4ELSA

Structure of e. coli. 1,4-dihydroxy-2- naphthoyl coenzyme a synthases (menb) in complex with bicarbonate
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
282
structure length
267
Chain Sequence
PDEAMLYAPVEWHDCSEGFEDIRYEKSTDGIAKITINRPQVRNAFRPLTVKEMIQALADARYDDNIGVIILTGAGDKAFCSGGDQKHLNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAADNAIFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRQYDAKQALDMGLVNTVVPLADLEKETVRWCREMLQNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNQKRQPDFSKFKRNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site binding and catalytic role of bicarbonate in 1,4-dihydroxy-2-naphthoyl coenzyme A synthases from vitamin K biosynthetic pathways
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords 1,4-Dihydroxy-2-naphthoyl-CoA synthase
total genus 101
structure length 267
sequence length 282
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 4elsA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4elsA01
4MOUA 3Q1TA 3SLLA 4JYLA 1XNWA 4U0HA 3ZWAA 3R9SA 5G1RA 3TVWA 4Q1IA 3QMJA 3GLMA 4U0GA 4LK5A 4GHNA 1UYTA 4QIIA 1ON3A 1DUBA 1W2XA 4FN8A 4L8KA 3GF3A 3GF7A 3IAVA 2ZQRA 5DTPA 1EY3A 3H0SA 3QWDA 5CTBA 3RSIA 2A7SA 1SG4A 5E0SA 4ELSA 1TYFA 4ASIA 1Q51A 3GKBA 4FJWD 5C90A 4WZ8B 3H02A 3TT6A 4OMRA 4IZBA 4U18A 5INGA 3OT6A 3HLN1 4ZDCA 4JOTA 4U19A 2F9IB 3N6RB 3ST9A 2FW2A 1OD2A 4EMPA 2GTRA 2F9IA 1MJ3A 4ZDFA 4ZDDA 5INFA 1K39A 3R9TA 3ISAA 5DL1A 4L6WA 1K32A 3QK8A 4Z0MA 3Q0JA 3T89A 4JSBA 4FZWA 2VSUC 4DI1A 2HW5A 1X0UA 1WDKA 3LAOA 1UYVA 5DU6A 2UZFA 4ELWA 3FDUA 1VRGA 1HNOA 5C9GA 1SZOA 3ZWCA 1FC7A 3SWXA 1O8UA 2IEXA 2F9YA 1FC6A 3G64A 4B3IA 3KQFA 1XNVA 4G2RA 1XX4A 4WYOB 3PGQA 5DU8A 2QQ3A 2D3TA 3MFMA 1DCIA 3R0OA 3PE8A 4KWBA 4IZCA 3ZWBA 2BZRA 3IBBA 2VREA 3BEZA 1XNYA 3DORA 3T8BA 5DKPA 4RYFH 4JVTA 3V5EA 4B3JA 3HP0A 1WDLA 5FUSA 3U9SB 5DU4A 5G1SA 5E0NX 4Q0GA 5KDRA 1WZ8A 3MOYA 4JJTA 3K8XA 2J5GA 3H81A 2PG8A 2X58A 4ZU2A 2VSSF 3QXZA 4OLQA 1FCFA 3BPPA 4FN7A 3P5MA 1YG8A 4K3WA 3HRXA 2W3PA 3OMEA 3P2LA 1NZYB 2J5SA 2EJ5A 2CE3A 2J5IB 3KTJA 2Q34A 2VSSA 1N6EA 4ELXA 3I47A 3RRVA 3H0JA 3FF6A 1OD4A 4F47A 2DUBA 4EMLA 3NJDA 3K50A 4FNDA 1ON9A 2ZL2A 3U9TB 3T88A 3R6HA 4JFCA 4ZDBA 3MYBA 3JU1A 3IB9A 3TV5A 4IZDA 3TZ3A 3OC7A 5JBWA 1N6DA 3H0UA 1Y7OA 3QKAA 5JBXA 3Q7HA 4WCZA 3M6NA 2VX2A 2Q35A 4RCNA 2ZL4A 2PPYA 3TT7A 4B3HA 2J5II 5KDRB 2Q2XA 5CTCA 3H0QA 3QYRA 4I42A 2PBPA 4K2NA 2X24A 2A7KA 2ZL0A 4MI2A 3TDCA 1N6FA 5DUFA 1JXZA 4U1AA 4MXIA 3HE2A 2FBMA 3VIVA 3TLFA 2CBYA 3U9RB 3PEAA 3HINA 3BF0A 2WTBA 4KD6A 4I4ZA 1TG6A 3T3WA 4HNKA 2VSUF 3PZKA 2NP9A 5MGBA 4JYJA 3TRRA 3ZW8A 3L3SA 3QXIA 3P85A 4HC8A 4GM2A 1NZYA 4EMMA 3RSTA 4RYFA 5E0SH 1YG6A 1J7XA 2FZSA 3KTHA 1FC9A 3M6MA 5DZKH 1HZDA 5KJPA 3QREA 4ZDEA 1RJNA 3T8AA 4FB8A 4YLHA 5FIFA 4JCRA 1WDMA 3GMAA 3R9QA 4U0GH 4JCSA 4NEKA 1PIXA 3V5IA 2ZL3A 3KTKA 5DTWA 4JCTA 4I52A 4FZWC 3KTIA 2C8TA 1UIYA 4OG1A 1HNUA 3ZW9A 3Q0GA 1EF9A 4K29A 5G1QA 1RJMA 4QIJA 3TVUA 3DJAA 2F6IA 5DUCA 1PJHA 5INIA 4JCQA 4KPKA 3STAA 4NNQA 3KTGA 2A81A 2ZQQA 1UYSA 3NJBA 1XO6A 3WG5A 4FNBA 2F9YB 4KNPA 2VSUA 2VSSE 5DZKA 2DEOA 5IKLB 1Q52A 2VSUE 1EF8A 4QFEA 3MT6A 2F6QA 1UYRA 4JWVA 3LKEA 2J5IA 2J5GD
chains in the Genus database with same CATH superfamily
4MOUA 3Q1TA 3SLLA 4JYLA 1XNWA 4U0HA 3ZWAA 3R9SA 5G1RA 3TVWA 4Q1IA 3QMJA 3GLMA 4U0GA 4LK5A 4GHNA 1UYTA 4QIIA 1ON3A 1DUBA 1W2XA 4FN8A 4L8KA 3GF3A 3GF7A 3IAVA 2ZQRA 5DTPA 1EY3A 3H0SA 3QWDA 5CTBA 3RSIA 2A7SA 1SG4A 5E0SA 4ELSA 1TYFA 4ASIA 1Q51A 3GKBA 4FJWD 5C90A 4WZ8B 3H02A 3TT6A 4OMRA 4J2UA 4IZBA 4U18A 5INGA 3OT6A 3HLN1 4ZDCA 4JOTA 4U19A 2F9IB 3N6RB 3ST9A 2FW2A 1OD2A 4EMPA 2GTRA 2F9IA 1MJ3A 3RQFA 4ZDFA 4ZDDA 5INFA 1K39A 3R9TA 3ISAA 5DL1A 4L6WA 1K32A 3QK8A 4Z0MA 3Q0JA 3T89A 4JSBA 4FZWA 2VSUC 4DI1A 2HW5A 1X0UA 1WDKA 3LAOA 3AJMA 1UYVA 5DU6A 3ADDA 2UZFA 4ELWA 3FDUA 1VRGA 1HNOA 5C9GA 1SZOA 3ZWCA 1FC7A 3L8IA 3SWXA 1O8UA 2IEXA 2F9YA 1FC6A 3G64A 4B3IA 3A4LA 3KQFA 1XNVA 4G2RA 1XX4A 4WYOB 3PGQA 5DU8A 2QQ3A 2D3TA 3L8JA 3MFMA 1DCIA 3R0OA 3PE8A 3O4XE 4KWBA 4IZCA 3ZWBA 2BZRA 3IBBA 2VREA 3BEZA 1XNYA 3DORA 3T8BA 5DKPA 4RYFH 4JVTA 3V5EA 4B3JA 3HP0A 1WDLA 5FUSA 3U9SB 5DU4A 5G1SA 5E0NX 3A4MA 4Q0GA 3RQGA 5KDRA 1WZ8A 3MOYA 4JJTA 3K8XA 4GEHB 2J5GA 3H81A 2PG8A 2X58A 4NARA 4ZU2A 2YJGA 2VSSF 3QXZA 4OLQA 1FCFA 3BPPA 4FN7A 3P5MA 1YG8A 4K3WA 3HRXA 2W3PA 3OMEA 3P2LA 1NZYB 2J5SA 2EJ5A 2CE3A 2J5IB 3KTJA 2Q34A 2VSSA 1N6EA 4ELXA 3I47A 3RRVA 3H0JA 3BPTA 1UX5A 3FF6A 1OD4A 4F47A 2DUBA 4EMLA 3NJDA 3A4NA 3K50A 3W8HB 4FNDA 1ON9A 2ZL2A 3U9TB 3T88A 3R6HA 2P63A 4JFCA 4HDTA 4ZDBA 3MYBA 3JU1A 3IB9A 3TV5A 4IZDA 3TZ3A 1Y64B 5HUQA 3OC7A 3ADBA 5JBWA 1N6DA 3H0UA 1Y7OA 3QKAA 5JBXA 3Q7HA 4WCZA 3M6NA 2VX2A 2Q35A 4RCNA 2ZL4A 2PPYA 3W8IB 3TT7A 4B3HA 2J5II 5KDRB 2Q2XA 5CTCA 3H0QA 3QYRA 4I42A 2PBPA 4K2NA 2X24A 2A7KA 2ZL0A 4MI2A 3TDCA 1N6FA 5DUFA 1JXZA 4U1AA 4MXIA 3HE2A 2FBMA 3VIVA 3TLFA 2CBYA 3U9RB 3PEAA 3HINA 3BF0A 2WTBA 4KD6A 4I4ZA 1TG6A 3T3WA 3AM1A 4HNKA 2VSUF 3PZKA 2NP9A 5MGBA 4JYJA 3TRRA 3L3SA 3ZW8A 3QXIA 3P85A 4HC8A 4GM2A 1NZYA 4EMMA 3RSTA 4RYFA 5E0SH 1YG6A 1J7XA 2FZSA 3KTHA 1FC9A 3M6MA 5DZKH 1HZDA 5KJPA 3QREA 4ZDEA 1RJNA 3T8AA 4FB8A 4YLHA 3IRBA 5FIFA 4JCRA 1WDMA 3GMAA 3R9QA 4U0GH 4JCSA 4NEKA 1PIXA 3V5IA 2ZL3A 3RQEA 3KTKA 5DTWA 4JCTA 4I52A 4FZWC 3KTIA 2C8TA 1UIYA 4OG1A 1HNUA 3ZW9A 3Q0GA 1EF9A 4K29A 5G1QA 1RJMA 4QIJA 3TVUA 3DJAA 2F6IA 5DUCA 1PJHA 5INIA 4JCQA 4KPKA 3STAA 4NNQA 3KTGA 2A81A 2ZQQA 1UX4A 1UYSA 3NJBA 1XO6A 3WG5A 4FNBA 2F9YB 4KNPA 2VSUA 2VSSE 5DZKA 2DEOA 5IKLB 1Q52A 2VSUE 1EF8A 4QFEA 3MT6A 2F6QA 1UYRA 4JWVA 3LKEA 2J5IA 3ADCA 2J5GD
chains in the Genus database with same CATH topology
4MOUA 3Q1TA 3SLLA 4JYLA 1XNWA 4U0HA 3ZWAA 3R9SA 5G1RA 3TVWA 4Q1IA 3QMJA 3GLMA 4U0GA 4LK5A 4GHNA 1UYTA 4QIIA 1ON3A 1DUBA 1W2XA 4FN8A 4L8KA 3GF3A 3GF7A 3IAVA 2ZQRA 5DTPA 1EY3A 3H0SA 3QWDA 5CTBA 3RSIA 2A7SA 1SG4A 5E0SA 4ELSA 1TYFA 4ASIA 1Q51A 3GKBA 4FJWD 5C90A 4WZ8B 3H02A 3TT6A 4OMRA 4J2UA 4IZBA 4U18A 5INGA 3OT6A 3HLN1 4ZDCA 4JOTA 4U19A 2F9IB 3N6RB 3ST9A 2FW2A 1OD2A 4EMPA 2GTRA 2F9IA 1MJ3A 4ZDFA 4ZDDA 5INFA 1K39A 3R9TA 3ISAA 5DL1A 4L6WA 1K32A 3QK8A 4Z0MA 3Q0JA 3T89A 4JSBA 4FZWA 2VSUC 4DI1A 2HW5A 1X0UA 1WDKA 3LAOA 1UYVA 5DU6A 2UZFA 4ELWA 3FDUA 1VRGA 1HNOA 5C9GA 1SZOA 3ZWCA 1FC7A 3SWXA 1O8UA 2IEXA 2F9YA 1FC6A 3G64A 4B3IA 3KQFA 1XNVA 4G2RA 1XX4A 4WYOB 3PGQA 5DU8A 2QQ3A 2D3TA 3MFMA 1DCIA 3R0OA 3PE8A 4KWBA 4IZCA 3ZWBA 2BZRA 3IBBA 2VREA 3BEZA 1XNYA 3DORA 3T8BA 5DKPA 4RYFH 4JVTA 3V5EA 4B3JA 3HP0A 1WDLA 5FUSA 3U9SB 5DU4A 5G1SA 5E0NX 4Q0GA 5KDRA 1WZ8A 3MOYA 4JJTA 3K8XA 2J5GA 3H81A 2PG8A 2X58A 4NARA 4ZU2A 2YJGA 2VSSF 3QXZA 4OLQA 1FCFA 3BPPA 4FN7A 3P5MA 1YG8A 4K3WA 3HRXA 2W3PA 3OMEA 3P2LA 1NZYB 2J5SA 2EJ5A 2CE3A 2J5IB 3KTJA 2Q34A 2VSSA 1N6EA 4ELXA 3I47A 3RRVA 3H0JA 3BPTA 3FF6A 1OD4A 4F47A 2DUBA 4EMLA 3NJDA 3K50A 4FNDA 1ON9A 2ZL2A 3U9TB 3T88A 3R6HA 4JFCA 4HDTA 4ZDBA 3MYBA 3JU1A 3IB9A 3TV5A 4IZDA 3TZ3A 5HUQA 3OC7A 5JBWA 1N6DA 3H0UA 1Y7OA 3QKAA 5JBXA 3Q7HA 4WCZA 3M6NA 2VX2A 2Q35A 4RCNA 2ZL4A 2PPYA 3TT7A 4B3HA 2J5II 5KDRB 2Q2XA 5CTCA 3H0QA 3QYRA 4I42A 2PBPA 4K2NA 2X24A 2A7KA 2ZL0A 4MI2A 3TDCA 1N6FA 5DUFA 1JXZA 4U1AA 4MXIA 3HE2A 2FBMA 3VIVA 3TLFA 2CBYA 3U9RB 3PEAA 3HINA 3BF0A 2WTBA 4KD6A 4I4ZA 1TG6A 3T3WA 4HNKA 2VSUF 3PZKA 2NP9A 5MGBA 4JYJA 3TRRA 3ZW8A 3L3SA 3QXIA 3P85A 4HC8A 4GM2A 1NZYA 4EMMA 3RSTA 4RYFA 5E0SH 1YG6A 1J7XA 2FZSA 3KTHA 1FC9A 3M6MA 5DZKH 1HZDA 5KJPA 3QREA 4ZDEA 1RJNA 3T8AA 4FB8A 4YLHA 5FIFA 4JCRA 1WDMA 3GMAA 3R9QA 4U0GH 4JCSA 4NEKA 1PIXA 3V5IA 2ZL3A 3KTKA 5DTWA 4JCTA 4I52A 4FZWC 3KTIA 2C8TA 1UIYA 4OG1A 1HNUA 3ZW9A 3Q0GA 1EF9A 4K29A 5G1QA 1RJMA 4QIJA 3TVUA 3DJAA 2F6IA 5DUCA 1PJHA 5INIA 4JCQA 4KPKA 3STAA 4NNQA 3KTGA 2A81A 2ZQQA 1UYSA 3NJBA 1XO6A 3WG5A 4FNBA 2F9YB 4KNPA 2VSUA 2VSSE 5DZKA 2DEOA 5IKLB 1Q52A 2VSUE 1EF8A 4QFEA 3MT6A 2F6QA 1UYRA 4JWVA 3LKEA 2J5IA 2J5GD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MOU A;  3Q1T A;  3SLL A;  4JYL A;  1XNW A;  4U0H A;  3ZWA A;  3R9S A;  5G1R A;  3TVW A;  4Q1I A;  3QMJ A;  3GLM A;  4U0G A;  4LK5 A;  4GHN A;  1UYT A;  4QII A;  1ON3 A;  1DUB A;  1W2X A;  4FN8 A;  4L8K A;  3GF3 A;  3GF7 A;  3IAV A;  2ZQR A;  5DTP A;  1EY3 A;  3H0S A;  3QWD A;  5CTB A;  3RSI A;  2A7S A;  1SG4 A;  5E0S A;  4ELS A;  1TYF A;  4ASI A;  1Q51 A;  3GKB A;  4FJW D;  5C90 A;  4WZ8 B;  3H02 A;  3TT6 A;  4OMR A;  4IZB A;  4U18 A;  5ING A;  3OT6 A;  3HLN 1;  4ZDC A;  4JOT A;  4U19 A;  2F9I B;  3N6R B;  3ST9 A;  2FW2 A;  1OD2 A;  4EMP A;  2GTR A;  2F9I A;  1MJ3 A;  4ZDF A;  4ZDD A;  5INF A;  1K39 A;  3R9T A;  3ISA A;  5DL1 A;  4L6W A;  1K32 A;  3QK8 A;  4Z0M A;  3Q0J A;  3T89 A;  4JSB A;  4FZW A;  2VSU C;  4DI1 A;  2HW5 A;  1X0U A;  1WDK A;  3LAO A;  1UYV A;  5DU6 A;  2UZF A;  4ELW A;  3FDU A;  1VRG A;  1HNO A;  5C9G A;  1SZO A;  3ZWC A;  1FC7 A;  3SWX A;  1O8U A;  2IEX A;  2F9Y A;  1FC6 A;  3G64 A;  4B3I A;  3KQF A;  1XNV A;  4G2R A;  1XX4 A;  4WYO B;  3PGQ A;  5DU8 A;  2QQ3 A;  2D3T A;  3MFM A;  1DCI A;  3R0O A;  3PE8 A;  4KWB A;  4IZC A;  3ZWB A;  2BZR A;  3IBB A;  2VRE A;  3BEZ A;  1XNY A;  3DOR A;  3T8B A;  5DKP A;  4RYF H;  4JVT A;  3V5E A;  4B3J A;  3HP0 A;  1WDL A;  5FUS A;  3U9S B;  5DU4 A;  5G1S A;  5E0N X;  4Q0G A;  5KDR A;  1WZ8 A;  3MOY A;  4JJT A;  3K8X A;  2J5G A;  3H81 A;  2PG8 A;  2X58 A;  4ZU2 A;  2VSS F;  3QXZ A;  4OLQ A;  1FCF A;  3BPP A;  4FN7 A;  3P5M A;  1YG8 A;  4K3W A;  3HRX A;  2W3P A;  3OME A;  3P2L A;  1NZY B;  2J5S A;  2EJ5 A;  2CE3 A;  2J5I B;  3KTJ A;  2Q34 A;  2VSS A;  1N6E A;  4ELX A;  3I47 A;  3RRV A;  3H0J A;  3FF6 A;  1OD4 A;  4F47 A;  2DUB A;  4EML A;  3NJD A;  3K50 A;  4FND A;  1ON9 A;  2ZL2 A;  3U9T B;  3T88 A;  3R6H A;  4JFC A;  4ZDB A;  3MYB A;  3JU1 A;  3IB9 A;  3TV5 A;  4IZD A;  3TZ3 A;  3OC7 A;  5JBW A;  1N6D A;  3H0U A;  1Y7O A;  3QKA A;  5JBX A;  3Q7H A;  4WCZ A;  3M6N A;  2VX2 A;  2Q35 A;  4RCN A;  2ZL4 A;  2PPY A;  3TT7 A;  4B3H A;  2J5I I;  5KDR B;  2Q2X A;  5CTC A;  3H0Q A;  3QYR A;  4I42 A;  2PBP A;  4K2N A;  2X24 A;  2A7K A;  2ZL0 A;  4MI2 A;  3TDC A;  1N6F A;  5DUF A;  1JXZ A;  4U1A A;  4MXI A;  3HE2 A;  2FBM A;  3VIV A;  3TLF A;  2CBY A;  3U9R B;  3PEA A;  3HIN A;  3BF0 A;  2WTB A;  4KD6 A;  4I4Z A;  1TG6 A;  3T3W A;  4HNK A;  2VSU F;  3PZK A;  2NP9 A;  5MGB A;  4JYJ A;  3TRR A;  3ZW8 A;  3L3S A;  3QXI A;  3P85 A;  4HC8 A;  4GM2 A;  1NZY A;  4EMM A;  3RST A;  4RYF A;  5E0S H;  1YG6 A;  1J7X A;  2FZS A;  3KTH A;  1FC9 A;  3M6M A;  5DZK H;  1HZD A;  5KJP A;  3QRE A;  4ZDE A;  1RJN A;  3T8A A;  4FB8 A;  4YLH A;  5FIF A;  4JCR A;  1WDM A;  3GMA A;  3R9Q A;  4U0G H;  4JCS A;  4NEK A;  1PIX A;  3V5I A;  2ZL3 A;  3KTK A;  5DTW A;  4JCT A;  4I52 A;  4FZW C;  3KTI A;  2C8T A;  1UIY A;  4OG1 A;  1HNU A;  3ZW9 A;  3Q0G A;  1EF9 A;  4K29 A;  5G1Q A;  1RJM A;  4QIJ A;  3TVU A;  3DJA A;  2F6I A;  5DUC A;  1PJH A;  5INI A;  4JCQ A;  4KPK A;  3STA A;  4NNQ A;  3KTG A;  2A81 A;  2ZQQ A;  1UYS A;  3NJB A;  1XO6 A;  3WG5 A;  4FNB A;  2F9Y B;  4KNP A;  2VSU A;  2VSS E;  5DZK A;  2DEO A;  5IKL B;  1Q52 A;  2VSU E;  1EF8 A;  4QFE A;  3MT6 A;  2F6Q A;  1UYR A;  4JWV A;  3LKE A;  2J5I A;  2J5G D; 
#chains in the Genus database with same CATH topology
 4MOU A;  3Q1T A;  3SLL A;  4JYL A;  1XNW A;  4U0H A;  3ZWA A;  3R9S A;  5G1R A;  3TVW A;  4Q1I A;  3QMJ A;  3GLM A;  4U0G A;  4LK5 A;  4GHN A;  1UYT A;  4QII A;  1ON3 A;  1DUB A;  1W2X A;  4FN8 A;  4L8K A;  3GF3 A;  3GF7 A;  3IAV A;  2ZQR A;  5DTP A;  1EY3 A;  3H0S A;  3QWD A;  5CTB A;  3RSI A;  2A7S A;  1SG4 A;  5E0S A;  4ELS A;  1TYF A;  4ASI A;  1Q51 A;  3GKB A;  4FJW D;  5C90 A;  4WZ8 B;  3H02 A;  3TT6 A;  4OMR A;  4J2U A;  4IZB A;  4U18 A;  5ING A;  3OT6 A;  3HLN 1;  4ZDC A;  4JOT A;  4U19 A;  2F9I B;  3N6R B;  3ST9 A;  2FW2 A;  1OD2 A;  4EMP A;  2GTR A;  2F9I A;  1MJ3 A;  3RQF A;  4ZDF A;  4ZDD A;  5INF A;  1K39 A;  3R9T A;  3ISA A;  5DL1 A;  4L6W A;  1K32 A;  3QK8 A;  4Z0M A;  3Q0J A;  3T89 A;  4JSB A;  4FZW A;  2VSU C;  4DI1 A;  2HW5 A;  1X0U A;  1WDK A;  3LAO A;  3AJM A;  1UYV A;  5DU6 A;  3ADD A;  2UZF A;  4ELW A;  3FDU A;  1VRG A;  1HNO A;  5C9G A;  1SZO A;  3ZWC A;  1FC7 A;  3L8I A;  3SWX A;  1O8U A;  2IEX A;  2F9Y A;  1FC6 A;  3G64 A;  4B3I A;  3A4L A;  3KQF A;  1XNV A;  4G2R A;  1XX4 A;  4WYO B;  3PGQ A;  5DU8 A;  2QQ3 A;  2D3T A;  3L8J A;  3MFM A;  1DCI A;  3R0O A;  3PE8 A;  3O4X E;  4KWB A;  4IZC A;  3ZWB A;  2BZR A;  3IBB A;  2VRE A;  3BEZ A;  1XNY A;  3DOR A;  3T8B A;  5DKP A;  4RYF H;  4JVT A;  3V5E A;  4B3J A;  3HP0 A;  1WDL A;  5FUS A;  3U9S B;  5DU4 A;  5G1S A;  5E0N X;  3A4M A;  4Q0G A;  3RQG A;  5KDR A;  1WZ8 A;  3MOY A;  4JJT A;  3K8X A;  4GEH B;  2J5G A;  3H81 A;  2PG8 A;  2X58 A;  4NAR A;  4ZU2 A;  2YJG A;  2VSS F;  3QXZ A;  4OLQ A;  1FCF A;  3BPP A;  4FN7 A;  3P5M A;  1YG8 A;  4K3W A;  3HRX A;  2W3P A;  3OME A;  3P2L A;  1NZY B;  2J5S A;  2EJ5 A;  2CE3 A;  2J5I B;  3KTJ A;  2Q34 A;  2VSS A;  1N6E A;  4ELX A;  3I47 A;  3RRV A;  3H0J A;  3BPT A;  1UX5 A;  3FF6 A;  1OD4 A;  4F47 A;  2DUB A;  4EML A;  3NJD A;  3A4N A;  3K50 A;  3W8H B;  4FND A;  1ON9 A;  2ZL2 A;  3U9T B;  3T88 A;  3R6H A;  2P63 A;  4JFC A;  4HDT A;  4ZDB A;  3MYB A;  3JU1 A;  3IB9 A;  3TV5 A;  4IZD A;  3TZ3 A;  1Y64 B;  5HUQ A;  3OC7 A;  3ADB A;  5JBW A;  1N6D A;  3H0U A;  1Y7O A;  3QKA A;  5JBX A;  3Q7H A;  4WCZ A;  3M6N A;  2VX2 A;  2Q35 A;  4RCN A;  2ZL4 A;  2PPY A;  3W8I B;  3TT7 A;  4B3H A;  2J5I I;  5KDR B;  2Q2X A;  5CTC A;  3H0Q A;  3QYR A;  4I42 A;  2PBP A;  4K2N A;  2X24 A;  2A7K A;  2ZL0 A;  4MI2 A;  3TDC A;  1N6F A;  5DUF A;  1JXZ A;  4U1A A;  4MXI A;  3HE2 A;  2FBM A;  3VIV A;  3TLF A;  2CBY A;  3U9R B;  3PEA A;  3HIN A;  3BF0 A;  2WTB A;  4KD6 A;  4I4Z A;  1TG6 A;  3T3W A;  3AM1 A;  4HNK A;  2VSU F;  3PZK A;  2NP9 A;  5MGB A;  4JYJ A;  3TRR A;  3L3S A;  3ZW8 A;  3QXI A;  3P85 A;  4HC8 A;  4GM2 A;  1NZY A;  4EMM A;  3RST A;  4RYF A;  5E0S H;  1YG6 A;  1J7X A;  2FZS A;  3KTH A;  1FC9 A;  3M6M A;  5DZK H;  1HZD A;  5KJP A;  3QRE A;  4ZDE A;  1RJN A;  3T8A A;  4FB8 A;  4YLH A;  3IRB A;  5FIF A;  4JCR A;  1WDM A;  3GMA A;  3R9Q A;  4U0G H;  4JCS A;  4NEK A;  1PIX A;  3V5I A;  2ZL3 A;  3RQE A;  3KTK A;  5DTW A;  4JCT A;  4I52 A;  4FZW C;  3KTI A;  2C8T A;  1UIY A;  4OG1 A;  1HNU A;  3ZW9 A;  3Q0G A;  1EF9 A;  4K29 A;  5G1Q A;  1RJM A;  4QIJ A;  3TVU A;  3DJA A;  2F6I A;  5DUC A;  1PJH A;  5INI A;  4JCQ A;  4KPK A;  3STA A;  4NNQ A;  3KTG A;  2A81 A;  2ZQQ A;  1UX4 A;  1UYS A;  3NJB A;  1XO6 A;  3WG5 A;  4FNB A;  2F9Y B;  4KNP A;  2VSU A;  2VSS E;  5DZK A;  2DEO A;  5IKL B;  1Q52 A;  2VSU E;  1EF8 A;  4QFE A;  3MT6 A;  2F6Q A;  1UYR A;  4JWV A;  3LKE A;  2J5I A;  3ADC A;  2J5G D; 
#chains in the Genus database with same CATH homology
 4MOU A;  3Q1T A;  3SLL A;  4JYL A;  1XNW A;  4U0H A;  3ZWA A;  3R9S A;  5G1R A;  3TVW A;  4Q1I A;  3QMJ A;  3GLM A;  4U0G A;  4LK5 A;  4GHN A;  1UYT A;  4QII A;  1ON3 A;  1DUB A;  1W2X A;  4FN8 A;  4L8K A;  3GF3 A;  3GF7 A;  3IAV A;  2ZQR A;  5DTP A;  1EY3 A;  3H0S A;  3QWD A;  5CTB A;  3RSI A;  2A7S A;  1SG4 A;  5E0S A;  4ELS A;  1TYF A;  4ASI A;  1Q51 A;  3GKB A;  4FJW D;  5C90 A;  4WZ8 B;  3H02 A;  3TT6 A;  4OMR A;  4J2U A;  4IZB A;  4U18 A;  5ING A;  3OT6 A;  3HLN 1;  4ZDC A;  4JOT A;  4U19 A;  2F9I B;  3N6R B;  3ST9 A;  2FW2 A;  1OD2 A;  4EMP A;  2GTR A;  2F9I A;  1MJ3 A;  4ZDF A;  4ZDD A;  5INF A;  1K39 A;  3R9T A;  3ISA A;  5DL1 A;  4L6W A;  1K32 A;  3QK8 A;  4Z0M A;  3Q0J A;  3T89 A;  4JSB A;  4FZW A;  2VSU C;  4DI1 A;  2HW5 A;  1X0U A;  1WDK A;  3LAO A;  1UYV A;  5DU6 A;  2UZF A;  4ELW A;  3FDU A;  1VRG A;  1HNO A;  5C9G A;  1SZO A;  3ZWC A;  1FC7 A;  3SWX A;  1O8U A;  2IEX A;  2F9Y A;  1FC6 A;  3G64 A;  4B3I A;  3KQF A;  1XNV A;  4G2R A;  1XX4 A;  4WYO B;  3PGQ A;  5DU8 A;  2QQ3 A;  2D3T A;  3MFM A;  1DCI A;  3R0O A;  3PE8 A;  4KWB A;  4IZC A;  3ZWB A;  2BZR A;  3IBB A;  2VRE A;  3BEZ A;  1XNY A;  3DOR A;  3T8B A;  5DKP A;  4RYF H;  4JVT A;  3V5E A;  4B3J A;  3HP0 A;  1WDL A;  5FUS A;  3U9S B;  5DU4 A;  5G1S A;  5E0N X;  4Q0G A;  5KDR A;  1WZ8 A;  3MOY A;  4JJT A;  3K8X A;  2J5G A;  3H81 A;  2PG8 A;  2X58 A;  4NAR A;  4ZU2 A;  2YJG A;  2VSS F;  3QXZ A;  4OLQ A;  1FCF A;  3BPP A;  4FN7 A;  3P5M A;  1YG8 A;  4K3W A;  3HRX A;  2W3P A;  3OME A;  3P2L A;  1NZY B;  2J5S A;  2EJ5 A;  2CE3 A;  2J5I B;  3KTJ A;  2Q34 A;  2VSS A;  1N6E A;  4ELX A;  3I47 A;  3RRV A;  3H0J A;  3BPT A;  3FF6 A;  1OD4 A;  4F47 A;  2DUB A;  4EML A;  3NJD A;  3K50 A;  4FND A;  1ON9 A;  2ZL2 A;  3U9T B;  3T88 A;  3R6H A;  4JFC A;  4HDT A;  4ZDB A;  3MYB A;  3JU1 A;  3IB9 A;  3TV5 A;  4IZD A;  3TZ3 A;  5HUQ A;  3OC7 A;  5JBW A;  1N6D A;  3H0U A;  1Y7O A;  3QKA A;  5JBX A;  3Q7H A;  4WCZ A;  3M6N A;  2VX2 A;  2Q35 A;  4RCN A;  2ZL4 A;  2PPY A;  3TT7 A;  4B3H A;  2J5I I;  5KDR B;  2Q2X A;  5CTC A;  3H0Q A;  3QYR A;  4I42 A;  2PBP A;  4K2N A;  2X24 A;  2A7K A;  2ZL0 A;  4MI2 A;  3TDC A;  1N6F A;  5DUF A;  1JXZ A;  4U1A A;  4MXI A;  3HE2 A;  2FBM A;  3VIV A;  3TLF A;  2CBY A;  3U9R B;  3PEA A;  3HIN A;  3BF0 A;  2WTB A;  4KD6 A;  4I4Z A;  1TG6 A;  3T3W A;  4HNK A;  2VSU F;  3PZK A;  2NP9 A;  5MGB A;  4JYJ A;  3TRR A;  3ZW8 A;  3L3S A;  3QXI A;  3P85 A;  4HC8 A;  4GM2 A;  1NZY A;  4EMM A;  3RST A;  4RYF A;  5E0S H;  1YG6 A;  1J7X A;  2FZS A;  3KTH A;  1FC9 A;  3M6M A;  5DZK H;  1HZD A;  5KJP A;  3QRE A;  4ZDE A;  1RJN A;  3T8A A;  4FB8 A;  4YLH A;  5FIF A;  4JCR A;  1WDM A;  3GMA A;  3R9Q A;  4U0G H;  4JCS A;  4NEK A;  1PIX A;  3V5I A;  2ZL3 A;  3KTK A;  5DTW A;  4JCT A;  4I52 A;  4FZW C;  3KTI A;  2C8T A;  1UIY A;  4OG1 A;  1HNU A;  3ZW9 A;  3Q0G A;  1EF9 A;  4K29 A;  5G1Q A;  1RJM A;  4QIJ A;  3TVU A;  3DJA A;  2F6I A;  5DUC A;  1PJH A;  5INI A;  4JCQ A;  4KPK A;  3STA A;  4NNQ A;  3KTG A;  2A81 A;  2ZQQ A;  1UYS A;  3NJB A;  1XO6 A;  3WG5 A;  4FNB A;  2F9Y B;  4KNP A;  2VSU A;  2VSS E;  5DZK A;  2DEO A;  5IKL B;  1Q52 A;  2VSU E;  1EF8 A;  4QFE A;  3MT6 A;  2F6Q A;  1UYR A;  4JWV A;  3LKE A;  2J5I A;  2J5G D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...