4ELYA

Ccdbvfi:gyra14ec
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
134
structure length
134
Chain Sequence
b'TRRTIFELRKARDRAHILEALAVALANIDPIIELIRHAPTPAEAKTALVANPWQLGNVAAMLERAGDDAARPEWLEPEFGVRDGLYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLDQIAELLRILGSAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA gyrase subunit A
publication title Alternative interactions define gyrase specificity in the CcdB family.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Toxin/isomerase
total genus 44
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2012-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.268.10 Mainly Alpha Orthogonal Bundle Topoisomerase; domain 3 Topoisomerase, domain 3 4elyA00
1AB4A 4DDQA 4G0UA 4CKLA 3LPXA 3FOFA 1ZVUA 2RGRA 4TMAA 2XCRB 1BGWA 3FOEA 4Z53A 2XCOA 4ELYA 4J3NA 4Z4QA 1BJTA 4CKKA 3L4KA 4G0WA 4ELZA 4FM9A 4G0VA 4Z3OA 2XCQA 3QX3A 3L4JA 2Y3PA 1X75A 3NUHA
chains in the Genus database with same CATH superfamily
1AB4A 4DDQA 4G0UA 4CKLA 3LPXA 3FOFA 1ZVUA 2RGRA 4TMAA 2XCRB 1BGWA 3FOEA 4Z53A 2XCOA 4ELYA 4J3NA 4Z4QA 1BJTA 4CKKA 2QPTA 4CIDA 3L4KA 4G0WA 4ELZA 4FM9A 4G0VA 4Z3OA 2XCQA 3QX3A 3L4JA 2Y3PA 1X75A 3NUHA
chains in the Genus database with same CATH topology
1AB4A 4DDQA 4G0UA 4CKLA 3LPXA 3FOFA 1ZVUA 2RGRA 4TMAA 2XCRB 1BGWA 3FOEA 4Z53A 2XCOA 4ELYA 4J3NA 4Z4QA 1BJTA 4CKKA 3L4KA 4G0WA 4ELZA 4FM9A 4G0VA 4Z3OA 2XCQA 3QX3A 3L4JA 2Y3PA 1X75A 3NUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AB4 A;  4DDQ A;  4G0U A;  4CKL A;  3LPX A;  3FOF A;  1ZVU A;  2RGR A;  4TMA A;  2XCR B;  1BGW A;  3FOE A;  4Z53 A;  2XCO A;  4ELY A;  4J3N A;  4Z4Q A;  1BJT A;  4CKK A;  3L4K A;  4G0W A;  4ELZ A;  4FM9 A;  4G0V A;  4Z3O A;  2XCQ A;  3QX3 A;  3L4J A;  2Y3P A;  1X75 A;  3NUH A; 
#chains in the Genus database with same CATH topology
 1AB4 A;  4DDQ A;  4G0U A;  4CKL A;  3LPX A;  3FOF A;  1ZVU A;  2RGR A;  4TMA A;  2XCR B;  1BGW A;  3FOE A;  4Z53 A;  2XCO A;  4ELY A;  4J3N A;  4Z4Q A;  1BJT A;  4CKK A;  2QPT A;  4CID A;  3L4K A;  4G0W A;  4ELZ A;  4FM9 A;  4G0V A;  4Z3O A;  2XCQ A;  3QX3 A;  3L4J A;  2Y3P A;  1X75 A;  3NUH A; 
#chains in the Genus database with same CATH homology
 1AB4 A;  4DDQ A;  4G0U A;  4CKL A;  3LPX A;  3FOF A;  1ZVU A;  2RGR A;  4TMA A;  2XCR B;  1BGW A;  3FOE A;  4Z53 A;  2XCO A;  4ELY A;  4J3N A;  4Z4Q A;  1BJT A;  4CKK A;  3L4K A;  4G0W A;  4ELZ A;  4FM9 A;  4G0V A;  4Z3O A;  2XCQ A;  3QX3 A;  3L4J A;  2Y3P A;  1X75 A;  3NUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...