4ELWA

Structure of e. coli. 1,4-dihydroxy-2- naphthoyl coenzyme a synthases (menb) in complex with nitrate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
282
structure length
267
Chain Sequence
b'PDEAMLYAPVEWHDCSEGFEDIRYEKSTDGIAKITINRPQVRNAFRPLTVKEMIQALADARYDDNIGVIILTGAGDKAFCSGGDQKHLNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAADNAIFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRQYDAKQALDMGLVNTVVPLADLEKETVRWCREMLQNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNQKRQPDFSKFKRNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,4-Dihydroxy-2-naphthoyl-CoA synthase
publication title Active site binding and catalytic role of bicarbonate in 1,4-dihydroxy-2-naphthoyl coenzyme A synthases from vitamin K biosynthetic pathways
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 103
structure length 267
sequence length 282
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 4elwA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4elwA01
4I52A 1YG8A 3H0QA 4FN8A 4G2RA 2J5IB 2VSUE 5JBXA 5FIFA 3U9SB 4WZ8B 3TVWA 3KTGA 3FDUA 4ZDBA 4FN7A 5G1RA 1JXZA 1WDLA 5G1QA 1N6FA 3TT6A 5KJPA 2J5IA 4OG1A 5INIA 2FBMA 3N6RB 4U1AA 3IAVA 4QIJA 3KTIA 5E0SH 4ASIA 1XO6A 5E0SA 1RJNA 2J5GD 3MYBA 1UYSA 4L6WA 5KDRB 4K3WA 4RCNA 4I4ZA 2CE3A 1SG4A 3TRRA 4EMMA 2X24A 3BPPA 4JCSA 5C90A 5KDRA 3TDCA 2NP9A 1HNUA 2F6QA 4F47A 3PE8A 3R0OA 4JYJA 5DUCA 1X0UA 4Q1IA 4MI2A 4MOUA 5MGBA 4EMLA 3RRVA 4K2NA 1WDKA 3ZWBA 3RSIA 3TV5A 3R9TA 1XNYA 1ON3A 4LK5A 2ZQRA 2ZQQA 2VX2A 3K8XA 3I47A 4JSBA 3OT6A 1SZOA 3OMEA 2Q34A 1W2XA 4QFEA 3QXZA 4JWVA 5CTCA 4NEKA 2PG8A 3M6MA 3QREA 1K32A 4FJWD 4FNBA 4ZDDA 1WZ8A 1FC9A 3ZWCA 2VSUC 4JCTA 1MJ3A 2Q35A 5INGA 3LKEA 3P85A 3Q0JA 3ISAA 2CBYA 5DZKH 4I42A 3KTHA 4KWBA 3NJDA 3GMAA 3HP0A 1EY3A 4NNQA 2VSSE 4OMRA 1N6EA 5DTPA 3DORA 1FCFA 4U19A 3H0UA 3K50A 4QIIA 3OC7A 4Q0GA 5DU4A 3G64A 3V5EA 4Z0MA 5G1SA 3QYRA 2D3TA 4JJTA 1EF8A 1OD2A 1DCIA 4IZCA 1UYVA 3H0JA 3T3WA 3U9TB 3P2LA 1DUBA 1PIXA 2A7KA 3T8AA 3M6NA 3NJBA 3TVUA 4B3JA 3FF6A 5DL1A 4ELSA 2A81A 4FB8A 2VSUF 4HNKA 1PJHA 3V5IA 4WCZA 3H02A 2BZRA 2VSSF 3ZW8A 5INFA 5IKLB 1XX4A 3QXIA 4IZDA 4K29A 3R6HA 3T88A 4JFCA 3IB9A 4ELWA 3Q0GA 5C9GA 3R9QA 4ZDFA 1UIYA 1XNVA 3GF3A 3KQFA 2W3PA 3QMJA 4RYFH 4ZDEA 5CTBA 4RYFA 1Y7OA 3HE2A 3HRXA 3L3SA 3WG5A 1HZDA 4ZDCA 1ON9A 2ZL3A 2VREA 2PBPA 2ZL2A 2F9IB 3TT7A 1TG6A 4U0HA 1VRGA 1WDMA 3HLN1 4KNPA 2J5II 4JVTA 1HNOA 5JBWA 2FZSA 3HINA 1RJMA 4L8KA 2HW5A 4GHNA 2F9IA 3BEZA 4KD6A 3T8BA 2Q2XA 5DTWA 5DZKA 3ZWAA 2PPYA 4U0GH 3VIVA 2J5GA 5FUSA 3KTJA 2EJ5A 3ZW9A 3STAA 4FZWC 4WYOB 3MOYA 5E0NX 1FC6A 1NZYB 3ST9A 3GKBA 3SWXA 2F9YB 2WTBA 4ELXA 3TLFA 3PEAA 1NZYA 4GM2A 1TYFA 4U18A 2ZL0A 2J5SA 4JYLA 5DU6A 4FNDA 1UYRA 2UZFA 2C8TA 2F9YA 2A7SA 2DUBA 3TZ3A 1YG6A 3QWDA 5DU8A 3DJAA 3PZKA 4KPKA 4OLQA 3H0SA 4B3IA 2QQ3A 4EMPA 2FW2A 4IZBA 1N6DA 4B3HA 4YLHA 3IBBA 3U9RB 3Q7HA 3BF0A 3H81A 3KTKA 1UYTA 3R9SA 3QKAA 1Q52A 2DEOA 1EF9A 3GLMA 3QK8A 4HC8A 3PGQA 5DUFA 1OD4A 1O8UA 2VSUA 3GF7A 3P5MA 3LAOA 1Q51A 2VSSA 5DKPA 4ZU2A 1XNWA 2GTRA 2F6IA 3RSTA 2ZL4A 4JCRA 3T89A 4JOTA 3SLLA 3JU1A 4MXIA 3Q1TA 2X58A 4JCQA 1K39A 4U0GA 4DI1A 4FZWA 1J7XA 1FC7A 3MFMA 3MT6A 2IEXA
chains in the Genus database with same CATH superfamily
4I52A 1YG8A 3H0QA 4FN8A 4G2RA 2J5IB 2VSUE 5JBXA 5FIFA 3U9SB 4WZ8B 3TVWA 3KTGA 3FDUA 4ZDBA 4FN7A 5G1RA 1JXZA 1WDLA 5G1QA 1N6FA 3TT6A 5KJPA 3AJMA 2J5IA 4OG1A 5INIA 2FBMA 3N6RB 4U1AA 3IAVA 4QIJA 3A4MA 3KTIA 5E0SH 4ASIA 1XO6A 5E0SA 1RJNA 2J5GD 3MYBA 1UYSA 4L6WA 5KDRB 4K3WA 4RCNA 4I4ZA 2CE3A 1SG4A 3TRRA 4EMMA 2X24A 3BPPA 4JCSA 5C90A 5KDRA 3A4LA 3TDCA 2NP9A 1HNUA 2F6QA 4F47A 3PE8A 3R0OA 4JYJA 5DUCA 1X0UA 3RQFA 4Q1IA 4MI2A 2P63A 4MOUA 5MGBA 4EMLA 3RRVA 4K2NA 1WDKA 3ZWBA 3RSIA 3TV5A 3R9TA 3W8IB 1XNYA 1ON3A 4LK5A 2ZQRA 2ZQQA 2VX2A 3K8XA 3I47A 4JSBA 3OT6A 1SZOA 3OMEA 2Q34A 1W2XA 4QFEA 5CTCA 3QXZA 4JWVA 4NEKA 2PG8A 3M6MA 3QREA 1K32A 4FJWD 4FNBA 4ZDDA 1WZ8A 1FC9A 3ZWCA 2VSUC 4JCTA 1MJ3A 2Q35A 1Y64B 5INGA 3LKEA 3P85A 3Q0JA 3ISAA 2CBYA 5DZKH 4I42A 3KTHA 4KWBA 3NJDA 3GMAA 3IRBA 3HP0A 1EY3A 4NNQA 2VSSE 4OMRA 1N6EA 5DTPA 3DORA 1FCFA 4U19A 3H0UA 3K50A 4QIIA 3OC7A 4Q0GA 5DU4A 3G64A 3V5EA 4Z0MA 5G1SA 3QYRA 2D3TA 4JJTA 1EF8A 1OD2A 1DCIA 4IZCA 1UYVA 3H0JA 3T3WA 3U9TB 3P2LA 1DUBA 1PIXA 2A7KA 3T8AA 3M6NA 3NJBA 1UX4A 3TVUA 4B3JA 3FF6A 5DL1A 4ELSA 2A81A 4FB8A 2VSUF 4HNKA 1PJHA 3V5IA 4WCZA 3H02A 2BZRA 2VSSF 3ZW8A 3RQGA 4J2UA 5INFA 5IKLB 1XX4A 3QXIA 4IZDA 4K29A 3R6HA 3T88A 4JFCA 3IB9A 4ELWA 3Q0GA 5C9GA 3R9QA 4ZDFA 1UIYA 1XNVA 3AM1A 3GF3A 3KQFA 2W3PA 3QMJA 4RYFH 4ZDEA 5CTBA 4RYFA 1Y7OA 3HE2A 3HRXA 3L3SA 3WG5A 1HZDA 4ZDCA 1ON9A 2ZL3A 2VREA 4NARA 2PBPA 2ZL2A 2F9IB 3TT7A 1TG6A 4U0HA 1VRGA 1WDMA 3HLN1 3RQEA 4KNPA 2J5II 4JVTA 1HNOA 5JBWA 2FZSA 3A4NA 3HINA 1RJMA 4L8KA 2HW5A 4GHNA 2F9IA 3BEZA 4KD6A 3T8BA 2Q2XA 5DTWA 5DZKA 3ZWAA 2PPYA 4U0GH 3VIVA 2J5GA 5FUSA 3KTJA 4GEHB 2EJ5A 3ZW9A 3L8JA 3STAA 4FZWC 4WYOB 3MOYA 5E0NX 1FC6A 1NZYB 3ST9A 1UX5A 3GKBA 3SWXA 2F9YB 2WTBA 4ELXA 3ADBA 3TLFA 3PEAA 1NZYA 4GM2A 1TYFA 4U18A 2ZL0A 2J5SA 4JYLA 5DU6A 4FNDA 1UYRA 2UZFA 2C8TA 3L8IA 3ADCA 2F9YA 2A7SA 2DUBA 3TZ3A 1YG6A 3QWDA 5DU8A 3DJAA 3PZKA 4KPKA 4OLQA 3H0SA 4B3IA 2QQ3A 4EMPA 2FW2A 4IZBA 1N6DA 4B3HA 4YLHA 3IBBA 3U9RB 3Q7HA 3BF0A 3BPTA 3H81A 3KTKA 1UYTA 3R9SA 3QKAA 1Q52A 2DEOA 1EF9A 3GLMA 3QK8A 3ADDA 4HC8A 3PGQA 5DUFA 1OD4A 1O8UA 2VSUA 3GF7A 3P5MA 3LAOA 1Q51A 2VSSA 5DKPA 4ZU2A 1XNWA 2GTRA 2F6IA 4HDTA 3RSTA 2ZL4A 4JCRA 3T89A 4JOTA 2YJGA 5HUQA 3SLLA 3JU1A 4MXIA 3Q1TA 2X58A 4JCQA 1K39A 4U0GA 4DI1A 3O4XE 4FZWA 1J7XA 1FC7A 3MFMA 3W8HB 3MT6A 2IEXA
chains in the Genus database with same CATH topology
4I52A 1YG8A 3H0QA 4FN8A 4G2RA 2J5IB 2VSUE 5JBXA 5FIFA 3U9SB 4WZ8B 3TVWA 3KTGA 3FDUA 4ZDBA 4FN7A 5G1RA 1JXZA 1WDLA 5G1QA 1N6FA 3TT6A 5KJPA 2J5IA 4OG1A 5INIA 2FBMA 3N6RB 4U1AA 3IAVA 4QIJA 3KTIA 5E0SH 4ASIA 1XO6A 5E0SA 1RJNA 2J5GD 3MYBA 1UYSA 4L6WA 5KDRB 4K3WA 4RCNA 4I4ZA 2CE3A 1SG4A 3TRRA 4EMMA 2X24A 3BPPA 4JCSA 5C90A 5KDRA 3TDCA 2NP9A 1HNUA 2F6QA 4F47A 3PE8A 3R0OA 4JYJA 5DUCA 1X0UA 4Q1IA 4MI2A 4MOUA 5MGBA 4EMLA 3RRVA 4K2NA 1WDKA 3ZWBA 3RSIA 3TV5A 3R9TA 1XNYA 1ON3A 4LK5A 2ZQRA 2ZQQA 2VX2A 3K8XA 3I47A 4JSBA 3OT6A 1SZOA 3OMEA 2Q34A 1W2XA 4QFEA 3QXZA 4JWVA 5CTCA 4NEKA 2PG8A 3M6MA 3QREA 1K32A 4FJWD 4FNBA 4ZDDA 1WZ8A 1FC9A 3ZWCA 2VSUC 4JCTA 1MJ3A 2Q35A 5INGA 3LKEA 3P85A 3Q0JA 3ISAA 2CBYA 5DZKH 4I42A 3KTHA 4KWBA 3NJDA 3GMAA 3HP0A 1EY3A 4NNQA 2VSSE 4OMRA 1N6EA 5DTPA 3DORA 1FCFA 4U19A 3H0UA 3K50A 4QIIA 3OC7A 4Q0GA 5DU4A 3G64A 3V5EA 4Z0MA 5G1SA 3QYRA 2D3TA 4JJTA 1EF8A 1OD2A 1DCIA 4IZCA 1UYVA 3H0JA 3T3WA 3U9TB 3P2LA 1DUBA 1PIXA 2A7KA 3T8AA 3M6NA 3NJBA 3TVUA 4B3JA 3FF6A 5DL1A 4ELSA 2A81A 4FB8A 2VSUF 4HNKA 1PJHA 3V5IA 4WCZA 3H02A 2BZRA 2VSSF 3ZW8A 4J2UA 5INFA 5IKLB 1XX4A 3QXIA 4IZDA 4K29A 3R6HA 3T88A 4JFCA 3IB9A 4ELWA 3Q0GA 5C9GA 3R9QA 4ZDFA 1UIYA 1XNVA 3GF3A 3KQFA 2W3PA 3QMJA 4RYFH 4ZDEA 5CTBA 4RYFA 1Y7OA 3HE2A 3HRXA 3L3SA 3WG5A 1HZDA 4ZDCA 1ON9A 2ZL3A 2VREA 4NARA 2PBPA 2ZL2A 2F9IB 3TT7A 1TG6A 4U0HA 1VRGA 1WDMA 3HLN1 4KNPA 2J5II 4JVTA 1HNOA 5JBWA 2FZSA 3HINA 1RJMA 4L8KA 2HW5A 4GHNA 2F9IA 3BEZA 4KD6A 3T8BA 2Q2XA 5DTWA 5DZKA 3ZWAA 2PPYA 4U0GH 3VIVA 2J5GA 5FUSA 3KTJA 2EJ5A 3ZW9A 3STAA 4FZWC 4WYOB 3MOYA 5E0NX 1FC6A 1NZYB 3ST9A 3GKBA 3SWXA 2F9YB 2WTBA 4ELXA 3TLFA 3PEAA 1NZYA 4GM2A 1TYFA 4U18A 2ZL0A 2J5SA 4JYLA 5DU6A 4FNDA 1UYRA 2UZFA 2C8TA 2F9YA 2A7SA 2DUBA 3TZ3A 1YG6A 3QWDA 5DU8A 3DJAA 3PZKA 4KPKA 4OLQA 3H0SA 4B3IA 2QQ3A 4EMPA 2FW2A 4IZBA 1N6DA 4B3HA 4YLHA 3IBBA 3U9RB 3Q7HA 3BF0A 3BPTA 3H81A 3KTKA 1UYTA 3R9SA 3QKAA 1Q52A 2DEOA 1EF9A 3GLMA 3QK8A 4HC8A 3PGQA 5DUFA 1OD4A 1O8UA 2VSUA 3GF7A 3P5MA 3LAOA 1Q51A 2VSSA 5DKPA 4ZU2A 1XNWA 2GTRA 2F6IA 4HDTA 3RSTA 2ZL4A 4JCRA 3T89A 4JOTA 2YJGA 5HUQA 3SLLA 3JU1A 4MXIA 3Q1TA 2X58A 4JCQA 1K39A 4U0GA 4DI1A 4FZWA 1J7XA 1FC7A 3MFMA 3MT6A 2IEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I52 A;  1YG8 A;  3H0Q A;  4FN8 A;  4G2R A;  2J5I B;  2VSU E;  5JBX A;  5FIF A;  3U9S B;  4WZ8 B;  3TVW A;  3KTG A;  3FDU A;  4ZDB A;  4FN7 A;  5G1R A;  1JXZ A;  1WDL A;  5G1Q A;  1N6F A;  3TT6 A;  5KJP A;  2J5I A;  4OG1 A;  5INI A;  2FBM A;  3N6R B;  4U1A A;  3IAV A;  4QIJ A;  3KTI A;  5E0S H;  4ASI A;  1XO6 A;  5E0S A;  1RJN A;  2J5G D;  3MYB A;  1UYS A;  4L6W A;  5KDR B;  4K3W A;  4RCN A;  4I4Z A;  2CE3 A;  1SG4 A;  3TRR A;  4EMM A;  2X24 A;  3BPP A;  4JCS A;  5C90 A;  5KDR A;  3TDC A;  2NP9 A;  1HNU A;  2F6Q A;  4F47 A;  3PE8 A;  3R0O A;  4JYJ A;  5DUC A;  1X0U A;  4Q1I A;  4MI2 A;  4MOU A;  5MGB A;  4EML A;  3RRV A;  4K2N A;  1WDK A;  3ZWB A;  3RSI A;  3TV5 A;  3R9T A;  1XNY A;  1ON3 A;  4LK5 A;  2ZQR A;  2ZQQ A;  2VX2 A;  3K8X A;  3I47 A;  4JSB A;  3OT6 A;  1SZO A;  3OME A;  2Q34 A;  1W2X A;  4QFE A;  3QXZ A;  4JWV A;  5CTC A;  4NEK A;  2PG8 A;  3M6M A;  3QRE A;  1K32 A;  4FJW D;  4FNB A;  4ZDD A;  1WZ8 A;  1FC9 A;  3ZWC A;  2VSU C;  4JCT A;  1MJ3 A;  2Q35 A;  5ING A;  3LKE A;  3P85 A;  3Q0J A;  3ISA A;  2CBY A;  5DZK H;  4I42 A;  3KTH A;  4KWB A;  3NJD A;  3GMA A;  3HP0 A;  1EY3 A;  4NNQ A;  2VSS E;  4OMR A;  1N6E A;  5DTP A;  3DOR A;  1FCF A;  4U19 A;  3H0U A;  3K50 A;  4QII A;  3OC7 A;  4Q0G A;  5DU4 A;  3G64 A;  3V5E A;  4Z0M A;  5G1S A;  3QYR A;  2D3T A;  4JJT A;  1EF8 A;  1OD2 A;  1DCI A;  4IZC A;  1UYV A;  3H0J A;  3T3W A;  3U9T B;  3P2L A;  1DUB A;  1PIX A;  2A7K A;  3T8A A;  3M6N A;  3NJB A;  3TVU A;  4B3J A;  3FF6 A;  5DL1 A;  4ELS A;  2A81 A;  4FB8 A;  2VSU F;  4HNK A;  1PJH A;  3V5I A;  4WCZ A;  3H02 A;  2BZR A;  2VSS F;  3ZW8 A;  5INF A;  5IKL B;  1XX4 A;  3QXI A;  4IZD A;  4K29 A;  3R6H A;  3T88 A;  4JFC A;  3IB9 A;  4ELW A;  3Q0G A;  5C9G A;  3R9Q A;  4ZDF A;  1UIY A;  1XNV A;  3GF3 A;  3KQF A;  2W3P A;  3QMJ A;  4RYF H;  4ZDE A;  5CTB A;  4RYF A;  1Y7O A;  3HE2 A;  3HRX A;  3L3S A;  3WG5 A;  1HZD A;  4ZDC A;  1ON9 A;  2ZL3 A;  2VRE A;  2PBP A;  2ZL2 A;  2F9I B;  3TT7 A;  1TG6 A;  4U0H A;  1VRG A;  1WDM A;  3HLN 1;  4KNP A;  2J5I I;  4JVT A;  1HNO A;  5JBW A;  2FZS A;  3HIN A;  1RJM A;  4L8K A;  2HW5 A;  4GHN A;  2F9I A;  3BEZ A;  4KD6 A;  3T8B A;  2Q2X A;  5DTW A;  5DZK A;  3ZWA A;  2PPY A;  4U0G H;  3VIV A;  2J5G A;  5FUS A;  3KTJ A;  2EJ5 A;  3ZW9 A;  3STA A;  4FZW C;  4WYO B;  3MOY A;  5E0N X;  1FC6 A;  1NZY B;  3ST9 A;  3GKB A;  3SWX A;  2F9Y B;  2WTB A;  4ELX A;  3TLF A;  3PEA A;  1NZY A;  4GM2 A;  1TYF A;  4U18 A;  2ZL0 A;  2J5S A;  4JYL A;  5DU6 A;  4FND A;  1UYR A;  2UZF A;  2C8T A;  2F9Y A;  2A7S A;  2DUB A;  3TZ3 A;  1YG6 A;  3QWD A;  5DU8 A;  3DJA A;  3PZK A;  4KPK A;  4OLQ A;  3H0S A;  4B3I A;  2QQ3 A;  4EMP A;  2FW2 A;  4IZB A;  1N6D A;  4B3H A;  4YLH A;  3IBB A;  3U9R B;  3Q7H A;  3BF0 A;  3H81 A;  3KTK A;  1UYT A;  3R9S A;  3QKA A;  1Q52 A;  2DEO A;  1EF9 A;  3GLM A;  3QK8 A;  4HC8 A;  3PGQ A;  5DUF A;  1OD4 A;  1O8U A;  2VSU A;  3GF7 A;  3P5M A;  3LAO A;  1Q51 A;  2VSS A;  5DKP A;  4ZU2 A;  1XNW A;  2GTR A;  2F6I A;  3RST A;  2ZL4 A;  4JCR A;  3T89 A;  4JOT A;  3SLL A;  3JU1 A;  4MXI A;  3Q1T A;  2X58 A;  4JCQ A;  1K39 A;  4U0G A;  4DI1 A;  4FZW A;  1J7X A;  1FC7 A;  3MFM A;  3MT6 A;  2IEX A; 
#chains in the Genus database with same CATH topology
 4I52 A;  1YG8 A;  3H0Q A;  4FN8 A;  4G2R A;  2J5I B;  2VSU E;  5JBX A;  5FIF A;  3U9S B;  4WZ8 B;  3TVW A;  3KTG A;  3FDU A;  4ZDB A;  4FN7 A;  5G1R A;  1JXZ A;  1WDL A;  5G1Q A;  1N6F A;  3TT6 A;  5KJP A;  3AJM A;  2J5I A;  4OG1 A;  5INI A;  2FBM A;  3N6R B;  4U1A A;  3IAV A;  4QIJ A;  3A4M A;  3KTI A;  5E0S H;  4ASI A;  1XO6 A;  5E0S A;  1RJN A;  2J5G D;  3MYB A;  1UYS A;  4L6W A;  5KDR B;  4K3W A;  4RCN A;  4I4Z A;  2CE3 A;  1SG4 A;  3TRR A;  4EMM A;  2X24 A;  3BPP A;  4JCS A;  5C90 A;  5KDR A;  3A4L A;  3TDC A;  2NP9 A;  1HNU A;  2F6Q A;  4F47 A;  3PE8 A;  3R0O A;  4JYJ A;  5DUC A;  1X0U A;  3RQF A;  4Q1I A;  4MI2 A;  2P63 A;  4MOU A;  5MGB A;  4EML A;  3RRV A;  4K2N A;  1WDK A;  3ZWB A;  3RSI A;  3TV5 A;  3R9T A;  3W8I B;  1XNY A;  1ON3 A;  4LK5 A;  2ZQR A;  2ZQQ A;  2VX2 A;  3K8X A;  3I47 A;  4JSB A;  3OT6 A;  1SZO A;  3OME A;  2Q34 A;  1W2X A;  4QFE A;  5CTC A;  3QXZ A;  4JWV A;  4NEK A;  2PG8 A;  3M6M A;  3QRE A;  1K32 A;  4FJW D;  4FNB A;  4ZDD A;  1WZ8 A;  1FC9 A;  3ZWC A;  2VSU C;  4JCT A;  1MJ3 A;  2Q35 A;  1Y64 B;  5ING A;  3LKE A;  3P85 A;  3Q0J A;  3ISA A;  2CBY A;  5DZK H;  4I42 A;  3KTH A;  4KWB A;  3NJD A;  3GMA A;  3IRB A;  3HP0 A;  1EY3 A;  4NNQ A;  2VSS E;  4OMR A;  1N6E A;  5DTP A;  3DOR A;  1FCF A;  4U19 A;  3H0U A;  3K50 A;  4QII A;  3OC7 A;  4Q0G A;  5DU4 A;  3G64 A;  3V5E A;  4Z0M A;  5G1S A;  3QYR A;  2D3T A;  4JJT A;  1EF8 A;  1OD2 A;  1DCI A;  4IZC A;  1UYV A;  3H0J A;  3T3W A;  3U9T B;  3P2L A;  1DUB A;  1PIX A;  2A7K A;  3T8A A;  3M6N A;  3NJB A;  1UX4 A;  3TVU A;  4B3J A;  3FF6 A;  5DL1 A;  4ELS A;  2A81 A;  4FB8 A;  2VSU F;  4HNK A;  1PJH A;  3V5I A;  4WCZ A;  3H02 A;  2BZR A;  2VSS F;  3ZW8 A;  3RQG A;  4J2U A;  5INF A;  5IKL B;  1XX4 A;  3QXI A;  4IZD A;  4K29 A;  3R6H A;  3T88 A;  4JFC A;  3IB9 A;  4ELW A;  3Q0G A;  5C9G A;  3R9Q A;  4ZDF A;  1UIY A;  1XNV A;  3AM1 A;  3GF3 A;  3KQF A;  2W3P A;  3QMJ A;  4RYF H;  4ZDE A;  5CTB A;  4RYF A;  1Y7O A;  3HE2 A;  3HRX A;  3L3S A;  3WG5 A;  1HZD A;  4ZDC A;  1ON9 A;  2ZL3 A;  2VRE A;  4NAR A;  2PBP A;  2ZL2 A;  2F9I B;  3TT7 A;  1TG6 A;  4U0H A;  1VRG A;  1WDM A;  3HLN 1;  3RQE A;  4KNP A;  2J5I I;  4JVT A;  1HNO A;  5JBW A;  2FZS A;  3A4N A;  3HIN A;  1RJM A;  4L8K A;  2HW5 A;  4GHN A;  2F9I A;  3BEZ A;  4KD6 A;  3T8B A;  2Q2X A;  5DTW A;  5DZK A;  3ZWA A;  2PPY A;  4U0G H;  3VIV A;  2J5G A;  5FUS A;  3KTJ A;  4GEH B;  2EJ5 A;  3ZW9 A;  3L8J A;  3STA A;  4FZW C;  4WYO B;  3MOY A;  5E0N X;  1FC6 A;  1NZY B;  3ST9 A;  1UX5 A;  3GKB A;  3SWX A;  2F9Y B;  2WTB A;  4ELX A;  3ADB A;  3TLF A;  3PEA A;  1NZY A;  4GM2 A;  1TYF A;  4U18 A;  2ZL0 A;  2J5S A;  4JYL A;  5DU6 A;  4FND A;  1UYR A;  2UZF A;  2C8T A;  3L8I A;  3ADC A;  2F9Y A;  2A7S A;  2DUB A;  3TZ3 A;  1YG6 A;  3QWD A;  5DU8 A;  3DJA A;  3PZK A;  4KPK A;  4OLQ A;  3H0S A;  4B3I A;  2QQ3 A;  4EMP A;  2FW2 A;  4IZB A;  1N6D A;  4B3H A;  4YLH A;  3IBB A;  3U9R B;  3Q7H A;  3BF0 A;  3BPT A;  3H81 A;  3KTK A;  1UYT A;  3R9S A;  3QKA A;  1Q52 A;  2DEO A;  1EF9 A;  3GLM A;  3QK8 A;  3ADD A;  4HC8 A;  3PGQ A;  5DUF A;  1OD4 A;  1O8U A;  2VSU A;  3GF7 A;  3P5M A;  3LAO A;  1Q51 A;  2VSS A;  5DKP A;  4ZU2 A;  1XNW A;  2GTR A;  2F6I A;  4HDT A;  3RST A;  2ZL4 A;  4JCR A;  3T89 A;  4JOT A;  2YJG A;  5HUQ A;  3SLL A;  3JU1 A;  4MXI A;  3Q1T A;  2X58 A;  4JCQ A;  1K39 A;  4U0G A;  4DI1 A;  3O4X E;  4FZW A;  1J7X A;  1FC7 A;  3MFM A;  3W8H B;  3MT6 A;  2IEX A; 
#chains in the Genus database with same CATH homology
 4I52 A;  1YG8 A;  3H0Q A;  4FN8 A;  4G2R A;  2J5I B;  2VSU E;  5JBX A;  5FIF A;  3U9S B;  4WZ8 B;  3TVW A;  3KTG A;  3FDU A;  4ZDB A;  4FN7 A;  5G1R A;  1JXZ A;  1WDL A;  5G1Q A;  1N6F A;  3TT6 A;  5KJP A;  2J5I A;  4OG1 A;  5INI A;  2FBM A;  3N6R B;  4U1A A;  3IAV A;  4QIJ A;  3KTI A;  5E0S H;  4ASI A;  1XO6 A;  5E0S A;  1RJN A;  2J5G D;  3MYB A;  1UYS A;  4L6W A;  5KDR B;  4K3W A;  4RCN A;  4I4Z A;  2CE3 A;  1SG4 A;  3TRR A;  4EMM A;  2X24 A;  3BPP A;  4JCS A;  5C90 A;  5KDR A;  3TDC A;  2NP9 A;  1HNU A;  2F6Q A;  4F47 A;  3PE8 A;  3R0O A;  4JYJ A;  5DUC A;  1X0U A;  4Q1I A;  4MI2 A;  4MOU A;  5MGB A;  4EML A;  3RRV A;  4K2N A;  1WDK A;  3ZWB A;  3RSI A;  3TV5 A;  3R9T A;  1XNY A;  1ON3 A;  4LK5 A;  2ZQR A;  2ZQQ A;  2VX2 A;  3K8X A;  3I47 A;  4JSB A;  3OT6 A;  1SZO A;  3OME A;  2Q34 A;  1W2X A;  4QFE A;  3QXZ A;  4JWV A;  5CTC A;  4NEK A;  2PG8 A;  3M6M A;  3QRE A;  1K32 A;  4FJW D;  4FNB A;  4ZDD A;  1WZ8 A;  1FC9 A;  3ZWC A;  2VSU C;  4JCT A;  1MJ3 A;  2Q35 A;  5ING A;  3LKE A;  3P85 A;  3Q0J A;  3ISA A;  2CBY A;  5DZK H;  4I42 A;  3KTH A;  4KWB A;  3NJD A;  3GMA A;  3HP0 A;  1EY3 A;  4NNQ A;  2VSS E;  4OMR A;  1N6E A;  5DTP A;  3DOR A;  1FCF A;  4U19 A;  3H0U A;  3K50 A;  4QII A;  3OC7 A;  4Q0G A;  5DU4 A;  3G64 A;  3V5E A;  4Z0M A;  5G1S A;  3QYR A;  2D3T A;  4JJT A;  1EF8 A;  1OD2 A;  1DCI A;  4IZC A;  1UYV A;  3H0J A;  3T3W A;  3U9T B;  3P2L A;  1DUB A;  1PIX A;  2A7K A;  3T8A A;  3M6N A;  3NJB A;  3TVU A;  4B3J A;  3FF6 A;  5DL1 A;  4ELS A;  2A81 A;  4FB8 A;  2VSU F;  4HNK A;  1PJH A;  3V5I A;  4WCZ A;  3H02 A;  2BZR A;  2VSS F;  3ZW8 A;  4J2U A;  5INF A;  5IKL B;  1XX4 A;  3QXI A;  4IZD A;  4K29 A;  3R6H A;  3T88 A;  4JFC A;  3IB9 A;  4ELW A;  3Q0G A;  5C9G A;  3R9Q A;  4ZDF A;  1UIY A;  1XNV A;  3GF3 A;  3KQF A;  2W3P A;  3QMJ A;  4RYF H;  4ZDE A;  5CTB A;  4RYF A;  1Y7O A;  3HE2 A;  3HRX A;  3L3S A;  3WG5 A;  1HZD A;  4ZDC A;  1ON9 A;  2ZL3 A;  2VRE A;  4NAR A;  2PBP A;  2ZL2 A;  2F9I B;  3TT7 A;  1TG6 A;  4U0H A;  1VRG A;  1WDM A;  3HLN 1;  4KNP A;  2J5I I;  4JVT A;  1HNO A;  5JBW A;  2FZS A;  3HIN A;  1RJM A;  4L8K A;  2HW5 A;  4GHN A;  2F9I A;  3BEZ A;  4KD6 A;  3T8B A;  2Q2X A;  5DTW A;  5DZK A;  3ZWA A;  2PPY A;  4U0G H;  3VIV A;  2J5G A;  5FUS A;  3KTJ A;  2EJ5 A;  3ZW9 A;  3STA A;  4FZW C;  4WYO B;  3MOY A;  5E0N X;  1FC6 A;  1NZY B;  3ST9 A;  3GKB A;  3SWX A;  2F9Y B;  2WTB A;  4ELX A;  3TLF A;  3PEA A;  1NZY A;  4GM2 A;  1TYF A;  4U18 A;  2ZL0 A;  2J5S A;  4JYL A;  5DU6 A;  4FND A;  1UYR A;  2UZF A;  2C8T A;  2F9Y A;  2A7S A;  2DUB A;  3TZ3 A;  1YG6 A;  3QWD A;  5DU8 A;  3DJA A;  3PZK A;  4KPK A;  4OLQ A;  3H0S A;  4B3I A;  2QQ3 A;  4EMP A;  2FW2 A;  4IZB A;  1N6D A;  4B3H A;  4YLH A;  3IBB A;  3U9R B;  3Q7H A;  3BF0 A;  3BPT A;  3H81 A;  3KTK A;  1UYT A;  3R9S A;  3QKA A;  1Q52 A;  2DEO A;  1EF9 A;  3GLM A;  3QK8 A;  4HC8 A;  3PGQ A;  5DUF A;  1OD4 A;  1O8U A;  2VSU A;  3GF7 A;  3P5M A;  3LAO A;  1Q51 A;  2VSS A;  5DKP A;  4ZU2 A;  1XNW A;  2GTR A;  2F6I A;  4HDT A;  3RST A;  2ZL4 A;  4JCR A;  3T89 A;  4JOT A;  2YJG A;  5HUQ A;  3SLL A;  3JU1 A;  4MXI A;  3Q1T A;  2X58 A;  4JCQ A;  1K39 A;  4U0G A;  4DI1 A;  4FZW A;  1J7X A;  1FC7 A;  3MFM A;  3MT6 A;  2IEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...