4ELYC

Ccdbvfi:gyra14ec
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
98
Chain Sequence
SQFTLYKNKDKSSAKTYPYFVDVQSDLLDNLNTRLVIPLTPIEPSHLCPTIHIDEGDFIMLTQQMTSVPVKILSEPVNELSTFRNEIIAAIDFLITGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit A
publication title Alternative interactions define gyrase specificity in the CcdB family.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Toxin/isomerase
total genus 28
structure length 98
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4elyC00
4MZPA 5CR2A 1M1FA 5CKEA 3JRZA 5HK3A 5CQXA 5CKBA 5CO7A 5CCAA 5CKFA 1NE8A 1X75C 1VUBA 4MZTA 3VUBA 5CK9A 3HPWA 4OF1A 2MF2A 4ME7A 2KMTA 4VUBA 5DLOA 3NFCA 3JSCA 5HK0A 3TCJA 5CKDA 4ELZC 4HKEA 5CQYA 4MZMA 2VUBA 5CKHA 1UB4A 4ELYC 5HKCA 2C06A 3G7ZA 4MDXA
chains in the Genus database with same CATH superfamily
1W2BA 2LT1A 1K1ZA 2GTOA 1WJQA 5LJ5d 3NMZC 5KH6A 1ZBXA 8AT1B 4QVZA 1MUZA 3FLGA 2KXDA 3SB2A 4M75D 4X9DA 2V1QA 3HFOA 4C5GA 3C95A 4X1VA 3E9FA 3CC2A 1HXDA 2LC4A 1M2VB 2PU9B 1VQ4Q 2Y90A 3JCMg 3FC3A 2A37A 2K79A 1QCOA 4EDUA 1QVFP 4AMCA 4LE9A 4KGVB 2CZ1B 2MMPA 1JJ2A 1BIBA 1KIKA 2RHYA 2RH2A 1YCSB 1R77A 2NWMA 1K9MU 1KSWA 2OJ2A 3G4SQ 2L5QA 4XTWA 3G6EQ 4DBQA 5GAOp 1YJNQ 2LJ3A 3WVDB 4J9HA 1VYUA 1UHFA 5LL6S 1MNDA 1O75A 1PSFA 1OULA 3I56T 2XKOC 2O2OA 2RQUA 3L1AA 3CD6A 3M9QA 5IHIA 4D8DA 2XHCA 4XU3A 1M2VA 7AT1B 5A0LA 2CT4A 5GAOr 4ZN3A 4EMHA 4ZGJB 3UPUA 2D8HA 5GMKl 5FRMA 1YITA 4PL6A 2DIGA 1UGVA 4PJOB 4FT4A 2COZA 4PJOC 1FX7A 1Y0MA 2HEQA 4HKEA 3OYIA 2GTJA 2KEAA 4LNPA 3BY7A 3MP8A 1W2BS 4OMLA 1KC8C 3TSZA 3DLMA 3UF4A 4RCBA 2D8JA 5GANg 3LWHA 3JB9H 4ATOA 1RAFB 2VVKA 5KYXB 1VYTA 2EYQA 4ORZA 1PRMC 5GANj 1CKAA 4M7AE 3DB4A 1VQ6Q 1VQPT 4CC2A 1BCOA 1I5OB 1D0YA 4RTXA 3JCMe 1UJ0A 2D1XA 3OYMA 3QHSA 3BFMA 3RKYA 2E70A 1W4SA 1NJIU 3EG2A 1Z9ZA 1RABB 4M77F 1BI1A 4C92F 1MMDA 4PJOA 1W70A 1VQ9Q 2RN8A 5LJ5f 5GAOm 1N9SA 2LJ1A 3X24B 2OTLQ 2RM4A 3GIBA 4RMOA 1UJYA 1Y57A 5HY6A 1S72T 2V8IA 3MCAB 1AT1B 2BKDN 1Q81R 2D6FA 1PKSA 1QWFA 3QBYA 3RUXA 5AYFA 5KYXA 4BE0A 3I56A 4HT8A 1NLPC 2YUOA 4IIOA 4J9DA 1SG5A 3CMEQ 1UGPB 3EGUA 2ED0A 2CP7A 2FZCB 4M7DG 2MYSA 4CC3A 3M4YA 2X4XA 5IAYA 2LNHB 1T3LA 3CXCA 1AWJA 3M0QA 4JUVA 5DM7R 2EGEA 2LCLA 1E6GA 4MZPA 2VWFA 3E9GA 3GF5A 4ZGDB 2GFUA 5KYUB 5I2SA 2M16A 2B8AA 5GANe 2JT4A 2EJGA 2QAZA 2X4JA 2AKLA 2DXBA 2RD1A 4PFZA 1TUGB 2CP0A 4QQ6A 2JXBA 3JCMc 1KC8R 2QEXT 2RQTA 2BZYA 2MPXC 2LRQA 5LJ3h 4DBRA 1WXTA 1M3BA 5D6XA 1OYXA 1WQ7A 2LQ8A 4E7ZA 2JM9A 2LP5A 2KVQG 1XJWB 4M75E 3EG1A 3GOXA 3JCMJ 4RG2A 4HCZA 4PJNA 4E7JA 4OMFB 1D1BA 4A4FA 3EGXB 1M90R 3UWNA 3OMCA 3J80E 2QYZA 3MEWA 4A53A 3EGDB 3OYLA 4JLGA 4XU0A 1VQOT 3OYDA 3JCMh 2QA4T 5CK9A 4J9BA 2X3XD 2EPDA 2QGGA 4LDYA 5GAN5 2J6OA 5CKDA 2RJDA 3ME9A 2ZCFB 1S72A 4P5NA 2DE0X 1W2BP 3AHUA 3NGPA 2F2XA 3QIIA 1QCFA 2RO0A 2HL3A 3QSUA 1MHNA 3RR6A 3OYKA 3OSVA 4K11A 1WHJA 4OGCA 4J8OA 1VIEA 1R0BG 1KD1U 2DRMA 2F2WA 4R55A 1G3WA 3FJPA 2JS2A 3ZL7C 2JM8A 2WSFE 3X25B 1K4US 1N8RC 3EGXA 4LDVA 4E2FB 4EMGA 3GNGA 3CXCS 3CCLQ 4FW2A 4D6WA 1B34A 3PT9A 3EG0A 1KFZA 1GFDA 1JJ2P 2F5KA 3EGDA 3UT1A 2CUDA 4Y91A 3JB9G 3A8GB 3HP9A 2D9TA 1C6VX 3MP1A 1V76A 4AG2C 4J9FA 4LN2A 3NTIA 5C0MA 4EMKB 2QQ9A 3JCMd 4J5YA 1KG1A 3PE0A 1VQ5T 2DEQA 2PQWA 2O9SA 3H0FA 2M0OA 4RTTA 2QEXA 2PUKB 2OAUA 1WXUA 3PIOA 2K57A 1UE9A 3OYCA 3DLLA 1MMGA 4HA8A 2DLPA 4LD9K 3PGGA 3M0TA 2RHUA 2KDSA 2K2VA 3D7SB 2BE9B 2R57A 1SRMA 5GANh 3VS0A 2QK0A 1TWBA 2YT6A 5KYWB 4E6RA 3LH5A 4IUVA 2YLBA 1RACB 4J83A 4M78F 2DL4A 2EAYA 2V8JA 1NE8A 4OB2B 2HAXA 3EHQA 4DEYA 1WHHA 1CSKA 1M5Q1 3RKWA 3QDRB 2A3LA 1VQOA 4M7AC 4C8QF 2GGRA 1NEBA 2LQKA 5KYNA 1P92A 1HYOA 4PLIA 3CEYA 3O5ZA 1B7TA 1VQ8T 3FIFA 4PJOE 2MCNA 1UGQB 2DERA 4M77D 1YJWQ 4C92D 2K5LA 1VQLQ 2H3EB 3WXMB 4JZ4A 1N9RA 4Z88A 2K3XA 1HJDA 4HVWA 1SSFA 3QJ6A 1ABOA 2ZZDA 4OMOA 1K73R 3CCRQ 1Q86R 3JCMQ 3OY9A 5GAN3 2MIOA 3AT1B 2MI6A 4ZN1A 1OU9A 5GANd 3CCST 4F17A 4DA4A 3ASKA 5FU6B 3QWYA 5FU6C 1WFWA 2E12A 1JO8A 3P8DA 1R0CB 3JB9I 1JQQA 4NL2A 2R58A 2QQBA 4M7AA 2EW3A 3CCMT 2QASA 4LDUA 2LTOA 1NM7A 4M7DF 1YHQT 3A8LB 2VKNA 2FZKB 5A0DA 2VXEA 2SRCA 2BZXA 1PG5B 2IG0A 3OYNA 1VQ5A 5FWBA 1SRLA 4HCBA 2KE9A 2GNCA 8ATCB 2PUOB 4MMKA 2P0PA 3TCJA 4R56A 5D7UA 3MEUA 1G3SA 1M3AA 2KT1A 4FM4B 3I5RA 1MMAA 2HZYA 3ER0A 1AOJA 1U1SA 1K9AA 2LCCA 4IUPA 4OB0B 2CKKA 1Y71A 5GAMh 2KYMA 3CC4T 3JCMf 3MEVA 1BU1A 5DLOA 2DJZA 1YWPA 4DQ2A 4LUEA 3CXCP 1K8AU 1YJ9T 1M30A 4PFOA 1AEYA 1M1FA 1VQMQ 1X69A 5CKFA 5KCOA 4MZTA 1BIAA 2Y4YA 4JJBA 1PCXA 3HL8A 2EYYA 1NG2A 3ZEHA 2DL7A 4J7FA 3OYHA 1ZUKA 2F2VA 2FB7A 1RLPC 2BE7D 2L8DA 3CCEQ 2K7AA 4QVCA 2RMOA 4N0AC 4A54A 4KULA 4XTUA 4XTYA 3JCMP 1PWTA 1VQ6A 2RI2A 1I0CA 1W6XA 5CQXA 5GAOl 3QWXX 1H3HA 5I11A 4O6JA 1ACMB 2HQEA 1U1TA 1G3YA 3QZ9B 3CCSA 4F7UB 3CCQT 1OZ2A 5A0GA 2K4YA 2L3PA 4EPCA 2E3HA 1ABQA 3V7CA 5LJ3g 1VQNT 4M78B 1H641 4M78C 4OGEA 1WGSA 1I5LA 2VGMA 2A7YA 3CCMA 2OI3A 5LJ3j 4N4HA 2OTJT 1JBMA 4RTWA 2QA4Q 1YHQA 3BW1A 1RAHB 1JU5C 2LDMA 3X20B 1AWOA 4C8QB 3H6ZA 2A0FB 3OBWA 1X6GA 3JB9F 4C8QC 1ZX6A 5GANf 5FLXE 2G3RA 2C0IA 1LJOA 4N0AA 1IGQA 1YIJT 1RAEB 2DTIA 2COWA 4B6MA 2JS0A 1ZA2B 3FB9A 1Q7YC 2VC8A 1X6OA 1KQSA 2GCXA 2L2PA 3PNWC 4RTYA 4F7UA 1C0MA 2DFUA 1MGQA 1R8OB 3CC7Q 3M58A 3CC4A 3PMTA 4II1A 1BI3A 3PFSA 3J81E 4KH0B 3V8KA 1Q81C 4ZGEB 4C0DB 5CCAA 2YRDA 3LW5E 4C0DC 4DOVA 1KC8U 1YJ9A 3OYEA 2XDDA 3UDCA 1M2OA 2GQIA 2Z0WA 4E7KA 3L2WA 4J6XA 4M78D 1FWZA 2MWOA 3L2VA 4C8QA 1BI0A 4PLLA 4BACA 2YWWA 2NYSA 1GCPA 1KHCA 2CT3A 1TXQA 4GLMA 4JRPA 3X26B 5CKHA 4KUIA 2QXFA 2KXCA 1N6AA 1E7OA 2FPFA 2O88A 4C8QD 4JS5A 1X2QA 1M8VA 3SEMA 3URGA 4FYWB 4ME7A 4Z8AA 2HSPA 1WLPB 4DBFA 2ATCB 3CPWA 1W1FA 2XICA 3H41A 1X6BA 5LJ3e 4M75G 2DBKA 3CCUT 2W0ZA 2O01E 2IVWA 2I2LA 4C5IA 3CCQA 3RERA 1X01A 4MMLA 2KRNA 3LGLA 5M9OA 2HBWA 2C0TA 4JZ3A 2CP6A 2DYBA 3UA6A 1VQNA 1GBQA 3NFCA 4AT1B 2OAWA 1WIEA 2QQAA 2A08A 4C5HA 1OPLA 1WHLA 2OTJA 2AZSA 1AHJB 2D0QB 2HL5C 1JXOA 3CCVQ 1SKUB 2DILA 2OX7A 4OP0A 2O31A 2AT1B 3G71T 1NPRA 1M90C 2PVOB 4LDXA 1ZQ1A 1KQSS 2VB6A 3VS4A 3JCMX 2HQXA 2D0NA 4KUDK 1YIJA 2HD0A 2MWPA 1JJ2S 1QMCA 4PJJA 3EFSA 1Q7YR 2KNBB 1M1KR 2C06A 2KI7A 1TTHB 4J7IA 4QQDA 4C0FA 4XQ3A 2KGTA 3M55A 3PMIA 2ECZA 5GAN2 1UG1A 1YP5A 3MJXA 1D1CA 3OW2A 2E3IA 2YUNA 4L6V5 4KGZB 1PD1A 2M02A 3LGFA 4BD3A 2MAMA 1GL5A 2ZPBB 2E6NA 3A8HB 2YSQA 1Z9QA 1BK2A 5L8RE 1X75C 4DBHA 1KJWA 3CMAT 4E7SA 3CC2Q 4OMMA 1TS9A 4BE1A 3IQLA 2QDLA 2EQJA 1TOVA 2RK1A 1YI2T 2RI3A 1VQ7T 1WHKA 3I55T 2P0QA 3CCUA 1O9SA 2LZ6B 3OMGA 1D0XA 1PD0A 2CGHA 1GRIA 1QP3A 5FWCA 2J06A 1NZ9A 2CH4W 3META 3FDRA 1N5ZA 2ROLA 1WX6A 4FYYB 2RQRA 4JJDA 2EFIA 4QT7A 1K9MR 4OMQA 3V7RA 5DY9A 2K9GA 4ELYC 3JRZA 5GAMg 3CD6Q 1GBRA 4BI4A 4PJOG 3MHXA 3V7SA 1K73U 1MV0B 1OPKA 3MO8A 3G71A 3TVTA 5GAMj 1M27C 2FEIA 4UC4A 3S6WA 1N8RU 1LCKA 4PKCC 2CS7A 4L5GA 2YXYA 2K2MA 1Y07A 3JB9D 1YITQ 2KK4A 3OW2S 1PM3A 3KFVA 2P0KA 5KYUA 3WVEB 4A4HA 4NOYA 2DD5A 3CCJT 2ROTA 2VGNA 3OB9A 2KR3A 3M54A 3PVQA 4F7UE 1NBEB 1PSEA 5CVIA 4DEXA 3I5SA 4M78E 2QQRA 1OV3A 1OX8A 2QQSA 2ZPEB 1K73C 3HPWA 1Q86C 5LJ3d 2JVVA 2J05A 4GY5A 4FYXB 4AG1C 1ZUYA 2K3YA 2K5IA 2RQVA 3THKA 5CIUA 2EQUA 3CMAA 4OMNA 4F04B 2KROA 3JCMb 4C8QE 4J6WA 2NUTB 1VQ4T 5GAN8 3JCMW 2XMFA 1KQSP 2JUFA 1VQKA 1YI2A 3J7AF 1VQ7A 2X51A 4PK4A 5D6WA 3I55A 4X34A 2VXFA 2MF2A 2EIFA 4M77B 2XK0A 3H0HA 4M77C 4C92B 3RIRA 2Y4XA 4C92C 3SFMA 2DETA 1U06A 1K76A 1IZ6A 1WNLA 3G4ST 1NJIR 3M56A 3EH1A 4EMKC 1YJNT 4M75F 3G7ZA 3C12A 5J3BA 5GAMe 2HDAA 1YN8A 3OS1A 2LCSA 1SEMA 3OYYA 2E5KA 2WSEE 3QUIA 3I56Q 1WA7A 3GP8A 1ZSGA 2R5AA 5GJWB 2CSQA 4BY6B 1WXBA 2ZPFB 3M4GA 4BY6C 4XTVA 2CDTA 2HNIA 4Q5WA 4LXCA 3NTKA 2NUTA 1XNIA 1ARKA 1U8RA 2HSEB 5DLQE 3VUBA 3OS2A 5FU7B 3CPWP 3M0SA 2RQWA 2L0AA 4XU2A 4M77A 1QKXA 4C92A 4C5EA 1WJSA 3VS1A 1KQ1A 2DVEA 2FO0A 5CQYA 3DKMA 2LX7A 4EMKA 3MEAA 1UDLA 2I0NA 1WPYA 2QTVA 2PZ1A 3SHWA 2CP3A 3CCJA 1LVKA 5I22A 4AFSC 2KQWA 2DXUA 1G8XA 2P84A 4PJLA 1PKTA 4HVUA 1EIFA 1TUCA 2QDYB 4E47A 2EQKA 4JDSA 1VQ6T 2DK3A 2AHJB 1QKWA 2E64A 2YLCA 2H8HA 2DYIA 1VQPQ 5KYWA 4E7IA 2X3WD 1SSHA 1M4ZA 4WCIA 2FPEA 2L3QA 2FL7A 2JTFA 3PTAA 2DVJA 1VQ4A 2VASA 2VV5A 2KMTA 1T3SA 2MK5A 5IHKA 1VQ9T 3M59A 2JZ2A 2P4TA 1U5SA 1UHCA 4OVAA 4LUDA 3OW2P 5CKEA 3VS6A 1VIFA 2DL8A 2PNIA 5LJ3f 3G4SA 3FJ5A 2DKGA 3G6EA 1YJNA 2RJFA 2J6FA 4F14A 1NYFA 2X4YA 1QWEA 1S72Q 1BB9A 1AWWA 2RHZA 4ESRA 3MPUB 4PNOA 1OU8A 3C4SA 2FYKA 2VUBA 2CP2A 3NTHA 4M4ZA 1PC0A 2KAFA 2CZ6B 4L59A 1IREB 1M3CA 3LLRA 2EGCA 3CMET 1BI2A 4IUUA 4IIMA 4JJNK 3VS7A 4HVVA 4PJOF 4GBQA 2LNVA 3M57A 1KD1R 3NHNA 4B9XA 2F1LA 2MOXA 4A4GA 2RHXA 1YWOA 1FMVA 5FROA 2KBTA 3A98A 4JJCA 4QQGA 3U23A 5CO7A 1S1NA 2RF0A 1MMNA 2LT4A 2CUBA 5GAOn 1BYMA 1JEGA 2JMAA 2IPOB 4CC7A 2XDBA 2KT8A 2F5TX 4FSSA 5LJ5h 3FRNA 1VYVA 5C6SA 2QEXQ 2VYTA 1SPKA 2EJ9A 3OYFA 4A4KA 1HSQA 3TQ7P 3Q1JA 2QI2A 2V1RA 4BUGA 2LVMA 1Q82C 2L3RA 4M7AG 3A8OB 1WI7A 1Q7YU 4D8KA 6AT1B 1QVGA 2KRSA 2JN0A 2RI5A 3BDLA 5GAMd 1I8FA 1PHTA 5L23A 1JRIA 2CSIA 2AKKA 1VQ9A 2XDPA 4RKUE 4R0KA 3QYGB 1SHGA 1Q81U 4BI8B 2LQWA 5GMKi 1VQOQ 1XOVA 3OBYA 4FT2A 2OTLA 4XAXB 1I4K1 1BCMA 4ZNXA 2E65A 3EFRA 4ZTJA 2YHTA 3QXEB 3VU3C 1UUEA 1OZ3A 4AFQC 2DMOA 1QVPA 1G3TA 1AD5A 4J9CA 4PJMA 1V1CA 3REAB 3HRSA 4MDXA 3OYAA 1IB8A 4A4EA 2DXCA 4HCCA 2EQIA 1X43A 1M1KC 2DXTA 3CMEA 4J9GA 2EKHA 3CCLT 3QG1A 4RG8A 2DRKA 1HK9A 4Z02A 3S3MA 2FPDA 3QJYA 4M78A 5CR2A 2EYWA 5FRNA 3VUZA 3OS0A 1MNEA 3R6NA 1G5VA 1IHVA 5J26A 2DA9A 3JSCA 3EAEA 1HD3A 1H92A 4LDWA 1EFNA 4CRIA 4Y28E 4M77E 1WJRA 4KGXB 2DTHA 3M0PA 4C92E 2HBPA 5IT9E 4M7DB 1VQ5Q 4M7DC 3VKIA 3RMSA 4JRQA 3QZ5B 1Y7XA 3OSSC 4XTXA 4XTZA 3GPLA 1AZEA 3H0IA 5KE2A 4HT9A 2FHDA 1M90U 5I21A 5GMKj 3V8JA 2DO3A 2R5MA 4E7LA 5IHNA 1QVGS 4HXJA 1OQKA 1VOMA 1SF9A 1Q82R 4JPBW 3LWIA 1CKBA 1D1AA 3L2ZA 2FG0A 4FCYA 1YBYA 3RKXA 1FMKA 4RUGA 5HK3A 3S3NA 3A8MB 3I9QA 2XD0A 4OF1A 4EIKA 1UEBA 1K9MC 1ZBJA 2DX1A 5KYYB 1V29B 2M1HA 2AK5A 3FEOA 3HHTB 3PIPA 2RK2A 4YTLA 3KXTA 1NPPA 4IURA 2DEUA 2ZPIB 2KY9A 3MKDA 4F16A 4M7DA 1VQ8Q 1YJWT 3GBQA 3CBOA 3LYIA 1VQLT 4F7UG 3UATA 4ANJA 1K8AR 5GJVB 2F69A 2J7IA 2EKOA 2YRCA 1VA7A 5GAMf 2ED1A 4M7DD 2ABLA 5GAN6 3HFNA 4M78G 2DIQA 2NUPB 1WHMA 2FRWA 2GBQA 3CCRT 1UTIA 1BBZA 3HSBA 2G6FX 1H8KA 3M0RA 4FIBA 2ZPHB 3CCSQ 3CCLA 3G1JA 1LNXA 4C8QG 1U3OA 2H3JA 2XIDA 1TSFA 4N4IA 3GLXA 2RJEA 3VJPA 2A36A 2DD4A 3I35A 2O4XB 1M8MA 5IXBA 5KYYA 2J6KA 2CH4A 3CCMQ 2DAQA 2EQMA 3O8VA 1DJ7B 1FMWA 5GMKe 2BUDA 2AIRB 4RTUA 3EG3A 1YHQQ 2GFAA 1T0JA 2BIVA 4ZTFA 1M9SA 4BE2A 4PJOD 3C94A 1D0ZA 2DTOA 1N27A 3CPWS 2ESWA 2X9HA 3LX7A 4FW1A 2JTEA 4B9WA 1PNJA 2NUPA 1VQKT 2XI9A 2DL5A 1OOTA 4FSXA 2L3SA 3RESA 2WACA 1B3QA 2GF7A 3ZBDA 4NS5A 1NJIC 1F1BB 5IN1A 2DL3A 4IKFA 1EX4A 3T9NA 5EG2A 3CC4Q 5I2MA 3S3OA 2JOYA 4M7AF 3KUFA 3R6OA 2O4XA 3EG9B 5GAN4 3HKSA 2CREA 2DZ9A 1GXIE 1JB0E 2LX9A 1RAAB 1YJ9Q 1D3BB 3KBGA 1VQMT 2V8KA 2KYBA 3BDUA 2FRYA 1GCQC 1YJWA 3SDZA 4A63B 4OB1B 2YRVA 4DOWA 1Q86U 2DNUA 1VQLA 2ENMA 3JB9J 2JW4A 3CCET 3LH0A 4N4GA 3QO3A 4MZMA 2COYA 2JJ9A 2XU8A 5HKCA 2YUPA 1ZHIA 1NYGA 2KSSA 4BB7A 2E1HA 2E41A 3CCRA 1VQPA 3OYJA 1AZGB 3A5ZB 2EVRA 1C1AA 1XTDA 2CZ7B 1QVGP 1YFNA 3INZA 1WHGA 3JAME 5LJ5g 5D6YA 3CCQQ 1TUDA 4ELZC 4Y92A 1OI1A 3EG9A 2DM1A 2V26A 1B34B 1G83A 1VQNQ 4BDYA 1I07A 2DF6A 5LJ5j 5GMKm 1KHIA 1ZLMA 4JRKA 1D3BA 1UGRB 4Z89A 4TVRA 2OTJQ 1GCQA 2YUQA 4J9EA 1QP2A 3HTRA 2LJ0A 4KH1B 3L2QA 3H9NA 5A2QE 1H3ZA 2CP5A 4BDZA 1UB4A 2QG9B 1LOJA 3TSWA 4IUTA 3RNJA 2IIMA 2EJFA 2ZGWA 1YIJQ 3CBMA 3E19A 2RA2A 2NLUA 1UECA 4QVDA 2E5QA 4FL6A 5GMKh 2RNAA 2C0OA 3EHRA 2PVDB 2XG8D 3CBPA 4RTZA 2JTMA 1QVFA 2W10A 3CC7T 3ZFJA 3C0CA 3SWNB 3OA6A 3SWNC 1Q95G 2A28A 4PFPA 3G6ET 4C0ZA 2K6DA 4JS4A 4WF2A 1X27A 1BKBA 2QTXA 1RADB 3VYHB 3QDFA 2FZGB 3VRZA 1VQMA 2EBPA 3ULRB 3L42A 3NPFA 3OQ5A 3JCMV 2HKQB 2EYXA 2RHIA 2KRMA 3DB3A 4MDWA 2EYZA 3UA7A 3CCEA 2LQNA 1WYXA 2P4RA 1KD1C 4M7DE 1I81A 5HCKA 1TU0B 5KCHA 1VUBA 2AZVA 3VS3A 1IHWA 2DJQA 2HCKA 2E4HA 5FU7C 5LJ5e 5CAIA 4F7UF 1QQJA 4LD6A 1RAIB 3SWNA 5IXFA 2M9UA 3CCUQ 1FYNA 1QW1A 1X2KA 4KT0E 1SHFA 1K0XA 2BTTA 2NUZA 1IGUA 1IXDA 1PRLC 4CC4B 2HKNA 3QPHA 4QW2A 4RTVA 1G2BA 4M7AB 2QA4A 1OEBA 2QGFB 3M5AA 3CQTA 3CCVT 3P8BB 1GFCA 3PVLA 4V2SA 3VS5A 3G71Q 2E10A 3TREA 4XK8E 1WZOA 3V8LA 1D09B 4JLIA 4AFUC 4KRTA 1QCNA 2X4WA 4OB3B 1QVFS 4IUQA 1RAGB 1K0SA 1NEGA 2M51A 1IO6A 9ATCB 1NLOC 1WQWA 3CC7A 1E6HA 2SEMA 2OTLT 3HRTA 2HQHA 1N8RR 2DPPB 1AWXA 2CYZB 2JMCA 4FYVB 4VUBA 3CPFA 2HMAA 1RUWA 2RJCA 2DBMA 3P8HA 5AT1B 3RDVA 2JNGA 5FW9A 1RI0A 2EWNA 1RI9A 2YDLA 3H8ZA 3X28B 1ZUUA 5KE3A 1Y96B 4M77G 4M7AD 1LPLA 4C92G 4AFZC 4CI0C 3VS2A 3RBBB 3CC2T 2RPNA 2ZPGB 1Q82U 3GNFB 3CMAQ 1ZA1B 1QLYA 3E2UA 5HK0A 2PVGB 1ZSZB 3A1PA 1ZSZC 1VQKQ 1YI2Q 2O9VA 3M53A 1VQ7Q 1EZZB 1WDXA 3OYGA 3I55Q 3SD4A 4HCKA 4JRIA 4QKUA 1UFFA 4BI3A 3F70A 5GAN7 4X9CA 3MP6A 1YNZA 3EFOB 2B86A 3VV0A 2CZ0B 4WTOB 1OX9A 3E1SA 3N5BB 4J9IA 4OMPA 3VRYA 1MV3A 3JV3A 4C0GA 1AVZC 2X35A 1A0NB 2K3BA 1TH7A 4KBMB 2BZ8A 4M75B 2EGAA 4M75C 2E6ZA 2L89A 4RCCA 3CD6T 1UGSB 3CCVA 5CKBA 2K5FA 1VQ8A 1Y96A 3M0UA 1FXXA 1JXMA 2ZAEA 1KK7A 2FVUA 1YCYA 4NL3A 1TG0A 1M1KU 3TEEA 3BE3A 3OS5A 3QKJA 3REBB 5GAOq 1B07A 1T0HA 2PTKA 1ZSZA 2M0YA 3L2RA 1XQHA 3HRUA 1RLQC 5ECAA 1YITT 4GLKA 3RMQA 2GQVA 1I1JA 3QYHB 2WSCE 4E7HA 2LMJA 2RB6A 1M1GA 3EFOA 1KQ2A 4O5VA 5IH2A 4FU6A 4XU1A 5J39A 2DZCA 3VYGA 3CCJQ 1J3TA 1K8AC 5EC7A 1IRXA 3TU4K 1RL2A 3L2UA 4J6YA 3OYBA 3EH2A 4M75A
chains in the Genus database with same CATH topology
1W2BA 2LT1A 3CCST 4DA4A 2ZPHB 3ASKA 5FU6B 3CCLA 4M78E 2QQRA 5FU6C 1WJQA 2QQSA 5LJ5d 1LNXA 4C8QG 2E12A 2ZPEB 1K73C 2H3JA 2XIDA 1ZBXA 3HPWA 5KH6A 1Q86C 4N4IA 3P8DA 3GLXA 2JVVA 2RJEA 4GY5A 3FLGA 4QVZA 5LJ3d 3VJPA 3JB9I 3SB2A 2DD4A 2O4XB 4M75D 4NL2A 2K3YA 2K5IA 2R58A 2QQBA 3HFOA 3C95A 4X9DA 3E9FA 5CIUA 2EQUA 4C5GA 3CC2A 1HXDA 3CCMT 2LC4A 3CMAA 4LDUA 2LTOA 2DAQA 3JCMb 4C8QE 4J6WA 2EQMA 3O8VA 2PU9B 1DJ7B 4M7DF 5GMKe 3A8LB 2BUDA 1YHQT 1VQ4T 5GAN8 2GFAA 3JCMW 2BIVA 2Y90A 5A0DA 4ZTFA 3JCMg 2JUFA 2VXEA 3FC3A 1YI2A 1VQKA 1M9SA 4BE2A 2IG0A 3OYNA 1VQ7A 3J7AF 4PJOD 4EDUA 1VQ5A 5D6WA 3I55A 3C94A 4X34A 2DTOA 2VXFA 2MF2A 2CZ1B 2MMPA 2EIFA 4M77B 1JJ2A 4HCBA 1BIBA 2XK0A 4M77C 4C92B 2PUOB 2RH2A 2RHYA 3RIRA 1N27A 2Y4XA 4MMKA 3SFMA 4C92C 2P0PA 3TCJA 4R56A 3CPWS 1K9MU 3LX7A 1IZ6A 3MEUA 1G3SA 1WNLA 3G4ST 4B9WA 3M56A 4LDXA 4FM4B 2L5QA 1VQKT 4XTWA 4EMKC 2XI9A 1YJNT 5GAOp 3ER0A 4FSXA 3WVDB 1U1SA 4M75F 3RESA 3G7ZA 3C12A 1Q81U 5J3BA 5GAMe 2WACA 2GF7A 2LCCA 5LL6S 3ZBDA 3OS1A 4IUPA 4NS5A 4OB0B 1O75A 1NJIC 1PSFA 2CKKA 1Y71A 5IN1A 5GAMh 3OYYA 4IKFA 2WSEE 3CC4T 3I56T 3T9NA 3MEVA 3QUIA 5EG2A 3JCMf 2XKOC 5DLOA 3L1AA 5I2MA 2DJZA 3CD6A 3S3OA 3GP8A 4DQ2A 2R5AA 2JOYA 4M7AF 3KUFA 3R6OA 4BY6B 2O4XA 5GAN4 3HKSA 3M9QA 2ZPFB 3M4GA 4BY6C 4XTVA 2HNIA 2DZ9A 4Q5WA 2XHCA 1K8AU 1GXIE 1YJ9T 4XU3A 1JB0E 2LX9A 3NTKA 5A0LA 1XNIA 1D3BB 3KBGA 1M1FA 1VQMT 5GAOr 2V8KA 4ZN3A 1U8RA 5CKFA 4EMHA 4ZGJB 5KCOA 3BDUA 3UPUA 4MZTA 1BIAA 5DLQE 2Y4YA 3VUBA 3OS2A 3HL8A 5FU7B 5GMKl 1YJWA 3SDZA 5FRMA 1YITA 4PL6A 3ZEHA 4OB1B 4XU2A 2YRVA 4M77A 4DOWA 1Q86U 2DIGA 1VQLA 4J7FA 3OYHA 4C92A 4PJOB 4FT4A 2FB7A 3JB9J 4C5EA 2L8DA 4PJOC 3CCET 1WJSA 1FX7A 3LH0A 1KQ1A 2DVEA 4HKEA 4N4GA 3DKMA 3QO3A 4MZMA 5CQYA 3OYIA 2XU8A 4EMKA 3MEAA 4QVCA 5HKCA 1WPYA 4N0AC 1ZHIA 4A54A 4KULA 4XTUA 4XTYA 3BY7A 3MP8A 2KSSA 4BB7A 3CCJA 3JCMP 1W2BS 1VQ6A 2E1HA 2KQWA 2RI2A 2E41A 3CCRA 1VQPA 1KC8C 5CQXA 3OYJA 2DXUA 5GAOl 3A5ZB 3DLMA 2CZ7B 1XTDA 4RCBA 4O6JA 2HQEA 1U1TA 1G3YA 3QZ9B 5GANg 3CCSA 3LWHA 3JB9H 4F7UB 3INZA 3JAME 4ATOA 3CCQT 1EIFA 1OZ2A 5A0GA 5LJ5g 5D6YA 2K4YA 2QDYB 4ELZC 4E47A 4EPCA 2EQKA 2EYQA 4JDSA 1OI1A 2DK3A 3V7CA 2AHJB 5LJ3g 5GANj 2E64A 1B34B 2YLCA 3DB4A 1VQNT 1VQPT 4M7AE 4M78B 1H641 4BDYA 4E7IA 5LJ5j 5GMKm 4M78C 4OGEA 1WGSA 3JCMe 1KHIA 1M4ZA 1I5LA 2VGMA 3OYMA 2A7YA 4JRKA 3CCMA 5LJ3j 1D3BA 3QHSA 4N4HA 2FL7A 3BFMA 3RKYA 2E70A 1UGRB 2OTJT 1W4SA 1JBMA 4TVRA 2JTFA 1YHQA 3PTAA 1NJIU 1VQ4A 2VV5A 1QP2A 2KMTA 3BW1A 4M77F 2LDMA 3X20B 1BI1A 4C8QB 4C92F 3H6ZA 3OBWA 3JB9F 4C8QC 3L2QA 3M59A 1VQ9T 4PJOA 2JZ2A 5GANf 2P4TA 5FLXE 1M90C 2G3RA 5A2QE 1H3ZA 4BDZA 1LJOA 1UB4A 1LOJA 4OVAA 5LJ5f 5GAOm 4IUTA 1N9SA 4N0AA 2EJFA 1YIJT 2ZGWA 3X24B 5CKEA 2DTIA 3CBMA 1VIFA 3E19A 5LJ3f 2RA2A 3G4SA 2NLUA 4QVDA 2E5QA 2DKGA 4FL6A 2RM4A 3G6EA 3GIBA 5GMKh 1YJNA 3FB9A 4RMOA 2RJFA 1Q7YC 2VC8A 1X6OA 1KQSA 2PVDB 2X4YA 2GCXA 2XG8D 3CBPA 5HY6A 1S72T 2V8IA 3PNWC 2JTMA 1QVFA 3MCAB 4F7UA 2BKDN 2D6FA 3CC7T 1MGQA 3ZFJA 1R8OB 2RHZA 3SWNB 3QBYA 3M58A 3RUXA 5AYFA 3OA6A 3PMTA 4PNOA 3SWNC 3I56A 4BE0A 3C4SA 3CC4A 4II1A 1BI3A 2FYKA 3PFSA 2VUBA 3J81E 3G6ET 3NTHA 3V8KA 4C0ZA 4HT8A 2KAFA 2CZ6B 4L59A 4JS4A 1IREB 4WF2A 1Q81C 1BKBA 2QTXA 3LLRA 3VYHB 4C0DB 4ZGEB 5CCAA 3LW5E 3CMET 4C0DC 4DOVA 1KC8U 1YJ9A 3OYEA 2XDDA 3UDCA 1BI2A 4IUUA 1UGPB 4JJNK 1VQMA 4E7KA 3L2WA 4J6XA 4M78D 1FWZA 2MWOA 3L42A 3JCMV 3OQ5A 3L2VA 4M7DG 4C8QA 4PJOF 2LNVA 3M57A 2X4XA 3M4YA 1BI0A 4PLLA 4BACA 2RHIA 1KHCA 5IAYA 4B9XA 4JRPA 3X26B 5CKHA 3DB3A 4KUIA 4A4GA 2QXFA 2RHXA 3CXCA 4MDWA 4JUVA 5DM7R 1N6AA 2LCLA 5FROA 3CCEA 4MZPA 3E9GA 3GF5A 4QQGA 4ZGDB 1KD1C 2GFUA 1I81A 5CO7A 4C8QD 5KCHA 4JS5A 4M7DE 1VUBA 5I2SA 2M16A 2B8AA 5GANe 1M8VA 2LT4A 3URGA 4ME7A 2EJGA 2X4JA 5GAOn 1BYMA 5FU7C 2DXBA 5LJ5e 2RD1A 5CAIA 2XDBA 4QQ6A 4F7UF 4PJOE 3CPWA 4LD6A 2XICA 2F5TX 5LJ3e 4M75G 3FRNA 3JCMc 5LJ5h 3CCUT 3SWNA 2M9UA 2QEXT 5C6SA 2VYTA 2O01E 2IVWA 1QW1A 2EJ9A 2LRQA 2I2LA 5LJ3h 4A4KA 4C5IA 4KT0E 3OYFA 3CCQA 3RERA 5D6XA 1X01A 4MMLA 3LGLA 1OYXA 5M9OA 3Q1JA 2QI2A 1WQ7A 2LQ8A 4BUGA 1VQNA 2KVQG 2LVMA 4M75E 1Q82C 2L3RA 4M7AG 3GOXA 3JCMJ 3A8OB 1Q7YU 4RG2A 4HCZA 3NFCA 4E7JA 3QPHA 2QQAA 4QW2A 4M7AB 4OMFB 4C5HA 1QVGA 2QA4A 2OTJA 4A4FA 3M5AA 2JN0A 2RI5A 3CCVT 1AHJB 3BDLA 3P8BB 5GAMd 3UWNA 1I8FA 2D0QB 3OMCA 3J80E 4A53A 3MEWA 1JRIA 4OP0A 1VQ9A 2XDPA 4V2SA 4RKUE 3QYGB 3G71T 1NPRA 2E10A 3TREA 4JLGA 4XK8E 4XU0A 3OYDA 4BI8B 3OYLA 2PVOB 3JCMh 5GMKi 1ZQ1A 3V8LA 1VQOT 1XOVA 2QA4T 4JLIA 5CK9A 3JCMX 2HQXA 3OBYA 4FT2A 1YIJA 4KUDK 2OTLA 2HD0A 2MWPA 4XAXB 2X4WA 4OB3B 4LDYA 1JJ2S 1I4K1 1QVFS 4IUQA 5GAN5 2E65A 5CKDA 2RJDA 3EFRA 4ZTJA 2YHTA 3QXEB 3ME9A 3VU3C 1OZ3A 2ZCFB 3EFSA 1S72A 1WQWA 4P5NA 1QVPA 1G3TA 3AHUA 2C06A 3QIIA 2RO0A 4J7IA 4QQDA 4C0FA 4XQ3A 3M55A 3CC7A 3PMIA 3QSUA 1MHNA 3HRSA 5GAN2 2OTLT 3OYAA 3OYKA 4MDXA 3OSVA 3HRTA 2DPPB 4OGCA 4A4EA 4J8OA 3OW2A 2DXCA 1VIEA 1KD1U 4HCCA 1M1KC 2CYZB 4L6V5 4VUBA 4R55A 1G3WA 3CPFA 4M7AA 3FJPA 2DXTA 2RJCA 3X25B 2WSFE 3P8HA 3CMEA 1N8RC 3LGFA 4BD3A 2JNGA 4LDVA 1RI0A 2MAMA 2EWNA 4EMGA 3CCLT 3GNGA 3QG1A 4RG8A 3CXCS 1HK9A 2ZPBB 3H8ZA 4Z02A 1B34A 3PT9A 4D6WA 3S3NA 3S3MA 4M78A 2E6NA 3QJYA 3A8HB 3X28B 5KE3A 5CR2A 5FRNA 1Y96B 4M77G 4M7AD 3VUZA 3OS0A 2F5KA 5L8RE 3UT1A 1X75C 4Y91A 4C92G 4CI0C 3JB9G 1G5VA 3A8GB 3HP9A 2D9TA 5J26A 3CC2T 3CMAT 3MP1A 2ZPGB 1Q82U 3GNFB 3JSCA 3NTIA 3EAEA 5HK0A 5C0MA 4BE1A 4LDWA 2PVGB 1VQ6T 4CRIA 2EQJA 4Y28E 4M77E 1WJRA 2QQ9A 2DTHA 4EMKB 3JCMd 2RK1A 1YI2T 2RI3A 4C92E 4J5YA 1KG1A 2HBPA 1VQ7T 3M53A 5IT9E 4M7DB 1VQ5T 2DEQA 2PQWA 3I55T 3OYGA 4M7DC 2P0QA 3VKIA 3RMSA 4JRQA 3QZ5B 1Y7XA 2M0OA 3SD4A 3OSSC 3CCUA 1O9SA 2QEXA 2PUKB 2OAUA 3OMGA 4XTXA 4XTZA 4JRIA 3GPLA 2CGHA 3PIOA 2K57A 4BI3A 3F70A 3OYCA 3DLLA 5KE2A 5GAN7 2FHDA 4HT9A 1QP3A 4HA8A 4X9CA 3MP6A 1M90U 4LD9K 3PGGA 5I21A 2RHUA 3VV0A 5GMKj 1NZ9A 2CZ0B 2DO3A 2KDSA 3V8JA 2R5MA 4E7LA 2K2VA 2R57A 1QVGS 3E1SA 5GANh 3N5BB 3META 3FDRA 4C0GA 2X35A 4IUVA 2EFIA 2YLBA 4M75A 4J83A 1TH7A 4KBMB 4M75B 3LWIA 3L2ZA 4M78F 3V7RA 4M75C 4RCCA 2E6ZA 2L89A 5DY9A 1YBYA 4ELYC 3RKXA 3CD6T 1UGSB 3JRZA 5HK3A 3CCVA 5CKBA 2EAYA 2K5FA 2V8JA 3A8MB 1NE8A 4BI4A 1Y96A 4OB2B 5GAMg 1VQ8A 2HAXA 1FXXA 2XD0A 4PJOG 2FVUA 1YCYA 3MHXA 4OF1A 4NL3A 3V7SA 1K73U 3MO8A 1M5Q1 1UEBA 1M1KU 1K9MC 3RKWA 3G71A 3TEEA 5GANd 3OS5A 3QKJA 3QDRB 5GAMj 2A3LA 1VQOA 5GAOq 1V29B 2M1HA 4C8QF 4M7AC 3HHTB 3FEOA 3PIPA 2LQKA 2RK2A 4YTLA 3KXTA 4UC4A 3S6WA 1NPPA 4IURA 1P92A 1N8RU 3L2RA 2ZPIB 3CEYA 1XQHA 4PKCC 4PLIA 2KY9A 3FIFA 1VQ8T 3HRUA 4M7DA 1UGQB 2CS7A 1YJWT 4M77D 3CBOA 4L5GA 3LYIA 1Y07A 1YITT 4GLKA 4C92D 3RMQA 2GQVA 2K5LA 2KK4A 3JB9D 3OW2S 1VQLT 3QYHB 4F7UG 2WSCE 3WXMB 4E7HA 2F69A 2P0KA 2EKOA 2RB6A 1N9RA 1M1GA 2K3XA 3WVEB 4A4HA 5GAMf 1KQ2A 4O5VA 4M7DD 4NOYA 2DD5A 4FU6A 3HFNA 4XU1A 1SSFA 2DZCA 5GAN6 4M78G 5J39A 2DIQA 3CCJT 3QJ6A 2ZZDA 3VYGA 2VGNA 3OB9A 3M54A 1K8AC 3CCRT 4F7UE 1PSEA 3TU4K 1RL2A 3HSBA 5CVIA 1KQSS 3JCMQ 3L2UA 3OY9A 4J6YA 5GAN3 3OYBA 2MI6A 4ZN1A 4FIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MZP A;  5CR2 A;  1M1F A;  5CKE A;  3JRZ A;  5HK3 A;  5CQX A;  5CKB A;  5CO7 A;  5CCA A;  5CKF A;  1NE8 A;  1X75 C;  1VUB A;  4MZT A;  3VUB A;  5CK9 A;  3HPW A;  4OF1 A;  2MF2 A;  4ME7 A;  2KMT A;  4VUB A;  5DLO A;  3NFC A;  3JSC A;  5HK0 A;  3TCJ A;  5CKD A;  4ELZ C;  4HKE A;  5CQY A;  4MZM A;  2VUB A;  5CKH A;  1UB4 A;  4ELY C;  5HKC A;  2C06 A;  3G7Z A;  4MDX A; 
#chains in the Genus database with same CATH topology
 1W2B A;  2LT1 A;  1K1Z A;  2GTO A;  1WJQ A;  5LJ5 d;  3NMZ C;  5KH6 A;  1ZBX A;  8AT1 B;  4QVZ A;  1MUZ A;  3FLG A;  2KXD A;  3SB2 A;  4M75 D;  4X9D A;  2V1Q A;  3HFO A;  4C5G A;  3C95 A;  4X1V A;  3E9F A;  3CC2 A;  1HXD A;  2LC4 A;  1M2V B;  2PU9 B;  1VQ4 Q;  2Y90 A;  3JCM g;  3FC3 A;  2A37 A;  2K79 A;  1QCO A;  4EDU A;  1QVF P;  4AMC A;  4LE9 A;  4KGV B;  2CZ1 B;  2MMP A;  1JJ2 A;  1BIB A;  1KIK A;  2RHY A;  2RH2 A;  1YCS B;  1R77 A;  2NWM A;  1K9M U;  1KSW A;  2OJ2 A;  3G4S Q;  2L5Q A;  4XTW A;  3G6E Q;  4DBQ A;  5GAO p;  1YJN Q;  2LJ3 A;  3WVD B;  4J9H A;  1VYU A;  1UHF A;  5LL6 S;  1MND A;  1O75 A;  1PSF A;  1OUL A;  3I56 T;  2XKO C;  2O2O A;  2RQU A;  3L1A A;  3CD6 A;  3M9Q A;  5IHI A;  4D8D A;  2XHC A;  4XU3 A;  1M2V A;  7AT1 B;  5A0L A;  2CT4 A;  5GAO r;  4ZN3 A;  4EMH A;  4ZGJ B;  3UPU A;  2D8H A;  5GMK l;  5FRM A;  1YIT A;  4PL6 A;  2DIG A;  1UGV A;  4PJO B;  4FT4 A;  2COZ A;  4PJO C;  1FX7 A;  1Y0M A;  2HEQ A;  4HKE A;  3OYI A;  2GTJ A;  2KEA A;  4LNP A;  3BY7 A;  3MP8 A;  1W2B S;  4OML A;  1KC8 C;  3TSZ A;  3DLM A;  3UF4 A;  4RCB A;  2D8J A;  5GAN g;  3LWH A;  3JB9 H;  4ATO A;  1RAF B;  2VVK A;  5KYX B;  1VYT A;  2EYQ A;  4ORZ A;  1PRM C;  5GAN j;  1CKA A;  4M7A E;  3DB4 A;  1VQ6 Q;  1VQP T;  4CC2 A;  1BCO A;  1I5O B;  1D0Y A;  4RTX A;  3JCM e;  1UJ0 A;  2D1X A;  3OYM A;  3QHS A;  3BFM A;  3RKY A;  2E70 A;  1W4S A;  1NJI U;  3EG2 A;  1Z9Z A;  1RAB B;  4M77 F;  1BI1 A;  4C92 F;  1MMD A;  4PJO A;  1W70 A;  1VQ9 Q;  2RN8 A;  5LJ5 f;  5GAO m;  1N9S A;  2LJ1 A;  3X24 B;  2OTL Q;  2RM4 A;  3GIB A;  4RMO A;  1UJY A;  1Y57 A;  5HY6 A;  1S72 T;  2V8I A;  3MCA B;  1AT1 B;  2BKD N;  1Q81 R;  2D6F A;  1PKS A;  1QWF A;  3QBY A;  3RUX A;  5AYF A;  5KYX A;  4BE0 A;  3I56 A;  4HT8 A;  1NLP C;  2YUO A;  4IIO A;  4J9D A;  1SG5 A;  3CME Q;  1UGP B;  3EGU A;  2ED0 A;  2CP7 A;  2FZC B;  4M7D G;  2MYS A;  4CC3 A;  3M4Y A;  2X4X A;  5IAY A;  2LNH B;  1T3L A;  3CXC A;  1AWJ A;  3M0Q A;  4JUV A;  5DM7 R;  2EGE A;  2LCL A;  1E6G A;  4MZP A;  2VWF A;  3E9G A;  3GF5 A;  4ZGD B;  2GFU A;  5KYU B;  5I2S A;  2M16 A;  2B8A A;  5GAN e;  2JT4 A;  2EJG A;  2QAZ A;  2X4J A;  2AKL A;  2DXB A;  2RD1 A;  4PFZ A;  1TUG B;  2CP0 A;  4QQ6 A;  2JXB A;  3JCM c;  1KC8 R;  2QEX T;  2RQT A;  2BZY A;  2MPX C;  2LRQ A;  5LJ3 h;  4DBR A;  1WXT A;  1M3B A;  5D6X A;  1OYX A;  1WQ7 A;  2LQ8 A;  4E7Z A;  2JM9 A;  2LP5 A;  2KVQ G;  1XJW B;  4M75 E;  3EG1 A;  3GOX A;  3JCM J;  4RG2 A;  4HCZ A;  4PJN A;  4E7J A;  4OMF B;  1D1B A;  4A4F A;  3EGX B;  1M90 R;  3UWN A;  3OMC A;  3J80 E;  2QYZ A;  3MEW A;  4A53 A;  3EGD B;  3OYL A;  4JLG A;  4XU0 A;  1VQO T;  3OYD A;  3JCM h;  2QA4 T;  5CK9 A;  4J9B A;  2X3X D;  2EPD A;  2QGG A;  4LDY A;  5GAN 5;  2J6O A;  5CKD A;  2RJD A;  3ME9 A;  2ZCF B;  1S72 A;  4P5N A;  2DE0 X;  1W2B P;  3AHU A;  3NGP A;  2F2X A;  3QII A;  1QCF A;  2RO0 A;  2HL3 A;  3QSU A;  1MHN A;  3RR6 A;  3OYK A;  3OSV A;  4K11 A;  1WHJ A;  4OGC A;  4J8O A;  1VIE A;  1R0B G;  1KD1 U;  2DRM A;  2F2W A;  4R55 A;  1G3W A;  3FJP A;  2JS2 A;  3ZL7 C;  2JM8 A;  2WSF E;  3X25 B;  1K4U S;  1N8R C;  3EGX A;  4LDV A;  4E2F B;  4EMG A;  3GNG A;  3CXC S;  3CCL Q;  4FW2 A;  4D6W A;  1B34 A;  3PT9 A;  3EG0 A;  1KFZ A;  1GFD A;  1JJ2 P;  2F5K A;  3EGD A;  3UT1 A;  2CUD A;  4Y91 A;  3JB9 G;  3A8G B;  3HP9 A;  2D9T A;  1C6V X;  3MP1 A;  1V76 A;  4AG2 C;  4J9F A;  4LN2 A;  3NTI A;  5C0M A;  4EMK B;  2QQ9 A;  3JCM d;  4J5Y A;  1KG1 A;  3PE0 A;  1VQ5 T;  2DEQ A;  2PQW A;  2O9S A;  3H0F A;  2M0O A;  4RTT A;  2QEX A;  2PUK B;  2OAU A;  1WXU A;  3PIO A;  2K57 A;  1UE9 A;  3OYC A;  3DLL A;  1MMG A;  4HA8 A;  2DLP A;  4LD9 K;  3PGG A;  3M0T A;  2RHU A;  2KDS A;  2K2V A;  3D7S B;  2BE9 B;  2R57 A;  1SRM A;  5GAN h;  3VS0 A;  2QK0 A;  1TWB A;  2YT6 A;  5KYW B;  4E6R A;  3LH5 A;  4IUV A;  2YLB A;  1RAC B;  4J83 A;  4M78 F;  2DL4 A;  2EAY A;  2V8J A;  1NE8 A;  4OB2 B;  2HAX A;  3EHQ A;  4DEY A;  1WHH A;  1CSK A;  1M5Q 1;  3RKW A;  3QDR B;  2A3L A;  1VQO A;  4M7A C;  4C8Q F;  2GGR A;  1NEB A;  2LQK A;  5KYN A;  1P92 A;  1HYO A;  4PLI A;  3CEY A;  3O5Z A;  1B7T A;  1VQ8 T;  3FIF A;  4PJO E;  2MCN A;  1UGQ B;  2DER A;  4M77 D;  1YJW Q;  4C92 D;  2K5L A;  1VQL Q;  2H3E B;  3WXM B;  4JZ4 A;  1N9R A;  4Z88 A;  2K3X A;  1HJD A;  4HVW A;  1SSF A;  3QJ6 A;  1ABO A;  2ZZD A;  4OMO A;  1K73 R;  3CCR Q;  1Q86 R;  3JCM Q;  3OY9 A;  5GAN 3;  2MIO A;  3AT1 B;  2MI6 A;  4ZN1 A;  1OU9 A;  5GAN d;  3CCS T;  4F17 A;  4DA4 A;  3ASK A;  5FU6 B;  3QWY A;  5FU6 C;  1WFW A;  2E12 A;  1JO8 A;  3P8D A;  1R0C B;  3JB9 I;  1JQQ A;  4NL2 A;  2R58 A;  2QQB A;  4M7A A;  2EW3 A;  3CCM T;  2QAS A;  4LDU A;  2LTO A;  1NM7 A;  4M7D F;  1YHQ T;  3A8L B;  2VKN A;  2FZK B;  5A0D A;  2VXE A;  2SRC A;  2BZX A;  1PG5 B;  2IG0 A;  3OYN A;  1VQ5 A;  5FWB A;  1SRL A;  4HCB A;  2KE9 A;  2GNC A;  8ATC B;  2PUO B;  4MMK A;  2P0P A;  3TCJ A;  4R56 A;  5D7U A;  3MEU A;  1G3S A;  1M3A A;  2KT1 A;  4FM4 B;  3I5R A;  1MMA A;  2HZY A;  3ER0 A;  1AOJ A;  1U1S A;  1K9A A;  2LCC A;  4IUP A;  4OB0 B;  2CKK A;  1Y71 A;  5GAM h;  2KYM A;  3CC4 T;  3JCM f;  3MEV A;  1BU1 A;  5DLO A;  2DJZ A;  1YWP A;  4DQ2 A;  4LUE A;  3CXC P;  1K8A U;  1YJ9 T;  1M30 A;  4PFO A;  1AEY A;  1M1F A;  1VQM Q;  1X69 A;  5CKF A;  5KCO A;  4MZT A;  1BIA A;  2Y4Y A;  4JJB A;  1PCX A;  3HL8 A;  2EYY A;  1NG2 A;  3ZEH A;  2DL7 A;  4J7F A;  3OYH A;  1ZUK A;  2F2V A;  2FB7 A;  1RLP C;  2BE7 D;  2L8D A;  3CCE Q;  2K7A A;  4QVC A;  2RMO A;  4N0A C;  4A54 A;  4KUL A;  4XTU A;  4XTY A;  3JCM P;  1PWT A;  1VQ6 A;  2RI2 A;  1I0C A;  1W6X A;  5CQX A;  5GAO l;  3QWX X;  1H3H A;  5I11 A;  4O6J A;  1ACM B;  2HQE A;  1U1T A;  1G3Y A;  3QZ9 B;  3CCS A;  4F7U B;  3CCQ T;  1OZ2 A;  5A0G A;  2K4Y A;  2L3P A;  4EPC A;  2E3H A;  1ABQ A;  3V7C A;  5LJ3 g;  1VQN T;  4M78 B;  1H64 1;  4M78 C;  4OGE A;  1WGS A;  1I5L A;  2VGM A;  2A7Y A;  3CCM A;  2OI3 A;  5LJ3 j;  4N4H A;  2OTJ T;  1JBM A;  4RTW A;  2QA4 Q;  1YHQ A;  3BW1 A;  1RAH B;  1JU5 C;  2LDM A;  3X20 B;  1AWO A;  4C8Q B;  3H6Z A;  2A0F B;  3OBW A;  1X6G A;  3JB9 F;  4C8Q C;  1ZX6 A;  5GAN f;  5FLX E;  2G3R A;  2C0I A;  1LJO A;  4N0A A;  1IGQ A;  1YIJ T;  1RAE B;  2DTI A;  2COW A;  4B6M A;  2JS0 A;  1ZA2 B;  3FB9 A;  1Q7Y C;  2VC8 A;  1X6O A;  1KQS A;  2GCX A;  2L2P A;  3PNW C;  4RTY A;  4F7U A;  1C0M A;  2DFU A;  1MGQ A;  1R8O B;  3CC7 Q;  3M58 A;  3CC4 A;  3PMT A;  4II1 A;  1BI3 A;  3PFS A;  3J81 E;  4KH0 B;  3V8K A;  1Q81 C;  4ZGE B;  4C0D B;  5CCA A;  2YRD A;  3LW5 E;  4C0D C;  4DOV A;  1KC8 U;  1YJ9 A;  3OYE A;  2XDD A;  3UDC A;  1M2O A;  2GQI A;  2Z0W A;  4E7K A;  3L2W A;  4J6X A;  4M78 D;  1FWZ A;  2MWO A;  3L2V A;  4C8Q A;  1BI0 A;  4PLL A;  4BAC A;  2YWW A;  2NYS A;  1GCP A;  1KHC A;  2CT3 A;  1TXQ A;  4GLM A;  4JRP A;  3X26 B;  5CKH A;  4KUI A;  2QXF A;  2KXC A;  1N6A A;  1E7O A;  2FPF A;  2O88 A;  4C8Q D;  4JS5 A;  1X2Q A;  1M8V A;  3SEM A;  3URG A;  4FYW B;  4ME7 A;  4Z8A A;  2HSP A;  1WLP B;  4DBF A;  2ATC B;  3CPW A;  1W1F A;  2XIC A;  3H41 A;  1X6B A;  5LJ3 e;  4M75 G;  2DBK A;  3CCU T;  2W0Z A;  2O01 E;  2IVW A;  2I2L A;  4C5I A;  3CCQ A;  3RER A;  1X01 A;  4MML A;  2KRN A;  3LGL A;  5M9O A;  2HBW A;  2C0T A;  4JZ3 A;  2CP6 A;  2DYB A;  3UA6 A;  1VQN A;  1GBQ A;  3NFC A;  4AT1 B;  2OAW A;  1WIE A;  2QQA A;  2A08 A;  4C5H A;  1OPL A;  1WHL A;  2OTJ A;  2AZS A;  1AHJ B;  2D0Q B;  2HL5 C;  1JXO A;  3CCV Q;  1SKU B;  2DIL A;  2OX7 A;  4OP0 A;  2O31 A;  2AT1 B;  3G71 T;  1NPR A;  1M90 C;  2PVO B;  4LDX A;  1ZQ1 A;  1KQS S;  2VB6 A;  3VS4 A;  3JCM X;  2HQX A;  2D0N A;  4KUD K;  1YIJ A;  2HD0 A;  2MWP A;  1JJ2 S;  1QMC A;  4PJJ A;  3EFS A;  1Q7Y R;  2KNB B;  1M1K R;  2C06 A;  2KI7 A;  1TTH B;  4J7I A;  4QQD A;  4C0F A;  4XQ3 A;  2KGT A;  3M55 A;  3PMI A;  2ECZ A;  5GAN 2;  1UG1 A;  1YP5 A;  3MJX A;  1D1C A;  3OW2 A;  2E3I A;  2YUN A;  4L6V 5;  4KGZ B;  1PD1 A;  2M02 A;  3LGF A;  4BD3 A;  2MAM A;  1GL5 A;  2ZPB B;  2E6N A;  3A8H B;  2YSQ A;  1Z9Q A;  1BK2 A;  5L8R E;  1X75 C;  4DBH A;  1KJW A;  3CMA T;  4E7S A;  3CC2 Q;  4OMM A;  1TS9 A;  4BE1 A;  3IQL A;  2QDL A;  2EQJ A;  1TOV A;  2RK1 A;  1YI2 T;  2RI3 A;  1VQ7 T;  1WHK A;  3I55 T;  2P0Q A;  3CCU A;  1O9S A;  2LZ6 B;  3OMG A;  1D0X A;  1PD0 A;  2CGH A;  1GRI A;  1QP3 A;  5FWC A;  2J06 A;  1NZ9 A;  2CH4 W;  3MET A;  3FDR A;  1N5Z A;  2ROL A;  1WX6 A;  4FYY B;  2RQR A;  4JJD A;  2EFI A;  4QT7 A;  1K9M R;  4OMQ A;  3V7R A;  5DY9 A;  2K9G A;  4ELY C;  3JRZ A;  5GAM g;  3CD6 Q;  1GBR A;  4BI4 A;  4PJO G;  3MHX A;  3V7S A;  1K73 U;  1MV0 B;  1OPK A;  3MO8 A;  3G71 A;  3TVT A;  5GAM j;  1M27 C;  2FEI A;  4UC4 A;  3S6W A;  1N8R U;  1LCK A;  4PKC C;  2CS7 A;  4L5G A;  2YXY A;  2K2M A;  1Y07 A;  3JB9 D;  1YIT Q;  2KK4 A;  3OW2 S;  1PM3 A;  3KFV A;  2P0K A;  5KYU A;  3WVE B;  4A4H A;  4NOY A;  2DD5 A;  3CCJ T;  2ROT A;  2VGN A;  3OB9 A;  2KR3 A;  3M54 A;  3PVQ A;  4F7U E;  1NBE B;  1PSE A;  5CVI A;  4DEX A;  3I5S A;  4M78 E;  2QQR A;  1OV3 A;  1OX8 A;  2QQS A;  2ZPE B;  1K73 C;  3HPW A;  1Q86 C;  5LJ3 d;  2JVV A;  2J05 A;  4GY5 A;  4FYX B;  4AG1 C;  1ZUY A;  2K3Y A;  2K5I A;  2RQV A;  3THK A;  5CIU A;  2EQU A;  3CMA A;  4OMN A;  4F04 B;  2KRO A;  3JCM b;  4C8Q E;  4J6W A;  2NUT B;  1VQ4 T;  5GAN 8;  3JCM W;  2XMF A;  1KQS P;  2JUF A;  1VQK A;  1YI2 A;  3J7A F;  1VQ7 A;  2X51 A;  4PK4 A;  5D6W A;  3I55 A;  4X34 A;  2VXF A;  2MF2 A;  2EIF A;  4M77 B;  2XK0 A;  3H0H A;  4M77 C;  4C92 B;  3RIR A;  2Y4X A;  4C92 C;  3SFM A;  2DET A;  1U06 A;  1K76 A;  1IZ6 A;  1WNL A;  3G4S T;  1NJI R;  3M56 A;  3EH1 A;  4EMK C;  1YJN T;  4M75 F;  3G7Z A;  3C12 A;  5J3B A;  5GAM e;  2HDA A;  1YN8 A;  3OS1 A;  2LCS A;  1SEM A;  3OYY A;  2E5K A;  2WSE E;  3QUI A;  3I56 Q;  1WA7 A;  3GP8 A;  1ZSG A;  2R5A A;  5GJW B;  2CSQ A;  4BY6 B;  1WXB A;  2ZPF B;  3M4G A;  4BY6 C;  4XTV A;  2CDT A;  2HNI A;  4Q5W A;  4LXC A;  3NTK A;  2NUT A;  1XNI A;  1ARK A;  1U8R A;  2HSE B;  5DLQ E;  3VUB A;  3OS2 A;  5FU7 B;  3CPW P;  3M0S A;  2RQW A;  2L0A A;  4XU2 A;  4M77 A;  1QKX A;  4C92 A;  4C5E A;  1WJS A;  3VS1 A;  1KQ1 A;  2DVE A;  2FO0 A;  5CQY A;  3DKM A;  2LX7 A;  4EMK A;  3MEA A;  1UDL A;  2I0N A;  1WPY A;  2QTV A;  2PZ1 A;  3SHW A;  2CP3 A;  3CCJ A;  1LVK A;  5I22 A;  4AFS C;  2KQW A;  2DXU A;  1G8X A;  2P84 A;  4PJL A;  1PKT A;  4HVU A;  1EIF A;  1TUC A;  2QDY B;  4E47 A;  2EQK A;  4JDS A;  1VQ6 T;  2DK3 A;  2AHJ B;  1QKW A;  2E64 A;  2YLC A;  2H8H A;  2DYI A;  1VQP Q;  5KYW A;  4E7I A;  2X3W D;  1SSH A;  1M4Z A;  4WCI A;  2FPE A;  2L3Q A;  2FL7 A;  2JTF A;  3PTA A;  2DVJ A;  1VQ4 A;  2VAS A;  2VV5 A;  2KMT A;  1T3S A;  2MK5 A;  5IHK A;  1VQ9 T;  3M59 A;  2JZ2 A;  2P4T A;  1U5S A;  1UHC A;  4OVA A;  4LUD A;  3OW2 P;  5CKE A;  3VS6 A;  1VIF A;  2DL8 A;  2PNI A;  5LJ3 f;  3G4S A;  3FJ5 A;  2DKG A;  3G6E A;  1YJN A;  2RJF A;  2J6F A;  4F14 A;  1NYF A;  2X4Y A;  1QWE A;  1S72 Q;  1BB9 A;  1AWW A;  2RHZ A;  4ESR A;  3MPU B;  4PNO A;  1OU8 A;  3C4S A;  2FYK A;  2VUB A;  2CP2 A;  3NTH A;  4M4Z A;  1PC0 A;  2KAF A;  2CZ6 B;  4L59 A;  1IRE B;  1M3C A;  3LLR A;  2EGC A;  3CME T;  1BI2 A;  4IUU A;  4IIM A;  4JJN K;  3VS7 A;  4HVV A;  4PJO F;  4GBQ A;  2LNV A;  3M57 A;  1KD1 R;  3NHN A;  4B9X A;  2F1L A;  2MOX A;  4A4G A;  2RHX A;  1YWO A;  1FMV A;  5FRO A;  2KBT A;  3A98 A;  4JJC A;  4QQG A;  3U23 A;  5CO7 A;  1S1N A;  2RF0 A;  1MMN A;  2LT4 A;  2CUB A;  5GAO n;  1BYM A;  1JEG A;  2JMA A;  2IPO B;  4CC7 A;  2XDB A;  2KT8 A;  2F5T X;  4FSS A;  5LJ5 h;  3FRN A;  1VYV A;  5C6S A;  2QEX Q;  2VYT A;  1SPK A;  2EJ9 A;  3OYF A;  4A4K A;  1HSQ A;  3TQ7 P;  3Q1J A;  2QI2 A;  2V1R A;  4BUG A;  2LVM A;  1Q82 C;  2L3R A;  4M7A G;  3A8O B;  1WI7 A;  1Q7Y U;  4D8K A;  6AT1 B;  1QVG A;  2KRS A;  2JN0 A;  2RI5 A;  3BDL A;  5GAM d;  1I8F A;  1PHT A;  5L23 A;  1JRI A;  2CSI A;  2AKK A;  1VQ9 A;  2XDP A;  4RKU E;  4R0K A;  3QYG B;  1SHG A;  1Q81 U;  4BI8 B;  2LQW A;  5GMK i;  1VQO Q;  1XOV A;  3OBY A;  4FT2 A;  2OTL A;  4XAX B;  1I4K 1;  1BCM A;  4ZNX A;  2E65 A;  3EFR A;  4ZTJ A;  2YHT A;  3QXE B;  3VU3 C;  1UUE A;  1OZ3 A;  4AFQ C;  2DMO A;  1QVP A;  1G3T A;  1AD5 A;  4J9C A;  4PJM A;  1V1C A;  3REA B;  3HRS A;  4MDX A;  3OYA A;  1IB8 A;  4A4E A;  2DXC A;  4HCC A;  2EQI A;  1X43 A;  1M1K C;  2DXT A;  3CME A;  4J9G A;  2EKH A;  3CCL T;  3QG1 A;  4RG8 A;  2DRK A;  1HK9 A;  4Z02 A;  3S3M A;  2FPD A;  3QJY A;  4M78 A;  5CR2 A;  2EYW A;  5FRN A;  3VUZ A;  3OS0 A;  1MNE A;  3R6N A;  1G5V A;  1IHV A;  5J26 A;  2DA9 A;  3JSC A;  3EAE A;  1HD3 A;  1H92 A;  4LDW A;  1EFN A;  4CRI A;  4Y28 E;  4M77 E;  1WJR A;  4KGX B;  2DTH A;  3M0P A;  4C92 E;  2HBP A;  5IT9 E;  4M7D B;  1VQ5 Q;  4M7D C;  3VKI A;  3RMS A;  4JRQ A;  3QZ5 B;  1Y7X A;  3OSS C;  4XTX A;  4XTZ A;  3GPL A;  1AZE A;  3H0I A;  5KE2 A;  4HT9 A;  2FHD A;  1M90 U;  5I21 A;  5GMK j;  3V8J A;  2DO3 A;  2R5M A;  4E7L A;  5IHN A;  1QVG S;  4HXJ A;  1OQK A;  1VOM A;  1SF9 A;  1Q82 R;  4JPB W;  3LWI A;  1CKB A;  1D1A A;  3L2Z A;  2FG0 A;  4FCY A;  1YBY A;  3RKX A;  1FMK A;  4RUG A;  5HK3 A;  3S3N A;  3A8M B;  3I9Q A;  2XD0 A;  4OF1 A;  4EIK A;  1UEB A;  1K9M C;  1ZBJ A;  2DX1 A;  5KYY B;  1V29 B;  2M1H A;  2AK5 A;  3FEO A;  3HHT B;  3PIP A;  2RK2 A;  4YTL A;  3KXT A;  1NPP A;  4IUR A;  2DEU A;  2ZPI B;  2KY9 A;  3MKD A;  4F16 A;  4M7D A;  1VQ8 Q;  1YJW T;  3GBQ A;  3CBO A;  3LYI A;  1VQL T;  4F7U G;  3UAT A;  4ANJ A;  1K8A R;  5GJV B;  2F69 A;  2J7I A;  2EKO A;  2YRC A;  1VA7 A;  5GAM f;  2ED1 A;  4M7D D;  2ABL A;  5GAN 6;  3HFN A;  4M78 G;  2DIQ A;  2NUP B;  1WHM A;  2FRW A;  2GBQ A;  3CCR T;  1UTI A;  1BBZ A;  3HSB A;  2G6F X;  1H8K A;  3M0R A;  4FIB A;  2ZPH B;  3CCS Q;  3CCL A;  3G1J A;  1LNX A;  4C8Q G;  1U3O A;  2H3J A;  2XID A;  1TSF A;  4N4I A;  3GLX A;  2RJE A;  3VJP A;  2A36 A;  2DD4 A;  3I35 A;  2O4X B;  1M8M A;  5IXB A;  5KYY A;  2J6K A;  2CH4 A;  3CCM Q;  2DAQ A;  2EQM A;  3O8V A;  1DJ7 B;  1FMW A;  5GMK e;  2BUD A;  2AIR B;  4RTU A;  3EG3 A;  1YHQ Q;  2GFA A;  1T0J A;  2BIV A;  4ZTF A;  1M9S A;  4BE2 A;  4PJO D;  3C94 A;  1D0Z A;  2DTO A;  1N27 A;  3CPW S;  2ESW A;  2X9H A;  3LX7 A;  4FW1 A;  2JTE A;  4B9W A;  1PNJ A;  2NUP A;  1VQK T;  2XI9 A;  2DL5 A;  1OOT A;  4FSX A;  2L3S A;  3RES A;  2WAC A;  1B3Q A;  2GF7 A;  3ZBD A;  4NS5 A;  1NJI C;  1F1B B;  5IN1 A;  2DL3 A;  4IKF A;  1EX4 A;  3T9N A;  5EG2 A;  3CC4 Q;  5I2M A;  3S3O A;  2JOY A;  4M7A F;  3KUF A;  3R6O A;  2O4X A;  3EG9 B;  5GAN 4;  3HKS A;  2CRE A;  2DZ9 A;  1GXI E;  1JB0 E;  2LX9 A;  1RAA B;  1YJ9 Q;  1D3B B;  3KBG A;  1VQM T;  2V8K A;  2KYB A;  3BDU A;  2FRY A;  1GCQ C;  1YJW A;  3SDZ A;  4A63 B;  4OB1 B;  2YRV A;  4DOW A;  1Q86 U;  2DNU A;  1VQL A;  2ENM A;  3JB9 J;  2JW4 A;  3CCE T;  3LH0 A;  4N4G A;  3QO3 A;  4MZM A;  2COY A;  2JJ9 A;  2XU8 A;  5HKC A;  2YUP A;  1ZHI A;  1NYG A;  2KSS A;  4BB7 A;  2E1H A;  2E41 A;  3CCR A;  1VQP A;  3OYJ A;  1AZG B;  3A5Z B;  2EVR A;  1C1A A;  1XTD A;  2CZ7 B;  1QVG P;  1YFN A;  3INZ A;  1WHG A;  3JAM E;  5LJ5 g;  5D6Y A;  3CCQ Q;  1TUD A;  4ELZ C;  4Y92 A;  1OI1 A;  3EG9 A;  2DM1 A;  2V26 A;  1B34 B;  1G83 A;  1VQN Q;  4BDY A;  1I07 A;  2DF6 A;  5LJ5 j;  5GMK m;  1KHI A;  1ZLM A;  4JRK A;  1D3B A;  1UGR B;  4Z89 A;  4TVR A;  2OTJ Q;  1GCQ A;  2YUQ A;  4J9E A;  1QP2 A;  3HTR A;  2LJ0 A;  4KH1 B;  3L2Q A;  3H9N A;  5A2Q E;  1H3Z A;  2CP5 A;  4BDZ A;  1UB4 A;  2QG9 B;  1LOJ A;  3TSW A;  4IUT A;  3RNJ A;  2IIM A;  2EJF A;  2ZGW A;  1YIJ Q;  3CBM A;  3E19 A;  2RA2 A;  2NLU A;  1UEC A;  4QVD A;  2E5Q A;  4FL6 A;  5GMK h;  2RNA A;  2C0O A;  3EHR A;  2PVD B;  2XG8 D;  3CBP A;  4RTZ A;  2JTM A;  1QVF A;  2W10 A;  3CC7 T;  3ZFJ A;  3C0C A;  3SWN B;  3OA6 A;  3SWN C;  1Q95 G;  2A28 A;  4PFP A;  3G6E T;  4C0Z A;  2K6D A;  4JS4 A;  4WF2 A;  1X27 A;  1BKB A;  2QTX A;  1RAD B;  3VYH B;  3QDF A;  2FZG B;  3VRZ A;  1VQM A;  2EBP A;  3ULR B;  3L42 A;  3NPF A;  3OQ5 A;  3JCM V;  2HKQ B;  2EYX A;  2RHI A;  2KRM A;  3DB3 A;  4MDW A;  2EYZ A;  3UA7 A;  3CCE A;  2LQN A;  1WYX A;  2P4R A;  1KD1 C;  4M7D E;  1I81 A;  5HCK A;  1TU0 B;  5KCH A;  1VUB A;  2AZV A;  3VS3 A;  1IHW A;  2DJQ A;  2HCK A;  2E4H A;  5FU7 C;  5LJ5 e;  5CAI A;  4F7U F;  1QQJ A;  4LD6 A;  1RAI B;  3SWN A;  5IXF A;  2M9U A;  3CCU Q;  1FYN A;  1QW1 A;  1X2K A;  4KT0 E;  1SHF A;  1K0X A;  2BTT A;  2NUZ A;  1IGU A;  1IXD A;  1PRL C;  4CC4 B;  2HKN A;  3QPH A;  4QW2 A;  4RTV A;  1G2B A;  4M7A B;  2QA4 A;  1OEB A;  2QGF B;  3M5A A;  3CQT A;  3CCV T;  3P8B B;  1GFC A;  3PVL A;  4V2S A;  3VS5 A;  3G71 Q;  2E10 A;  3TRE A;  4XK8 E;  1WZO A;  3V8L A;  1D09 B;  4JLI A;  4AFU C;  4KRT A;  1QCN A;  2X4W A;  4OB3 B;  1QVF S;  4IUQ A;  1RAG B;  1K0S A;  1NEG A;  2M51 A;  1IO6 A;  9ATC B;  1NLO C;  1WQW A;  3CC7 A;  1E6H A;  2SEM A;  2OTL T;  3HRT A;  2HQH A;  1N8R R;  2DPP B;  1AWX A;  2CYZ B;  2JMC A;  4FYV B;  4VUB A;  3CPF A;  2HMA A;  1RUW A;  2RJC A;  2DBM A;  3P8H A;  5AT1 B;  3RDV A;  2JNG A;  5FW9 A;  1RI0 A;  2EWN A;  1RI9 A;  2YDL A;  3H8Z A;  3X28 B;  1ZUU A;  5KE3 A;  1Y96 B;  4M77 G;  4M7A D;  1LPL A;  4C92 G;  4AFZ C;  4CI0 C;  3VS2 A;  3RBB B;  3CC2 T;  2RPN A;  2ZPG B;  1Q82 U;  3GNF B;  3CMA Q;  1ZA1 B;  1QLY A;  3E2U A;  5HK0 A;  2PVG B;  1ZSZ B;  3A1P A;  1ZSZ C;  1VQK Q;  1YI2 Q;  2O9V A;  3M53 A;  1VQ7 Q;  1EZZ B;  1WDX A;  3OYG A;  3I55 Q;  3SD4 A;  4HCK A;  4JRI A;  4QKU A;  1UFF A;  4BI3 A;  3F70 A;  5GAN 7;  4X9C A;  3MP6 A;  1YNZ A;  3EFO B;  2B86 A;  3VV0 A;  2CZ0 B;  4WTO B;  1OX9 A;  3E1S A;  3N5B B;  4J9I A;  4OMP A;  3VRY A;  1MV3 A;  3JV3 A;  4C0G A;  1AVZ C;  2X35 A;  1A0N B;  2K3B A;  1TH7 A;  4KBM B;  2BZ8 A;  4M75 B;  2EGA A;  4M75 C;  2E6Z A;  2L89 A;  4RCC A;  3CD6 T;  1UGS B;  3CCV A;  5CKB A;  2K5F A;  1VQ8 A;  1Y96 A;  3M0U A;  1FXX A;  1JXM A;  2ZAE A;  1KK7 A;  2FVU A;  1YCY A;  4NL3 A;  1TG0 A;  1M1K U;  3TEE A;  3BE3 A;  3OS5 A;  3QKJ A;  3REB B;  5GAO q;  1B07 A;  1T0H A;  2PTK A;  1ZSZ A;  2M0Y A;  3L2R A;  1XQH A;  3HRU A;  1RLQ C;  5ECA A;  1YIT T;  4GLK A;  3RMQ A;  2GQV A;  1I1J A;  3QYH B;  2WSC E;  4E7H A;  2LMJ A;  2RB6 A;  1M1G A;  3EFO A;  1KQ2 A;  4O5V A;  5IH2 A;  4FU6 A;  4XU1 A;  5J39 A;  2DZC A;  3VYG A;  3CCJ Q;  1J3T A;  1K8A C;  5EC7 A;  1IRX A;  3TU4 K;  1RL2 A;  3L2U A;  4J6Y A;  3OYB A;  3EH2 A;  4M75 A; 
#chains in the Genus database with same CATH homology
 1W2B A;  2LT1 A;  3CCS T;  4DA4 A;  2ZPH B;  3ASK A;  5FU6 B;  3CCL A;  4M78 E;  2QQR A;  5FU6 C;  1WJQ A;  2QQS A;  5LJ5 d;  1LNX A;  4C8Q G;  2E12 A;  2ZPE B;  1K73 C;  2H3J A;  2XID A;  1ZBX A;  3HPW A;  5KH6 A;  1Q86 C;  4N4I A;  3P8D A;  3GLX A;  2JVV A;  2RJE A;  4GY5 A;  3FLG A;  4QVZ A;  5LJ3 d;  3VJP A;  3JB9 I;  3SB2 A;  2DD4 A;  2O4X B;  4M75 D;  4NL2 A;  2K3Y A;  2K5I A;  2R58 A;  2QQB A;  3HFO A;  3C95 A;  4X9D A;  3E9F A;  5CIU A;  2EQU A;  4C5G A;  3CC2 A;  1HXD A;  3CCM T;  2LC4 A;  3CMA A;  4LDU A;  2LTO A;  2DAQ A;  3JCM b;  4C8Q E;  4J6W A;  2EQM A;  3O8V A;  2PU9 B;  1DJ7 B;  4M7D F;  5GMK e;  3A8L B;  2BUD A;  1YHQ T;  1VQ4 T;  5GAN 8;  2GFA A;  3JCM W;  2BIV A;  2Y90 A;  5A0D A;  4ZTF A;  3JCM g;  2JUF A;  2VXE A;  3FC3 A;  1YI2 A;  1VQK A;  1M9S A;  4BE2 A;  2IG0 A;  3OYN A;  1VQ7 A;  3J7A F;  4PJO D;  4EDU A;  1VQ5 A;  5D6W A;  3I55 A;  3C94 A;  4X34 A;  2DTO A;  2VXF A;  2MF2 A;  2CZ1 B;  2MMP A;  2EIF A;  4M77 B;  1JJ2 A;  4HCB A;  1BIB A;  2XK0 A;  4M77 C;  4C92 B;  2PUO B;  2RH2 A;  2RHY A;  3RIR A;  1N27 A;  2Y4X A;  4MMK A;  3SFM A;  4C92 C;  2P0P A;  3TCJ A;  4R56 A;  3CPW S;  1K9M U;  3LX7 A;  1IZ6 A;  3MEU A;  1G3S A;  1WNL A;  3G4S T;  4B9W A;  3M56 A;  4LDX A;  4FM4 B;  2L5Q A;  1VQK T;  4XTW A;  4EMK C;  2XI9 A;  1YJN T;  5GAO p;  3ER0 A;  4FSX A;  3WVD B;  1U1S A;  4M75 F;  3RES A;  3G7Z A;  3C12 A;  1Q81 U;  5J3B A;  5GAM e;  2WAC A;  2GF7 A;  2LCC A;  5LL6 S;  3ZBD A;  3OS1 A;  4IUP A;  4NS5 A;  4OB0 B;  1O75 A;  1NJI C;  1PSF A;  2CKK A;  1Y71 A;  5IN1 A;  5GAM h;  3OYY A;  4IKF A;  2WSE E;  3CC4 T;  3I56 T;  3T9N A;  3MEV A;  3QUI A;  5EG2 A;  3JCM f;  2XKO C;  5DLO A;  3L1A A;  5I2M A;  2DJZ A;  3CD6 A;  3S3O A;  3GP8 A;  4DQ2 A;  2R5A A;  2JOY A;  4M7A F;  3KUF A;  3R6O A;  4BY6 B;  2O4X A;  5GAN 4;  3HKS A;  3M9Q A;  2ZPF B;  3M4G A;  4BY6 C;  4XTV A;  2HNI A;  2DZ9 A;  4Q5W A;  2XHC A;  1K8A U;  1GXI E;  1YJ9 T;  4XU3 A;  1JB0 E;  2LX9 A;  3NTK A;  5A0L A;  1XNI A;  1D3B B;  3KBG A;  1M1F A;  1VQM T;  5GAO r;  2V8K A;  4ZN3 A;  1U8R A;  5CKF A;  4EMH A;  4ZGJ B;  5KCO A;  3BDU A;  3UPU A;  4MZT A;  1BIA A;  5DLQ E;  2Y4Y A;  3VUB A;  3OS2 A;  3HL8 A;  5FU7 B;  5GMK l;  1YJW A;  3SDZ A;  5FRM A;  1YIT A;  4PL6 A;  3ZEH A;  4OB1 B;  4XU2 A;  2YRV A;  4M77 A;  4DOW A;  1Q86 U;  2DIG A;  1VQL A;  4J7F A;  3OYH A;  4C92 A;  4PJO B;  4FT4 A;  2FB7 A;  3JB9 J;  4C5E A;  2L8D A;  4PJO C;  3CCE T;  1WJS A;  1FX7 A;  3LH0 A;  1KQ1 A;  2DVE A;  4HKE A;  4N4G A;  3DKM A;  3QO3 A;  4MZM A;  5CQY A;  3OYI A;  2XU8 A;  4EMK A;  3MEA A;  4QVC A;  5HKC A;  1WPY A;  4N0A C;  1ZHI A;  4A54 A;  4KUL A;  4XTU A;  4XTY A;  3BY7 A;  3MP8 A;  2KSS A;  4BB7 A;  3CCJ A;  3JCM P;  1W2B S;  1VQ6 A;  2E1H A;  2KQW A;  2RI2 A;  2E41 A;  3CCR A;  1VQP A;  1KC8 C;  5CQX A;  3OYJ A;  2DXU A;  5GAO l;  3A5Z B;  3DLM A;  2CZ7 B;  1XTD A;  4RCB A;  4O6J A;  2HQE A;  1U1T A;  1G3Y A;  3QZ9 B;  5GAN g;  3CCS A;  3LWH A;  3JB9 H;  4F7U B;  3INZ A;  3JAM E;  4ATO A;  3CCQ T;  1EIF A;  1OZ2 A;  5A0G A;  5LJ5 g;  5D6Y A;  2K4Y A;  2QDY B;  4ELZ C;  4E47 A;  4EPC A;  2EQK A;  2EYQ A;  4JDS A;  1OI1 A;  2DK3 A;  3V7C A;  2AHJ B;  5LJ3 g;  5GAN j;  2E64 A;  1B34 B;  2YLC A;  3DB4 A;  1VQN T;  1VQP T;  4M7A E;  4M78 B;  1H64 1;  4BDY A;  4E7I A;  5LJ5 j;  5GMK m;  4M78 C;  4OGE A;  1WGS A;  3JCM e;  1KHI A;  1M4Z A;  1I5L A;  2VGM A;  3OYM A;  2A7Y A;  4JRK A;  3CCM A;  5LJ3 j;  1D3B A;  3QHS A;  4N4H A;  2FL7 A;  3BFM A;  3RKY A;  2E70 A;  1UGR B;  2OTJ T;  1W4S A;  1JBM A;  4TVR A;  2JTF A;  1YHQ A;  3PTA A;  1NJI U;  1VQ4 A;  2VV5 A;  1QP2 A;  2KMT A;  3BW1 A;  4M77 F;  2LDM A;  3X20 B;  1BI1 A;  4C8Q B;  4C92 F;  3H6Z A;  3OBW A;  3JB9 F;  4C8Q C;  3L2Q A;  3M59 A;  1VQ9 T;  4PJO A;  2JZ2 A;  5GAN f;  2P4T A;  5FLX E;  1M90 C;  2G3R A;  5A2Q E;  1H3Z A;  4BDZ A;  1LJO A;  1UB4 A;  1LOJ A;  4OVA A;  5LJ5 f;  5GAO m;  4IUT A;  1N9S A;  4N0A A;  2EJF A;  1YIJ T;  2ZGW A;  3X24 B;  5CKE A;  2DTI A;  3CBM A;  1VIF A;  3E19 A;  5LJ3 f;  2RA2 A;  3G4S A;  2NLU A;  4QVD A;  2E5Q A;  2DKG A;  4FL6 A;  2RM4 A;  3G6E A;  3GIB A;  5GMK h;  1YJN A;  3FB9 A;  4RMO A;  2RJF A;  1Q7Y C;  2VC8 A;  1X6O A;  1KQS A;  2PVD B;  2X4Y A;  2GCX A;  2XG8 D;  3CBP A;  5HY6 A;  1S72 T;  2V8I A;  3PNW C;  2JTM A;  1QVF A;  3MCA B;  4F7U A;  2BKD N;  2D6F A;  3CC7 T;  1MGQ A;  3ZFJ A;  1R8O B;  2RHZ A;  3SWN B;  3QBY A;  3M58 A;  3RUX A;  5AYF A;  3OA6 A;  3PMT A;  4PNO A;  3SWN C;  3I56 A;  4BE0 A;  3C4S A;  3CC4 A;  4II1 A;  1BI3 A;  2FYK A;  3PFS A;  2VUB A;  3J81 E;  3G6E T;  3NTH A;  3V8K A;  4C0Z A;  4HT8 A;  2KAF A;  2CZ6 B;  4L59 A;  4JS4 A;  1IRE B;  4WF2 A;  1Q81 C;  1BKB A;  2QTX A;  3LLR A;  3VYH B;  4C0D B;  4ZGE B;  5CCA A;  3LW5 E;  3CME T;  4C0D C;  4DOV A;  1KC8 U;  1YJ9 A;  3OYE A;  2XDD A;  3UDC A;  1BI2 A;  4IUU A;  1UGP B;  4JJN K;  1VQM A;  4E7K A;  3L2W A;  4J6X A;  4M78 D;  1FWZ A;  2MWO A;  3L42 A;  3JCM V;  3OQ5 A;  3L2V A;  4M7D G;  4C8Q A;  4PJO F;  2LNV A;  3M57 A;  2X4X A;  3M4Y A;  1BI0 A;  4PLL A;  4BAC A;  2RHI A;  1KHC A;  5IAY A;  4B9X A;  4JRP A;  3X26 B;  5CKH A;  3DB3 A;  4KUI A;  4A4G A;  2QXF A;  2RHX A;  3CXC A;  4MDW A;  4JUV A;  5DM7 R;  1N6A A;  2LCL A;  5FRO A;  3CCE A;  4MZP A;  3E9G A;  3GF5 A;  4QQG A;  4ZGD B;  1KD1 C;  2GFU A;  1I81 A;  5CO7 A;  4C8Q D;  5KCH A;  4JS5 A;  4M7D E;  1VUB A;  5I2S A;  2M16 A;  2B8A A;  5GAN e;  1M8V A;  2LT4 A;  3URG A;  4ME7 A;  2EJG A;  2X4J A;  5GAO n;  1BYM A;  5FU7 C;  2DXB A;  5LJ5 e;  2RD1 A;  5CAI A;  2XDB A;  4QQ6 A;  4F7U F;  4PJO E;  3CPW A;  4LD6 A;  2XIC A;  2F5T X;  5LJ3 e;  4M75 G;  3FRN A;  3JCM c;  5LJ5 h;  3CCU T;  3SWN A;  2M9U A;  2QEX T;  5C6S A;  2VYT A;  2O01 E;  2IVW A;  1QW1 A;  2EJ9 A;  2LRQ A;  2I2L A;  5LJ3 h;  4A4K A;  4C5I A;  4KT0 E;  3OYF A;  3CCQ A;  3RER A;  5D6X A;  1X01 A;  4MML A;  3LGL A;  1OYX A;  5M9O A;  3Q1J A;  2QI2 A;  1WQ7 A;  2LQ8 A;  4BUG A;  1VQN A;  2KVQ G;  2LVM A;  4M75 E;  1Q82 C;  2L3R A;  4M7A G;  3GOX A;  3JCM J;  3A8O B;  1Q7Y U;  4RG2 A;  4HCZ A;  3NFC A;  4E7J A;  3QPH A;  2QQA A;  4QW2 A;  4M7A B;  4OMF B;  4C5H A;  1QVG A;  2QA4 A;  2OTJ A;  4A4F A;  3M5A A;  2JN0 A;  2RI5 A;  3CCV T;  1AHJ B;  3BDL A;  3P8B B;  5GAM d;  3UWN A;  1I8F A;  2D0Q B;  3OMC A;  3J80 E;  4A53 A;  3MEW A;  1JRI A;  4OP0 A;  1VQ9 A;  2XDP A;  4V2S A;  4RKU E;  3QYG B;  3G71 T;  1NPR A;  2E10 A;  3TRE A;  4JLG A;  4XK8 E;  4XU0 A;  3OYD A;  4BI8 B;  3OYL A;  2PVO B;  3JCM h;  5GMK i;  1ZQ1 A;  3V8L A;  1VQO T;  1XOV A;  2QA4 T;  4JLI A;  5CK9 A;  3JCM X;  2HQX A;  3OBY A;  4FT2 A;  1YIJ A;  4KUD K;  2OTL A;  2HD0 A;  2MWP A;  4XAX B;  2X4W A;  4OB3 B;  4LDY A;  1JJ2 S;  1I4K 1;  1QVF S;  4IUQ A;  5GAN 5;  2E65 A;  5CKD A;  2RJD A;  3EFR A;  4ZTJ A;  2YHT A;  3QXE B;  3ME9 A;  3VU3 C;  1OZ3 A;  2ZCF B;  3EFS A;  1S72 A;  1WQW A;  4P5N A;  1QVP A;  1G3T A;  3AHU A;  2C06 A;  3QII A;  2RO0 A;  4J7I A;  4QQD A;  4C0F A;  4XQ3 A;  3M55 A;  3CC7 A;  3PMI A;  3QSU A;  1MHN A;  3HRS A;  5GAN 2;  2OTL T;  3OYA A;  3OYK A;  4MDX A;  3OSV A;  3HRT A;  2DPP B;  4OGC A;  4A4E A;  4J8O A;  3OW2 A;  2DXC A;  1VIE A;  1KD1 U;  4HCC A;  1M1K C;  2CYZ B;  4L6V 5;  4VUB A;  4R55 A;  1G3W A;  3CPF A;  4M7A A;  3FJP A;  2DXT A;  2RJC A;  3X25 B;  2WSF E;  3P8H A;  3CME A;  1N8R C;  3LGF A;  4BD3 A;  2JNG A;  4LDV A;  1RI0 A;  2MAM A;  2EWN A;  4EMG A;  3CCL T;  3GNG A;  3QG1 A;  4RG8 A;  3CXC S;  1HK9 A;  2ZPB B;  3H8Z A;  4Z02 A;  1B34 A;  3PT9 A;  4D6W A;  3S3N A;  3S3M A;  4M78 A;  2E6N A;  3QJY A;  3A8H B;  3X28 B;  5KE3 A;  5CR2 A;  5FRN A;  1Y96 B;  4M77 G;  4M7A D;  3VUZ A;  3OS0 A;  2F5K A;  5L8R E;  3UT1 A;  1X75 C;  4Y91 A;  4C92 G;  4CI0 C;  3JB9 G;  1G5V A;  3A8G B;  3HP9 A;  2D9T A;  5J26 A;  3CC2 T;  3CMA T;  3MP1 A;  2ZPG B;  1Q82 U;  3GNF B;  3JSC A;  3NTI A;  3EAE A;  5HK0 A;  5C0M A;  4BE1 A;  4LDW A;  2PVG B;  1VQ6 T;  4CRI A;  2EQJ A;  4Y28 E;  4M77 E;  1WJR A;  2QQ9 A;  2DTH A;  4EMK B;  3JCM d;  2RK1 A;  1YI2 T;  2RI3 A;  4C92 E;  4J5Y A;  1KG1 A;  2HBP A;  1VQ7 T;  3M53 A;  5IT9 E;  4M7D B;  1VQ5 T;  2DEQ A;  2PQW A;  3I55 T;  3OYG A;  4M7D C;  2P0Q A;  3VKI A;  3RMS A;  4JRQ A;  3QZ5 B;  1Y7X A;  2M0O A;  3SD4 A;  3OSS C;  3CCU A;  1O9S A;  2QEX A;  2PUK B;  2OAU A;  3OMG A;  4XTX A;  4XTZ A;  4JRI A;  3GPL A;  2CGH A;  3PIO A;  2K57 A;  4BI3 A;  3F70 A;  3OYC A;  3DLL A;  5KE2 A;  5GAN 7;  2FHD A;  4HT9 A;  1QP3 A;  4HA8 A;  4X9C A;  3MP6 A;  1M90 U;  4LD9 K;  3PGG A;  5I21 A;  2RHU A;  3VV0 A;  5GMK j;  1NZ9 A;  2CZ0 B;  2DO3 A;  2KDS A;  3V8J A;  2R5M A;  4E7L A;  2K2V A;  2R57 A;  1QVG S;  3E1S A;  5GAN h;  3N5B B;  3MET A;  3FDR A;  4C0G A;  2X35 A;  4IUV A;  2EFI A;  2YLB A;  4M75 A;  4J83 A;  1TH7 A;  4KBM B;  4M75 B;  3LWI A;  3L2Z A;  4M78 F;  3V7R A;  4M75 C;  4RCC A;  2E6Z A;  2L89 A;  5DY9 A;  1YBY A;  4ELY C;  3RKX A;  3CD6 T;  1UGS B;  3JRZ A;  5HK3 A;  3CCV A;  5CKB A;  2EAY A;  2K5F A;  2V8J A;  3A8M B;  1NE8 A;  4BI4 A;  1Y96 A;  4OB2 B;  5GAM g;  1VQ8 A;  2HAX A;  1FXX A;  2XD0 A;  4PJO G;  2FVU A;  1YCY A;  3MHX A;  4OF1 A;  4NL3 A;  3V7S A;  1K73 U;  3MO8 A;  1M5Q 1;  1UEB A;  1M1K U;  1K9M C;  3RKW A;  3G71 A;  3TEE A;  5GAN d;  3OS5 A;  3QKJ A;  3QDR B;  5GAM j;  2A3L A;  1VQO A;  5GAO q;  1V29 B;  2M1H A;  4C8Q F;  4M7A C;  3HHT B;  3FEO A;  3PIP A;  2LQK A;  2RK2 A;  4YTL A;  3KXT A;  4UC4 A;  3S6W A;  1NPP A;  4IUR A;  1P92 A;  1N8R U;  3L2R A;  2ZPI B;  3CEY A;  1XQH A;  4PKC C;  4PLI A;  2KY9 A;  3FIF A;  1VQ8 T;  3HRU A;  4M7D A;  1UGQ B;  2CS7 A;  1YJW T;  4M77 D;  3CBO A;  4L5G A;  3LYI A;  1Y07 A;  1YIT T;  4GLK A;  4C92 D;  3RMQ A;  2GQV A;  2K5L A;  2KK4 A;  3JB9 D;  3OW2 S;  1VQL T;  3QYH B;  4F7U G;  2WSC E;  3WXM B;  4E7H A;  2F69 A;  2P0K A;  2EKO A;  2RB6 A;  1N9R A;  1M1G A;  2K3X A;  3WVE B;  4A4H A;  5GAM f;  1KQ2 A;  4O5V A;  4M7D D;  4NOY A;  2DD5 A;  4FU6 A;  3HFN A;  4XU1 A;  1SSF A;  2DZC A;  5GAN 6;  4M78 G;  5J39 A;  2DIQ A;  3CCJ T;  3QJ6 A;  2ZZD A;  3VYG A;  2VGN A;  3OB9 A;  3M54 A;  1K8A C;  3CCR T;  4F7U E;  1PSE A;  3TU4 K;  1RL2 A;  3HSB A;  5CVI A;  1KQS S;  3JCM Q;  3L2U A;  3OY9 A;  4J6Y A;  5GAN 3;  3OYB A;  2MI6 A;  4ZN1 A;  4FIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...