4ELYC

Ccdbvfi:gyra14ec
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
98
Chain Sequence
SQFTLYKNKDKSSAKTYPYFVDVQSDLLDNLNTRLVIPLTPIEPSHLCPTIHIDEGDFIMLTQQMTSVPVKILSEPVNELSTFRNEIIAAIDFLITGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternative interactions define gyrase specificity in the CcdB family.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Toxin/isomerase
molecule keywords DNA gyrase subunit A
total genus 28
structure length 98
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4elyC00
5CK9A 3HPWA 4OF1A 1VUBA 1X75C 3NFCA 5CQYA 1M1FA 4MZPA 5CKHA 4ELYC 5CKDA 5HKCA 3JRZA 5CKEA 5HK0A 4HKEA 3G7ZA 5CQXA 2KMTA 2MF2A 4MDXA 1NE8A 5HK3A 3JSCA 5CO7A 4ME7A 5CKBA 4ELZC 5CR2A 3VUBA 2VUBA 5DLOA 3TCJA 2C06A 4MZMA 5CCAA 1UB4A 4MZTA 4VUBA 5CKFA
chains in the Genus database with same CATH superfamily
3NTIA 4C8QC 4XU0A 2CP3A 4MZPA 2XDPA 5GMKl 5C6SA 1RAAB 1I5LA 2LQWA 1TH7A 1X6BA 3CMAQ 1RLQC 3LLRA 3H8ZA 3ZEHA 3GLXA 1R8OB 2X35A 2LCSA 2C0TA 4D8KA 2DA9A 1UE9A 2IPOB 3JCMh 3PIOA 1FX7A 1KSWA 3KFVA 2NYSA 3L2ZA 4PFPA 2KGTA 1G3WA 2B86A 4FYWB 2O2OA 4B6MA 1UUEA 4ZTFA 1U1SA 2GTOA 1B07A 2QDLA 3V8JA 5D7UA 2E70A 2RF0A 2DTIA 3OA6A 2RB6A 2G6FX 3CCVQ 1OU9A 2NUTA 4FW2A 3CCUQ 3QDRB 5DY9A 5GMKh 1ZUYA 4OVAA 3CCRQ 4RG8A 2A36A 5GMKj 1YITA 4LNPA 5GANe 4RTTA 1ZUKA 2CGHA 5LL6S 1SHGA 4J7FA 2OTJT 2JUFA 2EWNA 4FYXB 3QUIA 1BKBA 1KK7A 2LJ1A 4F04B 1SKUB 3MJXA 3JCMc 4BI3A 1YNZA 3G6EA 1QVFS 4OB2B 4B9WA 1X6GA 4OF1A 1VQ8T 4RKUE 1NEGA 5HKCA 3CCMT 1AEYA 3OS0A 1K73C 4E7IA 2V8IA 2YHTA 1RABB 1N6AA 1NEBA 1MGQA 1YI2A 4JRQA 5KYYA 4PJLA 1QW1A 4ZGDB 3M0SA 4AFSC 2BE9B 2YUQA 4X9DA 3FDRA 5IXBA 5LJ5g 2KYMA 2DEUA 2L2PA 1UJYA 1Q82U 3I55Q 2ECZA 3CC4T 2WSEE 3M0TA 4E7ZA 1M3CA 2RK2A 3JCMQ 3X24B 5LJ5d 1VQ4T 1M30A 3OB9A 2FO0A 5LJ5j 1VQOT 1W4SA 2QQRA 1TUDA 2NUZA 1EFNA 4M78F 4MMKA 4EIKA 1D3BA 4M75A 4ZN3A 2RQTA 4M7AC 2FYKA 1Z9ZA 1Y07A 2E3IA 3UPUA 5GANj 3VV0A 2D0QB 3O5ZA 2R5AA 1M2VB 2JOYA 3EH1A 3NFCA 4M75D 4X9CA 2JT4A 1OPLA 2CSIA 3OSSC 4J9EA 4J7IA 5GANg 2E3HA 1CSKA 1W2BP 1XOVA 2MF2A 1IO6A 2YWWA 4HXJA 1SRLA 2X3XD 4JS4A 1H92A 1PKTA 2SEMA 3PMTA 1YJWT 2QK0A 5GAOp 3I9QA 2X4JA 2DNUA 3LWIA 4M75E 2QQ9A 1WHGA 2DXTA 1C1AA 1M1KR 1M90R 3TQ7P 4B9XA 3OYKA 4CC2A 1MMDA 1K0XA 1XTDA 4PJNA 2DZCA 3GNFB 1NJIR 4J9HA 5CR2A 2COWA 2A0FB 1FYNA 4ESRA 3FC3A 3NTKA 1PC0A 2MI6A 4ZNXA 1KQSA 1G8XA 4NS5A 5LJ3e 2KSSA 1VQ4Q 2YSQA 4RTUA 2YT6A 4BE0A 4HCZA 1ZA2B 4E7KA 1KG1A 1P92A 3CCMA 3OBYA 3L2UA 4KH0B 1N5ZA 2K4YA 5EG2A 1S1NA 1SHFA 2HKQB 5FROA 2P0PA 1YN8A 4VUBA 4QKUA 4M7DB 1FWZA 2PTKA 1JJ2A 4J9BA 4KH1B 1RI9A 2DM1A 2K57A 1NPRA 4EMKC 2GBQA 1S72Q 4C5IA 1VQ5T 4FCYA 4C8QF 4L6V5 2MAMA 3F70A 1W2BS 2XKOC 5GAOl 2DEQA 4DBFA 4PJOA 2GFUA 1WQ7A 2PUOB 1RAGB 2CZ1B 1WXUA 1Q86R 3G6EQ 2JNGA 2HD0A 4N4IA 3JB9D 3LYIA 3OYDA 3HHTB 2GNCA 5LJ3j 4HVWA 1UB4A 2F2VA 1X2QA 2ZPEB 4Y92A 4F7UG 3TREA 3VS5A 2F5TX 2FG0A 5CQYA 2LVMA 1YITQ 5CKHA 3HTRA 2ENMA 2CZ7B 1BBZA 2KT1A 1KD1U 4JJNK 3P8HA 1D1CA 3VS3A 3JCMX 3H9NA 2LX7A 2QA4A 3CMEA 1N8RU 4N0AA 1SEMA 2VGMA 1QMCA 4E6RA 2DO3A 1BIBA 4X1VA 4C8QA 3EGDB 4RCBA 2R5MA 3L2WA 2EYQA 1N8RR 2DILA 2FZCB 2HL5C 2CUDA 1AOJA 3M55A 3UT1A 3V8LA 1E6HA 1QVFP 4LD6A 4M77B 4DQ2A 4PFZA 2XG8D 4LDUA 2J6OA 4M78D 4YTLA 2M0YA 4DA4A 4JJCA 3CXCS 4QVCA 1R77A 2EBPA 1MNEA 2FZGB 2QAZA 4TVRA 4NL3A 1EX4A 1WIEA 2RHZA 4CC4B 2L8DA 2CP6A 2LT4A 1VQOA 4J8OA 5CKEA 3CCJQ 3RIRA 2I2LA 2V1RA 4ZTJA 1AWWA 2QTXA 1PSEA 2D8HA 2ED1A 3CC7A 5KYXB 2DL7A 4PKCC 1JJ2P 2XHCA 2NUTB 4BY6B 2VKNA 1W70A 3HFNA 2DERA 4CI0C 3CMAA 1N9RA 3NMZC 1C6VX 1GFCA 4F7UF 3EHRA 5GAMd 1VQ8A 1YJNT 2O31A 2DIGA 2D0NA 4A4GA 3MEVA 2G3RA 1RAIB 2QG9B 4M75C 3VYGA 4E2FB 1E6GA 2EW3A 4JJDA 3CC7Q 2DD5A 1D0YA 5IT9E 3OW2P 5A0DA 4N0AC 5CQXA 2CT3A 1PKSA 2ZPHB 4BACA 8AT1B 1ZSZA 5GAOr 2CH4W 4C92G 1HYOA 1IGUA 2CP7A 3G71Q 2QTVA 4WF2A 2KQWA 2KYBA 2JN0A 3S6WA 2J06A 4E47A 3OYIA 2CZ6B 3RERA 3I56Q 1I1JA 3FLGA 1VQPA 3CCSA 2VWFA 5GAOq 1WHHA 2O9VA 4C0ZA 1D09B 3QIIA 3JB9J 1GRIA 2K7AA 3KBGA 4LUEA 1UGSB 3M9QA 4J83A 2YRCA 3META 3HRSA 3JAME 3OYBA 1M9SA 4JRKA 1YJNQ 1M1GA 2KMTA 1LNXA 1AHJB 2DK3A 2ATCB 1AWOA 2CKKA 1TU0B 3KUFA 1KC8C 4JLIA 1U8RA 1Z9QA 2DVJA 5CAIA 3QKJA 2EGAA 1VUBA 3P8DA 4WTOB 1G3TA 2Y90A 2KXCA 1Q81R 3QPHA 2K3BA 3TVTA 5DM7R 5KYWA 4OB1B 1MMGA 1BK2A 4IUTA 4A4EA 2CZ0B 5IHIA 3RMSA 2BTTA 2PNIA 3OYNA 2QASA 3PGGA 1NYGA 2QDYB 5AYFA 5KYUA 1VQ5A 1OOTA 1IREB 3OYAA 2HDAA 1GBQA 1S72A 4OGCA 5GAOm 1K4US 4FSXA 3FJ5A 3OYYA 2MOXA 2PZ1A 2GTJA 1WQWA 3BE3A 2BKDN 3LW5E 3V7RA 3JB9G 2CP0A 1OX9A 3PFSA 1OULA 1D1AA 5A2QE 1WHJA 2CYZB 1VQ9A 1ZQ1A 1VQ7Q 2GFAA 1D0XA 2JJ9A 4J9DA 3EGUA 2Y4YA 4FU6A 3MP8A 3VS0A 2MCNA 3M53A 4DBHA 2ABLA 4KRTA 3GBQA 1CKAA 2P0QA 1K8AU 1ZSZC 2E4HA 2YUOA 1M27C 3CCLA 3JV3A 3GPLA 2E5KA 1VQ4A 4MZMA 2E10A 2NUPB 1RAFB 3MCAB 1WDXA 1V1CA 2YXYA 4PL6A 1M1FA 4E7HA 1QVPA 3M58A 3OW2A 3DKMA 1G3SA 3HFOA 2OI3A 3SFMA 4ANJA 4J6WA 1G2BA 2LMJA 4RUGA 5FLXE 4JS5A 4F7UE 5CCAA 4Y91A 3J7AF 2F2XA 2HKNA 3PE0A 1K9AA 5FU6C 2M9UA 1BI0A 5CVIA 2P4TA 2DRMA 3AHUA 4EMKA 3RR6A 3DB4A 3H0HA 1VQNT 1JXOA 1YP5A 5GAN3 2A28A 3M0RA 4C8QB 4ZN1A 3E19A 2FRYA 1RAEB 1SF9A 3CBOA 1RLPC 2X4XA 3E9FA 1UHCA 2GQIA 3VRZA 2FPDA 1WZOA 3CMEQ 1B7TA 2EQKA 1EIFA 3GP8A 2IVWA 2R57A 4M77C 1ACMB 5D6YA 1QLYA 3OSVA 2H8HA 3MEWA 1JB0E 2M0OA 1X69A 2MYSA 1MMAA 4M75B 5DLOA 1VQ6Q 3CCEQ 4OB0B 4MZTA 1IGQA 3QYGB 3REBB 1VQ9T 1WHMA 3CCUT 1TTHB 4KT0E 2KROA 1HJDA 2RJFA 3THKA 5KE3A 2MWOA 2RJEA 2QEXT 2FL7A 1BIAA 4M7AF 2DTHA 1ZUUA 1YITT 4F16A 1XJWB 1BCOA 2K3XA 2CSQA 1K9MC 2A7YA 4KULA 3MPUB 2EGEA 3MKDA 4C5EA 2O4XB 4O6JA 4BDZA 2EQMA 4O5VA 1VYTA 5KYNA 2DIQA 2RD1A 2HBPA 1KC8U 1NLPC 2LX9A 5CKBA 2CP2A 2JXBA 1XNIA 1IB8A 3ME9A 5D6WA 4C92F 2P0KA 5GAMh 1H8KA 4E7LA 1I5OB 2VV5A 2VVKA 1YBYA 1Q86C 3CC4Q 3CCEA 4MMLA 1A0NB 2KXDA 4C92E 5I11A 1Q7YC 2CDTA 3CD6Q 4HT8A 1W2BA 3QXEB 1NYFA 4M7DC 2XU8A 1VQOQ 5LJ5f 2DVEA 2DX1A 3CCRA 2Z0WA 2DLPA 1VQPT 4EMGA 2V8KA 2ZPIB 1F1BB 3NHNA 1MHNA 3UATA 1QWFA 1VQKT 2F2WA 5GANd 5IAYA 3OMCA 1FXXA 3JRZA 2HL3A 4CRIA 2QQAA 1X2KA 1YI2T 5CIUA 2AIRB 2RA2A 1K0SA 2LZ6B 4EDUA 1FMKA 1KHCA 4AT1B 2HEQA 1PD0A 1QWEA 3N5BB 2OAWA 4BDYA 3CC4A 3G4SA 1UECA 1ARKA 1G3YA 3OYMA 2MK5A 4M78A 1X6OA 2RHXA 1PCXA 1W6XA 3NGPA 4XU1A 2L3RA 3G71A 3RDVA 3CBPA 1VA7A 1I81A 1WHLA 2XK0A 3H0FA 1TUGB 3JCMg 2RPNA 1VQMQ 3I55A 3OBWA 3KXTA 4QQ6A 1VYVA 2MWPA 3C0CA 1T0JA 3CD6T 4XTXA 3M54A 1K8AR 5I2SA 1BI2A 4CC7A 3FJPA 4M7DF 1M1KC 2L3PA 2JMCA 1TG0A 1VIEA 2E64A 4J6XA 3L2VA 4M77E 1ZSZB 3M57A 4PNOA 1JO8A 3CCLT 3OS1A 2YLBA 1YI2Q 3SWNA 4J9GA 1QVFA 4FW1A 2X4WA 2KAFA 2DL8A 3OYJA 2F69A 1JQQA 3DB3A 3EFRA 2KNBB 2VUBA 1OYXA 3D7SB 3L2QA 5LJ3d 4C92A 1VQ5Q 2RK1A 4XQ3A 2LDMA 2ROTA 4XTVA 2L89A 5GAMg 1Q7YU 2C0OA 2PVGB 1WGSA 6AT1B 2K2VA 2RI3A 2YLCA 1VQMT 4F14A 4XTWA 3VUBA 4BI8B 5GAMj 3G6ET 1TXQA 1VQLT 1UTIA 1G5VA 2QQBA 1RAHB 2IIMA 5LJ3h 3HPWA 2GQVA 3FRNA 3CCVA 3CCQA 1NBEB 3M0PA 3CD6A 3G4ST 5KCHA 4HKEA 3M59A 2EQUA 4RG2A 3G71T 2KE9A 2BZ8A 3VU3C 3JCMb 4QT7A 4X34A 1Q95G 3CCLQ 3MEUA 2K3YA 4KBMB 5FRNA 2RJDA 4OMMA 2VB6A 5AT1B 4C92C 2RHYA 3RKWA 4FM4B 2QEXA 2FRWA 3EGDA 3QZ9B 4RTZA 2LP5A 2LQKA 2LJ3A 1Y71A 4PJOD 2SRCA 2NWMA 2D6FA 1TS9A 4LDYA 4A4KA 2FPFA 2MIOA 4IURA 1KC8R 3RKYA 2VGNA 4M7AD 4JLGA 5A0GA 1VQPQ 2X9HA 3T9NA 2EYXA 3MHXA 3SB2A 2RHUA 3QG1A 4XTUA 1VQKQ 1KIKA 4IUQA 3G7ZA 2M02A 2FVUA 3I35A 2PVOB 2DXBA 5GMKi 5GAMe 4BI4A 2ZPFB 1ZSGA 1VYUA 2JTFA 5CO7A 2AHJB 2CP5A 4RTYA 2KR3A 1QKWA 4JRPA 2EFIA 5GAN2 4RCCA 4F17A 2VASA 2DFUA 1KJWA 4J6YA 4BB7A 1OU8A 2DD4A 2RQVA 2X4YA 3RBBB 3OYHA 2XDBA 1VQNQ 1M2OA 3H6ZA 1QQJA 3X25B 2RNAA 1GFDA 1AWJA 2RHIA 4UC4A 4OB3B 2A37A 1ZA1B 3CCRT 5DLQE 4M77G 1NZ9A 1VOMA 3EGXA 2EQIA 1W1FA 4D6WA 1ZLMA 2LCLA 4RTWA 2EPDA 2V8JA 5LJ5h 2WSCE 1JXMA 2HQEA 3X28B 3QWYA 2JW4A 3A8OB 9ATCB 1R0CB 4IKFA 4J5YA 3FIFA 4ATOA 5C0MA 1YHQA 2C06A 3MP6A 1VQ7T 4AMCA 2J7IA 4JJBA 2F5KA 4KUIA 2W0ZA 3EHQA 3OQ5A 2X3WD 4JPBW 1O75A 4XAXB 1WI7A 4FIBA 3BDLA 1K9MU 3O8VA 1SPKA 4PJOE 3GNGA 3EFOB 2J6KA 4DEXA 3A1PA 5KYWB 1H3HA 3L2RA 4JUVA 1LOJA 3CPWP 1UJ0A 3I55T 3H0IA 2QQSA 2M51A 1LVKA 3E2UA 1V29B 3OW2S 2H3JA 3LWHA 2V26A 4LDVA 3VS4A 2DBMA 2D9TA 2L3QA 5GAN8 1RADB 1YJ9T 4DBRA 2OTJA 3FB9A 3HRUA 5KCOA 2HQXA 4GLKA 5FRMA 5GJWB 1M8MA 2VXFA 3QJ6A 1Q7YR 1MNDA 2QYZA 1J3TA 1VQLQ 4PJMA 2NUPA 1IHWA 4M77F 3CPWA 2RI2A 3L1AA 2HZYA 3QBYA 4LD9K 2EAYA 2HBWA 5HK0A 4IUPA 4BY6C 3VS7A 1AT1B 3PNWC 2LNVA 4ORZA 3RKXA 2O4XA 1GCQC 2L5QA 2LJ0A 1UGRB 3E9GA 3EG2A 1NM7A 4NL2A 3CCVT 1H641 2RO0A 3A5ZB 5GAN7 4PLIA 1TUCA 4QVZA 2OAUA 3HKSA 3H41A 3SDZA 1WFWA 3SWNB 2DF6A 4OMNA 2LQ8A 4Q5WA 1S72T 5GANh 1BB9A 2OTJQ 3QHSA 1HD3A 2KT8A 2D8JA 3PVQA 1IZ6A 2PU9B 2DAQA 2DL3A 3CEYA 5I2MA 3FEOA 4JRIA 3S3MA 1QVGS 2DPPB 3V7CA 4KUDK 3VRYA 4XTYA 2HSPA 3JCMV 3SHWA 4M7DD 3MO8A 2AZVA 4OMPA 5FWCA 2BE7D 1NE8A 5KYXA 3QDFA 5HK3A 3JSCA 3M56A 1RACB 3INZA 1UGVA 2DKGA 3UA7A 4C0GA 4DBQA 5FW9A 1GCQA 1AVZC 1I0CA 3EG0A 2EVRA 3SEMA 4P5NA 3E1SA 1T3SA 1YJNA 2YDLA 4LDXA 1WXTA 2D1XA 2YRDA 5IHKA 1UGQB 1YIJA 3JCMJ 3URGA 4HCBA 3RMQA 2ROLA 2JM8A 3I5SA 3CCQQ 3HRTA 1WXBA 3GIBA 4EMHA 3PTAA 2KRMA 1MV3A 4OMOA 1YJWA 1M90C 2RQRA 3UA6A 4OMFB 5LJ3g 3L42A 3M5AA 1N9SA 1PWTA 2E6NA 4MDXA 2ZCFB 3ASKA 3PVLA 4ME7A 1VQNA 5GAN5 2FHDA 3RESA 2EIFA 3M0QA 2VXEA 4C0FA 3BFMA 4XTZA 3CQTA 3UF4A 2M1HA 1Y96A 3DLMA 3PT9A 2EJ9A 1I07A 1NG2A 1K9MR 5J26A 2DJQA 1GCPA 4J9FA 4LN2A 2AKKA 2W10A 2FZKB 1VQ7A 4Z02A 1T0HA 2OTLT 2CUBA 3IQLA 1VQ8Q 5HCKA 2K5LA 3LH0A 1WJRA 4A4HA 3HL8A 3J81E 2EQJA 2YUNA 3CCJA 1NLOC 2FPEA 4LE9A 2EKHA 3CCST 1IRXA 2GCXA 4A4FA 3JCMd 2I0NA 2DETA 2E12A 2CS7A 1YCSB 3MP1A 4ELZC 3NPFA 1ZBJA 3C12A 1H3ZA 4IUUA 4F7UB 1PG5B 4DEYA 3AT1B 4OMQA 2XD0A 4J9CA 4FT2A 4M78B 1K73R 3ZL7C 1M4ZA 1YJ9A 4PJOB 4FL6A 2CT4A 5LJ3f 2AT1B 2DE0X 2EYWA 3CCUA 1KD1R 1KFZA 1ABOA 4MDWA 3GOXA 2AZSA 5GAN6 4PJOF 4LXCA 5CKFA 3A8LB 3CCMQ 4BE2A 2QGGA 1BCMA 4XU2A 4AG1C 2A3LA 4M75F 2OJ2A 1U1TA 1VIFA 1Y0MA 2RI5A 1TWBA 2E41A 2KRNA 1TSFA 1LPLA 3RNJA 1BI1A 1PD1A 2RH2A 4HCKA 1OPKA 3C94A 3M4GA 4HVVA 2OTLA 4AFQC 1K8AC 2COZA 3NTHA 4DOVA 2B8AA 3CXCA 3LX7A 2LC4A 4M78G 2P84A 2AKLA 2BZYA 2ZGWA 4CC3A 3VJPA 5LJ5e 3UWNA 2DXCA 1LJOA 3M4YA 2HMAA 3QJYA 4BUGA 3P8BB 4C8QD 4C8QE 4AFUC 3TU4K 2XIDA 1OI1A 2DL5A 1CKBA 1OZ2A 4C5GA 1FMWA 1K73U 1OQKA 2K9GA 3I56T 3TSWA 1GL5A 4KGXB 4BE1A 5CKDA 4LDWA 1TOVA 4M7DE 3QZ5B 4WCIA 1KHIA 1D3BB 1NJIU 1XQHA 2MMPA 1YJWQ 1B34A 1EZZB 4FYVB 1GBRA 5IHNA 2VC8A 4C5HA 3R6OA 1U5SA 2BZXA 3SD4A 3EH2A 4FYYB 4GY5A 2MPXC 1FMVA 3PIPA 1VQ6A 1B3QA 2E6ZA 4NOYA 2LRQA 3C4SA 1PM3A 5A0LA 3CCET 2KI7A 2PUKB 3TSZA 2GGRA 3CBMA 1M2VA 2O88A 3TEEA 4Z8AA 2H3EB 2QEXQ 3ER0A 4ZGJB 3LGLA 5J3BA 1Y7XA 4QQDA 2BIVA 2KRSA 3JCMW 5M9OA 5FWBA 1YJ9Q 2CH4A 1M1KU 1ZHIA 2LNHB 4ZGEB 2NLUA 4IIMA 2OTLQ 4K11A 2J05A 3LH5A 3EG9B 3VS2A 4JZ3A 3U23A 2ZZDA 3DLLA 1OZ3A 4QVDA 1AZGB 2JTMA 3G1JA 2RMOA 3OS5A 2OX7A 2E5QA 2DYBA 2JM9A 3WXMB 3VS6A 4Y28E 3QYHB 1I8FA 1T3LA 4C0DB 1Q81C 1AZEA 1PSFA 3VYHB 1WLPB 4HT9A 3WVDB 5L8RE 1WA7A 2RM4A 1OX8A 1X01A 1JBMA 5KYUB 1RL2A 4M7AG 4EMKB 2KEAA 1YHQT 1PRMC 4RTXA 3ZFJA 3JB9I 1Q86U 3A8MB 2HSEB 1U06A 2Y4XA 4A54A 2GF7A 2KBTA 4M7DA 2RQUA 3S3OA 2QXFA 5I22A 1M3BA 3M0UA 5ECAA 3V7SA 2DRKA 2R58A 4Z88A 5GAOn 4PJOC 2HAXA 4L59A 2V1QA 2COYA 4II1A 3LGFA 2LCCA 3CCJT 2QA4T 1M3AA 1QCOA 3GF5A 4J9IA 4C92D 4M75G 5GJVB 4M4ZA 1VQMA 3R6NA 4PLLA 2EKOA 5IN1A 1SSHA 3BDUA 1R0BG 2DYIA 1VQLA 1QCFA 1VQ6T 1PRLC 2RJCA 4HA8A 1UHFA 1V76A 1VQ9Q 4R55A 7AT1B 3QWXX 2YUPA 4RTVA 1KQSS 4OMLA 4F7UA 3G4SQ 1YIJQ 4XU3A 3A8HB 4EPCA 2PQWA 3QSUA 2VYTA 2WACA 2ZPGB 1AD5A 1Y96B 5FU6B 1QVGA 1QP2A 4QW2A 2JS2A 5IXFA 1M90U 2EJGA 5FU7C 1QCNA 5CK9A 5GMKm 1YHQQ 3VS1A 4HVUA 2ED0A 2HQHA 4PK4A 1YCYA 2K79A 1N8RC 4M78C 3OYEA 4Z89A 2K5IA 5IH2A 4E7SA 2LT1A 2RQWA 3TCJA 4KGZB 2HNIA 2C0IA 1NPPA 4M7AB 3I56A 2JTEA 1BI3A 1DJ7B 1U3OA 2E1HA 5GANf 3EG3A 4KGVB 4M77A 4N4HA 4C92B 1WJQA 3X26B 4M7AA 2ZPBB 3A98A 1HSQA 3JCMe 5GAN4 1Q81U 2KVQG 2KY9A 1D0ZA 2A08A 3REAB 2JVVA 2AK5A 2HCKA 1YIJT 1Y57A 3PMIA 2DXUA 3OYGA 1ZBXA 5KYYB 3CC2T 3OYCA 2DL4A 4IUVA 2FB7A 2BUDA 4GLMA 4JZ4A 2JS0A 2DBKA 3CCSQ 4PJOG 1HK9A 5FU7B 3VUZA 3S3NA 2KDSA 1E7OA 1QVGP 1JJ2S 2L3SA 3RUXA 3VKIA 3OMGA 1YFNA 2ESWA 1SG5A 2LTOA 2XICA 4QQGA 1X75C 4BD3A 4FT4A 2K2MA 4A63B 2EGCA 2O9SA 1NJIC 1JEGA 3CPFA 3HP9A 1GXIE 1I4K1 1WJSA 3OS2A 3V8KA 1RI0A 3CCQT 1QP3A 1N27A 3Q1JA 1WX6A 3SWNC 4JDSA 2FEIA 2DJZA 2QI2A 4FSSA 1UGPB 3CXCP 2DZ9A 4OP0A 2K5FA 3CMET 3ZBDA 1BU1A 3JB9F 1WPYA 1X27A 5L23A 5J39A 2E65A 5HY6A 1K76A 1C0MA 1JU5C 1MMNA 3JCMf 2WSFE 1QKXA 4M77D 1IXDA 4R0KA 1AWXA 2QGFB 3WVEB 1KQ1A 4PJJA 3CC2Q 5KH6A 1KQ2A 1M8VA 2O01E 2DMOA 2CREA 2J6FA 4AG2C 1YWOA 2EYZA 3J80E 3C95A 4M7DG 1M5Q1 1D1BA 2EYYA 4N4GA 2QA4Q 4LUDA 1LCKA 3OYLA 1UG1A 4GBQA 1HXDA 4V2SA 1JRIA 2LQNA 4L5GA 4C0DC 5KE2A 4XK8E 1OV3A 3EFOA 1UDLA 4M7AE 1KQSP 5I21A 2RN8A 3CPWS 1RUWA 3CC7T 4ELYC 2P4RA 2XDDA 1IHVA 4E7JA 3EG9A 1PHTA 3EGXB 2YRVA 3CC2A 3UDCA 2M16A 3I5RA 3BW1A 1K1ZA 3OY9A 2K6DA 1KD1C 4HCCA 1G83A 3QO3A 2KK4A 2F1LA 1UFFA 2ZAEA 3CMAT 1ABQA 1OEBA 2X51A 5EC7A 1PNJA 3EG1A 2PVDB 2L0AA 3X20B 4A53A 3HSBA 1MV0B 4RMOA 2XMFA 4D8DA 2JZ2A 4IIOA 2JMAA 8ATCB 1VQKA 3JB9H 4OGEA 1WYXA 1WNLA 4AFZC 2DTOA 1ZX6A 3EFSA 4DOWA 1UEBA 3MEAA 3OYFA 2XI9A 3EAEA 1B34B 1SSFA 4C8QG 1Q82C 3BY7A 2EJFA 3ULRB 5GMKe 1Q82R 3A8GB 5GAMf 4R56A 1O9SA 1X43A 1BYMA 2IG0A 4M78E 5D6XA 3JCMP 1YWPA 1WHKA 1MUZA 4PFOA 1SRMA
chains in the Genus database with same CATH topology
3NTIA 3M9QA 4C5GA 5FRNA 4J83A 2RJDA 1K73U 4C8QC 3META 4XU0A 3I56T 3HRSA 4C92C 4BE1A 3JAME 4MZPA 5CKDA 3OYBA 1M9SA 2RHYA 4FM4B 4LDWA 2XDPA 4JRKA 3RKWA 5C6SA 5GMKl 2QEXA 4M7DE 3QZ9B 1I5LA 3QZ5B 2LQKA 1M1GA 1Y71A 2KMTA 1LNXA 1AHJB 1KHIA 4PJOD 1D3BB 1TH7A 1NJIU 2DK3A 2D6FA 1XQHA 2MMPA 3LLRA 4LDYA 4A4KA 3H8ZA 4IURA 2CKKA 3ZEHA 1B34A 3KUFA 1KC8C 3GLXA 3RKYA 1R8OB 2VGNA 2X35A 4JLIA 1U8RA 2VC8A 4C5HA 4M7AD 4JLGA 3R6OA 5A0GA 3T9NA 3MHXA 3SB2A 2RHUA 3QG1A 5CAIA 3QKJA 3SD4A 1VUBA 3JCMh 3PIOA 3P8DA 4XTUA 1FX7A 1G3TA 3L2ZA 2Y90A 4GY5A 1G3WA 3PIPA 1VQ6A 4IUQA 2E6ZA 3G7ZA 1U1SA 4NOYA 2FVUA 2LRQA 3C4SA 4ZTFA 2PVOB 3QPHA 3V8JA 2DXBA 5GMKi 5GAMe 5A0LA 3CCET 2E70A 4BI4A 2ZPFB 2DTIA 2JTFA 5CO7A 5DM7R 3OA6A 2RB6A 2PUKB 2AHJB 4IUTA 4OB1B 4A4EA 2CZ0B 3QDRB 5DY9A 5GMKh 3CBMA 3RMSA 4OVAA 3TEEA 3OYNA 4JRPA 2EFIA 4RG8A 3PGGA 5GMKj 5GAN2 2QDYB 5AYFA 4RCCA 1YITA 5GANe 3ER0A 1VQ5A 4ZGJB 1IREB 4J6YA 3LGLA 3OYAA 1S72A 4OGCA 2CGHA 5J3BA 5GAOm 4BB7A 4FSXA 3OYYA 1Y7XA 2DD4A 5LL6S 4J7FA 1WQWA 2X4YA 2BKDN 3LW5E 3OYHA 2OTJT 2JUFA 2EWNA 2XDBA 4QQDA 3V7RA 3JB9G 3QUIA 1BKBA 2BIVA 3H6ZA 3PFSA 3X25B 5M9OA 3JCMW 2RHIA 4UC4A 5A2QE 4OB3B 3JCMc 3CCRT 4BI3A 5DLQE 4M77G 1M1KU 1ZHIA 2CYZB 4ZGEB 3G6EA 1NZ9A 2NLUA 1VQ9A 1QVFS 4OB2B 1ZQ1A 4B9WA 4OF1A 1VQ8T 4RKUE 4D6WA 2GFAA 2LCLA 2ZZDA 3DLLA 1OZ3A 2V8JA 5HKCA 3CCMT 5LJ5h 2Y4YA 3OS0A 4QVDA 4FU6A 2WSCE 2JTMA 2HQEA 1K73C 3X28B 3MP8A 4E7IA 2V8IA 3M53A 3A8OB 2YHTA 4IKFA 1N6AA 1MGQA 3OS5A 4J5YA 2P0QA 1YI2A 2E5QA 4JRQA 3FIFA 1K8AU 1QW1A 3WXMB 4ZGDB 3CCLA 4ATOA 4Y28E 5C0MA 3QYHB 3GPLA 1VQ4A 1YHQA 3MP6A 4MZMA 2E10A 2C06A 1I8FA 4X9DA 4C0DB 1Q81C 1VQ7T 3FDRA 5LJ5g 1PSFA 3VYHB 1Q82U 3MCAB 4HT9A 2F5KA 4KUIA 3WVDB 3CC4T 5L8RE 1Q82C 2RM4A 2WSEE 3OQ5A 1X01A 4PL6A 1JBMA 1RL2A 1M1FA 4E7HA 4M7AG 3JCMQ 2RK2A 4EMKB 3X24B 1O75A 1QVPA 5LJ5d 1VQ4T 1YHQT 4XAXB 3ZFJA 3M58A 3OW2A 3DKMA 3OB9A 4FIBA 5LJ5j 1VQOT 3BDLA 3JB9I 1G3SA 3HFOA 1K9MU 1W4SA 3O8VA 3SFMA 2QQRA 4PJOE 4J6WA 3GNGA 1Q86U 3A8MB 4M78F 2Y4XA 4MMKA 1D3BA 4M75A 4ZN3A 5FLXE 3L2RA 4JUVA 2FYKA 4JS5A 4M7AC 4A54A 1LOJA 2GF7A 1Y07A 4F7UE 4Y91A 5CCAA 3J7AF 4M7DA 3UPUA 5GANj 3VV0A 2D0QB 3S3OA 2QXFA 3I55T 2R5AA 5FU6C 2M9UA 2QQSA 3OW2S 3V7SA 1BI0A 1V29B 2H3JA 2JOYA 2R58A 5CVIA 5GAOn 3LWHA 2HAXA 4PJOC 4L59A 2P4TA 3AHUA 4EMKA 3NFCA 4LDVA 4M75D 4X9CA 2D9TA 3DB4A 1VQNT 4II1A 3LGFA 2LCCA 3OSSC 5GAN3 3CCJT 4J7IA 2QA4T 5GAN8 5GANg 4C8QB 4ZN1A 1YJ9T 2OTJA 3FB9A 3HRUA 3GF5A 1XOVA 4C92D 4M75G 5KCOA 2MF2A 2HQXA 3E19A 1VQMA 4GLKA 3CBOA 4PLLA 2EKOA 5FRMA 2X4XA 5IN1A 2VXFA 3BDUA 3QJ6A 3E9FA 1VQLA 1VQ6T 2RJCA 4HA8A 4JS4A 3PMTA 1YJWT 4M77F 3CPWA 2EQKA 1EIFA 5GAOp 3GP8A 2IVWA 2R57A 2RI2A 4R55A 2X4JA 3L1AA 4M77C 3QBYA 1UGSB 4M75E 3LWIA 4LD9K 1KQSS 2EAYA 2QQ9A 5D6YA 4F7UA 2DXTA 3OSVA 5HK0A 4XU3A 3A8HB 4IUPA 3MEWA 4BY6C 1JB0E 4EPCA 2PQWA 4B9XA 2M0OA 3OYKA 3PNWC 2LNVA 3QSUA 1XTDA 2VYTA 2DZCA 3RKXA 3GNFB 2WACA 2O4XA 2ZPGB 5FU6B 1Y96B 1QVGA 4M75B 1QP2A 5DLOA 5CR2A 3FC3A 4QW2A 3NTKA 1M90U 4OB0B 2EJGA 2L5QA 2MI6A 4MZTA 5FU7C 3QYGB 1KQSA 1UGRB 3E9GA 4NL2A 5CK9A 4NS5A 5GMKm 5LJ3e 2KSSA 3CCUT 1H641 2RO0A 4KT0E 3CCVT 1VQ9T 3A5ZB 2RJFA 5GAN7 4PLIA 4QVZA 5KE3A 2MWOA 2OAUA 4BE0A 4HCZA 1YCYA 2RJEA 3HKSA 2QEXT 4E7KA 1KG1A 1P92A 2FL7A 1BIAA 3CCMA 3OBYA 4M7AF 2DTHA 3SDZA 1YITT 1N8RC 4M78C 3L2UA 3SWNB 2K4YA 5EG2A 3OYEA 2K5IA 2LQ8A 4Q5WA 1S72T 5GANh 2LT1A 3QHSA 3TCJA 2K3XA 1K9MC 5FROA 2HNIA 2P0PA 1NPPA 2A7YA 4VUBA 1IZ6A 4M7AB 4M7DB 2PU9B 1FWZA 4KULA 3I56A 2DAQA 3CEYA 4C5EA 5I2MA 1BI3A 3FEOA 1DJ7B 4JRIA 3S3MA 2O4XB 1QVGS 1JJ2A 2DPPB 4O6JA 4BDZA 2E1HA 3V7CA 5GANf 2EQMA 4KUDK 4XTYA 4O5VA 2K57A 4M77A 4N4HA 3JCMV 4C92B 4M7DD 1WJQA 3MO8A 1NPRA 4EMKC 3X26B 2DIQA 4M7AA 2ZPBB 2RD1A 3RERA 1NE8A 2HBPA 3JCMe 1KC8U 5GAN4 4C5IA 5HK3A 3JSCA 3M56A 3INZA 2LX9A 5CKBA 1Q81U 1VQ5T 2KVQG 2KY9A 2DKGA 4C8QF 4C0GA 4L6V5 1XNIA 2MAMA 3F70A 3ME9A 5D6WA 2JVVA 2P0KA 4C92F 2XKOC 5GAMh 5GAOl 1W2BS 3CD6A 2DEQA 4PJOA 2GFUA 1YIJT 4P5NA 4E7LA 3E1SA 1WQ7A 1YJNA 2PUOB 3PMIA 2DXUA 2CZ1B 3OYGA 2VV5A 1ZBXA 1YBYA 4LDXA 3CC2T 3OYCA 1Q86C 3CCEA 4IUVA 4MMLA 1Q7YC 4C92E 2FB7A 1UGQB 2BUDA 2HD0A 2JNGA 4N4IA 3JB9D 4HT8A 1W2BA 3LYIA 1YIJA 3JCMJ 3QXEB 3URGA 3OYDA 4M7DC 2XU8A 3HHTB 4PJOG 1HK9A 5FU7B 3VUZA 2DVEA 2KDSA 3RMQA 5LJ5f 3S3NA 4HCBA 5LJ3j 3CCRA 3HRTA 1JJ2S 1VQPT 1UB4A 4EMGA 3GIBA 2ZPEB 2V8KA 2ZPIB 4F7UG 3TREA 3RUXA 4EMHA 3PTAA 3VKIA 1MHNA 3OMGA 2LTOA 2F5TX 2XICA 1YJWA 1M90C 4QQGA 1X75C 1VQKT 5CQYA 4BD3A 2LVMA 4FT4A 5CKHA 4OMFB 5IAYA 5LJ3g 3OMCA 5GANd 1FXXA 3JRZA 1NJIC 2CZ7B 3L42A 4CRIA 3M5AA 1N9SA 1KD1U 3CPFA 2QQAA 3HP9A 4JJNK 1GXIE 3P8HA 1I4K1 1WJSA 2E6NA 1YI2T 5CIUA 2ZCFB 4MDXA 3ASKA 3OS2A 2RA2A 3V8KA 1RI0A 3JCMX 4ME7A 1VQNA 3CCQT 1QP3A 5GAN5 4EDUA 1N27A 3Q1JA 2QA4A 1KHCA 3SWNC 3CMEA 2FHDA 1N8RU 2EIFA 4N0AA 3N5BB 3RESA 2VGMA 2VXEA 4JDSA 4C0FA 3BFMA 2QI2A 2DJZA 4XTZA 3CCQA 1UGPB 2DO3A 1BIBA 2M1HA 4C8QA 4BDYA 3CC4A 2DZ9A 3G4SA 4RCBA 2R5MA 3L2WA 2EYQA 1Y96A 3DLMA 4OP0A 1G3YA 3OYMA 4M78A 1X6OA 2K5FA 3PT9A 3CMET 2RHXA 3ZBDA 2EJ9A 3JB9F 3M55A 1WPYA 3UT1A 3V8LA 4XU1A 2L3RA 4LD6A 4M77B 5J39A 5J26A 3G71A 2E65A 5HY6A 4DQ2A 3CBPA 2XG8D 1I81A 4LDUA 4YTLA 4M78D 1VQ7A 2XK0A 4DA4A 4Z02A 3JCMg 2OTLT 3JCMf 2WSFE 4QVCA 3CXCS 4M77D 3I55A 3OBWA 3WVEB 1KQ1A 4TVRA 3KXTA 2K5LA 4QQ6A 3LH0A 4NL3A 1KQ2A 5KH6A 1WJRA 1M8VA 2RHZA 4A4HA 2L8DA 2O01E 3HL8A 2MWPA 3J81E 2EQJA 3CD6T 2LT4A 1VQOA 4J8OA 4XTXA 3CCJA 3M54A 5CKEA 3J80E 3C95A 4M7DG 1M5Q1 5I2SA 3CCST 1BI2A 2GCXA 4N4GA 2I2LA 3RIRA 4A4FA 3JCMd 4ZTJA 3FJPA 4M7DF 2E12A 2QTXA 3OYLA 1M1KC 2CS7A 1HXDA 1PSEA 4V2SA 1JRIA 3MP1A 4L5GA 4C0DC 4ELZC 3CC7A 5KE2A 4XK8E 1VIEA 2E64A 4J6XA 3L2VA 4M77E 3M57A 4PNOA 3C12A 4M7AE 1H3ZA 4IUUA 4F7UB 5I21A 3CPWS 4PKCC 2XD0A 3CCLT 4FT2A 3OS1A 4M78B 2YLBA 2XHCA 3CC7T 4BY6B 4ELYC 1M4ZA 3SWNA 3HFNA 1YJ9A 2XDDA 4PJOB 4E7JA 4CI0C 1QVFA 4FL6A 5LJ3f 3CMAA 1N9RA 2X4WA 2YRVA 2KAFA 3CC2A 3UDCA 2M16A 3OYJA 4F7UF 2F69A 3BW1A 3CCUA 5GAMd 1VQ8A 3DB3A 4MDWA 3EFRA 3OY9A 3GOXA 1YJNT 1KD1C 4HCCA 2VUBA 2DIGA 1OYXA 4A4GA 3MEVA 4PJOF 3QO3A 5GAN6 3L2QA 2KK4A 5LJ3d 5CKFA 3A8LB 2G3RA 3CMAT 4C92A 4BE2A 4M75C 3VYGA 2RK1A 4XQ3A 2LDMA 4XU2A 4XTVA 2A3LA 4M75F 2DD5A 2PVDB 5IT9E 2L89A 5GAMg 1Q7YU 4A53A 3X20B 1U1TA 1VIFA 2PVGB 2RI5A 5A0DA 3HSBA 1WGSA 2E41A 4N0AC 2ZPHB 5CQXA 2K2VA 4BACA 4RMOA 2RI3A 1BI1A 2RH2A 5GAOr 2JZ2A 4C92G 2YLCA 1VQMT 1VQKA 3C94A 3M4GA 4WF2A 4XTWA 3VUBA 4BI8B 2KQWA 5GAMj 3G6ET 2OTLA 4OGEA 3JB9H 1VQLT 1WNLA 2JN0A 1K8AC 2DTOA 2QQBA 3EFSA 3NTHA 4DOVA 2B8AA 4DOWA 3CXCA 5LJ3h 1G5VA 3LX7A 3S6WA 3HPWA 2LC4A 4M78G 2GQVA 1UEBA 3MEAA 4E47A 3FRNA 3OYFA 3CCVA 2ZGWA 2XI9A 2CZ6B 3EAEA 3VJPA 1SSFA 1B34B 4C8QG 5LJ5e 3OYIA 3BY7A 2EJFA 3UWNA 3FLGA 5GMKe 3G4ST 1VQPA 2DXCA 3CCSA 3A8GB 5GAOq 5KCHA 4HKEA 4C0ZA 5GAMf 4R56A 3QIIA 1LJOA 3M4YA 3QJYA 4BUGA 3M59A 2EQUA 3P8BB 4C8QD 4RG2A 4C8QE 1O9SA 3JB9J 1BYMA 3G71T 3TU4K 2XIDA 1OI1A 2IG0A 4M78E 3VU3C 5D6XA 3KBGA 3JCMP 3JCMb 4X34A 3MEUA 2K3YA 4KBMB 1OZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CK9 A;  3HPW A;  4OF1 A;  1VUB A;  1X75 C;  3NFC A;  5CQY A;  1M1F A;  4MZP A;  5CKH A;  4ELY C;  5CKD A;  5HKC A;  3JRZ A;  5CKE A;  5HK0 A;  4HKE A;  3G7Z A;  5CQX A;  2KMT A;  2MF2 A;  4MDX A;  1NE8 A;  5HK3 A;  3JSC A;  5CO7 A;  4ME7 A;  5CKB A;  4ELZ C;  5CR2 A;  3VUB A;  2VUB A;  5DLO A;  3TCJ A;  2C06 A;  4MZM A;  5CCA A;  1UB4 A;  4MZT A;  4VUB A;  5CKF A; 
#chains in the Genus database with same CATH topology
 3NTI A;  4C8Q C;  4XU0 A;  2CP3 A;  4MZP A;  2XDP A;  5GMK l;  5C6S A;  1RAA B;  1I5L A;  2LQW A;  1TH7 A;  1X6B A;  3CMA Q;  1RLQ C;  3LLR A;  3H8Z A;  3ZEH A;  3GLX A;  1R8O B;  2X35 A;  2LCS A;  2C0T A;  4D8K A;  2DA9 A;  1UE9 A;  2IPO B;  3JCM h;  3PIO A;  1FX7 A;  1KSW A;  3KFV A;  2NYS A;  3L2Z A;  4PFP A;  2KGT A;  1G3W A;  2B86 A;  4FYW B;  2O2O A;  4B6M A;  1UUE A;  4ZTF A;  1U1S A;  2GTO A;  1B07 A;  2QDL A;  3V8J A;  5D7U A;  2E70 A;  2RF0 A;  2DTI A;  3OA6 A;  2RB6 A;  2G6F X;  3CCV Q;  1OU9 A;  2NUT A;  4FW2 A;  3CCU Q;  3QDR B;  5DY9 A;  5GMK h;  1ZUY A;  4OVA A;  3CCR Q;  4RG8 A;  2A36 A;  5GMK j;  1YIT A;  4LNP A;  5GAN e;  4RTT A;  1ZUK A;  2CGH A;  5LL6 S;  1SHG A;  4J7F A;  2OTJ T;  2JUF A;  2EWN A;  4FYX B;  3QUI A;  1BKB A;  1KK7 A;  2LJ1 A;  4F04 B;  1SKU B;  3MJX A;  3JCM c;  4BI3 A;  1YNZ A;  3G6E A;  1QVF S;  4OB2 B;  4B9W A;  1X6G A;  4OF1 A;  1VQ8 T;  4RKU E;  1NEG A;  5HKC A;  3CCM T;  1AEY A;  3OS0 A;  1K73 C;  4E7I A;  2V8I A;  2YHT A;  1RAB B;  1N6A A;  1NEB A;  1MGQ A;  1YI2 A;  4JRQ A;  5KYY A;  4PJL A;  1QW1 A;  4ZGD B;  3M0S A;  4AFS C;  2BE9 B;  2YUQ A;  4X9D A;  3FDR A;  5IXB A;  5LJ5 g;  2KYM A;  2DEU A;  2L2P A;  1UJY A;  1Q82 U;  3I55 Q;  2ECZ A;  3CC4 T;  2WSE E;  3M0T A;  4E7Z A;  1M3C A;  2RK2 A;  3JCM Q;  3X24 B;  5LJ5 d;  1VQ4 T;  1M30 A;  3OB9 A;  2FO0 A;  5LJ5 j;  1VQO T;  1W4S A;  2QQR A;  1TUD A;  2NUZ A;  1EFN A;  4M78 F;  4MMK A;  4EIK A;  1D3B A;  4M75 A;  4ZN3 A;  2RQT A;  4M7A C;  2FYK A;  1Z9Z A;  1Y07 A;  2E3I A;  3UPU A;  5GAN j;  3VV0 A;  2D0Q B;  3O5Z A;  2R5A A;  1M2V B;  2JOY A;  3EH1 A;  3NFC A;  4M75 D;  4X9C A;  2JT4 A;  1OPL A;  2CSI A;  3OSS C;  4J9E A;  4J7I A;  5GAN g;  2E3H A;  1CSK A;  1W2B P;  1XOV A;  2MF2 A;  1IO6 A;  2YWW A;  4HXJ A;  1SRL A;  2X3X D;  4JS4 A;  1H92 A;  1PKT A;  2SEM A;  3PMT A;  1YJW T;  2QK0 A;  5GAO p;  3I9Q A;  2X4J A;  2DNU A;  3LWI A;  4M75 E;  2QQ9 A;  1WHG A;  2DXT A;  1C1A A;  1M1K R;  1M90 R;  3TQ7 P;  4B9X A;  3OYK A;  4CC2 A;  1MMD A;  1K0X A;  1XTD A;  4PJN A;  2DZC A;  3GNF B;  1NJI R;  4J9H A;  5CR2 A;  2COW A;  2A0F B;  1FYN A;  4ESR A;  3FC3 A;  3NTK A;  1PC0 A;  2MI6 A;  4ZNX A;  1KQS A;  1G8X A;  4NS5 A;  5LJ3 e;  2KSS A;  1VQ4 Q;  2YSQ A;  4RTU A;  2YT6 A;  4BE0 A;  4HCZ A;  1ZA2 B;  4E7K A;  1KG1 A;  1P92 A;  3CCM A;  3OBY A;  3L2U A;  4KH0 B;  1N5Z A;  2K4Y A;  5EG2 A;  1S1N A;  1SHF A;  2HKQ B;  5FRO A;  2P0P A;  1YN8 A;  4VUB A;  4QKU A;  4M7D B;  1FWZ A;  2PTK A;  1JJ2 A;  4J9B A;  4KH1 B;  1RI9 A;  2DM1 A;  2K57 A;  1NPR A;  4EMK C;  2GBQ A;  1S72 Q;  4C5I A;  1VQ5 T;  4FCY A;  4C8Q F;  4L6V 5;  2MAM A;  3F70 A;  1W2B S;  2XKO C;  5GAO l;  2DEQ A;  4DBF A;  4PJO A;  2GFU A;  1WQ7 A;  2PUO B;  1RAG B;  2CZ1 B;  1WXU A;  1Q86 R;  3G6E Q;  2JNG A;  2HD0 A;  4N4I A;  3JB9 D;  3LYI A;  3OYD A;  3HHT B;  2GNC A;  5LJ3 j;  4HVW A;  1UB4 A;  2F2V A;  1X2Q A;  2ZPE B;  4Y92 A;  4F7U G;  3TRE A;  3VS5 A;  2F5T X;  2FG0 A;  5CQY A;  2LVM A;  1YIT Q;  5CKH A;  3HTR A;  2ENM A;  2CZ7 B;  1BBZ A;  2KT1 A;  1KD1 U;  4JJN K;  3P8H A;  1D1C A;  3VS3 A;  3JCM X;  3H9N A;  2LX7 A;  2QA4 A;  3CME A;  1N8R U;  4N0A A;  1SEM A;  2VGM A;  1QMC A;  4E6R A;  2DO3 A;  1BIB A;  4X1V A;  4C8Q A;  3EGD B;  4RCB A;  2R5M A;  3L2W A;  2EYQ A;  1N8R R;  2DIL A;  2FZC B;  2HL5 C;  2CUD A;  1AOJ A;  3M55 A;  3UT1 A;  3V8L A;  1E6H A;  1QVF P;  4LD6 A;  4M77 B;  4DQ2 A;  4PFZ A;  2XG8 D;  4LDU A;  2J6O A;  4M78 D;  4YTL A;  2M0Y A;  4DA4 A;  4JJC A;  3CXC S;  4QVC A;  1R77 A;  2EBP A;  1MNE A;  2FZG B;  2QAZ A;  4TVR A;  4NL3 A;  1EX4 A;  1WIE A;  2RHZ A;  4CC4 B;  2L8D A;  2CP6 A;  2LT4 A;  1VQO A;  4J8O A;  5CKE A;  3CCJ Q;  3RIR A;  2I2L A;  2V1R A;  4ZTJ A;  1AWW A;  2QTX A;  1PSE A;  2D8H A;  2ED1 A;  3CC7 A;  5KYX B;  2DL7 A;  4PKC C;  1JJ2 P;  2XHC A;  2NUT B;  4BY6 B;  2VKN A;  1W70 A;  3HFN A;  2DER A;  4CI0 C;  3CMA A;  1N9R A;  3NMZ C;  1C6V X;  1GFC A;  4F7U F;  3EHR A;  5GAM d;  1VQ8 A;  1YJN T;  2O31 A;  2DIG A;  2D0N A;  4A4G A;  3MEV A;  2G3R A;  1RAI B;  2QG9 B;  4M75 C;  3VYG A;  4E2F B;  1E6G A;  2EW3 A;  4JJD A;  3CC7 Q;  2DD5 A;  1D0Y A;  5IT9 E;  3OW2 P;  5A0D A;  4N0A C;  5CQX A;  2CT3 A;  1PKS A;  2ZPH B;  4BAC A;  8AT1 B;  1ZSZ A;  5GAO r;  2CH4 W;  4C92 G;  1HYO A;  1IGU A;  2CP7 A;  3G71 Q;  2QTV A;  4WF2 A;  2KQW A;  2KYB A;  2JN0 A;  3S6W A;  2J06 A;  4E47 A;  3OYI A;  2CZ6 B;  3RER A;  3I56 Q;  1I1J A;  3FLG A;  1VQP A;  3CCS A;  2VWF A;  5GAO q;  1WHH A;  2O9V A;  4C0Z A;  1D09 B;  3QII A;  3JB9 J;  1GRI A;  2K7A A;  3KBG A;  4LUE A;  1UGS B;  3M9Q A;  4J83 A;  2YRC A;  3MET A;  3HRS A;  3JAM E;  3OYB A;  1M9S A;  4JRK A;  1YJN Q;  1M1G A;  2KMT A;  1LNX A;  1AHJ B;  2DK3 A;  2ATC B;  1AWO A;  2CKK A;  1TU0 B;  3KUF A;  1KC8 C;  4JLI A;  1U8R A;  1Z9Q A;  2DVJ A;  5CAI A;  3QKJ A;  2EGA A;  1VUB A;  3P8D A;  4WTO B;  1G3T A;  2Y90 A;  2KXC A;  1Q81 R;  3QPH A;  2K3B A;  3TVT A;  5DM7 R;  5KYW A;  4OB1 B;  1MMG A;  1BK2 A;  4IUT A;  4A4E A;  2CZ0 B;  5IHI A;  3RMS A;  2BTT A;  2PNI A;  3OYN A;  2QAS A;  3PGG A;  1NYG A;  2QDY B;  5AYF A;  5KYU A;  1VQ5 A;  1OOT A;  1IRE B;  3OYA A;  2HDA A;  1GBQ A;  1S72 A;  4OGC A;  5GAO m;  1K4U S;  4FSX A;  3FJ5 A;  3OYY A;  2MOX A;  2PZ1 A;  2GTJ A;  1WQW A;  3BE3 A;  2BKD N;  3LW5 E;  3V7R A;  3JB9 G;  2CP0 A;  1OX9 A;  3PFS A;  1OUL A;  1D1A A;  5A2Q E;  1WHJ A;  2CYZ B;  1VQ9 A;  1ZQ1 A;  1VQ7 Q;  2GFA A;  1D0X A;  2JJ9 A;  4J9D A;  3EGU A;  2Y4Y A;  4FU6 A;  3MP8 A;  3VS0 A;  2MCN A;  3M53 A;  4DBH A;  2ABL A;  4KRT A;  3GBQ A;  1CKA A;  2P0Q A;  1K8A U;  1ZSZ C;  2E4H A;  2YUO A;  1M27 C;  3CCL A;  3JV3 A;  3GPL A;  2E5K A;  1VQ4 A;  4MZM A;  2E10 A;  2NUP B;  1RAF B;  3MCA B;  1WDX A;  1V1C A;  2YXY A;  4PL6 A;  1M1F A;  4E7H A;  1QVP A;  3M58 A;  3OW2 A;  3DKM A;  1G3S A;  3HFO A;  2OI3 A;  3SFM A;  4ANJ A;  4J6W A;  1G2B A;  2LMJ A;  4RUG A;  5FLX E;  4JS5 A;  4F7U E;  5CCA A;  4Y91 A;  3J7A F;  2F2X A;  2HKN A;  3PE0 A;  1K9A A;  5FU6 C;  2M9U A;  1BI0 A;  5CVI A;  2P4T A;  2DRM A;  3AHU A;  4EMK A;  3RR6 A;  3DB4 A;  3H0H A;  1VQN T;  1JXO A;  1YP5 A;  5GAN 3;  2A28 A;  3M0R A;  4C8Q B;  4ZN1 A;  3E19 A;  2FRY A;  1RAE B;  1SF9 A;  3CBO A;  1RLP C;  2X4X A;  3E9F A;  1UHC A;  2GQI A;  3VRZ A;  2FPD A;  1WZO A;  3CME Q;  1B7T A;  2EQK A;  1EIF A;  3GP8 A;  2IVW A;  2R57 A;  4M77 C;  1ACM B;  5D6Y A;  1QLY A;  3OSV A;  2H8H A;  3MEW A;  1JB0 E;  2M0O A;  1X69 A;  2MYS A;  1MMA A;  4M75 B;  5DLO A;  1VQ6 Q;  3CCE Q;  4OB0 B;  4MZT A;  1IGQ A;  3QYG B;  3REB B;  1VQ9 T;  1WHM A;  3CCU T;  1TTH B;  4KT0 E;  2KRO A;  1HJD A;  2RJF A;  3THK A;  5KE3 A;  2MWO A;  2RJE A;  2QEX T;  2FL7 A;  1BIA A;  4M7A F;  2DTH A;  1ZUU A;  1YIT T;  4F16 A;  1XJW B;  1BCO A;  2K3X A;  2CSQ A;  1K9M C;  2A7Y A;  4KUL A;  3MPU B;  2EGE A;  3MKD A;  4C5E A;  2O4X B;  4O6J A;  4BDZ A;  2EQM A;  4O5V A;  1VYT A;  5KYN A;  2DIQ A;  2RD1 A;  2HBP A;  1KC8 U;  1NLP C;  2LX9 A;  5CKB A;  2CP2 A;  2JXB A;  1XNI A;  1IB8 A;  3ME9 A;  5D6W A;  4C92 F;  2P0K A;  5GAM h;  1H8K A;  4E7L A;  1I5O B;  2VV5 A;  2VVK A;  1YBY A;  1Q86 C;  3CC4 Q;  3CCE A;  4MML A;  1A0N B;  2KXD A;  4C92 E;  5I11 A;  1Q7Y C;  2CDT A;  3CD6 Q;  4HT8 A;  1W2B A;  3QXE B;  1NYF A;  4M7D C;  2XU8 A;  1VQO Q;  5LJ5 f;  2DVE A;  2DX1 A;  3CCR A;  2Z0W A;  2DLP A;  1VQP T;  4EMG A;  2V8K A;  2ZPI B;  1F1B B;  3NHN A;  1MHN A;  3UAT A;  1QWF A;  1VQK T;  2F2W A;  5GAN d;  5IAY A;  3OMC A;  1FXX A;  3JRZ A;  2HL3 A;  4CRI A;  2QQA A;  1X2K A;  1YI2 T;  5CIU A;  2AIR B;  2RA2 A;  1K0S A;  2LZ6 B;  4EDU A;  1FMK A;  1KHC A;  4AT1 B;  2HEQ A;  1PD0 A;  1QWE A;  3N5B B;  2OAW A;  4BDY A;  3CC4 A;  3G4S A;  1UEC A;  1ARK A;  1G3Y A;  3OYM A;  2MK5 A;  4M78 A;  1X6O A;  2RHX A;  1PCX A;  1W6X A;  3NGP A;  4XU1 A;  2L3R A;  3G71 A;  3RDV A;  3CBP A;  1VA7 A;  1I81 A;  1WHL A;  2XK0 A;  3H0F A;  1TUG B;  3JCM g;  2RPN A;  1VQM Q;  3I55 A;  3OBW A;  3KXT A;  4QQ6 A;  1VYV A;  2MWP A;  3C0C A;  1T0J A;  3CD6 T;  4XTX A;  3M54 A;  1K8A R;  5I2S A;  1BI2 A;  4CC7 A;  3FJP A;  4M7D F;  1M1K C;  2L3P A;  2JMC A;  1TG0 A;  1VIE A;  2E64 A;  4J6X A;  3L2V A;  4M77 E;  1ZSZ B;  3M57 A;  4PNO A;  1JO8 A;  3CCL T;  3OS1 A;  2YLB A;  1YI2 Q;  3SWN A;  4J9G A;  1QVF A;  4FW1 A;  2X4W A;  2KAF A;  2DL8 A;  3OYJ A;  2F69 A;  1JQQ A;  3DB3 A;  3EFR A;  2KNB B;  2VUB A;  1OYX A;  3D7S B;  3L2Q A;  5LJ3 d;  4C92 A;  1VQ5 Q;  2RK1 A;  4XQ3 A;  2LDM A;  2ROT A;  4XTV A;  2L89 A;  5GAM g;  1Q7Y U;  2C0O A;  2PVG B;  1WGS A;  6AT1 B;  2K2V A;  2RI3 A;  2YLC A;  1VQM T;  4F14 A;  4XTW A;  3VUB A;  4BI8 B;  5GAM j;  3G6E T;  1TXQ A;  1VQL T;  1UTI A;  1G5V A;  2QQB A;  1RAH B;  2IIM A;  5LJ3 h;  3HPW A;  2GQV A;  3FRN A;  3CCV A;  3CCQ A;  1NBE B;  3M0P A;  3CD6 A;  3G4S T;  5KCH A;  4HKE A;  3M59 A;  2EQU A;  4RG2 A;  3G71 T;  2KE9 A;  2BZ8 A;  3VU3 C;  3JCM b;  4QT7 A;  4X34 A;  1Q95 G;  3CCL Q;  3MEU A;  2K3Y A;  4KBM B;  5FRN A;  2RJD A;  4OMM A;  2VB6 A;  5AT1 B;  4C92 C;  2RHY A;  3RKW A;  4FM4 B;  2QEX A;  2FRW A;  3EGD A;  3QZ9 B;  4RTZ A;  2LP5 A;  2LQK A;  2LJ3 A;  1Y71 A;  4PJO D;  2SRC A;  2NWM A;  2D6F A;  1TS9 A;  4LDY A;  4A4K A;  2FPF A;  2MIO A;  4IUR A;  1KC8 R;  3RKY A;  2VGN A;  4M7A D;  4JLG A;  5A0G A;  1VQP Q;  2X9H A;  3T9N A;  2EYX A;  3MHX A;  3SB2 A;  2RHU A;  3QG1 A;  4XTU A;  1VQK Q;  1KIK A;  4IUQ A;  3G7Z A;  2M02 A;  2FVU A;  3I35 A;  2PVO B;  2DXB A;  5GMK i;  5GAM e;  4BI4 A;  2ZPF B;  1ZSG A;  1VYU A;  2JTF A;  5CO7 A;  2AHJ B;  2CP5 A;  4RTY A;  2KR3 A;  1QKW A;  4JRP A;  2EFI A;  5GAN 2;  4RCC A;  4F17 A;  2VAS A;  2DFU A;  1KJW A;  4J6Y A;  4BB7 A;  1OU8 A;  2DD4 A;  2RQV A;  2X4Y A;  3RBB B;  3OYH A;  2XDB A;  1VQN Q;  1M2O A;  3H6Z A;  1QQJ A;  3X25 B;  2RNA A;  1GFD A;  1AWJ A;  2RHI A;  4UC4 A;  4OB3 B;  2A37 A;  1ZA1 B;  3CCR T;  5DLQ E;  4M77 G;  1NZ9 A;  1VOM A;  3EGX A;  2EQI A;  1W1F A;  4D6W A;  1ZLM A;  2LCL A;  4RTW A;  2EPD A;  2V8J A;  5LJ5 h;  2WSC E;  1JXM A;  2HQE A;  3X28 B;  3QWY A;  2JW4 A;  3A8O B;  9ATC B;  1R0C B;  4IKF A;  4J5Y A;  3FIF A;  4ATO A;  5C0M A;  1YHQ A;  2C06 A;  3MP6 A;  1VQ7 T;  4AMC A;  2J7I A;  4JJB A;  2F5K A;  4KUI A;  2W0Z A;  3EHQ A;  3OQ5 A;  2X3W D;  4JPB W;  1O75 A;  4XAX B;  1WI7 A;  4FIB A;  3BDL A;  1K9M U;  3O8V A;  1SPK A;  4PJO E;  3GNG A;  3EFO B;  2J6K A;  4DEX A;  3A1P A;  5KYW B;  1H3H A;  3L2R A;  4JUV A;  1LOJ A;  3CPW P;  1UJ0 A;  3I55 T;  3H0I A;  2QQS A;  2M51 A;  1LVK A;  3E2U A;  1V29 B;  3OW2 S;  2H3J A;  3LWH A;  2V26 A;  4LDV A;  3VS4 A;  2DBM A;  2D9T A;  2L3Q A;  5GAN 8;  1RAD B;  1YJ9 T;  4DBR A;  2OTJ A;  3FB9 A;  3HRU A;  5KCO A;  2HQX A;  4GLK A;  5FRM A;  5GJW B;  1M8M A;  2VXF A;  3QJ6 A;  1Q7Y R;  1MND A;  2QYZ A;  1J3T A;  1VQL Q;  4PJM A;  2NUP A;  1IHW A;  4M77 F;  3CPW A;  2RI2 A;  3L1A A;  2HZY A;  3QBY A;  4LD9 K;  2EAY A;  2HBW A;  5HK0 A;  4IUP A;  4BY6 C;  3VS7 A;  1AT1 B;  3PNW C;  2LNV A;  4ORZ A;  3RKX A;  2O4X A;  1GCQ C;  2L5Q A;  2LJ0 A;  1UGR B;  3E9G A;  3EG2 A;  1NM7 A;  4NL2 A;  3CCV T;  1H64 1;  2RO0 A;  3A5Z B;  5GAN 7;  4PLI A;  1TUC A;  4QVZ A;  2OAU A;  3HKS A;  3H41 A;  3SDZ A;  1WFW A;  3SWN B;  2DF6 A;  4OMN A;  2LQ8 A;  4Q5W A;  1S72 T;  5GAN h;  1BB9 A;  2OTJ Q;  3QHS A;  1HD3 A;  2KT8 A;  2D8J A;  3PVQ A;  1IZ6 A;  2PU9 B;  2DAQ A;  2DL3 A;  3CEY A;  5I2M A;  3FEO A;  4JRI A;  3S3M A;  1QVG S;  2DPP B;  3V7C A;  4KUD K;  3VRY A;  4XTY A;  2HSP A;  3JCM V;  3SHW A;  4M7D D;  3MO8 A;  2AZV A;  4OMP A;  5FWC A;  2BE7 D;  1NE8 A;  5KYX A;  3QDF A;  5HK3 A;  3JSC A;  3M56 A;  1RAC B;  3INZ A;  1UGV A;  2DKG A;  3UA7 A;  4C0G A;  4DBQ A;  5FW9 A;  1GCQ A;  1AVZ C;  1I0C A;  3EG0 A;  2EVR A;  3SEM A;  4P5N A;  3E1S A;  1T3S A;  1YJN A;  2YDL A;  4LDX A;  1WXT A;  2D1X A;  2YRD A;  5IHK A;  1UGQ B;  1YIJ A;  3JCM J;  3URG A;  4HCB A;  3RMQ A;  2ROL A;  2JM8 A;  3I5S A;  3CCQ Q;  3HRT A;  1WXB A;  3GIB A;  4EMH A;  3PTA A;  2KRM A;  1MV3 A;  4OMO A;  1YJW A;  1M90 C;  2RQR A;  3UA6 A;  4OMF B;  5LJ3 g;  3L42 A;  3M5A A;  1N9S A;  1PWT A;  2E6N A;  4MDX A;  2ZCF B;  3ASK A;  3PVL A;  4ME7 A;  1VQN A;  5GAN 5;  2FHD A;  3RES A;  2EIF A;  3M0Q A;  2VXE A;  4C0F A;  3BFM A;  4XTZ A;  3CQT A;  3UF4 A;  2M1H A;  1Y96 A;  3DLM A;  3PT9 A;  2EJ9 A;  1I07 A;  1NG2 A;  1K9M R;  5J26 A;  2DJQ A;  1GCP A;  4J9F A;  4LN2 A;  2AKK A;  2W10 A;  2FZK B;  1VQ7 A;  4Z02 A;  1T0H A;  2OTL T;  2CUB A;  3IQL A;  1VQ8 Q;  5HCK A;  2K5L A;  3LH0 A;  1WJR A;  4A4H A;  3HL8 A;  3J81 E;  2EQJ A;  2YUN A;  3CCJ A;  1NLO C;  2FPE A;  4LE9 A;  2EKH A;  3CCS T;  1IRX A;  2GCX A;  4A4F A;  3JCM d;  2I0N A;  2DET A;  2E12 A;  2CS7 A;  1YCS B;  3MP1 A;  4ELZ C;  3NPF A;  1ZBJ A;  3C12 A;  1H3Z A;  4IUU A;  4F7U B;  1PG5 B;  4DEY A;  3AT1 B;  4OMQ A;  2XD0 A;  4J9C A;  4FT2 A;  4M78 B;  1K73 R;  3ZL7 C;  1M4Z A;  1YJ9 A;  4PJO B;  4FL6 A;  2CT4 A;  5LJ3 f;  2AT1 B;  2DE0 X;  2EYW A;  3CCU A;  1KD1 R;  1KFZ A;  1ABO A;  4MDW A;  3GOX A;  2AZS A;  5GAN 6;  4PJO F;  4LXC A;  5CKF A;  3A8L B;  3CCM Q;  4BE2 A;  2QGG A;  1BCM A;  4XU2 A;  4AG1 C;  2A3L A;  4M75 F;  2OJ2 A;  1U1T A;  1VIF A;  1Y0M A;  2RI5 A;  1TWB A;  2E41 A;  2KRN A;  1TSF A;  1LPL A;  3RNJ A;  1BI1 A;  1PD1 A;  2RH2 A;  4HCK A;  1OPK A;  3C94 A;  3M4G A;  4HVV A;  2OTL A;  4AFQ C;  1K8A C;  2COZ A;  3NTH A;  4DOV A;  2B8A A;  3CXC A;  3LX7 A;  2LC4 A;  4M78 G;  2P84 A;  2AKL A;  2BZY A;  2ZGW A;  4CC3 A;  3VJP A;  5LJ5 e;  3UWN A;  2DXC A;  1LJO A;  3M4Y A;  2HMA A;  3QJY A;  4BUG A;  3P8B B;  4C8Q D;  4C8Q E;  4AFU C;  3TU4 K;  2XID A;  1OI1 A;  2DL5 A;  1CKB A;  1OZ2 A;  4C5G A;  1FMW A;  1K73 U;  1OQK A;  2K9G A;  3I56 T;  3TSW A;  1GL5 A;  4KGX B;  4BE1 A;  5CKD A;  4LDW A;  1TOV A;  4M7D E;  3QZ5 B;  4WCI A;  1KHI A;  1D3B B;  1NJI U;  1XQH A;  2MMP A;  1YJW Q;  1B34 A;  1EZZ B;  4FYV B;  1GBR A;  5IHN A;  2VC8 A;  4C5H A;  3R6O A;  1U5S A;  2BZX A;  3SD4 A;  3EH2 A;  4FYY B;  4GY5 A;  2MPX C;  1FMV A;  3PIP A;  1VQ6 A;  1B3Q A;  2E6Z A;  4NOY A;  2LRQ A;  3C4S A;  1PM3 A;  5A0L A;  3CCE T;  2KI7 A;  2PUK B;  3TSZ A;  2GGR A;  3CBM A;  1M2V A;  2O88 A;  3TEE A;  4Z8A A;  2H3E B;  2QEX Q;  3ER0 A;  4ZGJ B;  3LGL A;  5J3B A;  1Y7X A;  4QQD A;  2BIV A;  2KRS A;  3JCM W;  5M9O A;  5FWB A;  1YJ9 Q;  2CH4 A;  1M1K U;  1ZHI A;  2LNH B;  4ZGE B;  2NLU A;  4IIM A;  2OTL Q;  4K11 A;  2J05 A;  3LH5 A;  3EG9 B;  3VS2 A;  4JZ3 A;  3U23 A;  2ZZD A;  3DLL A;  1OZ3 A;  4QVD A;  1AZG B;  2JTM A;  3G1J A;  2RMO A;  3OS5 A;  2OX7 A;  2E5Q A;  2DYB A;  2JM9 A;  3WXM B;  3VS6 A;  4Y28 E;  3QYH B;  1I8F A;  1T3L A;  4C0D B;  1Q81 C;  1AZE A;  1PSF A;  3VYH B;  1WLP B;  4HT9 A;  3WVD B;  5L8R E;  1WA7 A;  2RM4 A;  1OX8 A;  1X01 A;  1JBM A;  5KYU B;  1RL2 A;  4M7A G;  4EMK B;  2KEA A;  1YHQ T;  1PRM C;  4RTX A;  3ZFJ A;  3JB9 I;  1Q86 U;  3A8M B;  2HSE B;  1U06 A;  2Y4X A;  4A54 A;  2GF7 A;  2KBT A;  4M7D A;  2RQU A;  3S3O A;  2QXF A;  5I22 A;  1M3B A;  3M0U A;  5ECA A;  3V7S A;  2DRK A;  2R58 A;  4Z88 A;  5GAO n;  4PJO C;  2HAX A;  4L59 A;  2V1Q A;  2COY A;  4II1 A;  3LGF A;  2LCC A;  3CCJ T;  2QA4 T;  1M3A A;  1QCO A;  3GF5 A;  4J9I A;  4C92 D;  4M75 G;  5GJV B;  4M4Z A;  1VQM A;  3R6N A;  4PLL A;  2EKO A;  5IN1 A;  1SSH A;  3BDU A;  1R0B G;  2DYI A;  1VQL A;  1QCF A;  1VQ6 T;  1PRL C;  2RJC A;  4HA8 A;  1UHF A;  1V76 A;  1VQ9 Q;  4R55 A;  7AT1 B;  3QWX X;  2YUP A;  4RTV A;  1KQS S;  4OML A;  4F7U A;  3G4S Q;  1YIJ Q;  4XU3 A;  3A8H B;  4EPC A;  2PQW A;  3QSU A;  2VYT A;  2WAC A;  2ZPG B;  1AD5 A;  1Y96 B;  5FU6 B;  1QVG A;  1QP2 A;  4QW2 A;  2JS2 A;  5IXF A;  1M90 U;  2EJG A;  5FU7 C;  1QCN A;  5CK9 A;  5GMK m;  1YHQ Q;  3VS1 A;  4HVU A;  2ED0 A;  2HQH A;  4PK4 A;  1YCY A;  2K79 A;  1N8R C;  4M78 C;  3OYE A;  4Z89 A;  2K5I A;  5IH2 A;  4E7S A;  2LT1 A;  2RQW A;  3TCJ A;  4KGZ B;  2HNI A;  2C0I A;  1NPP A;  4M7A B;  3I56 A;  2JTE A;  1BI3 A;  1DJ7 B;  1U3O A;  2E1H A;  5GAN f;  3EG3 A;  4KGV B;  4M77 A;  4N4H A;  4C92 B;  1WJQ A;  3X26 B;  4M7A A;  2ZPB B;  3A98 A;  1HSQ A;  3JCM e;  5GAN 4;  1Q81 U;  2KVQ G;  2KY9 A;  1D0Z A;  2A08 A;  3REA B;  2JVV A;  2AK5 A;  2HCK A;  1YIJ T;  1Y57 A;  3PMI A;  2DXU A;  3OYG A;  1ZBX A;  5KYY B;  3CC2 T;  3OYC A;  2DL4 A;  4IUV A;  2FB7 A;  2BUD A;  4GLM A;  4JZ4 A;  2JS0 A;  2DBK A;  3CCS Q;  4PJO G;  1HK9 A;  5FU7 B;  3VUZ A;  3S3N A;  2KDS A;  1E7O A;  1QVG P;  1JJ2 S;  2L3S A;  3RUX A;  3VKI A;  3OMG A;  1YFN A;  2ESW A;  1SG5 A;  2LTO A;  2XIC A;  4QQG A;  1X75 C;  4BD3 A;  4FT4 A;  2K2M A;  4A63 B;  2EGC A;  2O9S A;  1NJI C;  1JEG A;  3CPF A;  3HP9 A;  1GXI E;  1I4K 1;  1WJS A;  3OS2 A;  3V8K A;  1RI0 A;  3CCQ T;  1QP3 A;  1N27 A;  3Q1J A;  1WX6 A;  3SWN C;  4JDS A;  2FEI A;  2DJZ A;  2QI2 A;  4FSS A;  1UGP B;  3CXC P;  2DZ9 A;  4OP0 A;  2K5F A;  3CME T;  3ZBD A;  1BU1 A;  3JB9 F;  1WPY A;  1X27 A;  5L23 A;  5J39 A;  2E65 A;  5HY6 A;  1K76 A;  1C0M A;  1JU5 C;  1MMN A;  3JCM f;  2WSF E;  1QKX A;  4M77 D;  1IXD A;  4R0K A;  1AWX A;  2QGF B;  3WVE B;  1KQ1 A;  4PJJ A;  3CC2 Q;  5KH6 A;  1KQ2 A;  1M8V A;  2O01 E;  2DMO A;  2CRE A;  2J6F A;  4AG2 C;  1YWO A;  2EYZ A;  3J80 E;  3C95 A;  4M7D G;  1M5Q 1;  1D1B A;  2EYY A;  4N4G A;  2QA4 Q;  4LUD A;  1LCK A;  3OYL A;  1UG1 A;  4GBQ A;  1HXD A;  4V2S A;  1JRI A;  2LQN A;  4L5G A;  4C0D C;  5KE2 A;  4XK8 E;  1OV3 A;  3EFO A;  1UDL A;  4M7A E;  1KQS P;  5I21 A;  2RN8 A;  3CPW S;  1RUW A;  3CC7 T;  4ELY C;  2P4R A;  2XDD A;  1IHV A;  4E7J A;  3EG9 A;  1PHT A;  3EGX B;  2YRV A;  3CC2 A;  3UDC A;  2M16 A;  3I5R A;  3BW1 A;  1K1Z A;  3OY9 A;  2K6D A;  1KD1 C;  4HCC A;  1G83 A;  3QO3 A;  2KK4 A;  2F1L A;  1UFF A;  2ZAE A;  3CMA T;  1ABQ A;  1OEB A;  2X51 A;  5EC7 A;  1PNJ A;  3EG1 A;  2PVD B;  2L0A A;  3X20 B;  4A53 A;  3HSB A;  1MV0 B;  4RMO A;  2XMF A;  4D8D A;  2JZ2 A;  4IIO A;  2JMA A;  8ATC B;  1VQK A;  3JB9 H;  4OGE A;  1WYX A;  1WNL A;  4AFZ C;  2DTO A;  1ZX6 A;  3EFS A;  4DOW A;  1UEB A;  3MEA A;  3OYF A;  2XI9 A;  3EAE A;  1B34 B;  1SSF A;  4C8Q G;  1Q82 C;  3BY7 A;  2EJF A;  3ULR B;  5GMK e;  1Q82 R;  3A8G B;  5GAM f;  4R56 A;  1O9S A;  1X43 A;  1BYM A;  2IG0 A;  4M78 E;  5D6X A;  3JCM P;  1YWP A;  1WHK A;  1MUZ A;  4PFO A;  1SRM A; 
#chains in the Genus database with same CATH homology
 3NTI A;  3M9Q A;  4C5G A;  5FRN A;  4J83 A;  2RJD A;  1K73 U;  4C8Q C;  3MET A;  4XU0 A;  3I56 T;  3HRS A;  4C92 C;  4BE1 A;  3JAM E;  4MZP A;  5CKD A;  3OYB A;  1M9S A;  2RHY A;  4FM4 B;  4LDW A;  2XDP A;  4JRK A;  3RKW A;  5C6S A;  5GMK l;  2QEX A;  4M7D E;  3QZ9 B;  1I5L A;  3QZ5 B;  2LQK A;  1M1G A;  1Y71 A;  2KMT A;  1LNX A;  1AHJ B;  1KHI A;  4PJO D;  1D3B B;  1TH7 A;  1NJI U;  2DK3 A;  2D6F A;  1XQH A;  2MMP A;  3LLR A;  4LDY A;  4A4K A;  3H8Z A;  4IUR A;  2CKK A;  3ZEH A;  1B34 A;  3KUF A;  1KC8 C;  3GLX A;  3RKY A;  1R8O B;  2VGN A;  2X35 A;  4JLI A;  1U8R A;  2VC8 A;  4C5H A;  4M7A D;  4JLG A;  3R6O A;  5A0G A;  3T9N A;  3MHX A;  3SB2 A;  2RHU A;  3QG1 A;  5CAI A;  3QKJ A;  3SD4 A;  1VUB A;  3JCM h;  3PIO A;  3P8D A;  4XTU A;  1FX7 A;  1G3T A;  3L2Z A;  2Y90 A;  4GY5 A;  1G3W A;  3PIP A;  1VQ6 A;  4IUQ A;  2E6Z A;  3G7Z A;  1U1S A;  4NOY A;  2FVU A;  2LRQ A;  3C4S A;  4ZTF A;  2PVO B;  3QPH A;  3V8J A;  2DXB A;  5GMK i;  5GAM e;  5A0L A;  3CCE T;  2E70 A;  4BI4 A;  2ZPF B;  2DTI A;  2JTF A;  5CO7 A;  5DM7 R;  3OA6 A;  2RB6 A;  2PUK B;  2AHJ B;  4IUT A;  4OB1 B;  4A4E A;  2CZ0 B;  3QDR B;  5DY9 A;  5GMK h;  3CBM A;  3RMS A;  4OVA A;  3TEE A;  3OYN A;  4JRP A;  2EFI A;  4RG8 A;  3PGG A;  5GMK j;  5GAN 2;  2QDY B;  5AYF A;  4RCC A;  1YIT A;  5GAN e;  3ER0 A;  1VQ5 A;  4ZGJ B;  1IRE B;  4J6Y A;  3LGL A;  3OYA A;  1S72 A;  4OGC A;  2CGH A;  5J3B A;  5GAO m;  4BB7 A;  4FSX A;  3OYY A;  1Y7X A;  2DD4 A;  5LL6 S;  4J7F A;  1WQW A;  2X4Y A;  2BKD N;  3LW5 E;  3OYH A;  2OTJ T;  2JUF A;  2EWN A;  2XDB A;  4QQD A;  3V7R A;  3JB9 G;  3QUI A;  1BKB A;  2BIV A;  3H6Z A;  3PFS A;  3X25 B;  5M9O A;  3JCM W;  2RHI A;  4UC4 A;  5A2Q E;  4OB3 B;  3JCM c;  3CCR T;  4BI3 A;  5DLQ E;  4M77 G;  1M1K U;  1ZHI A;  2CYZ B;  4ZGE B;  3G6E A;  1NZ9 A;  2NLU A;  1VQ9 A;  1QVF S;  4OB2 B;  1ZQ1 A;  4B9W A;  4OF1 A;  1VQ8 T;  4RKU E;  4D6W A;  2GFA A;  2LCL A;  2ZZD A;  3DLL A;  1OZ3 A;  2V8J A;  5HKC A;  3CCM T;  5LJ5 h;  2Y4Y A;  3OS0 A;  4QVD A;  4FU6 A;  2WSC E;  2JTM A;  2HQE A;  1K73 C;  3X28 B;  3MP8 A;  4E7I A;  2V8I A;  3M53 A;  3A8O B;  2YHT A;  4IKF A;  1N6A A;  1MGQ A;  3OS5 A;  4J5Y A;  2P0Q A;  1YI2 A;  2E5Q A;  4JRQ A;  3FIF A;  1K8A U;  1QW1 A;  3WXM B;  4ZGD B;  3CCL A;  4ATO A;  4Y28 E;  5C0M A;  3QYH B;  3GPL A;  1VQ4 A;  1YHQ A;  3MP6 A;  4MZM A;  2E10 A;  2C06 A;  1I8F A;  4X9D A;  4C0D B;  1Q81 C;  1VQ7 T;  3FDR A;  5LJ5 g;  1PSF A;  3VYH B;  1Q82 U;  3MCA B;  4HT9 A;  2F5K A;  4KUI A;  3WVD B;  3CC4 T;  5L8R E;  1Q82 C;  2RM4 A;  2WSE E;  3OQ5 A;  1X01 A;  4PL6 A;  1JBM A;  1RL2 A;  1M1F A;  4E7H A;  4M7A G;  3JCM Q;  2RK2 A;  4EMK B;  3X24 B;  1O75 A;  1QVP A;  5LJ5 d;  1VQ4 T;  1YHQ T;  4XAX B;  3ZFJ A;  3M58 A;  3OW2 A;  3DKM A;  3OB9 A;  4FIB A;  5LJ5 j;  1VQO T;  3BDL A;  3JB9 I;  1G3S A;  3HFO A;  1K9M U;  1W4S A;  3O8V A;  3SFM A;  2QQR A;  4PJO E;  4J6W A;  3GNG A;  1Q86 U;  3A8M B;  4M78 F;  2Y4X A;  4MMK A;  1D3B A;  4M75 A;  4ZN3 A;  5FLX E;  3L2R A;  4JUV A;  2FYK A;  4JS5 A;  4M7A C;  4A54 A;  1LOJ A;  2GF7 A;  1Y07 A;  4F7U E;  4Y91 A;  5CCA A;  3J7A F;  4M7D A;  3UPU A;  5GAN j;  3VV0 A;  2D0Q B;  3S3O A;  2QXF A;  3I55 T;  2R5A A;  5FU6 C;  2M9U A;  2QQS A;  3OW2 S;  3V7S A;  1BI0 A;  1V29 B;  2H3J A;  2JOY A;  2R58 A;  5CVI A;  5GAO n;  3LWH A;  2HAX A;  4PJO C;  4L59 A;  2P4T A;  3AHU A;  4EMK A;  3NFC A;  4LDV A;  4M75 D;  4X9C A;  2D9T A;  3DB4 A;  1VQN T;  4II1 A;  3LGF A;  2LCC A;  3OSS C;  5GAN 3;  3CCJ T;  4J7I A;  2QA4 T;  5GAN 8;  5GAN g;  4C8Q B;  4ZN1 A;  1YJ9 T;  2OTJ A;  3FB9 A;  3HRU A;  3GF5 A;  1XOV A;  4C92 D;  4M75 G;  5KCO A;  2MF2 A;  2HQX A;  3E19 A;  1VQM A;  4GLK A;  3CBO A;  4PLL A;  2EKO A;  5FRM A;  2X4X A;  5IN1 A;  2VXF A;  3BDU A;  3QJ6 A;  3E9F A;  1VQL A;  1VQ6 T;  2RJC A;  4HA8 A;  4JS4 A;  3PMT A;  1YJW T;  4M77 F;  3CPW A;  2EQK A;  1EIF A;  5GAO p;  3GP8 A;  2IVW A;  2R57 A;  2RI2 A;  4R55 A;  2X4J A;  3L1A A;  4M77 C;  3QBY A;  1UGS B;  4M75 E;  3LWI A;  4LD9 K;  1KQS S;  2EAY A;  2QQ9 A;  5D6Y A;  4F7U A;  2DXT A;  3OSV A;  5HK0 A;  4XU3 A;  3A8H B;  4IUP A;  3MEW A;  4BY6 C;  1JB0 E;  4EPC A;  2PQW A;  4B9X A;  2M0O A;  3OYK A;  3PNW C;  2LNV A;  3QSU A;  1XTD A;  2VYT A;  2DZC A;  3RKX A;  3GNF B;  2WAC A;  2O4X A;  2ZPG B;  5FU6 B;  1Y96 B;  1QVG A;  4M75 B;  1QP2 A;  5DLO A;  5CR2 A;  3FC3 A;  4QW2 A;  3NTK A;  1M90 U;  4OB0 B;  2EJG A;  2L5Q A;  2MI6 A;  4MZT A;  5FU7 C;  3QYG B;  1KQS A;  1UGR B;  3E9G A;  4NL2 A;  5CK9 A;  4NS5 A;  5GMK m;  5LJ3 e;  2KSS A;  3CCU T;  1H64 1;  2RO0 A;  4KT0 E;  3CCV T;  1VQ9 T;  3A5Z B;  2RJF A;  5GAN 7;  4PLI A;  4QVZ A;  5KE3 A;  2MWO A;  2OAU A;  4BE0 A;  4HCZ A;  1YCY A;  2RJE A;  3HKS A;  2QEX T;  4E7K A;  1KG1 A;  1P92 A;  2FL7 A;  1BIA A;  3CCM A;  3OBY A;  4M7A F;  2DTH A;  3SDZ A;  1YIT T;  1N8R C;  4M78 C;  3L2U A;  3SWN B;  2K4Y A;  5EG2 A;  3OYE A;  2K5I A;  2LQ8 A;  4Q5W A;  1S72 T;  5GAN h;  2LT1 A;  3QHS A;  3TCJ A;  2K3X A;  1K9M C;  5FRO A;  2HNI A;  2P0P A;  1NPP A;  2A7Y A;  4VUB A;  1IZ6 A;  4M7A B;  4M7D B;  2PU9 B;  1FWZ A;  4KUL A;  3I56 A;  2DAQ A;  3CEY A;  4C5E A;  5I2M A;  1BI3 A;  3FEO A;  1DJ7 B;  4JRI A;  3S3M A;  2O4X B;  1QVG S;  1JJ2 A;  2DPP B;  4O6J A;  4BDZ A;  2E1H A;  3V7C A;  5GAN f;  2EQM A;  4KUD K;  4XTY A;  4O5V A;  2K57 A;  4M77 A;  4N4H A;  3JCM V;  4C92 B;  4M7D D;  1WJQ A;  3MO8 A;  1NPR A;  4EMK C;  3X26 B;  2DIQ A;  4M7A A;  2ZPB B;  2RD1 A;  3RER A;  1NE8 A;  2HBP A;  3JCM e;  1KC8 U;  5GAN 4;  4C5I A;  5HK3 A;  3JSC A;  3M56 A;  3INZ A;  2LX9 A;  5CKB A;  1Q81 U;  1VQ5 T;  2KVQ G;  2KY9 A;  2DKG A;  4C8Q F;  4C0G A;  4L6V 5;  1XNI A;  2MAM A;  3F70 A;  3ME9 A;  5D6W A;  2JVV A;  2P0K A;  4C92 F;  2XKO C;  5GAM h;  5GAO l;  1W2B S;  3CD6 A;  2DEQ A;  4PJO A;  2GFU A;  1YIJ T;  4P5N A;  4E7L A;  3E1S A;  1WQ7 A;  1YJN A;  2PUO B;  3PMI A;  2DXU A;  2CZ1 B;  3OYG A;  2VV5 A;  1ZBX A;  1YBY A;  4LDX A;  3CC2 T;  3OYC A;  1Q86 C;  3CCE A;  4IUV A;  4MML A;  1Q7Y C;  4C92 E;  2FB7 A;  1UGQ B;  2BUD A;  2HD0 A;  2JNG A;  4N4I A;  3JB9 D;  4HT8 A;  1W2B A;  3LYI A;  1YIJ A;  3JCM J;  3QXE B;  3URG A;  3OYD A;  4M7D C;  2XU8 A;  3HHT B;  4PJO G;  1HK9 A;  5FU7 B;  3VUZ A;  2DVE A;  2KDS A;  3RMQ A;  5LJ5 f;  3S3N A;  4HCB A;  5LJ3 j;  3CCR A;  3HRT A;  1JJ2 S;  1VQP T;  1UB4 A;  4EMG A;  3GIB A;  2ZPE B;  2V8K A;  2ZPI B;  4F7U G;  3TRE A;  3RUX A;  4EMH A;  3PTA A;  3VKI A;  1MHN A;  3OMG A;  2LTO A;  2F5T X;  2XIC A;  1YJW A;  1M90 C;  4QQG A;  1X75 C;  1VQK T;  5CQY A;  4BD3 A;  2LVM A;  4FT4 A;  5CKH A;  4OMF B;  5IAY A;  5LJ3 g;  3OMC A;  5GAN d;  1FXX A;  3JRZ A;  1NJI C;  2CZ7 B;  3L42 A;  4CRI A;  3M5A A;  1N9S A;  1KD1 U;  3CPF A;  2QQA A;  3HP9 A;  4JJN K;  1GXI E;  3P8H A;  1I4K 1;  1WJS A;  2E6N A;  1YI2 T;  5CIU A;  2ZCF B;  4MDX A;  3ASK A;  3OS2 A;  2RA2 A;  3V8K A;  1RI0 A;  3JCM X;  4ME7 A;  1VQN A;  3CCQ T;  1QP3 A;  5GAN 5;  4EDU A;  1N27 A;  3Q1J A;  2QA4 A;  1KHC A;  3SWN C;  3CME A;  2FHD A;  1N8R U;  2EIF A;  4N0A A;  3N5B B;  3RES A;  2VGM A;  2VXE A;  4JDS A;  4C0F A;  3BFM A;  2QI2 A;  2DJZ A;  4XTZ A;  3CCQ A;  1UGP B;  2DO3 A;  1BIB A;  2M1H A;  4C8Q A;  4BDY A;  3CC4 A;  2DZ9 A;  3G4S A;  4RCB A;  2R5M A;  3L2W A;  2EYQ A;  1Y96 A;  3DLM A;  4OP0 A;  1G3Y A;  3OYM A;  4M78 A;  1X6O A;  2K5F A;  3PT9 A;  3CME T;  2RHX A;  3ZBD A;  2EJ9 A;  3JB9 F;  3M55 A;  1WPY A;  3UT1 A;  3V8L A;  4XU1 A;  2L3R A;  4LD6 A;  4M77 B;  5J39 A;  5J26 A;  3G71 A;  2E65 A;  5HY6 A;  4DQ2 A;  3CBP A;  2XG8 D;  1I81 A;  4LDU A;  4YTL A;  4M78 D;  1VQ7 A;  2XK0 A;  4DA4 A;  4Z02 A;  3JCM g;  2OTL T;  3JCM f;  2WSF E;  4QVC A;  3CXC S;  4M77 D;  3I55 A;  3OBW A;  3WVE B;  1KQ1 A;  4TVR A;  3KXT A;  2K5L A;  4QQ6 A;  3LH0 A;  4NL3 A;  1KQ2 A;  5KH6 A;  1WJR A;  1M8V A;  2RHZ A;  4A4H A;  2L8D A;  2O01 E;  3HL8 A;  2MWP A;  3J81 E;  2EQJ A;  3CD6 T;  2LT4 A;  1VQO A;  4J8O A;  4XTX A;  3CCJ A;  3M54 A;  5CKE A;  3J80 E;  3C95 A;  4M7D G;  1M5Q 1;  5I2S A;  3CCS T;  1BI2 A;  2GCX A;  4N4G A;  2I2L A;  3RIR A;  4A4F A;  3JCM d;  4ZTJ A;  3FJP A;  4M7D F;  2E12 A;  2QTX A;  3OYL A;  1M1K C;  2CS7 A;  1HXD A;  1PSE A;  4V2S A;  1JRI A;  3MP1 A;  4L5G A;  4C0D C;  4ELZ C;  3CC7 A;  5KE2 A;  4XK8 E;  1VIE A;  2E64 A;  4J6X A;  3L2V A;  4M77 E;  3M57 A;  4PNO A;  3C12 A;  4M7A E;  1H3Z A;  4IUU A;  4F7U B;  5I21 A;  3CPW S;  4PKC C;  2XD0 A;  3CCL T;  4FT2 A;  3OS1 A;  4M78 B;  2YLB A;  2XHC A;  3CC7 T;  4BY6 B;  4ELY C;  1M4Z A;  3SWN A;  3HFN A;  1YJ9 A;  2XDD A;  4PJO B;  4E7J A;  4CI0 C;  1QVF A;  4FL6 A;  5LJ3 f;  3CMA A;  1N9R A;  2X4W A;  2YRV A;  2KAF A;  3CC2 A;  3UDC A;  2M16 A;  3OYJ A;  4F7U F;  2F69 A;  3BW1 A;  3CCU A;  5GAM d;  1VQ8 A;  3DB3 A;  4MDW A;  3EFR A;  3OY9 A;  3GOX A;  1YJN T;  1KD1 C;  4HCC A;  2VUB A;  2DIG A;  1OYX A;  4A4G A;  3MEV A;  4PJO F;  3QO3 A;  5GAN 6;  3L2Q A;  2KK4 A;  5LJ3 d;  5CKF A;  3A8L B;  2G3R A;  3CMA T;  4C92 A;  4BE2 A;  4M75 C;  3VYG A;  2RK1 A;  4XQ3 A;  2LDM A;  4XU2 A;  4XTV A;  2A3L A;  4M75 F;  2DD5 A;  2PVD B;  5IT9 E;  2L89 A;  5GAM g;  1Q7Y U;  4A53 A;  3X20 B;  1U1T A;  1VIF A;  2PVG B;  2RI5 A;  5A0D A;  3HSB A;  1WGS A;  2E41 A;  4N0A C;  2ZPH B;  5CQX A;  2K2V A;  4BAC A;  4RMO A;  2RI3 A;  1BI1 A;  2RH2 A;  5GAO r;  2JZ2 A;  4C92 G;  2YLC A;  1VQM T;  1VQK A;  3C94 A;  3M4G A;  4WF2 A;  4XTW A;  3VUB A;  4BI8 B;  2KQW A;  5GAM j;  3G6E T;  2OTL A;  4OGE A;  3JB9 H;  1VQL T;  1WNL A;  2JN0 A;  1K8A C;  2DTO A;  2QQB A;  3EFS A;  3NTH A;  4DOV A;  2B8A A;  4DOW A;  3CXC A;  5LJ3 h;  1G5V A;  3LX7 A;  3S6W A;  3HPW A;  2LC4 A;  4M78 G;  2GQV A;  1UEB A;  3MEA A;  4E47 A;  3FRN A;  3OYF A;  3CCV A;  2ZGW A;  2XI9 A;  2CZ6 B;  3EAE A;  3VJP A;  1SSF A;  1B34 B;  4C8Q G;  5LJ5 e;  3OYI A;  3BY7 A;  2EJF A;  3UWN A;  3FLG A;  5GMK e;  3G4S T;  1VQP A;  2DXC A;  3CCS A;  3A8G B;  5GAO q;  5KCH A;  4HKE A;  4C0Z A;  5GAM f;  4R56 A;  3QII A;  1LJO A;  3M4Y A;  3QJY A;  4BUG A;  3M59 A;  2EQU A;  3P8B B;  4C8Q D;  4RG2 A;  4C8Q E;  1O9S A;  3JB9 J;  1BYM A;  3G71 T;  3TU4 K;  2XID A;  1OI1 A;  2IG0 A;  4M78 E;  3VU3 C;  5D6X A;  3KBG A;  3JCM P;  3JCM b;  4X34 A;  3MEU A;  2K3Y A;  4KBM B;  1OZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...