4ELYC

Ccdbvfi:gyra14ec
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
98
Chain Sequence
b'SQFTLYKNKDKSSAKTYPYFVDVQSDLLDNLNTRLVIPLTPIEPSHLCPTIHIDEGDFIMLTQQMTSVPVKILSEPVNELSTFRNEIIAAIDFLITGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit A
publication title Alternative interactions define gyrase specificity in the CcdB family.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Toxin/isomerase
total genus 28
structure length 98
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4elyC00
5CKBA 5CK9A 2KMTA 4VUBA 4HKEA 4MZPA 2C06A 3NFCA 4MDXA 5CKFA 3JRZA 5CO7A 5CQYA 1X75C 4ELYC 5CKHA 5CR2A 5CKDA 3TCJA 3JSCA 5HK0A 1NE8A 1M1FA 2VUBA 5CKEA 2MF2A 5CQXA 3G7ZA 4ELZC 1UB4A 4ME7A 4MZTA 4MZMA 1VUBA 3HPWA 5CCAA 5DLOA 4OF1A 5HK3A 5HKCA 3VUBA
chains in the Genus database with same CATH superfamily
1VQNT 1Q82R 5KE3A 1WHLA 3EG3A 3ZFJA 1WXBA 4R56A 2DRKA 3OY9A 5GAN5 4RMOA 4PK4A 5CKDA 4M7DA 1Q86C 1IXDA 4M78G 1K73R 2DX1A 4J5YA 1JXMA 2AZVA 1T0JA 1TWBA 2FG0A 4PJJA 3C94A 2ZPBB 2FZCB 3OS1A 2EIFA 4BE2A 1M8VA 1I0CA 3MO8A 1OPKA 3AT1B 3EHQA 5GMKi 5FROA 4JZ3A 4ZGJB 3OYEA 4UC4A 5GAOn 3G6ET 4L5GA 5KCHA 2ENMA 3CBMA 4QT7A 3UWNA 1AWWA 1YCSB 1SF9A 2WSCE 1CKBA 4QVZA 1W2BS 3CMAA 3CC7T 3QHSA 2RD1A 1H8KA 2FYKA 1WHKA 1TOVA 3V8JA 4C8QE 2QQRA 2YLCA 2EFIA 4KT0E 3OW2S 2HCKA 2EYYA 1YN8A 1WJSA 1LPLA 8AT1B 1V1CA 1VQ6A 1U1SA 3RNJA 4WF2A 3FB9A 4M77E 2F5TX 5FLXE 2COWA 3M0RA 3PGGA 2YRVA 3I5RA 2DBMA 2MYSA 2L3QA 1VQ5T 1P92A 4FT4A 3CEYA 1M90U 2PU9B 1UGSB 5J3BA 3O5ZA 2YHTA 3PT9A 2QXFA 2NLUA 2DO3A 3CCUA 4JS4A 1VQ8T 2X4YA 4C8QB 3BY7A 4E7KA 2AHJB 1YHQT 2K3BA 3PMIA 3S3NA 2BZ8A 4M77B 2CZ6B 1TU0B 2LQ8A 4FL6A 3HRUA 2VUBA 2KSSA 1VQ7Q 3CC4A 4A63B 2JUFA 3CCMA 2JM9A 5GMKh 1TUDA 5GAMf 1SSHA 1NEGA 1N8RR 2PVDB 4MMKA 4XU2A 1NYGA 2DK3A 2JT4A 2KRNA 2A08A 1OX8A 2RHXA 4F7UA 4JJBA 3CCLQ 2KQWA 5GMKm 3I35A 2DL8A 2M16A 3EGDA 3I55A 3LWHA 1IO6A 2A7YA 2K9GA 1VQ5Q 2MCNA 4O6JA 1RAGB 4CI0C 2KMTA 3GNGA 2OTLA 3VRZA 1KQ2A 3SHWA 2GFUA 2BE7D 5GANe 1AZGB 2LTOA 3X25B 1LCKA 3VRYA 3V7CA 3H0FA 1WA7A 1QWEA 2QEXQ 4RCCA 1UGRB 1OQKA 4RG2A 4LXCA 2MWOA 1W4SA 1JJ2P 3WXMB 3CD6T 1KIKA 8ATCB 2QA4A 2XG8D 1KHCA 4M7AA 2KRSA 1Y07A 5GAMd 1NLPC 2LDMA 3SFMA 1RAFB 3PTAA 3QBYA 3L1AA 4ZNXA 3G4ST 3UDCA 2D8JA 1VOMA 3RESA 2FPDA 4E7LA 2P0PA 1Q81R 4M77C 2ZGWA 1G3WA 4QKUA 2JN0A 1I81A 2RB6A 2GBQA 2RQUA 2QDLA 2L5QA 2BTTA 4C0GA 3CCST 5IHIA 2PUOB 2C06A 2HMAA 1UJ0A 5CR2A 4LUDA 1RAAB 3OW2P 2O2OA 2LCLA 4LDVA 3HL8A 1YITA 2ZAEA 3I56T 2O4XA 1K9MC 4F14A 3EG9A 3UPUA 1NPRA 3ULRB 4BD3A 3QSUA 1RLPC 5CKBA 4OP0A 2QK0A 2CYZB 3V8LA 1VQNA 4BI4A 3ZEHA 4KGVB 1FX7A 1K9AA 2PNIA 5LJ3j 1BCMA 4Q5WA 2OTJQ 1Z9ZA 3V7SA 1M2VB 2VGNA 1N27A 3G4SQ 2LJ0A 5FU6B 1RACB 1JEGA 3OYBA 1W70A 1GFDA 4AFQC 3LWIA 1U8RA 3VS6A 2XD0A 4C92E 2ED1A 2FL7A 4XU0A 4JJCA 4OMQA 3LYIA 4BE1A 2AZSA 2EQMA 3HHTB 2I0NA 2KDSA 3RKWA 2A3LA 4OB0B 1VQPQ 1M27C 2RI5A 1CSKA 4E6RA 3HSBA 3JCMQ 1BYMA 2QI2A 2YSQA 5CIUA 3CBPA 3THKA 4BDYA 1VQ7A 2KY9A 3CCSQ 2O9VA 4C0FA 2HZYA 4F7UG 4HKEA 4PJOA 2EQJA 2LJ1A 3M0SA 1GCQA 3FJ5A 2DXUA 4ELYC 1QLYA 2HBWA 4X34A 3RKXA 5GAN8 4M7DF 4C92B 1D09B 4HVWA 1TUGB 1VQMQ 4D8DA 3M0UA 1KC8C 4BE0A 1K8AC 1OI1A 1Q86U 1BU1A 4RTVA 1M1KU 1M5Q1 3QWXX 1UGPB 3TEEA 1OYXA 3X26B 1KK7A 1WGSA 1VQ5A 1ZX6A 2KT8A 4KUIA 2AT1B 4OB2B 1FYNA 1XJWB 2V8KA 4JZ4A 2KXDA 5GAN4 4M7AG 1JRIA 1VQ8A 4C8QD 3A1PA 1N6AA 2JS0A 3I9QA 1JB0E 3RERA 1BI2A 2DVEA 4J83A 2QEXA 1YHQA 3EGXB 2EYWA 2JM8A 4C5EA 2WSFE 2QQAA 4EIKA 5LJ3e 1UECA 2M0YA 3EH1A 5GAN7 4M77D 4LDXA 2DE0X 4KH1B 5HK0A 4RCBA 2CZ0B 2JW4A 4EMKA 1IREB 4DOWA 4J9CA 5IXBA 2ED0A 5FU6C 4C8QG 4HVUA 5HKCA 1YIJT 4M78A 3PE0A 4LD9K 2CKKA 1G3TA 3MP1A 1VIFA 2HD0A 3RMQA 3M0PA 4KGZB 5D6YA 5KYUA 2CUDA 2XMFA 4J6YA 3TCJA 1BKBA 2RI3A 1OU9A 4E7IA 4J9FA 1VQ9T 5LJ5j 2X3WD 1AHJB 5GANf 5KH6A 3WVDB 5KYNA 4E7JA 2DERA 4M7DE 4CC4B 2LNVA 2K2MA 3OQ5A 4XAXB 4JJDA 2D0QB 5L23A 2CREA 1WJRA 2PQWA 4JRIA 3JCMV 3GOXA 1H641 2RM4A 4AG1C 4GY5A 3CMEQ 1SRMA 1V29B 1GBRA 1YJ9T 5GAMg 5KYYB 2D6FA 5KYXA 2MMPA 2J06A 1SHFA 2RJFA 2KK4A 1IRXA 1QCNA 5DM7R 3VKIA 5A0DA 5KYWA 2QGFB 4IIMA 3GP8A 3A8LB 1AVZC 3EAEA 5CKHA 1AD5A 3CCUQ 4FCYA 2PTKA 3MPUB 2NUTA 2VGMA 2KNBB 1UHCA 1UB4A 3DB4A 4M7DB 2XU8A 4F7UF 3VUZA 1PSEA 2OTJA 2X51A 3G4SA 4QQGA 1X01A 5KE2A 1OEBA 2HKNA 1KD1R 2K7AA 1NEBA 4Z89A 3OYGA 2EJFA 2LQWA 3JCMe 3E1SA 1SPKA 1G8XA 1MMAA 2E3IA 2QQSA 4RTYA 2VC8A 2V1RA 1VQ9Q 3CCMQ 2ZPHB 3H0HA 1WXUA 3LGFA 3RBBB 1VQPA 4A54A 2VB6A 4PJOG 2KR3A 5D6WA 3QPHA 2XICA 3VYHB 1UE9A 2E5QA 2F69A 3CCQT 2CP3A 4C5HA 1NYFA 2E70A 4LNPA 3OYLA 4PNOA 1G2BA 4M75F 4OMNA 3CCSA 2FZGB 2ABLA 2QTXA 2DZCA 2DYIA 3H8ZA 5LL6S 2V1QA 3PIOA 4Y91A 3JCMW 2VYTA 5LJ5e 2K5FA 1M1KR 1YFNA 2D0NA 2LT1A 2OTLQ 4IUTA 4RTXA 4OMFB 2DXTA 1BIAA 2HAXA 3M0TA 2L0AA 2QTVA 4HT9A 1Y96B 4AFUC 3JCMX 3M57A 4RTWA 3CCRT 4OMLA 3OYYA 3L42A 2P4RA 2LQKA 1YJWT 6AT1B 2E1HA 3QDRB 3SB2A 1B34B 4FU6A 2YXYA 1OOTA 2K5IA 3JB9D 3JB9H 1D3BA 1KSWA 4J9DA 2DL7A 3CCJT 4WTOB 1ACMB 2V26A 3GIBA 2X35A 1MNEA 1BBZA 3D7SB 1MGQA 4A4EA 1H3HA 1M30A 2AKKA 4FW1A 4M7DC 1QQJA 1D0ZA 4F04B 4OGEA 1O9SA 2QASA 1PNJA 3JB9G 1K9MU 2DD4A 3J81E 2RHIA 1TG0A 3NMZC 2VVKA 2PZ1A 4JRPA 2C0IA 5GAOl 1T3LA 1B3QA 4M75E 3CXCS 3TSZA 4C92D 4EDUA 2Y4XA 2LVMA 3HFOA 4XQ3A 4BY6B 1H3ZA 1Q7YC 3EFOB 3REBB 3PNWC 1WNLA 2HSEB 1YITQ 2R57A 4J7IA 4J9HA 3CCRQ 1TXQA 1X43A 3VS7A 5CQXA 5GANj 3KUFA 1LNXA 4XTYA 1G3YA 5LJ3f 1ZUKA 1M1GA 2FZKB 3VS5A 1YJNT 4C92G 2M02A 4II1A 2E64A 1I5LA 2EKHA 1X27A 2QG9B 3CMEA 1VQNQ 3MEWA 4A53A 1Q82C 4DQ2A 4QQDA 3A8GB 4C0ZA 3MEAA 1YCYA 3JCMc 4M4ZA 3BE3A 2W0ZA 2JOYA 1GBQA 2HL5C 4M75B 2DA9A 1K73C 2KAFA 2DEUA 2HBPA 4ZGDB 5I22A 3H9NA 2CSIA 3P8BB 1NM7A 3MEVA 1HJDA 4QVCA 3OSSC 1OU8A 2JVVA 3M5AA 4FM4B 4NOYA 1J3TA 3KFVA 2MI6A 4DBQA 1YIJA 1KC8U 2X9HA 1K8AU 2DNUA 2JMAA 2DRMA 2HDAA 4F16A 3G6EQ 2RMOA 2CZ1B 1PHTA 2EQUA 3M54A 4FYXB 3L2VA 3EG0A 5AT1B 3S3OA 3NTKA 2RNAA 3JB9J 3QXEB 1NJIU 3CC7Q 3OYNA 1VQ9A 1QVGA 4FT2A 2YDLA 1MMGA 2MAMA 2EW3A 2J6OA 1NBEB 2DTHA 3L2ZA 5LJ3d 3SWNB 2ZPEB 2CT3A 1HK9A 1T0HA 2P0KA 1AEYA 1NPPA 2GGRA 5GAMh 1MUZA 3M4YA 1KJWA 3KXTA 3HTRA 4RG8A 1S72T 2OAWA 3OYJA 4E7ZA 3H0IA 3JSCA 2M9UA 4J7FA 1OZ2A 2A36A 1YJNQ 4HCKA 1AOJA 2CS7A 3U23A 2DXCA 3QO3A 1YJ9A 1ZSZB 3OBYA 3X20B 1Y0MA 2AK5A 5IT9E 4R0KA 1MV3A 2G3RA 3OYMA 1QMCA 4M78F 4BY6C 4Z8AA 1C1AA 3VV0A 2JTEA 1B7TA 1NE8A 3UT1A 1VQ8Q 2K57A 3JCMf 2DMOA 2NUPB 2LQNA 5GJWB 1YHQQ 1VQ4T 4M7DD 1VQLT 2H3JA 2QYZA 5FW9A 2GTJA 5CVIA 1MHNA 3PVLA 1YI2T 3H6ZA 3N5BB 2KYBA 4M75C 5CKEA 1UUEA 3MEUA 2L3RA 4XTVA 2OI3A 3INZA 2ZZDA 3PMTA 2E5KA 2EGCA 2E4HA 3LGLA 5LJ5f 1N8RC 3X24B 3QYHB 2CP5A 3JCMJ 3TVTA 4EPCA 3CCQA 1PRLC 1IGQA 3JRZA 4N4HA 4C8QA 2M51A 1WZOA 3EFSA 2QGGA 1PG5B 1YBYA 5GJVB 4K11A 2FRYA 5CCAA 4AFSC 4RTUA 3LH0A 1TS9A 1UDLA 5GAOm 3GPLA 2R58A 3JCMd 4M77A 3CCVT 4DBHA 1W2BP 3QYGB 2FRWA 1T3SA 4GLMA 2JTMA 3X28B 2XDBA 3SWNC 3CPWS 3A5ZB 1Q95G 1YWPA 5I11A 3UA7A 2FPEA 1X2KA 3FIFA 2KRMA 3NPFA 4PFOA 4ORZA 2CP2A 5HY6A 3QKJA 3CCRA 1WXTA 4NS5A 2LP5A 3ER0A 1PD1A 3CC2T 1YJWA 4JRKA 3GF5A 3VU3C 4FSSA 1WDXA 1ZSZC 3CD6Q 3MP8A 2YLBA 5FRMA 3M56A 1M90R 1G83A 2ZPIB 3VS1A 4PLLA 2W10A 3OMGA 2FPFA 2JNGA 1RL2A 4PL6A 1NZ9A 2DZ9A 5FU7C 1U5SA 3SEMA 5LJ5d 4PJMA 2RJCA 1PKSA 1JXOA 1U06A 1PD0A 2R5MA 4ELZC 2F2XA 1VQOT 1LVKA 3R6NA 3DLLA 2K3XA 3C0CA 3R6OA 4B9WA 3VUBA 2RO0A 1K76A 1QP3A 4J9EA 1KQSS 1Q81C 1QCOA 2XHCA 2LNHB 4HCBA 1B07A 1XNIA 2FHDA 2ZPGB 1NJIR 2E12A 3TQ7P 4EMHA 2RQRA 4BI8B 2JZ2A 3G6EA 2VV5A 4C0DC 2RI2A 3OS2A 4AT1B 2KXCA 3P8HA 4XTZA 3CC7A 4X9CA 3NGPA 1M2OA 2VXEA 1KFZA 3ZL7C 2K2VA 3C12A 1RAHB 5EG2A 3I56Q 3NTIA 2RHYA 4KH0B 1BCOA 3M55A 4JS5A 3HKSA 1IHVA 2EYQA 2EWNA 4BI3A 2LZ6B 4A4GA 1WIEA 4LD6A 4FYVB 1QVGS 3RUXA 4A4KA 3VJPA 1YJNA 4PFPA 2EAYA 1RAIB 3OYKA 1UGQB 2XDDA 2CP6A 3JCMP 5I2MA 4LUEA 2ZPFB 5IHKA 2E6NA 3TREA 4M75D 2E65A 2L3PA 2HNIA 4N4GA 2EYXA 1TUCA 5GAOr 1SG5A 1XQHA 5IH2A 4YTLA 1C0MA 4ANJA 1PRMC 2JXBA 4J6XA 5IAYA 7AT1B 2EJGA 3LLRA 4CRIA 2R5AA 2L89A 5LJ3g 4A4FA 3M0QA 2M0OA 2EKOA 4O5VA 1Q7YU 4FIBA 3KBGA 2XI9A 4LDYA 1H92A 1NLOC 3CXCA 4HA8A 4DEYA 5GAN3 5HK3A 5GAN6 3G71T 1D1AA 3G1JA 4OMOA 5IHNA 1BB9A 3PFSA 1IB8A 4KBMB 2CDTA 1R77A 2IVWA 2KE9A 4XU1A 1Q82U 1BIBA 2PVOB 4M78C 2RPNA 2NWMA 4M77G 1OPLA 1S72A 2DPPB 2BUDA 3QUIA 1RI9A 1K73U 2E41A 5DLQE 1JO8A 2BZXA 4NL3A 3QG1A 2COZA 2QDYB 1M3BA 2H3EB 5GANh 2BIVA 2FEIA 3MP6A 1VQKT 4IIOA 4V2SA 3NHNA 3PVQA 2DKGA 3E19A 5KCOA 2DAQA 1VQ4A 5J26A 3EFRA 1VQLA 3M59A 1D1CA 1G5VA 1D0XA 2X4WA 1SEMA 1WI7A 4C92A 3CD6A 4J9IA 1X2QA 4RTTA 4J9BA 5GMKe 3AHUA 1QWFA 1M1FA 1PKTA 4IUPA 4ZN1A 1AWOA 3RKYA 3CCET 2DL3A 2RF0A 1SSFA 1YIJQ 4HXJA 3OMCA 2CSQA 3VS4A 5GANd 4PLIA 3NFCA 5CKFA 3JCMg 4JJNK 3JCMb 1AT1B 1W6XA 3Q1JA 4FSXA 3SDZA 1SHGA 4LE9A 3MKDA 2J6KA 3EG1A 1ZLMA 2YRCA 3EGXA 3VS0A 2B86A 2QA4T 1M8MA 2OX7A 1ZBJA 2AIRB 3CCVA 1VQKQ 2K79A 1YP5A 3OS5A 3I5SA 1XTDA 4M7AF 4JLIA 4CC3A 1IGUA 2CP7A 1VIEA 2JS2A 1YJ9Q 2VXFA 5LJ5g 1Q86R 5A2QE 1ZQ1A 4N0AC 2DETA 3I56A 1R8OB 4HCZA 1BI1A 1EX4A 3ZBDA 2VWFA 1I8FA 4ZTJA 2IPOB 3CC2A 3BFMA 3E2UA 2DIGA 1E6HA 3OB9A 5HCKA 4NL2A 4IUUA 2CT4A 3GLXA 1N8RU 4D6WA 2DILA 4AMCA 2IIMA 5GMKl 4C8QF 4Y28E 3OBWA 3MJXA 3QZ5B 3M4GA 4MZTA 1TSFA 1TH7A 3P8DA 2MWPA 2PUKB 4OB1B 1V76A 3IQLA 1AWJA 1VQOA 1KD1C 3DB3A 2RJDA 2YWWA 2O31A 2FB7A 3S6WA 3FDRA 1C6VX 2RQWA 3QDFA 4F7UE 2RQVA 2ROTA 1D1BA 1X69A 2QAZA 2QQ9A 4E2FB 4FW2A 1WX6A 4OF1A 3CCQQ 3ME9A 1EIFA 1HXDA 4QVDA 1VA7A 3CPWA 4DEXA 2HSPA 1OX9A 2JJ9A 2NYSA 3OSVA 1ABOA 4Y92A 1QKWA 3LW5E 1SKUB 4HVVA 2L3SA 1M1KC 2EPDA 3VYGA 4DOVA 2RK1A 4XTXA 4F7UB 4KULA 1G3SA 4RTZA 4M7AE 2D8HA 3V7RA 2OJ2A 3EGDB 1M9SA 2XK0A 3HP9A 2ECZA 3V8KA 4WCIA 2RJEA 3FLGA 1Q81U 2LCSA 1YJWQ 2QQBA 2A0FB 3O8VA 4BDZA 1VQ7T 2P0QA 4B9XA 2J05A 3GNFB 5LJ3h 4PJLA 2L8DA 2HL3A 3CCJQ 4E7HA 1KQSA 5ECAA 1W1FA 2EBPA 2EQKA 2RH2A 4PJOF 4JLGA 3FJPA 4M7AB 1N9SA 3OYDA 2HEQA 4KGXB 3CCLT 2LX7A 2DIQA 1WPYA 1VYVA 1Y96A 1OULA 3G71A 3EG2A 2WSEE 4IKFA 1XOVA 4VUBA 3EH2A 2JMCA 1QW1A 5C6SA 1IZ6A 3L2UA 1BI3A 2LT4A 5CO7A 1ZA2B 1Y7XA 4C5IA 2KGTA 1I5OB 2YRDA 3A98A 2DJZA 2DM1A 4FYYB 3REAB 1B34A 2OAUA 1QKXA 1TTHB 2WACA 1QVFA 2DTOA 2QEXT 2L2PA 2YUOA 2B8AA 2X4XA 2KVQG 3DLMA 4MZPA 4IUVA 2HQEA 1MMDA 1X75C 1RAEB 1I07A 2X4JA 4J9GA 2HQXA 2EYZA 1VQKA 3HRSA 1QP2A 2EGAA 2O4XB 2CP0A 5IN1A 4BB7A 4E7SA 3EG9B 1OZ3A 1ZUYA 5GAOp 3J7AF 5FU7B 1MMNA 3RR6A 2KEAA 3GBQA 3OYIA 3VS3A 1ZUUA 5GANg 2C0TA 3J80E 4JDSA 2LRQA 2HQHA 3FRNA 2VASA 3JB9F 3LX7A 4L59A 3JCMh 3UA6A 1GFCA 3QJYA 2E3HA 3EFOA 3CCEA 4PJOE 1K1ZA 4OMPA 2CZ7B 2Y90A 1GCPA 2DEQA 2RHUA 2EVRA 3OYAA 4CC7A 4JPBW 2DL5A 1JBMA 1R0CB 1CKAA 4C0DB 4LDUA 4M7AC 4MZMA 1PSFA 1X6BA 2CGHA 4BACA 1K9MR 1U3OA 4M7DG 2DYBA 2GFAA 2MPXC 3JV3A 2GNCA 2IG0A 4M75A 4TVRA 1GXIE 5IXFA 5LJ5h 3T9NA 3FC3A 1S72Q 1UGVA 4C92F 4PJOB 2DVJA 4R55A 2VKNA 3HRTA 2OTJT 1WYXA 2KROA 4GBQA 2DTIA 4LDWA 4C8QC 4EMGA 1M3AA 3F70A 1RABB 1WHHA 5FRNA 3CXCP 2Y4YA 3CQTA 2KI7A 2K3YA 4MDXA 3S3MA 3META 1UFFA 5J39A 1VQPT 3L2WA 4Z88A 3OS0A 2ATCB 1JQQA 4M78E 1VQ4Q 1PM3A 3SWNA 1VQLQ 3C4SA 1Z9QA 2COYA 5FWCA 3M9QA 2H8HA 2LMJA 1UEBA 1BK2A 1MNDA 4DBFA 1WQ7A 2A37A 1YI2Q 2XIDA 2DXBA 2DJQA 2LJ3A 3CCJA 4B6MA 1YWOA 2SRCA 2LX9A 4ZN3A 3JB9I 4XTWA 1ZSZA 2G6FX 3L2RA 1F1BB 1I1JA 1Y57A 1VQMT 2DF6A 2O9SA 5M9OA 3MHXA 3E9GA 4C5GA 4EMKB 1KC8R 2FVUA 1E7OA 1K8AR 3A8OB 4X1VA 4KRTA 3M58A 5FWBA 5CK9A 1AWXA 1EFNA 3QZ9B 3A8HB 2DBKA 2BZYA 3WVEB 4M78B 2NUPA 1K0XA 5KYUB 1I4K1 2LC4A 1RUWA 2KT1A 2YUNA 4PKCC 1O75A 3FEOA 2X3XD 4CC2A 2GF7A 3M53A 3CCVQ 1A0NB 1DJ7B 3BW1A 2MOXA 5A0LA 1KD1U 1GRIA 4KUDK 3BDLA 4PJOC 2P4TA 1GCQC 3HPWA 1FMWA 1N5ZA 1WHJA 3CC2Q 3PIPA 2FO0A 1QVFS 1FMKA 1LOJA 1UHFA 1M90C 2MIOA 2MK5A 2XDPA 5KYXB 3OA6A 5GAOq 5D7UA 4RKUE 1IHWA 3H41A 5KYWB 4HCCA 2C0OA 1ARKA 5EC7A 2K4YA 5GMKj 1VQOQ 2LCCA 3CMAT 4AG2C 4M7AD 3SD4A 2F2VA 2NUTB 5GAMj 1MV0B 1JJ2A 2AKLA 3CCLA 2I2LA 3TU4K 1UJYA 2O88A 1BI0A 3A8MB 1NJIC 2XKOC 4L6V5 1VQ6T 2F5KA 2DLPA 2HKQB 4OMMA 1D0YA 2EQIA 1OV3A 3G7ZA 1EZZB 3HFNA 4M75G 2K5LA 3CMET 2PVGB 2YUPA 4OVAA 1JU5C 4LN2A 1Y71A 5DLOA 4FYWB 2V8JA 4N4IA 2M1HA 3TSWA 1WJQA 4EMKC 5I21A 1X6GA 4JRQA 2CUBA 2KYMA 2BE9B 2D9TA 4E47A 5L8RE 4MDWA 1M2VA 1WQWA 4P5NA 3CCUT 4HT8A 3RMSA 4X9DA 2RA2A 1HYOA 1HSQA 1W2BA 2GCXA 3JAME 4ESRA 4AFZC 3CBOA 2KBTA 4XTUA 4XU3A 3C95A 2SEMA 1FWZA 3OW2A 3MCAB 1ZA1B 1WFWA 1RLQC 5CQYA 3CPWP 5A0GA 3CMAQ 3EGUA 3OYFA 3CC4T 2MF2A 1UG1A 3CCMT 1SRLA 2EJ9A 2GQIA 4QQ6A 4IUQA 2ESWA 4OB3B 2J7IA 4QW2A 2E10A 4ZGEB 1VQ6Q 3QIIA 1FMVA 1E6GA 4PJNA 2P84A 5C0MA 1D3BB 4DBRA 4J8OA 1PCXA 1ABQA 4XK8E 3NTHA 1YI2A 1KHIA 5GAMe 1R0BG 1VUBA 4C92C 4D8KA 2RHZA 3I55T 4MMLA 3G71Q 4OGCA 3LH5A 3QJ6A 1ZHIA 4A4HA 2OTLT 1S1NA 3BDUA 2RQTA 3CPFA 4J6WA 1WLPB 3ASKA 4PFZA 2F2WA 1PWTA 3UATA 3DKMA 4BUGA 1VYTA 4RUGA 1KQSP 2Z0WA 3E9FA 4IURA 4GLKA 1QCFA 2EGEA 2DFUA 4ME7A 2RK2A 4PJOD 4ATOA 4F17A 1HD3A 1K4US 5D6XA 1GL5A 3RIRA 2ZCFB 1WHMA 2YUQA 4DA4A 3URGA 3CC4Q 1N9RA 2F1LA 1M3CA 1NG2A 2J6FA 3EHRA 1LJOA 1RI0A 4JUVA 2BKDN 1X6OA 2A28A 3VS2A 2O01E 1QVFP 1RADB 2E6ZA 1VYUA 1YNZA 1K0SA 1QVGP 3RDVA 5CAIA 2D1XA 1WHGA 2DL4A 2K6DA 4N0AA 4Z02A 5DY9A 1KG1A 3UF4A 2CH4A 5I2SA 3I55Q 1KQ1A 3CCEQ 2DD5A 1FXXA 1ZBXA 1ZSGA 1UTIA 2JTFA 5GAN2 1VQMA 3OYCA 2CH4W 1AZEA 2NUZA 2RN8A 4M77F 2GTOA 2YT6A 5AYFA 1Q7YR 9ATCB 2GQVA 1YITT 2ROLA 2V8IA 3L2QA 4M78D 1U1TA 1QVPA 5KYYA 1PC0A 1M4ZA 3OYHA 4ZTFA 1JJ2S 2QA4Q 3QWYA
chains in the Genus database with same CATH topology
4E7JA 2RO0A 1VQNT 1OZ3A 4M7DE 1QP3A 2LNVA 3OQ5A 4XAXB 5KE3A 1KQSS 1Q81C 5GAOp 2D0QB 5FU7B 3J7AF 1WJRA 2XHCA 2PQWA 4JRIA 3ZFJA 4R56A 4HCBA 3JCMV 3OY9A 3GOXA 1H641 5GAN5 1XNIA 2FHDA 3OYIA 2RM4A 4RMOA 2ZPGB 5CKDA 4M7DA 4GY5A 2E12A 4EMHA 1Q86C 5GANg 3J80E 4M78G 4JDSA 4BI8B 2JZ2A 4J5YA 2LRQA 3G6EA 1V29B 2VV5A 3FRNA 1YJ9T 5GAMg 3JB9F 4C0DC 3LX7A 2RI2A 4L59A 2D6FA 3C94A 3JCMh 2MMPA 2ZPBB 3QJYA 3OS2A 3CCEA 3OS1A 4BE2A 2EIFA 4PJOE 1M8VA 2RJFA 3P8HA 2KK4A 4XTZA 3MO8A 5DM7R 3CC7A 2CZ7B 4X9CA 3VKIA 2Y90A 5A0DA 2DEQA 2RHUA 5GMKi 3GP8A 5FROA 3A8LB 3EAEA 2VXEA 5CKHA 4ZGJB 4UC4A 2K2VA 5GAOn 3OYAA 3OYEA 4L5GA 3G6ET 3C12A 5EG2A 3NTIA 1JBMA 2RHYA 5KCHA 3CBMA 3UWNA 2VGMA 3M55A 4C0DB 4LDUA 1UB4A 3DB4A 4JS5A 4M7AC 3HKSA 2EYQA 1PSFA 2EWNA 2XU8A 4MZMA 4BI3A 4F7UF 2CGHA 4BACA 2WSCE 4QVZA 4A4GA 1W2BS 3VUZA 3CMAA 3CC7T 4LD6A 1PSEA 3QHSA 2OTJA 1QVGS 2RD1A 3RUXA 4M7DG 2FYKA 4A4KA 2GFAA 3VJPA 1YJNA 3G4SA 4QQGA 1X01A 2EAYA 5KE2A 3OYKA 1UGQB 2IG0A 3V8JA 2XDDA 4M75A 4TVRA 2QQRA 4C8QE 2YLCA 2EFIA 3OYGA 2EJFA 3JCMP 1GXIE 4KT0E 5LJ5h 3JCMe 3T9NA 5I2MA 3OW2S 3E1SA 3FC3A 2ZPFB 1WJSA 2E6NA 1U1SA 2QQSA 2VC8A 1VQ6A 4C92F 4PJOB 3TREA 4M75D 4R55A 2E65A 2ZPHB 2HNIA 3HRTA 4WF2A 3FB9A 4M77E 4N4GA 2OTJT 3LGFA 1VQPA 2F5TX 2DTIA 4LDWA 4A54A 4C8QC 4PJOG 4EMGA 5GAOr 5D6WA 5FLXE 1XQHA 3QPHA 3F70A 2YRVA 2XICA 3PGGA 4YTLA 3VYHB 5FRNA 2E5QA 2F69A 3CCQT 2Y4YA 4J6XA 4C5HA 5IAYA 2EJGA 3LLRA 1VQ5T 4CRIA 2E70A 2K3YA 1P92A 2L89A 2R5AA 3S3MA 4MDXA 4FT4A 3CEYA 3OYLA 3META 4PNOA 4M75F 5LJ3g 4A4FA 3CCSA 2PU9B 1M90U 1UGSB 2M0OA 2QTXA 2DZCA 2EKOA 5J3BA 5LL6S 3H8ZA 2YHTA 5J39A 4O5VA 3PIOA 3PT9A 4Y91A 1VQPT 3JCMW 4FIBA 2QXFA 3OS0A 2VYTA 3KBGA 2NLUA 3L2WA 2DO3A 5LJ5e 3CCUA 4JS4A 2XI9A 1VQ8T 2X4YA 4C8QB 4M78E 4LDYA 2K5FA 3BY7A 4E7KA 2AHJB 3SWNA 3CXCA 4HA8A 5GAN3 2LT1A 3C4SA 5HK3A 4IUTA 5GAN6 3G71T 1YHQT 4OMFB 2DXTA 1BIAA 3M9QA 3PMIA 3PFSA 4KBMB 3S3NA 1UEBA 2HAXA 1WQ7A 4M77B 2XIDA 2DXBA 1Y96B 2IVWA 4HT9A 4XU1A 1Q82U 1BIBA 2PVOB 4M78C 3CCJA 3JCMX 2LX9A 2CZ6B 2LQ8A 3M57A 4FL6A 4ZN3A 3HRUA 4M77G 3JB9I 3CCRT 2VUBA 4XTWA 1S72A 2DPPB 2BUDA 2KSSA 3QUIA 3OYYA 3L42A 3L2RA 2LQKA 4M7DB 1YJWT 1K73U 2E1HA 3CC4A 2E41A 2JUFA 5DLQE 1VQMT 3CCMA 3QDRB 4NL3A 3QG1A 3SB2A 5M9OA 1B34B 4FU6A 3MHXA 3E9GA 4C5GA 2QDYB 4EMKB 2FVUA 5GANh 3A8OB 2K5IA 3JB9D 5GMKh 3M58A 1D3BA 3JB9H 5GAMf 5CK9A 3CCJT 3QZ9B 2BIVA 2PVDB 3A8HB 3WVEB 4MMKA 4XU2A 4M78B 3GIBA 2DK3A 3MP6A 1VQKT 2X35A 4V2SA 2RHXA 1I4K1 4F7UA 2LC4A 1MGQA 2KQWA 4A4EA 2DKGA 1O75A 3FEOA 4PKCC 3E19A 5GMKm 4M7DC 5KCOA 2GF7A 3M53A 2M16A 3I55A 4OGEA 3LWHA 1O9SA 2DAQA 1DJ7B 2A7YA 3BW1A 5J26A 1VQ4A 4O6JA 3EFRA 3JB9G 1K9MU 1VQLA 3M59A 2DD4A 4CI0C 3J81E 2KMTA 1G5VA 3GNGA 2OTLA 2X4WA 2RHIA 1KQ2A 5A0LA 4C92A 1KD1U 4KUDK 3CD6A 2GFUA 5GANe 5GMKe 2LTOA 3AHUA 3X25B 4JRPA 3BDLA 1M1FA 3V7CA 4PJOC 2P4TA 4IUPA 4ZN1A 5GAOl 3RKYA 4RCCA 3HPWA 3CCET 1UGRB 4M75E 3CXCS 4RG2A 4C92D 4EDUA 3PIPA 2Y4XA 1QVFS 1SSFA 1LOJA 2MWOA 1W4SA 1M90C 2LVMA 3HFOA 3OMCA 4XQ3A 3WXMB 2XDPA 4BY6B 1H3ZA 3CD6T 3OA6A 1Q7YC 5GANd 2QA4A 2XG8D 4PLIA 3NFCA 1KHCA 3PNWC 5CKFA 3JCMg 5GAOq 4M7AA 1WNLA 4RKUE 2R57A 4J7IA 1Y07A 5GAMd 4JJNK 3JCMb 4HCCA 3Q1JA 4FSXA 5CQXA 2K4YA 3KUFA 2LDMA 5GMKj 5GANj 3SDZA 1LNXA 4XTYA 1G3YA 2LCCA 3SFMA 3PTAA 3CMAT 5LJ3f 4M7AD 3QBYA 3SD4A 1M1GA 3L1AA 5GAMj 1YJNT 1JJ2A 4C92G 4II1A 2E64A 3UDCA 3G4ST 1I5LA 3CMEA 3MEWA 4A53A 3CCLA 1Q82C 4DQ2A 2QA4T 4QQDA 2I2LA 3RESA 3A8GB 4C0ZA 3MEAA 1YCYA 3JCMc 3CCVA 3TU4K 4E7LA 1BI0A 2P0PA 2JOYA 2XKOC 3A8MB 4L6V5 1NJIC 1VQ6T 2F5KA 3OS5A 4M75B 1K73C 4M77C 1XTDA 2ZGWA 4M7AF 4JLIA 1G3WA 2KAFA 2JN0A 2HBPA 4ZGDB 1VIEA 1I81A 3P8BB 2RB6A 2VXFA 3G7ZA 3HFNA 4M75G 5LJ5g 2K5LA 1ZQ1A 4N0AC 5A2QE 3CMET 2PVGB 1Q7YU 3MEVA 4OVAA 1Y71A 5DLOA 3I56A 1R8OB 2V8JA 4QVCA 3OSSC 4HCZA 1BI1A 2JVVA 3ZBDA 1I8FA 4N4IA 3M5AA 4FM4B 2L5QA 4NOYA 2M1HA 4ZTJA 3CC2A 3BFMA 4C0GA 1WJQA 2DIGA 2MI6A 4EMKC 5I21A 4JRQA 3CCST 1YIJA 1KC8U 2PUOB 1K8AU 3OB9A 2C06A 2D9TA 4E47A 4NL2A 4IUUA 5L8RE 2CZ1B 4MDWA 5CR2A 1WQWA 3GLXA 1N8RU 2LCLA 2EQUA 3M54A 4LDVA 4P5NA 4D6WA 3L2VA 3CCUT 3RMSA 4X9DA 4HT8A 3HL8A 3S3OA 1YITA 2RA2A 4C8QF 4Y28E 2O4XA 3OBWA 5GMKl 3I56T 3NTKA 3QZ5B 3M4GA 3JB9J 4MZTA 1K9MC 3QXEB 1NJIU 1TH7A 1W2BA 3P8DA 2MWPA 2PUKB 4OB1B 2GCXA 3OYNA 1VQ9A 3JAME 1QVGA 4FT2A 3UPUA 1NPRA 2MAMA 3CBOA 1VQOA 1KD1C 3DB3A 4BD3A 2RJDA 2DTHA 3QSUA 3L2ZA 4XTUA 3SWNB 2ZPEB 5LJ3d 5CKBA 4OP0A 2FB7A 4XU3A 3S6WA 3FDRA 1HK9A 2CYZB 3V8LA 2P0KA 1VQNA 3C95A 3OW2A 1FWZA 4BI4A 1NPPA 3ZEHA 3MCAB 4F7UE 3M4YA 5GAMh 1FX7A 5CQYA 3KXTA 4RG8A 5LJ3j 1S72T 3OYJA 5A0GA 3JSCA 4Q5WA 2M9UA 3OYFA 2QQ9A 3CC4T 4J7FA 2MF2A 3V7SA 1OZ2A 3CCMT 2EJ9A 2VGNA 1N27A 4QQ6A 2CS7A 4IUQA 5FU6B 4OF1A 2DXCA 3QO3A 4OB3B 1YJ9A 3OBYA 3OYBA 4QW2A 3X20B 3LWIA 1U8RA 5IT9E 3ME9A 2XD0A 4C92E 1EIFA 2E10A 2G3RA 1HXDA 2FL7A 4QVDA 3OYMA 4ZGEB 4XU0A 3QIIA 3LYIA 4M78F 4BE1A 3CPWA 4BY6C 2EQMA 3HHTB 5C0MA 1D3BB 2KDSA 3VV0A 3RKWA 2A3LA 4OB0B 3OSVA 4J8OA 4XK8E 2RI5A 3NTHA 1NE8A 3UT1A 3LW5E 1YI2A 2K57A 1M1KC 1KHIA 3JCMf 3HSBA 3JCMQ 5GAMe 4C92C 1VUBA 1BYMA 2RHZA 2QI2A 3I55T 3VYGA 5CIUA 4MMLA 4DOVA 2RK1A 3CBPA 4OGCA 4XTXA 4F7UB 4KULA 4BDYA 1VQ4T 4M7DD 1G3SA 1VQLT 3QJ6A 1ZHIA 4M7AE 1VQ7A 2H3JA 4A4HA 2OTLT 2KY9A 3BDUA 3CPFA 4C0FA 4J6WA 3V7RA 3ASKA 5CVIA 4F7UG 1MHNA 4HKEA 1M9SA 4PJOA 2EQJA 2XK0A 3HP9A 3DKMA 4BUGA 2DXUA 4ELYC 1YI2T 3H6ZA 3N5BB 3E9FA 4IURA 3V8KA 4X34A 3RKXA 4GLKA 5GAN8 4M75C 2RJEA 3FLGA 1Q81U 5CKEA 4M7DF 4C92B 2QQBA 4ME7A 2RK2A 3MEUA 2L3RA 3O8VA 4BDZA 1VQ7T 4PJOD 4XTVA 2P0QA 4ATOA 4B9XA 1KC8C 3INZA 4BE0A 1K8AC 1OI1A 1Q86U 3GNFB 2ZZDA 5LJ3h 2L8DA 3PMTA 5D6XA 3LGLA 5LJ5f 1N8RC 1M1KU 3X24B 1M5Q1 3QYHB 4E7HA 3JCMJ 1KQSA 1UGPB 3RIRA 3TEEA 4EPCA 3CCQA 1OYXA 2ZCFB 3X26B 1WGSA 4DA4A 1VQ5A 3JRZA 2EQKA 2RH2A 4KUIA 4N4HA 3URGA 4PJOF 4C8QA 1N9RA 4OB2B 4JLGA 3EFSA 3FJPA 4M7AB 1N9SA 1LJOA 2V8KA 1RI0A 4JUVA 3OYDA 1YBYA 5GAN4 2BKDN 5CCAA 3CCLT 1X6OA 4M7AG 1JRIA 1VQ8A 3LH0A 5GAOm 4C8QD 2R58A 3GPLA 1N6AA 2DIQA 3JCMd 1WPYA 2O01E 4M77A 3CCVT 1JB0E 3RERA 1BI2A 1Y96A 2E6ZA 2DVEA 4J83A 3G71A 3QYGB 2QEXA 1YHQA 2WSEE 4IKFA 2JTMA 1XOVA 4VUBA 3X28B 3SWNC 5CAIA 2XDBA 3CPWS 1QW1A 3A5ZB 5C6SA 4C5EA 2WSFE 1IZ6A 2QQAA 1BI3A 2LT4A 4N0AA 4Z02A 5DY9A 5LJ3e 3L2UA 5CO7A 1Y7XA 3FIFA 4C5IA 5GAN7 4M77D 1KG1A 4LDXA 5I2SA 2DJZA 5HK0A 4RCBA 2CZ0B 5HY6A 3QKJA 1KQ1A 1B34A 2DD5A 2OAUA 1FXXA 1ZBXA 1IREB 4EMKA 3CCRA 4DOWA 4NS5A 2WACA 1QVFA 2DTOA 2QEXT 3ER0A 3CC2T 1YJWA 2JTFA 5FU6C 2B8AA 2X4XA 4C8QG 4JRKA 2KVQG 5HKCA 3GF5A 3VU3C 5GAN2 3OYCA 1VQMA 1YIJT 4M78A 3MP8A 4LD9K 2YLBA 2CKKA 5FRMA 3M56A 1G3TA 3MP1A 2ZPIB 1VIFA 4M77F 3DLMA 2HD0A 3OMGA 4MZPA 4PLLA 3RMQA 2JNGA 4IUVA 1RL2A 5D6YA 2HQEA 5AYFA 4PL6A 1NZ9A 2DZ9A 5FU7C 5LJ5d 1X75C 2GQVA 1YITT 2V8IA 2RJCA 3L2QA 4J6YA 3TCJA 4M78D 2X4JA 1U1TA 1BKBA 2HQXA 2RI3A 1VQKA 1QVPA 4E7IA 2R5MA 4ELZC 1VQ9T 5LJ5j 1M4ZA 1VQOT 3HRSA 3OYHA 1AHJB 4ZTFA 1QP2A 5GANf 5KH6A 2O4XB 2K3XA 3DLLA 1JJ2S 3R6OA 4B9WA 5IN1A 4BB7A 3WVDB 3VUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CKB A;  5CK9 A;  2KMT A;  4VUB A;  4HKE A;  4MZP A;  2C06 A;  3NFC A;  4MDX A;  5CKF A;  3JRZ A;  5CO7 A;  5CQY A;  1X75 C;  4ELY C;  5CKH A;  5CR2 A;  5CKD A;  3TCJ A;  3JSC A;  5HK0 A;  1NE8 A;  1M1F A;  2VUB A;  5CKE A;  2MF2 A;  5CQX A;  3G7Z A;  4ELZ C;  1UB4 A;  4ME7 A;  4MZT A;  4MZM A;  1VUB A;  3HPW A;  5CCA A;  5DLO A;  4OF1 A;  5HK3 A;  5HKC A;  3VUB A; 
#chains in the Genus database with same CATH topology
 1VQN T;  1Q82 R;  5KE3 A;  1WHL A;  3EG3 A;  3ZFJ A;  1WXB A;  4R56 A;  2DRK A;  3OY9 A;  5GAN 5;  4RMO A;  4PK4 A;  5CKD A;  4M7D A;  1Q86 C;  1IXD A;  4M78 G;  1K73 R;  2DX1 A;  4J5Y A;  1JXM A;  2AZV A;  1T0J A;  1TWB A;  2FG0 A;  4PJJ A;  3C94 A;  2ZPB B;  2FZC B;  3OS1 A;  2EIF A;  4BE2 A;  1M8V A;  1I0C A;  3MO8 A;  1OPK A;  3AT1 B;  3EHQ A;  5GMK i;  5FRO A;  4JZ3 A;  4ZGJ B;  3OYE A;  4UC4 A;  5GAO n;  3G6E T;  4L5G A;  5KCH A;  2ENM A;  3CBM A;  4QT7 A;  3UWN A;  1AWW A;  1YCS B;  1SF9 A;  2WSC E;  1CKB A;  4QVZ A;  1W2B S;  3CMA A;  3CC7 T;  3QHS A;  2RD1 A;  1H8K A;  2FYK A;  1WHK A;  1TOV A;  3V8J A;  4C8Q E;  2QQR A;  2YLC A;  2EFI A;  4KT0 E;  3OW2 S;  2HCK A;  2EYY A;  1YN8 A;  1WJS A;  1LPL A;  8AT1 B;  1V1C A;  1VQ6 A;  1U1S A;  3RNJ A;  4WF2 A;  3FB9 A;  4M77 E;  2F5T X;  5FLX E;  2COW A;  3M0R A;  3PGG A;  2YRV A;  3I5R A;  2DBM A;  2MYS A;  2L3Q A;  1VQ5 T;  1P92 A;  4FT4 A;  3CEY A;  1M90 U;  2PU9 B;  1UGS B;  5J3B A;  3O5Z A;  2YHT A;  3PT9 A;  2QXF A;  2NLU A;  2DO3 A;  3CCU A;  4JS4 A;  1VQ8 T;  2X4Y A;  4C8Q B;  3BY7 A;  4E7K A;  2AHJ B;  1YHQ T;  2K3B A;  3PMI A;  3S3N A;  2BZ8 A;  4M77 B;  2CZ6 B;  1TU0 B;  2LQ8 A;  4FL6 A;  3HRU A;  2VUB A;  2KSS A;  1VQ7 Q;  3CC4 A;  4A63 B;  2JUF A;  3CCM A;  2JM9 A;  5GMK h;  1TUD A;  5GAM f;  1SSH A;  1NEG A;  1N8R R;  2PVD B;  4MMK A;  4XU2 A;  1NYG A;  2DK3 A;  2JT4 A;  2KRN A;  2A08 A;  1OX8 A;  2RHX A;  4F7U A;  4JJB A;  3CCL Q;  2KQW A;  5GMK m;  3I35 A;  2DL8 A;  2M16 A;  3EGD A;  3I55 A;  3LWH A;  1IO6 A;  2A7Y A;  2K9G A;  1VQ5 Q;  2MCN A;  4O6J A;  1RAG B;  4CI0 C;  2KMT A;  3GNG A;  2OTL A;  3VRZ A;  1KQ2 A;  3SHW A;  2GFU A;  2BE7 D;  5GAN e;  1AZG B;  2LTO A;  3X25 B;  1LCK A;  3VRY A;  3V7C A;  3H0F A;  1WA7 A;  1QWE A;  2QEX Q;  4RCC A;  1UGR B;  1OQK A;  4RG2 A;  4LXC A;  2MWO A;  1W4S A;  1JJ2 P;  3WXM B;  3CD6 T;  1KIK A;  8ATC B;  2QA4 A;  2XG8 D;  1KHC A;  4M7A A;  2KRS A;  1Y07 A;  5GAM d;  1NLP C;  2LDM A;  3SFM A;  1RAF B;  3PTA A;  3QBY A;  3L1A A;  4ZNX A;  3G4S T;  3UDC A;  2D8J A;  1VOM A;  3RES A;  2FPD A;  4E7L A;  2P0P A;  1Q81 R;  4M77 C;  2ZGW A;  1G3W A;  4QKU A;  2JN0 A;  1I81 A;  2RB6 A;  2GBQ A;  2RQU A;  2QDL A;  2L5Q A;  2BTT A;  4C0G A;  3CCS T;  5IHI A;  2PUO B;  2C06 A;  2HMA A;  1UJ0 A;  5CR2 A;  4LUD A;  1RAA B;  3OW2 P;  2O2O A;  2LCL A;  4LDV A;  3HL8 A;  1YIT A;  2ZAE A;  3I56 T;  2O4X A;  1K9M C;  4F14 A;  3EG9 A;  3UPU A;  1NPR A;  3ULR B;  4BD3 A;  3QSU A;  1RLP C;  5CKB A;  4OP0 A;  2QK0 A;  2CYZ B;  3V8L A;  1VQN A;  4BI4 A;  3ZEH A;  4KGV B;  1FX7 A;  1K9A A;  2PNI A;  5LJ3 j;  1BCM A;  4Q5W A;  2OTJ Q;  1Z9Z A;  3V7S A;  1M2V B;  2VGN A;  1N27 A;  3G4S Q;  2LJ0 A;  5FU6 B;  1RAC B;  1JEG A;  3OYB A;  1W70 A;  1GFD A;  4AFQ C;  3LWI A;  1U8R A;  3VS6 A;  2XD0 A;  4C92 E;  2ED1 A;  2FL7 A;  4XU0 A;  4JJC A;  4OMQ A;  3LYI A;  4BE1 A;  2AZS A;  2EQM A;  3HHT B;  2I0N A;  2KDS A;  3RKW A;  2A3L A;  4OB0 B;  1VQP Q;  1M27 C;  2RI5 A;  1CSK A;  4E6R A;  3HSB A;  3JCM Q;  1BYM A;  2QI2 A;  2YSQ A;  5CIU A;  3CBP A;  3THK A;  4BDY A;  1VQ7 A;  2KY9 A;  3CCS Q;  2O9V A;  4C0F A;  2HZY A;  4F7U G;  4HKE A;  4PJO A;  2EQJ A;  2LJ1 A;  3M0S A;  1GCQ A;  3FJ5 A;  2DXU A;  4ELY C;  1QLY A;  2HBW A;  4X34 A;  3RKX A;  5GAN 8;  4M7D F;  4C92 B;  1D09 B;  4HVW A;  1TUG B;  1VQM Q;  4D8D A;  3M0U A;  1KC8 C;  4BE0 A;  1K8A C;  1OI1 A;  1Q86 U;  1BU1 A;  4RTV A;  1M1K U;  1M5Q 1;  3QWX X;  1UGP B;  3TEE A;  1OYX A;  3X26 B;  1KK7 A;  1WGS A;  1VQ5 A;  1ZX6 A;  2KT8 A;  4KUI A;  2AT1 B;  4OB2 B;  1FYN A;  1XJW B;  2V8K A;  4JZ4 A;  2KXD A;  5GAN 4;  4M7A G;  1JRI A;  1VQ8 A;  4C8Q D;  3A1P A;  1N6A A;  2JS0 A;  3I9Q A;  1JB0 E;  3RER A;  1BI2 A;  2DVE A;  4J83 A;  2QEX A;  1YHQ A;  3EGX B;  2EYW A;  2JM8 A;  4C5E A;  2WSF E;  2QQA A;  4EIK A;  5LJ3 e;  1UEC A;  2M0Y A;  3EH1 A;  5GAN 7;  4M77 D;  4LDX A;  2DE0 X;  4KH1 B;  5HK0 A;  4RCB A;  2CZ0 B;  2JW4 A;  4EMK A;  1IRE B;  4DOW A;  4J9C A;  5IXB A;  2ED0 A;  5FU6 C;  4C8Q G;  4HVU A;  5HKC A;  1YIJ T;  4M78 A;  3PE0 A;  4LD9 K;  2CKK A;  1G3T A;  3MP1 A;  1VIF A;  2HD0 A;  3RMQ A;  3M0P A;  4KGZ B;  5D6Y A;  5KYU A;  2CUD A;  2XMF A;  4J6Y A;  3TCJ A;  1BKB A;  2RI3 A;  1OU9 A;  4E7I A;  4J9F A;  1VQ9 T;  5LJ5 j;  2X3W D;  1AHJ B;  5GAN f;  5KH6 A;  3WVD B;  5KYN A;  4E7J A;  2DER A;  4M7D E;  4CC4 B;  2LNV A;  2K2M A;  3OQ5 A;  4XAX B;  4JJD A;  2D0Q B;  5L23 A;  2CRE A;  1WJR A;  2PQW A;  4JRI A;  3JCM V;  3GOX A;  1H64 1;  2RM4 A;  4AG1 C;  4GY5 A;  3CME Q;  1SRM A;  1V29 B;  1GBR A;  1YJ9 T;  5GAM g;  5KYY B;  2D6F A;  5KYX A;  2MMP A;  2J06 A;  1SHF A;  2RJF A;  2KK4 A;  1IRX A;  1QCN A;  5DM7 R;  3VKI A;  5A0D A;  5KYW A;  2QGF B;  4IIM A;  3GP8 A;  3A8L B;  1AVZ C;  3EAE A;  5CKH A;  1AD5 A;  3CCU Q;  4FCY A;  2PTK A;  3MPU B;  2NUT A;  2VGM A;  2KNB B;  1UHC A;  1UB4 A;  3DB4 A;  4M7D B;  2XU8 A;  4F7U F;  3VUZ A;  1PSE A;  2OTJ A;  2X51 A;  3G4S A;  4QQG A;  1X01 A;  5KE2 A;  1OEB A;  2HKN A;  1KD1 R;  2K7A A;  1NEB A;  4Z89 A;  3OYG A;  2EJF A;  2LQW A;  3JCM e;  3E1S A;  1SPK A;  1G8X A;  1MMA A;  2E3I A;  2QQS A;  4RTY A;  2VC8 A;  2V1R A;  1VQ9 Q;  3CCM Q;  2ZPH B;  3H0H A;  1WXU A;  3LGF A;  3RBB B;  1VQP A;  4A54 A;  2VB6 A;  4PJO G;  2KR3 A;  5D6W A;  3QPH A;  2XIC A;  3VYH B;  1UE9 A;  2E5Q A;  2F69 A;  3CCQ T;  2CP3 A;  4C5H A;  1NYF A;  2E70 A;  4LNP A;  3OYL A;  4PNO A;  1G2B A;  4M75 F;  4OMN A;  3CCS A;  2FZG B;  2ABL A;  2QTX A;  2DZC A;  2DYI A;  3H8Z A;  5LL6 S;  2V1Q A;  3PIO A;  4Y91 A;  3JCM W;  2VYT A;  5LJ5 e;  2K5F A;  1M1K R;  1YFN A;  2D0N A;  2LT1 A;  2OTL Q;  4IUT A;  4RTX A;  4OMF B;  2DXT A;  1BIA A;  2HAX A;  3M0T A;  2L0A A;  2QTV A;  4HT9 A;  1Y96 B;  4AFU C;  3JCM X;  3M57 A;  4RTW A;  3CCR T;  4OML A;  3OYY A;  3L42 A;  2P4R A;  2LQK A;  1YJW T;  6AT1 B;  2E1H A;  3QDR B;  3SB2 A;  1B34 B;  4FU6 A;  2YXY A;  1OOT A;  2K5I A;  3JB9 D;  3JB9 H;  1D3B A;  1KSW A;  4J9D A;  2DL7 A;  3CCJ T;  4WTO B;  1ACM B;  2V26 A;  3GIB A;  2X35 A;  1MNE A;  1BBZ A;  3D7S B;  1MGQ A;  4A4E A;  1H3H A;  1M30 A;  2AKK A;  4FW1 A;  4M7D C;  1QQJ A;  1D0Z A;  4F04 B;  4OGE A;  1O9S A;  2QAS A;  1PNJ A;  3JB9 G;  1K9M U;  2DD4 A;  3J81 E;  2RHI A;  1TG0 A;  3NMZ C;  2VVK A;  2PZ1 A;  4JRP A;  2C0I A;  5GAO l;  1T3L A;  1B3Q A;  4M75 E;  3CXC S;  3TSZ A;  4C92 D;  4EDU A;  2Y4X A;  2LVM A;  3HFO A;  4XQ3 A;  4BY6 B;  1H3Z A;  1Q7Y C;  3EFO B;  3REB B;  3PNW C;  1WNL A;  2HSE B;  1YIT Q;  2R57 A;  4J7I A;  4J9H A;  3CCR Q;  1TXQ A;  1X43 A;  3VS7 A;  5CQX A;  5GAN j;  3KUF A;  1LNX A;  4XTY A;  1G3Y A;  5LJ3 f;  1ZUK A;  1M1G A;  2FZK B;  3VS5 A;  1YJN T;  4C92 G;  2M02 A;  4II1 A;  2E64 A;  1I5L A;  2EKH A;  1X27 A;  2QG9 B;  3CME A;  1VQN Q;  3MEW A;  4A53 A;  1Q82 C;  4DQ2 A;  4QQD A;  3A8G B;  4C0Z A;  3MEA A;  1YCY A;  3JCM c;  4M4Z A;  3BE3 A;  2W0Z A;  2JOY A;  1GBQ A;  2HL5 C;  4M75 B;  2DA9 A;  1K73 C;  2KAF A;  2DEU A;  2HBP A;  4ZGD B;  5I22 A;  3H9N A;  2CSI A;  3P8B B;  1NM7 A;  3MEV A;  1HJD A;  4QVC A;  3OSS C;  1OU8 A;  2JVV A;  3M5A A;  4FM4 B;  4NOY A;  1J3T A;  3KFV A;  2MI6 A;  4DBQ A;  1YIJ A;  1KC8 U;  2X9H A;  1K8A U;  2DNU A;  2JMA A;  2DRM A;  2HDA A;  4F16 A;  3G6E Q;  2RMO A;  2CZ1 B;  1PHT A;  2EQU A;  3M54 A;  4FYX B;  3L2V A;  3EG0 A;  5AT1 B;  3S3O A;  3NTK A;  2RNA A;  3JB9 J;  3QXE B;  1NJI U;  3CC7 Q;  3OYN A;  1VQ9 A;  1QVG A;  4FT2 A;  2YDL A;  1MMG A;  2MAM A;  2EW3 A;  2J6O A;  1NBE B;  2DTH A;  3L2Z A;  5LJ3 d;  3SWN B;  2ZPE B;  2CT3 A;  1HK9 A;  1T0H A;  2P0K A;  1AEY A;  1NPP A;  2GGR A;  5GAM h;  1MUZ A;  3M4Y A;  1KJW A;  3KXT A;  3HTR A;  4RG8 A;  1S72 T;  2OAW A;  3OYJ A;  4E7Z A;  3H0I A;  3JSC A;  2M9U A;  4J7F A;  1OZ2 A;  2A36 A;  1YJN Q;  4HCK A;  1AOJ A;  2CS7 A;  3U23 A;  2DXC A;  3QO3 A;  1YJ9 A;  1ZSZ B;  3OBY A;  3X20 B;  1Y0M A;  2AK5 A;  5IT9 E;  4R0K A;  1MV3 A;  2G3R A;  3OYM A;  1QMC A;  4M78 F;  4BY6 C;  4Z8A A;  1C1A A;  3VV0 A;  2JTE A;  1B7T A;  1NE8 A;  3UT1 A;  1VQ8 Q;  2K57 A;  3JCM f;  2DMO A;  2NUP B;  2LQN A;  5GJW B;  1YHQ Q;  1VQ4 T;  4M7D D;  1VQL T;  2H3J A;  2QYZ A;  5FW9 A;  2GTJ A;  5CVI A;  1MHN A;  3PVL A;  1YI2 T;  3H6Z A;  3N5B B;  2KYB A;  4M75 C;  5CKE A;  1UUE A;  3MEU A;  2L3R A;  4XTV A;  2OI3 A;  3INZ A;  2ZZD A;  3PMT A;  2E5K A;  2EGC A;  2E4H A;  3LGL A;  5LJ5 f;  1N8R C;  3X24 B;  3QYH B;  2CP5 A;  3JCM J;  3TVT A;  4EPC A;  3CCQ A;  1PRL C;  1IGQ A;  3JRZ A;  4N4H A;  4C8Q A;  2M51 A;  1WZO A;  3EFS A;  2QGG A;  1PG5 B;  1YBY A;  5GJV B;  4K11 A;  2FRY A;  5CCA A;  4AFS C;  4RTU A;  3LH0 A;  1TS9 A;  1UDL A;  5GAO m;  3GPL A;  2R58 A;  3JCM d;  4M77 A;  3CCV T;  4DBH A;  1W2B P;  3QYG B;  2FRW A;  1T3S A;  4GLM A;  2JTM A;  3X28 B;  2XDB A;  3SWN C;  3CPW S;  3A5Z B;  1Q95 G;  1YWP A;  5I11 A;  3UA7 A;  2FPE A;  1X2K A;  3FIF A;  2KRM A;  3NPF A;  4PFO A;  4ORZ A;  2CP2 A;  5HY6 A;  3QKJ A;  3CCR A;  1WXT A;  4NS5 A;  2LP5 A;  3ER0 A;  1PD1 A;  3CC2 T;  1YJW A;  4JRK A;  3GF5 A;  3VU3 C;  4FSS A;  1WDX A;  1ZSZ C;  3CD6 Q;  3MP8 A;  2YLB A;  5FRM A;  3M56 A;  1M90 R;  1G83 A;  2ZPI B;  3VS1 A;  4PLL A;  2W10 A;  3OMG A;  2FPF A;  2JNG A;  1RL2 A;  4PL6 A;  1NZ9 A;  2DZ9 A;  5FU7 C;  1U5S A;  3SEM A;  5LJ5 d;  4PJM A;  2RJC A;  1PKS A;  1JXO A;  1U06 A;  1PD0 A;  2R5M A;  4ELZ C;  2F2X A;  1VQO T;  1LVK A;  3R6N A;  3DLL A;  2K3X A;  3C0C A;  3R6O A;  4B9W A;  3VUB A;  2RO0 A;  1K76 A;  1QP3 A;  4J9E A;  1KQS S;  1Q81 C;  1QCO A;  2XHC A;  2LNH B;  4HCB A;  1B07 A;  1XNI A;  2FHD A;  2ZPG B;  1NJI R;  2E12 A;  3TQ7 P;  4EMH A;  2RQR A;  4BI8 B;  2JZ2 A;  3G6E A;  2VV5 A;  4C0D C;  2RI2 A;  3OS2 A;  4AT1 B;  2KXC A;  3P8H A;  4XTZ A;  3CC7 A;  4X9C A;  3NGP A;  1M2O A;  2VXE A;  1KFZ A;  3ZL7 C;  2K2V A;  3C12 A;  1RAH B;  5EG2 A;  3I56 Q;  3NTI A;  2RHY A;  4KH0 B;  1BCO A;  3M55 A;  4JS5 A;  3HKS A;  1IHV A;  2EYQ A;  2EWN A;  4BI3 A;  2LZ6 B;  4A4G A;  1WIE A;  4LD6 A;  4FYV B;  1QVG S;  3RUX A;  4A4K A;  3VJP A;  1YJN A;  4PFP A;  2EAY A;  1RAI B;  3OYK A;  1UGQ B;  2XDD A;  2CP6 A;  3JCM P;  5I2M A;  4LUE A;  2ZPF B;  5IHK A;  2E6N A;  3TRE A;  4M75 D;  2E65 A;  2L3P A;  2HNI A;  4N4G A;  2EYX A;  1TUC A;  5GAO r;  1SG5 A;  1XQH A;  5IH2 A;  4YTL A;  1C0M A;  4ANJ A;  1PRM C;  2JXB A;  4J6X A;  5IAY A;  7AT1 B;  2EJG A;  3LLR A;  4CRI A;  2R5A A;  2L89 A;  5LJ3 g;  4A4F A;  3M0Q A;  2M0O A;  2EKO A;  4O5V A;  1Q7Y U;  4FIB A;  3KBG A;  2XI9 A;  4LDY A;  1H92 A;  1NLO C;  3CXC A;  4HA8 A;  4DEY A;  5GAN 3;  5HK3 A;  5GAN 6;  3G71 T;  1D1A A;  3G1J A;  4OMO A;  5IHN A;  1BB9 A;  3PFS A;  1IB8 A;  4KBM B;  2CDT A;  1R77 A;  2IVW A;  2KE9 A;  4XU1 A;  1Q82 U;  1BIB A;  2PVO B;  4M78 C;  2RPN A;  2NWM A;  4M77 G;  1OPL A;  1S72 A;  2DPP B;  2BUD A;  3QUI A;  1RI9 A;  1K73 U;  2E41 A;  5DLQ E;  1JO8 A;  2BZX A;  4NL3 A;  3QG1 A;  2COZ A;  2QDY B;  1M3B A;  2H3E B;  5GAN h;  2BIV A;  2FEI A;  3MP6 A;  1VQK T;  4IIO A;  4V2S A;  3NHN A;  3PVQ A;  2DKG A;  3E19 A;  5KCO A;  2DAQ A;  1VQ4 A;  5J26 A;  3EFR A;  1VQL A;  3M59 A;  1D1C A;  1G5V A;  1D0X A;  2X4W A;  1SEM A;  1WI7 A;  4C92 A;  3CD6 A;  4J9I A;  1X2Q A;  4RTT A;  4J9B A;  5GMK e;  3AHU A;  1QWF A;  1M1F A;  1PKT A;  4IUP A;  4ZN1 A;  1AWO A;  3RKY A;  3CCE T;  2DL3 A;  2RF0 A;  1SSF A;  1YIJ Q;  4HXJ A;  3OMC A;  2CSQ A;  3VS4 A;  5GAN d;  4PLI A;  3NFC A;  5CKF A;  3JCM g;  4JJN K;  3JCM b;  1AT1 B;  1W6X A;  3Q1J A;  4FSX A;  3SDZ A;  1SHG A;  4LE9 A;  3MKD A;  2J6K A;  3EG1 A;  1ZLM A;  2YRC A;  3EGX A;  3VS0 A;  2B86 A;  2QA4 T;  1M8M A;  2OX7 A;  1ZBJ A;  2AIR B;  3CCV A;  1VQK Q;  2K79 A;  1YP5 A;  3OS5 A;  3I5S A;  1XTD A;  4M7A F;  4JLI A;  4CC3 A;  1IGU A;  2CP7 A;  1VIE A;  2JS2 A;  1YJ9 Q;  2VXF A;  5LJ5 g;  1Q86 R;  5A2Q E;  1ZQ1 A;  4N0A C;  2DET A;  3I56 A;  1R8O B;  4HCZ A;  1BI1 A;  1EX4 A;  3ZBD A;  2VWF A;  1I8F A;  4ZTJ A;  2IPO B;  3CC2 A;  3BFM A;  3E2U A;  2DIG A;  1E6H A;  3OB9 A;  5HCK A;  4NL2 A;  4IUU A;  2CT4 A;  3GLX A;  1N8R U;  4D6W A;  2DIL A;  4AMC A;  2IIM A;  5GMK l;  4C8Q F;  4Y28 E;  3OBW A;  3MJX A;  3QZ5 B;  3M4G A;  4MZT A;  1TSF A;  1TH7 A;  3P8D A;  2MWP A;  2PUK B;  4OB1 B;  1V76 A;  3IQL A;  1AWJ A;  1VQO A;  1KD1 C;  3DB3 A;  2RJD A;  2YWW A;  2O31 A;  2FB7 A;  3S6W A;  3FDR A;  1C6V X;  2RQW A;  3QDF A;  4F7U E;  2RQV A;  2ROT A;  1D1B A;  1X69 A;  2QAZ A;  2QQ9 A;  4E2F B;  4FW2 A;  1WX6 A;  4OF1 A;  3CCQ Q;  3ME9 A;  1EIF A;  1HXD A;  4QVD A;  1VA7 A;  3CPW A;  4DEX A;  2HSP A;  1OX9 A;  2JJ9 A;  2NYS A;  3OSV A;  1ABO A;  4Y92 A;  1QKW A;  3LW5 E;  1SKU B;  4HVV A;  2L3S A;  1M1K C;  2EPD A;  3VYG A;  4DOV A;  2RK1 A;  4XTX A;  4F7U B;  4KUL A;  1G3S A;  4RTZ A;  4M7A E;  2D8H A;  3V7R A;  2OJ2 A;  3EGD B;  1M9S A;  2XK0 A;  3HP9 A;  2ECZ A;  3V8K A;  4WCI A;  2RJE A;  3FLG A;  1Q81 U;  2LCS A;  1YJW Q;  2QQB A;  2A0F B;  3O8V A;  4BDZ A;  1VQ7 T;  2P0Q A;  4B9X A;  2J05 A;  3GNF B;  5LJ3 h;  4PJL A;  2L8D A;  2HL3 A;  3CCJ Q;  4E7H A;  1KQS A;  5ECA A;  1W1F A;  2EBP A;  2EQK A;  2RH2 A;  4PJO F;  4JLG A;  3FJP A;  4M7A B;  1N9S A;  3OYD A;  2HEQ A;  4KGX B;  3CCL T;  2LX7 A;  2DIQ A;  1WPY A;  1VYV A;  1Y96 A;  1OUL A;  3G71 A;  3EG2 A;  2WSE E;  4IKF A;  1XOV A;  4VUB A;  3EH2 A;  2JMC A;  1QW1 A;  5C6S A;  1IZ6 A;  3L2U A;  1BI3 A;  2LT4 A;  5CO7 A;  1ZA2 B;  1Y7X A;  4C5I A;  2KGT A;  1I5O B;  2YRD A;  3A98 A;  2DJZ A;  2DM1 A;  4FYY B;  3REA B;  1B34 A;  2OAU A;  1QKX A;  1TTH B;  2WAC A;  1QVF A;  2DTO A;  2QEX T;  2L2P A;  2YUO A;  2B8A A;  2X4X A;  2KVQ G;  3DLM A;  4MZP A;  4IUV A;  2HQE A;  1MMD A;  1X75 C;  1RAE B;  1I07 A;  2X4J A;  4J9G A;  2HQX A;  2EYZ A;  1VQK A;  3HRS A;  1QP2 A;  2EGA A;  2O4X B;  2CP0 A;  5IN1 A;  4BB7 A;  4E7S A;  3EG9 B;  1OZ3 A;  1ZUY A;  5GAO p;  3J7A F;  5FU7 B;  1MMN A;  3RR6 A;  2KEA A;  3GBQ A;  3OYI A;  3VS3 A;  1ZUU A;  5GAN g;  2C0T A;  3J80 E;  4JDS A;  2LRQ A;  2HQH A;  3FRN A;  2VAS A;  3JB9 F;  3LX7 A;  4L59 A;  3JCM h;  3UA6 A;  1GFC A;  3QJY A;  2E3H A;  3EFO A;  3CCE A;  4PJO E;  1K1Z A;  4OMP A;  2CZ7 B;  2Y90 A;  1GCP A;  2DEQ A;  2RHU A;  2EVR A;  3OYA A;  4CC7 A;  4JPB W;  2DL5 A;  1JBM A;  1R0C B;  1CKA A;  4C0D B;  4LDU A;  4M7A C;  4MZM A;  1PSF A;  1X6B A;  2CGH A;  4BAC A;  1K9M R;  1U3O A;  4M7D G;  2DYB A;  2GFA A;  2MPX C;  3JV3 A;  2GNC A;  2IG0 A;  4M75 A;  4TVR A;  1GXI E;  5IXF A;  5LJ5 h;  3T9N A;  3FC3 A;  1S72 Q;  1UGV A;  4C92 F;  4PJO B;  2DVJ A;  4R55 A;  2VKN A;  3HRT A;  2OTJ T;  1WYX A;  2KRO A;  4GBQ A;  2DTI A;  4LDW A;  4C8Q C;  4EMG A;  1M3A A;  3F70 A;  1RAB B;  1WHH A;  5FRN A;  3CXC P;  2Y4Y A;  3CQT A;  2KI7 A;  2K3Y A;  4MDX A;  3S3M A;  3MET A;  1UFF A;  5J39 A;  1VQP T;  3L2W A;  4Z88 A;  3OS0 A;  2ATC B;  1JQQ A;  4M78 E;  1VQ4 Q;  1PM3 A;  3SWN A;  1VQL Q;  3C4S A;  1Z9Q A;  2COY A;  5FWC A;  3M9Q A;  2H8H A;  2LMJ A;  1UEB A;  1BK2 A;  1MND A;  4DBF A;  1WQ7 A;  2A37 A;  1YI2 Q;  2XID A;  2DXB A;  2DJQ A;  2LJ3 A;  3CCJ A;  4B6M A;  1YWO A;  2SRC A;  2LX9 A;  4ZN3 A;  3JB9 I;  4XTW A;  1ZSZ A;  2G6F X;  3L2R A;  1F1B B;  1I1J A;  1Y57 A;  1VQM T;  2DF6 A;  2O9S A;  5M9O A;  3MHX A;  3E9G A;  4C5G A;  4EMK B;  1KC8 R;  2FVU A;  1E7O A;  1K8A R;  3A8O B;  4X1V A;  4KRT A;  3M58 A;  5FWB A;  5CK9 A;  1AWX A;  1EFN A;  3QZ9 B;  3A8H B;  2DBK A;  2BZY A;  3WVE B;  4M78 B;  2NUP A;  1K0X A;  5KYU B;  1I4K 1;  2LC4 A;  1RUW A;  2KT1 A;  2YUN A;  4PKC C;  1O75 A;  3FEO A;  2X3X D;  4CC2 A;  2GF7 A;  3M53 A;  3CCV Q;  1A0N B;  1DJ7 B;  3BW1 A;  2MOX A;  5A0L A;  1KD1 U;  1GRI A;  4KUD K;  3BDL A;  4PJO C;  2P4T A;  1GCQ C;  3HPW A;  1FMW A;  1N5Z A;  1WHJ A;  3CC2 Q;  3PIP A;  2FO0 A;  1QVF S;  1FMK A;  1LOJ A;  1UHF A;  1M90 C;  2MIO A;  2MK5 A;  2XDP A;  5KYX B;  3OA6 A;  5GAO q;  5D7U A;  4RKU E;  1IHW A;  3H41 A;  5KYW B;  4HCC A;  2C0O A;  1ARK A;  5EC7 A;  2K4Y A;  5GMK j;  1VQO Q;  2LCC A;  3CMA T;  4AG2 C;  4M7A D;  3SD4 A;  2F2V A;  2NUT B;  5GAM j;  1MV0 B;  1JJ2 A;  2AKL A;  3CCL A;  2I2L A;  3TU4 K;  1UJY A;  2O88 A;  1BI0 A;  3A8M B;  1NJI C;  2XKO C;  4L6V 5;  1VQ6 T;  2F5K A;  2DLP A;  2HKQ B;  4OMM A;  1D0Y A;  2EQI A;  1OV3 A;  3G7Z A;  1EZZ B;  3HFN A;  4M75 G;  2K5L A;  3CME T;  2PVG B;  2YUP A;  4OVA A;  1JU5 C;  4LN2 A;  1Y71 A;  5DLO A;  4FYW B;  2V8J A;  4N4I A;  2M1H A;  3TSW A;  1WJQ A;  4EMK C;  5I21 A;  1X6G A;  4JRQ A;  2CUB A;  2KYM A;  2BE9 B;  2D9T A;  4E47 A;  5L8R E;  4MDW A;  1M2V A;  1WQW A;  4P5N A;  3CCU T;  4HT8 A;  3RMS A;  4X9D A;  2RA2 A;  1HYO A;  1HSQ A;  1W2B A;  2GCX A;  3JAM E;  4ESR A;  4AFZ C;  3CBO A;  2KBT A;  4XTU A;  4XU3 A;  3C95 A;  2SEM A;  1FWZ A;  3OW2 A;  3MCA B;  1ZA1 B;  1WFW A;  1RLQ C;  5CQY A;  3CPW P;  5A0G A;  3CMA Q;  3EGU A;  3OYF A;  3CC4 T;  2MF2 A;  1UG1 A;  3CCM T;  1SRL A;  2EJ9 A;  2GQI A;  4QQ6 A;  4IUQ A;  2ESW A;  4OB3 B;  2J7I A;  4QW2 A;  2E10 A;  4ZGE B;  1VQ6 Q;  3QII A;  1FMV A;  1E6G A;  4PJN A;  2P84 A;  5C0M A;  1D3B B;  4DBR A;  4J8O A;  1PCX A;  1ABQ A;  4XK8 E;  3NTH A;  1YI2 A;  1KHI A;  5GAM e;  1R0B G;  1VUB A;  4C92 C;  4D8K A;  2RHZ A;  3I55 T;  4MML A;  3G71 Q;  4OGC A;  3LH5 A;  3QJ6 A;  1ZHI A;  4A4H A;  2OTL T;  1S1N A;  3BDU A;  2RQT A;  3CPF A;  4J6W A;  1WLP B;  3ASK A;  4PFZ A;  2F2W A;  1PWT A;  3UAT A;  3DKM A;  4BUG A;  1VYT A;  4RUG A;  1KQS P;  2Z0W A;  3E9F A;  4IUR A;  4GLK A;  1QCF A;  2EGE A;  2DFU A;  4ME7 A;  2RK2 A;  4PJO D;  4ATO A;  4F17 A;  1HD3 A;  1K4U S;  5D6X A;  1GL5 A;  3RIR A;  2ZCF B;  1WHM A;  2YUQ A;  4DA4 A;  3URG A;  3CC4 Q;  1N9R A;  2F1L A;  1M3C A;  1NG2 A;  2J6F A;  3EHR A;  1LJO A;  1RI0 A;  4JUV A;  2BKD N;  1X6O A;  2A28 A;  3VS2 A;  2O01 E;  1QVF P;  1RAD B;  2E6Z A;  1VYU A;  1YNZ A;  1K0S A;  1QVG P;  3RDV A;  5CAI A;  2D1X A;  1WHG A;  2DL4 A;  2K6D A;  4N0A A;  4Z02 A;  5DY9 A;  1KG1 A;  3UF4 A;  2CH4 A;  5I2S A;  3I55 Q;  1KQ1 A;  3CCE Q;  2DD5 A;  1FXX A;  1ZBX A;  1ZSG A;  1UTI A;  2JTF A;  5GAN 2;  1VQM A;  3OYC A;  2CH4 W;  1AZE A;  2NUZ A;  2RN8 A;  4M77 F;  2GTO A;  2YT6 A;  5AYF A;  1Q7Y R;  9ATC B;  2GQV A;  1YIT T;  2ROL A;  2V8I A;  3L2Q A;  4M78 D;  1U1T A;  1QVP A;  5KYY A;  1PC0 A;  1M4Z A;  3OYH A;  4ZTF A;  1JJ2 S;  2QA4 Q;  3QWY A; 
#chains in the Genus database with same CATH homology
 4E7J A;  2RO0 A;  1VQN T;  1OZ3 A;  4M7D E;  1QP3 A;  2LNV A;  3OQ5 A;  4XAX B;  5KE3 A;  1KQS S;  1Q81 C;  5GAO p;  2D0Q B;  5FU7 B;  3J7A F;  1WJR A;  2XHC A;  2PQW A;  4JRI A;  3ZFJ A;  4R56 A;  4HCB A;  3JCM V;  3OY9 A;  3GOX A;  1H64 1;  5GAN 5;  1XNI A;  2FHD A;  3OYI A;  2RM4 A;  4RMO A;  2ZPG B;  5CKD A;  4M7D A;  4GY5 A;  2E12 A;  4EMH A;  1Q86 C;  5GAN g;  3J80 E;  4M78 G;  4JDS A;  4BI8 B;  2JZ2 A;  4J5Y A;  2LRQ A;  3G6E A;  1V29 B;  2VV5 A;  3FRN A;  1YJ9 T;  5GAM g;  3JB9 F;  4C0D C;  3LX7 A;  2RI2 A;  4L59 A;  2D6F A;  3C94 A;  3JCM h;  2MMP A;  2ZPB B;  3QJY A;  3OS2 A;  3CCE A;  3OS1 A;  4BE2 A;  2EIF A;  4PJO E;  1M8V A;  2RJF A;  3P8H A;  2KK4 A;  4XTZ A;  3MO8 A;  5DM7 R;  3CC7 A;  2CZ7 B;  4X9C A;  3VKI A;  2Y90 A;  5A0D A;  2DEQ A;  2RHU A;  5GMK i;  3GP8 A;  5FRO A;  3A8L B;  3EAE A;  2VXE A;  5CKH A;  4ZGJ B;  4UC4 A;  2K2V A;  5GAO n;  3OYA A;  3OYE A;  4L5G A;  3G6E T;  3C12 A;  5EG2 A;  3NTI A;  1JBM A;  2RHY A;  5KCH A;  3CBM A;  3UWN A;  2VGM A;  3M55 A;  4C0D B;  4LDU A;  1UB4 A;  3DB4 A;  4JS5 A;  4M7A C;  3HKS A;  2EYQ A;  1PSF A;  2EWN A;  2XU8 A;  4MZM A;  4BI3 A;  4F7U F;  2CGH A;  4BAC A;  2WSC E;  4QVZ A;  4A4G A;  1W2B S;  3VUZ A;  3CMA A;  3CC7 T;  4LD6 A;  1PSE A;  3QHS A;  2OTJ A;  1QVG S;  2RD1 A;  3RUX A;  4M7D G;  2FYK A;  4A4K A;  2GFA A;  3VJP A;  1YJN A;  3G4S A;  4QQG A;  1X01 A;  2EAY A;  5KE2 A;  3OYK A;  1UGQ B;  2IG0 A;  3V8J A;  2XDD A;  4M75 A;  4TVR A;  2QQR A;  4C8Q E;  2YLC A;  2EFI A;  3OYG A;  2EJF A;  3JCM P;  1GXI E;  4KT0 E;  5LJ5 h;  3JCM e;  3T9N A;  5I2M A;  3OW2 S;  3E1S A;  3FC3 A;  2ZPF B;  1WJS A;  2E6N A;  1U1S A;  2QQS A;  2VC8 A;  1VQ6 A;  4C92 F;  4PJO B;  3TRE A;  4M75 D;  4R55 A;  2E65 A;  2ZPH B;  2HNI A;  3HRT A;  4WF2 A;  3FB9 A;  4M77 E;  4N4G A;  2OTJ T;  3LGF A;  1VQP A;  2F5T X;  2DTI A;  4LDW A;  4A54 A;  4C8Q C;  4PJO G;  4EMG A;  5GAO r;  5D6W A;  5FLX E;  1XQH A;  3QPH A;  3F70 A;  2YRV A;  2XIC A;  3PGG A;  4YTL A;  3VYH B;  5FRN A;  2E5Q A;  2F69 A;  3CCQ T;  2Y4Y A;  4J6X A;  4C5H A;  5IAY A;  2EJG A;  3LLR A;  1VQ5 T;  4CRI A;  2E70 A;  2K3Y A;  1P92 A;  2L89 A;  2R5A A;  3S3M A;  4MDX A;  4FT4 A;  3CEY A;  3OYL A;  3MET A;  4PNO A;  4M75 F;  5LJ3 g;  4A4F A;  3CCS A;  2PU9 B;  1M90 U;  1UGS B;  2M0O A;  2QTX A;  2DZC A;  2EKO A;  5J3B A;  5LL6 S;  3H8Z A;  2YHT A;  5J39 A;  4O5V A;  3PIO A;  3PT9 A;  4Y91 A;  1VQP T;  3JCM W;  4FIB A;  2QXF A;  3OS0 A;  2VYT A;  3KBG A;  2NLU A;  3L2W A;  2DO3 A;  5LJ5 e;  3CCU A;  4JS4 A;  2XI9 A;  1VQ8 T;  2X4Y A;  4C8Q B;  4M78 E;  4LDY A;  2K5F A;  3BY7 A;  4E7K A;  2AHJ B;  3SWN A;  3CXC A;  4HA8 A;  5GAN 3;  2LT1 A;  3C4S A;  5HK3 A;  4IUT A;  5GAN 6;  3G71 T;  1YHQ T;  4OMF B;  2DXT A;  1BIA A;  3M9Q A;  3PMI A;  3PFS A;  4KBM B;  3S3N A;  1UEB A;  2HAX A;  1WQ7 A;  4M77 B;  2XID A;  2DXB A;  1Y96 B;  2IVW A;  4HT9 A;  4XU1 A;  1Q82 U;  1BIB A;  2PVO B;  4M78 C;  3CCJ A;  3JCM X;  2LX9 A;  2CZ6 B;  2LQ8 A;  3M57 A;  4FL6 A;  4ZN3 A;  3HRU A;  4M77 G;  3JB9 I;  3CCR T;  2VUB A;  4XTW A;  1S72 A;  2DPP B;  2BUD A;  2KSS A;  3QUI A;  3OYY A;  3L42 A;  3L2R A;  2LQK A;  4M7D B;  1YJW T;  1K73 U;  2E1H A;  3CC4 A;  2E41 A;  2JUF A;  5DLQ E;  1VQM T;  3CCM A;  3QDR B;  4NL3 A;  3QG1 A;  3SB2 A;  5M9O A;  1B34 B;  4FU6 A;  3MHX A;  3E9G A;  4C5G A;  2QDY B;  4EMK B;  2FVU A;  5GAN h;  3A8O B;  2K5I A;  3JB9 D;  5GMK h;  3M58 A;  1D3B A;  3JB9 H;  5GAM f;  5CK9 A;  3CCJ T;  3QZ9 B;  2BIV A;  2PVD B;  3A8H B;  3WVE B;  4MMK A;  4XU2 A;  4M78 B;  3GIB A;  2DK3 A;  3MP6 A;  1VQK T;  2X35 A;  4V2S A;  2RHX A;  1I4K 1;  4F7U A;  2LC4 A;  1MGQ A;  2KQW A;  4A4E A;  2DKG A;  1O75 A;  3FEO A;  4PKC C;  3E19 A;  5GMK m;  4M7D C;  5KCO A;  2GF7 A;  3M53 A;  2M16 A;  3I55 A;  4OGE A;  3LWH A;  1O9S A;  2DAQ A;  1DJ7 B;  2A7Y A;  3BW1 A;  5J26 A;  1VQ4 A;  4O6J A;  3EFR A;  3JB9 G;  1K9M U;  1VQL A;  3M59 A;  2DD4 A;  4CI0 C;  3J81 E;  2KMT A;  1G5V A;  3GNG A;  2OTL A;  2X4W A;  2RHI A;  1KQ2 A;  5A0L A;  4C92 A;  1KD1 U;  4KUD K;  3CD6 A;  2GFU A;  5GAN e;  5GMK e;  2LTO A;  3AHU A;  3X25 B;  4JRP A;  3BDL A;  1M1F A;  3V7C A;  4PJO C;  2P4T A;  4IUP A;  4ZN1 A;  5GAO l;  3RKY A;  4RCC A;  3HPW A;  3CCE T;  1UGR B;  4M75 E;  3CXC S;  4RG2 A;  4C92 D;  4EDU A;  3PIP A;  2Y4X A;  1QVF S;  1SSF A;  1LOJ A;  2MWO A;  1W4S A;  1M90 C;  2LVM A;  3HFO A;  3OMC A;  4XQ3 A;  3WXM B;  2XDP A;  4BY6 B;  1H3Z A;  3CD6 T;  3OA6 A;  1Q7Y C;  5GAN d;  2QA4 A;  2XG8 D;  4PLI A;  3NFC A;  1KHC A;  3PNW C;  5CKF A;  3JCM g;  5GAO q;  4M7A A;  1WNL A;  4RKU E;  2R57 A;  4J7I A;  1Y07 A;  5GAM d;  4JJN K;  3JCM b;  4HCC A;  3Q1J A;  4FSX A;  5CQX A;  2K4Y A;  3KUF A;  2LDM A;  5GMK j;  5GAN j;  3SDZ A;  1LNX A;  4XTY A;  1G3Y A;  2LCC A;  3SFM A;  3PTA A;  3CMA T;  5LJ3 f;  4M7A D;  3QBY A;  3SD4 A;  1M1G A;  3L1A A;  5GAM j;  1YJN T;  1JJ2 A;  4C92 G;  4II1 A;  2E64 A;  3UDC A;  3G4S T;  1I5L A;  3CME A;  3MEW A;  4A53 A;  3CCL A;  1Q82 C;  4DQ2 A;  2QA4 T;  4QQD A;  2I2L A;  3RES A;  3A8G B;  4C0Z A;  3MEA A;  1YCY A;  3JCM c;  3CCV A;  3TU4 K;  4E7L A;  1BI0 A;  2P0P A;  2JOY A;  2XKO C;  3A8M B;  4L6V 5;  1NJI C;  1VQ6 T;  2F5K A;  3OS5 A;  4M75 B;  1K73 C;  4M77 C;  1XTD A;  2ZGW A;  4M7A F;  4JLI A;  1G3W A;  2KAF A;  2JN0 A;  2HBP A;  4ZGD B;  1VIE A;  1I81 A;  3P8B B;  2RB6 A;  2VXF A;  3G7Z A;  3HFN A;  4M75 G;  5LJ5 g;  2K5L A;  1ZQ1 A;  4N0A C;  5A2Q E;  3CME T;  2PVG B;  1Q7Y U;  3MEV A;  4OVA A;  1Y71 A;  5DLO A;  3I56 A;  1R8O B;  2V8J A;  4QVC A;  3OSS C;  4HCZ A;  1BI1 A;  2JVV A;  3ZBD A;  1I8F A;  4N4I A;  3M5A A;  4FM4 B;  2L5Q A;  4NOY A;  2M1H A;  4ZTJ A;  3CC2 A;  3BFM A;  4C0G A;  1WJQ A;  2DIG A;  2MI6 A;  4EMK C;  5I21 A;  4JRQ A;  3CCS T;  1YIJ A;  1KC8 U;  2PUO B;  1K8A U;  3OB9 A;  2C06 A;  2D9T A;  4E47 A;  4NL2 A;  4IUU A;  5L8R E;  2CZ1 B;  4MDW A;  5CR2 A;  1WQW A;  3GLX A;  1N8R U;  2LCL A;  2EQU A;  3M54 A;  4LDV A;  4P5N A;  4D6W A;  3L2V A;  3CCU T;  3RMS A;  4X9D A;  4HT8 A;  3HL8 A;  3S3O A;  1YIT A;  2RA2 A;  4C8Q F;  4Y28 E;  2O4X A;  3OBW A;  5GMK l;  3I56 T;  3NTK A;  3QZ5 B;  3M4G A;  3JB9 J;  4MZT A;  1K9M C;  3QXE B;  1NJI U;  1TH7 A;  1W2B A;  3P8D A;  2MWP A;  2PUK B;  4OB1 B;  2GCX A;  3OYN A;  1VQ9 A;  3JAM E;  1QVG A;  4FT2 A;  3UPU A;  1NPR A;  2MAM A;  3CBO A;  1VQO A;  1KD1 C;  3DB3 A;  4BD3 A;  2RJD A;  2DTH A;  3QSU A;  3L2Z A;  4XTU A;  3SWN B;  2ZPE B;  5LJ3 d;  5CKB A;  4OP0 A;  2FB7 A;  4XU3 A;  3S6W A;  3FDR A;  1HK9 A;  2CYZ B;  3V8L A;  2P0K A;  1VQN A;  3C95 A;  3OW2 A;  1FWZ A;  4BI4 A;  1NPP A;  3ZEH A;  3MCA B;  4F7U E;  3M4Y A;  5GAM h;  1FX7 A;  5CQY A;  3KXT A;  4RG8 A;  5LJ3 j;  1S72 T;  3OYJ A;  5A0G A;  3JSC A;  4Q5W A;  2M9U A;  3OYF A;  2QQ9 A;  3CC4 T;  4J7F A;  2MF2 A;  3V7S A;  1OZ2 A;  3CCM T;  2EJ9 A;  2VGN A;  1N27 A;  4QQ6 A;  2CS7 A;  4IUQ A;  5FU6 B;  4OF1 A;  2DXC A;  3QO3 A;  4OB3 B;  1YJ9 A;  3OBY A;  3OYB A;  4QW2 A;  3X20 B;  3LWI A;  1U8R A;  5IT9 E;  3ME9 A;  2XD0 A;  4C92 E;  1EIF A;  2E10 A;  2G3R A;  1HXD A;  2FL7 A;  4QVD A;  3OYM A;  4ZGE B;  4XU0 A;  3QII A;  3LYI A;  4M78 F;  4BE1 A;  3CPW A;  4BY6 C;  2EQM A;  3HHT B;  5C0M A;  1D3B B;  2KDS A;  3VV0 A;  3RKW A;  2A3L A;  4OB0 B;  3OSV A;  4J8O A;  4XK8 E;  2RI5 A;  3NTH A;  1NE8 A;  3UT1 A;  3LW5 E;  1YI2 A;  2K57 A;  1M1K C;  1KHI A;  3JCM f;  3HSB A;  3JCM Q;  5GAM e;  4C92 C;  1VUB A;  1BYM A;  2RHZ A;  2QI2 A;  3I55 T;  3VYG A;  5CIU A;  4MML A;  4DOV A;  2RK1 A;  3CBP A;  4OGC A;  4XTX A;  4F7U B;  4KUL A;  4BDY A;  1VQ4 T;  4M7D D;  1G3S A;  1VQL T;  3QJ6 A;  1ZHI A;  4M7A E;  1VQ7 A;  2H3J A;  4A4H A;  2OTL T;  2KY9 A;  3BDU A;  3CPF A;  4C0F A;  4J6W A;  3V7R A;  3ASK A;  5CVI A;  4F7U G;  1MHN A;  4HKE A;  1M9S A;  4PJO A;  2EQJ A;  2XK0 A;  3HP9 A;  3DKM A;  4BUG A;  2DXU A;  4ELY C;  1YI2 T;  3H6Z A;  3N5B B;  3E9F A;  4IUR A;  3V8K A;  4X34 A;  3RKX A;  4GLK A;  5GAN 8;  4M75 C;  2RJE A;  3FLG A;  1Q81 U;  5CKE A;  4M7D F;  4C92 B;  2QQB A;  4ME7 A;  2RK2 A;  3MEU A;  2L3R A;  3O8V A;  4BDZ A;  1VQ7 T;  4PJO D;  4XTV A;  2P0Q A;  4ATO A;  4B9X A;  1KC8 C;  3INZ A;  4BE0 A;  1K8A C;  1OI1 A;  1Q86 U;  3GNF B;  2ZZD A;  5LJ3 h;  2L8D A;  3PMT A;  5D6X A;  3LGL A;  5LJ5 f;  1N8R C;  1M1K U;  3X24 B;  1M5Q 1;  3QYH B;  4E7H A;  3JCM J;  1KQS A;  1UGP B;  3RIR A;  3TEE A;  4EPC A;  3CCQ A;  1OYX A;  2ZCF B;  3X26 B;  1WGS A;  4DA4 A;  1VQ5 A;  3JRZ A;  2EQK A;  2RH2 A;  4KUI A;  4N4H A;  3URG A;  4PJO F;  4C8Q A;  1N9R A;  4OB2 B;  4JLG A;  3EFS A;  3FJP A;  4M7A B;  1N9S A;  1LJO A;  2V8K A;  1RI0 A;  4JUV A;  3OYD A;  1YBY A;  5GAN 4;  2BKD N;  5CCA A;  3CCL T;  1X6O A;  4M7A G;  1JRI A;  1VQ8 A;  3LH0 A;  5GAO m;  4C8Q D;  2R58 A;  3GPL A;  1N6A A;  2DIQ A;  3JCM d;  1WPY A;  2O01 E;  4M77 A;  3CCV T;  1JB0 E;  3RER A;  1BI2 A;  1Y96 A;  2E6Z A;  2DVE A;  4J83 A;  3G71 A;  3QYG B;  2QEX A;  1YHQ A;  2WSE E;  4IKF A;  2JTM A;  1XOV A;  4VUB A;  3X28 B;  3SWN C;  5CAI A;  2XDB A;  3CPW S;  1QW1 A;  3A5Z B;  5C6S A;  4C5E A;  2WSF E;  1IZ6 A;  2QQA A;  1BI3 A;  2LT4 A;  4N0A A;  4Z02 A;  5DY9 A;  5LJ3 e;  3L2U A;  5CO7 A;  1Y7X A;  3FIF A;  4C5I A;  5GAN 7;  4M77 D;  1KG1 A;  4LDX A;  5I2S A;  2DJZ A;  5HK0 A;  4RCB A;  2CZ0 B;  5HY6 A;  3QKJ A;  1KQ1 A;  1B34 A;  2DD5 A;  2OAU A;  1FXX A;  1ZBX A;  1IRE B;  4EMK A;  3CCR A;  4DOW A;  4NS5 A;  2WAC A;  1QVF A;  2DTO A;  2QEX T;  3ER0 A;  3CC2 T;  1YJW A;  2JTF A;  5FU6 C;  2B8A A;  2X4X A;  4C8Q G;  4JRK A;  2KVQ G;  5HKC A;  3GF5 A;  3VU3 C;  5GAN 2;  3OYC A;  1VQM A;  1YIJ T;  4M78 A;  3MP8 A;  4LD9 K;  2YLB A;  2CKK A;  5FRM A;  3M56 A;  1G3T A;  3MP1 A;  2ZPI B;  1VIF A;  4M77 F;  3DLM A;  2HD0 A;  3OMG A;  4MZP A;  4PLL A;  3RMQ A;  2JNG A;  4IUV A;  1RL2 A;  5D6Y A;  2HQE A;  5AYF A;  4PL6 A;  1NZ9 A;  2DZ9 A;  5FU7 C;  5LJ5 d;  1X75 C;  2GQV A;  1YIT T;  2V8I A;  2RJC A;  3L2Q A;  4J6Y A;  3TCJ A;  4M78 D;  2X4J A;  1U1T A;  1BKB A;  2HQX A;  2RI3 A;  1VQK A;  1QVP A;  4E7I A;  2R5M A;  4ELZ C;  1VQ9 T;  5LJ5 j;  1M4Z A;  1VQO T;  3HRS A;  3OYH A;  1AHJ B;  4ZTF A;  1QP2 A;  5GAN f;  5KH6 A;  2O4X B;  2K3X A;  3DLL A;  1JJ2 S;  3R6O A;  4B9W A;  5IN1 A;  4BB7 A;  3WVD B;  3VUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...