC1B 5CZXC 5F97E 4K8RD 2DQTH 1IE5A 4L8BA 3MNWB 3S5LA 5CP3H 4NJAL 2EDJA 1MCWM 1LO0L 4NQEE 5HHMD 1J0HA 5DMIH 5TQ2H 3AS3A 2ITDA 2EDXA 5IIEA 4QWWC 2IANE 1BVZA 3QIUC 1LO2H 1PY4A 2R0WL 3B9KC 4UTAH 1QSEE 3WJLA 1P2CB 4C54A 2BNRA 1AGEA 2HKHL 3QEGL 5IB2B 1S9WB 3OHXB 2VQ1B 4XVJL 3FHAA 3KYMA 3PV6B 3HZYA 4M5YL 3FO1B 2KPNA 3BDXA 1R5WA 4OF8A 4RAVA 1T3FB 3V52L 1LO3H 3NA4A 5EU6A 2BC4A 5FEBA 3QXTA 3HE7D 3MV9E 5C0ND 1I1AB 3TBYB 3HZKA 5FF6B 3B4NA 1UFUA 5I1HL 1DSFL 5J1AB 1FFRA 4ISVA 3B9DA 1UADC 1IQDA 4OCSL 2I60L 3ILQC 2Z91A 4MA3A 1OTSC 4BFIA 4JHAL 1U93B 2VLJB 5FAAA 5GRUL 4L4TE 1HSBB 3ZE2F 4DGYL 3FB6B 4QF1A 3P4MA 3SY0A 2OR9L 1FNLA 4WUKL 3T3PF 3FQWB 5BOZG 1CD1A 2AK4B 1R5VB 1R3HB 2K7PA 2O5XH 4FXKB 2VLRE 2WK2A 5F89B 4ACPA 1MWAL 1RJCA 4RMVA 2Y07L 3NFNA 5JOPE 2EDDA 4LIQL 4PLKD 2EDFA 4UDUA 2OI9C 5EOQL 3BQUB 1FDLH 2MPAL 2P5EE 4X6BB 1SJEA 3OKNA 4O5LH 4EDWL 4PJDE 5DYOB 5J11B 4POUB 4DGVL 2CR3A 4X80L 5JXEC 4LLYB 3CCHB 4EIZC 4J4PC 2R1YA 4ELMF 1H3VA 4WWID 4G6JL 4XNZC 2VOTA 1TENA 2P8LA 3WXVH 3VGEA 5CWSB 1FFOA 2RCSH 4X83A 3T77A 4YK4B 4OLZH 2H6PA 1YEJH 2VN4A 3NA9L 3ILPB 3UPRA 4GAYB 4JDZB 1LEGB 3VXMA 2M26A 3MLVL 1G0YR 4JM2C 3ZYOA 1EEZA 5BS0B 2HFTA 2P7TB 3I3DA 3VI4F 1IZJA 2YR3A 2ZCHL 1QR1A 4CVZA 4Y5YA 4NC1C 4PLJD 4K9EC 4NO2A 1ZT4A 3F12B 2BY1A 4YHKH 2DMBA 3RVTC 3PIQB 1K5NB 1PVHA 5KVEH 3FCTB 4FMFA 2HVJA 4CBPA 5L2JB 3O8XD 4CW1B 5I16B 4P57B 1CXHA 3L1OL 5T1MB 5GRVL 2APTA 4OZHF 3PGCB 5DJ8B 2N4IA 3G5VA 1I9RL 5FDWB 3X12B 5IEHB 4QY8A 3RWFB 1HH6A 5CKAA 3ARVA 4M43L 3MV7B 1KB9K 4JO2H 1RZIA 1HHGB 2AEQL 2FEDC 4ZS6C 1XCQA 4POZC 4OZ4B 3HNVL 5C3TA 3HHRB 1HHJB 5C0DB 2Z93B 4OM1H 1A6TA 2X4RB 1UH2A 3RIFK 5DRNB 3RRQA 2F53E 4URTB 3MLYL 1WCBB 1MFBH 4YHZH 2EKJA 4GKOA 1CL7I 4CMHC 1A64A 3U48A 5JW4N 2OLDA 2Z9TA 2DWEB 3MV8B 1GJIA 1U2CA 4X98A 3S4SA 2I24N 2IBBA 4LF3B 3RZCB 3WHE1 3WN5B 2XIDA 2V2XB 4R8WH 5FGBC 3NN8A 3P0VL 1IGIL 5IMOA 2CLRA 3VRIB 4I2XA 4TTDD 2IG2L 3HI6L 5K93A 3JWNC 4W68A 1E6JL 1RVFL 3AS1A 4BELD 3FRPA 1J0YA 5T33H 3MNZA 1XCTA 4QXUL 3QP3A 3P9WB 2A83B 3LN5A 3V6OE 1RZJL 5B4MD 2AJSH 3F58H 3C6LD 4X4ME 5E5MA 5T1LA 5TJWK 5C0BD 3UTTD 5DUBB 4UNUA 3U0WL 3ET9F 1XR9A 1WBZB 5I0DA 2VDRL 4OGXL 4RGOH 4FS0A 2W1NA 3MJ8B 3BHBA 3I6LE 4LHJB 5FECA 1V7ML 5AD0A 2HWZH 1DVFC 1DQQA 5ESVA 3RY5A 1R5IA 3VXPA 5F1NB 5DD6B 4ZSOA 3OR7B 5CP3A 3KPQA 2EXYD 3P30H 4G7YL 1WJ3A 4QRUA 1TPXC 1EJOL 2AVGA 3T2NL 3J8F7 3JV6B 4IS6B 3QCTL 1KTDB 4Q97A 3ISWA 3TEUA 1MJ7H 4U1SA 1UB6A 3P4NA 4NUJB 5I18L 3RL2A 2YD4A 3QRGH 2Z31D 1YNLH 3BH8A 3MLUL 4JR9H 5DJZA 5JW4Q 1EO7A 1KBGH 4L8CB 1LEIA 4L4VD 4XPBH 5TE6H 3ECBB 1JE6A 3SDDB 1I8KB 5BMFL 1HINL 2ADFL 5CJQH 2DIBA 1FH5L 1NGYB 3TVMD 1RSFA 4TPRL 1T0PB 4ZS7L 5IBLC 3ARTA 4MWFB 5IQ9B 1MCCA 5DK2B 4MDJB 4U1KB 4Z78A 4HWUA 3I2CH 4XP9H 3O3UN 1JYXA 1JTPA 4Z7NF 4KXZH 1T04B 2XPGB 3S36L 4DVBA 4WHYH 3B6SB 2R56L 2JB6B 3D6GA 3B3IA 3BIBX 5EZLA 1YJDH 2DBLL 2DQGL 1XF4A 3O2DL 3VA2C 4HS6A 1J05A 2A77L 7FABH 5GGTH 2BNQB 3LEVH 5EU5B 5TFSH 5ITFB 3QDJB 3LN4A 2FB4L 4TOYL 3KR3H 4N5ED 5A16A 4NT6B 1RK1B 3FB5A 3STLA 1WEJH 5ADOL 3KYOA 5F9DC 3PL6B 4PRPE 1OM3H 3LKNA 1SY6A 1LP9F 4GRWB 3HE7A 1UM5H 5FYKL 5KVFL 3ZTJG 3KLSA 3GI8L 3L5IA 2WBJC 4LSTH 5L88L 1MNUL 1CFQB 3QIBB 3WJJA 3QEQE 4UOW1 4I1NB 4C83A 1T1ZB 1CQKA 1U6AL 1JF6A 1HHKB 1KCSL 5EU4B 4R6UA 4NWUH 2ARJA 1CDCA 4KJYA 3G5XA 4V1DB 2W38A 3WIHH 5I19L 4PRIB 5FDYA 4JPWH 3KYKL 2YN3A 3QQ4B 1OPGL 3GKZA 3CFBA 3IDYC 3SDAB 1EVTC 5HYEA 2J8HA 3JBG7 3LRHA 3GZKA 2V9TA 3ROOA 2GJZB 3S8WA 4NP4L 1QVOB 4EBQL 2BNUB 4NQCE 5D1ZA 1X5FA 4PG9A 1U8KB 5AYUL 4TULH 3MLWL 4PP1D 2QQNL 4FFZH 2EE6A 1A2YA 3EFDH 4ZOEA 3MFFA 4JFFB 2DYPB 4FTVA 3RPKA 4KK9C 3MRRA 1CLCA 1JNNH 4IJ3B 4H26A 3UBXA 4PY8I 1CGSL 1WV7T 5C9JB 3K8KA 3FHQA 3TBSB 4OV5B 3GO1L 2L0DA 3K8MA 2MNUA 3F7RA 3SKOA 2E7LC 1DLHB 4J3XA 1WITA 3NPSC 3U6RA 1F00I 3MLSH 5D72H 1IAMA 2D7QA 3MRHB 3V2AR 4M7LT 2Q3AA 4PTTB 2WW8A 5HGAA 5HGDB 4XCEA 1WAAF 5CZXD 4ENED 2FYYA 1FORH 2J1KA 1F3JB 3HE6D 1HZHL 4L4JA 3TN0C 3HN3A 2FLRT 5E2VH 2K7QA 3HLAB 4JKPH 3O8XA 1GZQA 4MAUH 2L7UA 4PJFA 5GS0D 1IEAA 1L0XA 3PABA 3CJJA 3QIUD 1KPUB 5DRXA 3U83A 3WBDA 1ZLSH 4CNIA 5IF0B 1FL3A 3GNML 4LKXB 3RU8H 3G08B 5CILL 1ZGLM 4OZIE 1RI8A 3GSRB 4OLYL 1INEL 3MRGB 4L5FH 2WIIA 3D0VB 5CIPH 1EAPB 4MXVE 3H9HA 4OJFH 3U4BL 5E2UH 2O61B 3UROR 5LGHH 1NC4B 3PWVA 3UYOD 1DLFH 4JPKH 4YJZL 2FATH 1QR4A 4MLSA 4P2QD 1XH3B 1MFDL 1ZS8A 3GJFH 2GTWA 3WS6A 4L8SB 3MJ6A 2EDLA 3HZVB 4KKAC 4RMUA 5GS0H 3ILQD 1OTSD 1NGWB 4YHML 3VGAB 5D93C 4Z7VA 2X4OA 1JNHA 4MJIA 2UZXB 5D5MA 3D2UB 1NQBA 1P5VA 2VLKB 2Q7YB 3GBNL 2NY3B 2PYFB 2QQKL 2WZPD 2J88H 4NQXB 2L7JA 4DZBA 1WZMA 1A6PA 1CFBA 3T1FA 2IH1B 5DUPL 5FYJD 1Q9OB 3ZTNH 1HXMB 2XT1B 3B9EA 1BP3B 1CD8A 4JN2A 3R0MA 5ANMB 5F6IB 2DQIH 5KSAC 1YUHA 4GS7C 1LO4H 2NYYC 3I75B 5C0AD 5C0CA 3KPSE 4LLDA 5E8NB 3C6LA 4J4PD 5E56A 4LVEA 3RWEB 4CADB 3MLXH 5C0BA 2VLME 3ROLB 5T3ZD 2F74A 4LIQE 1BBJA 5DT1L 2ZUVA 1JN6B 2VR5A 3P77A 5BXFB 1GC1C 5T5NF 5IBUG 3RUGB 1E6OH 3V8CA 2YRPA 4PV9B 1FZKB 1FCGA 1YEEL 2W9DL 3BIKB 4MNQB 2VQTA 2G75A 4JM2D 2HKFH 3CVIH 4IM8A 1U3HD 3F6IA 2IAMC 5FYJH 3SDXF 3HC4H 3FMGH 3OKMA 4RA0C 2W59A 2AABL 5EUOA 4PGJA 5E8DH 1GGIL 2JCCF 1E4KA 2XFXB 5ITBH 4XBPB 3CMOL 1D6VL 4D9RE 5I74C 5H2BB 2Z31A 3RI5K 4P9MH 3MOBL 3RVTD 4Q2ZA 5H37H 1OCWH 5IEKA 4XWGL 3MBEC 3RX5A 3H9ZA 2BFVH 5T3ZH 4LEOB 3GI9H 5DSCA 4PJ7E 1P84K 3TVMA 4FXGA 4GQPH 4KHXL 3GJFK 1NBYA 2AJXL 4PJ5D 3OX8A 4O02L 3MGTA 2BVOB 5I9QB 5DVLA 1J8HD 2DQEH 5FK9B 1MCFA 5K9OA 2IBZX 3BGAA 4U6YB 3VXSD 1HDMB 4JY5H 4ZS6D 5J13C 2IPTH 35C8H 2Y25A 3R06B 3HPJB 3RWIB 4PG2C 3DGGA 4RIRB 1P7QB 4M7KH 5EA0H 2CLVB 4K9EH 5DHVH 4NQVA 4P3CL 2OL3B 2V9QA 3I02A 2ICWB 4MDIA 5C0FB 1ZVSA 1FVCA 1T20B 3U46A 4LRIA 1MRCL 3SKJH 1U36A 5TDNA 1JGLL 4K94H 4ZFFA 1WFUA 4LDOB 1ZWIB 4HKXA 4FHBD 1GGTA 2FJGB 4E41E 4LGRB 1CFNA 1N3NA 1F2XK 4MHHG 4HIJB 1GIGL 2ITCB 4UUJB 3AROA 2Q8AH 1MVUB 2BJML 5HYIA 1A7NH 5TF0A 3Q3GB 2VDNH 1X4YA 1JGDB 3KJ4C 1YEKL 3LKQA 3LS4H 3RQ3A 2VXQH 1UACH 3M8OL 1OGAE 5HI5C 4ODSH 4YDLB 1MAMH 1W0VB 5DO2C 1LD9A 3TV3L 3QA3A 5EO1B 3CSYB 3HMWH 3DX8B 2X41A 1NEUA 3D85A 1OSPH 4PJEF 4IMLA 4D9QE 5EDXA 5H94B 5DD0L 3GUTB 4F15C 1FL5A 3X13B 3D18A 4NSKA 4ZNEA 5KSBB 3ZT6A 5J9PA 3T04D 1A9EB 5GGUA 1DVFD 2AJ3B 2X4NB 3KLHC 2HFEB 1UB5A 4YXHH 2B7DT 3TIEA 5HDQH 3C5JB 1B4JL 2CKBB 3PXJA 4PJBB 2LV4A 4HJ0C 4TNVK 3RNQA 3MGOB 1Z2KA 1PG7H 3FONB 2P5WE 4G6AD 5EU6E 4YX2H 4KROB 5ADPL 5DVNA 5EOCH 2ZPKH 3VG0L 3CUPB 1GL4B 2VLJE 3TZVB 4Z7OE 3IVKB 2X05A 4KGJA 4BZ2H 1X7QA 1M6OA 2IBGA 5HHXH 3V5HA 2X4PA 4KJQC 2AK4E 1R3KA 2EH8H 2Z35B 3DYPA 5CIPA 1C12A 2FL5A 4X5WB 4LSSH 2NR6D 1J11A 4KDTC 1ZLWK 1F4XH 1NLBH 4HUUB 4YUEH 3QWOA 4MXQC 4QOKB 1T7XA 5F9WB 3O6LL 5FCSH 4WHYG 3DVGB 1WBYB 3E8UH 3MLZL 1G9NH 4NPYA 1IBGL 5DD1H 3UBXI 1JWUB 1ZGLP 3GHBL 1HEZA 5ALCH 4UMGA 2AK1H 4FOMA 4DOHB 5ICXA 1J1XL 3QIUA 2CIKB 1AJ7H 3B9KA 4UB0L 3EDEA 5DK0B 4NWTH 3WNMA 4X6CA 3P4OB 2CIIB 4ZYKA 2QLVB 2F54B 1QBLL 4OLEA 4TSBL 1RIHL 3G9VA 1N0XH 2MSPA 2YXMA