4ELYC

Ccdbvfi:gyra14ec
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
98
Chain Sequence
b'SQFTLYKNKDKSSAKTYPYFVDVQSDLLDNLNTRLVIPLTPIEPSHLCPTIHIDEGDFIMLTQQMTSVPVKILSEPVNELSTFRNEIIAAIDFLITGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit A
publication title Alternative interactions define gyrase specificity in the CcdB family.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Toxin/isomerase
total genus 28
structure length 98
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4elyC00
3VUBA 5HKCA 4MZMA 5CKHA 3TCJA 5CCAA 5CQYA 5CQXA 5HK3A 4ME7A 4MDXA 3HPWA 1VUBA 1M1FA 2KMTA 3G7ZA 5CR2A 3NFCA 4ELYC 5CK9A 5DLOA 4HKEA 1NE8A 4MZPA 3JRZA 4ELZC 5HK0A 2VUBA 4VUBA 4OF1A 1UB4A 2C06A 5CO7A 3JSCA 2MF2A 5CKBA 5CKEA 5CKDA 1X75C 4MZTA 5CKFA
chains in the Genus database with same CATH superfamily
2DL5A 4EMGA 1YP5A 3EGXB 1K73C 4B9XA 1ZUYA 5GAN8 2EQJA 2RF0A 3OW2P 2X9HA 4KUDK 4E47A 2E70A 4ZGEB 1VQ7T 1KD1R 5EC7A 1ZUUA 1QWEA 3TEEA 3RBBB 2A37A 2RHUA 2XI9A 2DXBA 2EYWA 1PG5B 4M7DG 1GCPA 4HVVA 4X1VA 3OYEA 1ZBJA 4J9GA 3ZBDA 2E10A 1RLQC 2ZZDA 1K0XA 4Z88A 1OOTA 3P8HA 5DLOA 5KYUA 3LLRA 1M3CA 1OPLA 1I07A 2QTXA 4BI8B 4OP0A 1YITA 4AFSC 4FW1A 4XTUA 3PVQA 5DM7R 3HFNA 4JJBA 1YBYA 2RQTA 4OGCA 1VQPQ 5GAOn 1H92A 1YITT 2DZ9A 3I9QA 4L59A 5KE3A 3CCQA 3OYDA 1GRIA 2F1LA 3LGLA 1G2BA 1WHMA 4N4IA 2RQWA 2GFAA 2EJFA 1FMVA 2D8HA 1B34B 4FYWB 1TTHB 1N8RC 3PNWC 5A0LA 1OX9A 1MHNA 2ECZA 4KBMB 1AWJA 3G4SA 2DVEA 1UJYA 3GIBA 4M75C 1Y71A 2XMFA 3MP1A 4C8QG 1K73R 1AVZC 1V29B 2GNCA 3G4ST 5GANf 1NBEB 1UFFA 3VS5A 2KT8A 5A0DA 5FLXE 2DTOA 3TSWA 1VQ4A 1MNDA 1D1BA 1AZGB 3A8OB 4ZGJB 1I1JA 4BE1A 4XTWA 2KVQG 1UEBA 2EJ9A 2FO0A 1VQ4T 3NPFA 3VS1A 2M0OA 3J7AF 4ELZC 2DVJA 1Y0MA 5DLQE 3I5SA 3JAME 1VQNA 2K3BA 5CVIA 1JO8A 3PFSA 2O9VA 2JOYA 2LCLA 5GAMf 4M7DD 4ZN3A 2L3RA 1VQNT 2HCKA 3RKYA 3REBB 3EGXA 4KT0E 4IUPA 1WX6A 5GANg 1QCNA 3C12A 4AFZC 5C6SA 5I11A 2DX1A 1Q81R 2M51A 4M78C 4FSSA 2EW3A 2ZAEA 5KYXB 1WNLA 1X75C 3EFSA 1N8RR 3VUBA 1QVFA 3QZ5B 4A4KA 2FPFA 3E9FA 4E7ZA 2DXCA 2BE9B 1ZA2B 4M75B 3TVTA 5KYYA 4FYYB 3OYGA 1U1SA 3BY7A 1BYMA 1KIKA 3SWNC 2E3HA 1JBMA 2O4XB 3JCMc 2PUKB 4F7UG 4E7SA 4IKFA 1VQ8A 1UJ0A 4J6YA 1Q86U 4OF1A 3SDZA 1JXOA 5GAMg 2P0KA 1C1AA 5GAMh 2X4WA 4F04B 4JRQA 5CKFA 1VQ8T 4F7UE 3JCMW 4E7HA 1KQSP 3X24B 3VRYA 1UHCA 3EG9B 4M7AC 2OTJT 2CP2A 3C94A 3V7CA 2RB6A 2VC8A 2VWFA 4C8QD 1ZSGA 4A54A 5A0GA 1YWPA 2YT6A 1AT1B 2D6FA 1WJRA 2DBMA 2YUOA 4C92C 3G1JA 4M7DF 1E6HA 3FDRA 5LJ3f 1KD1U 1NE8A 1D3BB 3CPWA 2QTVA 2E41A 5FU7C 2K4YA 4JJNK 3ER0A 1VQOQ 1KJWA 1LPLA 3ZFJA 3CCSQ 4PJOG 3EGDB 1B34A 4EPCA 1ABQA 2DYIA 3E19A 2E5QA 1J3TA 2RNAA 4A53A 2LJ1A 1SF9A 1MMDA 2LTOA 5LJ3d 3E2UA 1OEBA 4OMOA 3VKIA 3H9NA 1M8VA 1GCQA 2QQ9A 4M78B 1JU5C 4J6WA 4HCZA 2LDMA 3HP9A 3NHNA 2FL7A 1N9RA 2L0AA 2QYZA 3E1SA 2EPDA 1YITQ 5LJ3g 1VOMA 2HL3A 1U3OA 3EFOB 2QG9B 4RTTA 2LQNA 4RG8A 3LWIA 4C8QF 3CCQQ 3EAEA 4QQGA 5GMKh 5LJ5d 4J9EA 3OA6A 2CYZB 3KBGA 4ESRA 5IXBA 2BZXA 4M7AB 3HRSA 1NEBA 1Y07A 7AT1B 1W2BA 1YJWA 4RTUA 1SSHA 2QEXA 4D8KA 1QLYA 3QYHB 4PL6A 5FU7B 1M90C 2DBKA 1WXTA 4RG2A 5CKDA 2VASA 1TU0B 5FWCA 1OV3A 2YUNA 4J9BA 1YJWT 2J6OA 2QEXT 5KYXA 4LDVA 3F70A 1E7OA 3CC2A 1IGQA 3M0SA 2CREA 3ZL7C 1DJ7B 1MMNA 1V1CA 4II1A 3CC2T 1NJIC 4HKEA 1NYGA 4DEXA 1Y57A 4QQ6A 3V7SA 4Z89A 1K9MR 3H0IA 2W0ZA 1BIBA 3CXCS 2LC4A 3OS2A 1JJ2P 1BK2A 3EH2A 4WTOB 2EYZA 2GBQA 2HEQA 3NTKA 4QKUA 5IHNA 4J5YA 4Z8AA 3EG9A 1VQLQ 3X28B 3CCMA 4ORZA 1D09B 1YI2Q 4OB1B 2JVVA 3V8LA 4OVAA 3VS6A 2DMOA 2QDLA 3CCMT 1D3BA 2KR3A 2EWNA 2XDPA 5I2MA 2DKGA 4F7UF 4A63B 1WGSA 4JRPA 1I81A 1YJ9Q 1RUWA 4CC7A 3M54A 5IH2A 1MUZA 3OBWA 2AZSA 2CT3A 3G6EA 4JLIA 2RJFA 2KT1A 2C06A 1G8XA 2YXYA 3P8BB 4RCBA 4AT1B 3RKWA 1UGRB 4N4GA 3G6ET 1Q7YR 2QAZA 4XU2A 2MCNA 2DLPA 2R58A 3M0UA 5GANj 4PJOF 2JXBA 3N5BB 3OYHA 3FC3A 2BZ8A 2LJ3A 5KYWA 2D1XA 3L2RA 5GMKl 1PSEA 5CKBA 1T3LA 2OJ2A 4IURA 4DBHA 2P4RA 3UATA 1M1FA 1WZOA 1A0NB 1M3AA 1U8RA 5GAMj 3A8HB 3CC7Q 1UGSB 1VQPA 1WI7A 5FRMA 1VYVA 4M75E 1YNZA 4DOWA 4EMHA 1ARKA 4PK4A 1VQPT 2LP5A 4C5HA 2CDTA 3CCVQ 1Q82U 4RTXA 4BI3A 4GBQA 3CCRQ 3UWNA 2EGEA 1IRXA 2V26A 1M2VA 3U23A 2LVMA 1I0CA 4M4ZA 2VVKA 1VQ5Q 3JCMe 4QQDA 2E3IA 3DLMA 1G3SA 2K3YA 3CD6Q 1FYNA 4J9HA 1IB8A 3M9QA 5KYUB 2V8IA 2ZGWA 3CPFA 2GCXA 2DD4A 2DF6A 1MV0B 2KSSA 1RAIB 3RKXA 4GLMA 2J05A 5I21A 4QVDA 4M78G 2NWMA 2MK5A 1RABB 2MIOA 1M30A 5LJ3j 4EMKB 4XTZA 2E6NA 1OULA 3M0QA 1X6BA 2PNIA 2OTLQ 2HMAA 2JT4A 1WFWA 4M78E 4E6RA 1BB9A 1M27C 1VIEA 2RQUA 2CKKA 1K9MU 4LNPA 5GAN6 4M7DA 3OYCA 4C5IA 3JCMQ 1NM7A 2O9SA 3LGFA 1UTIA 5GAOq 3D7SB 2FPEA 5EG2A 1RADB 1LJOA 1HJDA 1VQ9Q 4YTLA 2CP7A 5GAOm 2K2MA 5LL6S 2K5LA 2R57A 4M7AG 4M75D 4CC3A 5LJ5j 1QCOA 2JM9A 1AHJB 4C92G 3OS0A 2XICA 4A4HA 4M7AE 1BBZA 3G71Q 2RK1A 2DJQA 1N27A 1B3QA 5CKHA 1IXDA 4C92E 3L2UA 1W4SA 2DL3A 2B8AA 2K2VA 1NLPC 1BI2A 2RJEA 4Z02A 1HSQA 2HBPA 2V8KA 1QKXA 2GGRA 3NFCA 5FU6B 2RMOA 1UDLA 2RQRA 3UA7A 4LDYA 1AD5A 4JZ3A 2CZ0B 3L2QA 2HQXA 1Q7YU 4C8QA 2V8JA 3G6EQ 2I0NA 3Q1JA 5L8RE 2KEAA 1VQOA 3CCSA 5FWBA 2DNUA 3AHUA 2FYKA 2WSFE 3PT9A 2HAXA 2NYSA 2P0QA 1WHJA 2EKHA 1K8AU 2VUBA 1GCQC 1VQOT 2FRWA 2JZ2A 3CCST 2F5KA 3AT1B 2C0OA 2CP0A 4M78D 3J81E 1LOJA 4D8DA 4PKCC 5KYYB 4OGEA 2HQHA 2ROLA 2DO3A 1GBQA 4AFQC 3JSCA 3HTRA 3MHXA 2EGAA 3CCUQ 3OYBA 1KSWA 4FT2A 4OMLA 4DEYA 3HFOA 4EMKA 1K1ZA 4M7AD 2XU8A 4FL6A 4E7KA 3MO8A 4ZNXA 2BZYA 5KYNA 2HZYA 4C92D 2CH4A 2EYYA 3CCQT 1KC8C 2G6FX 4J8OA 2KRMA 1FWZA 1PD0A 3VS3A 4B6MA 1K4US 5IHKA 3SHWA 2BIVA 2NUZA 2EGCA 3S6WA 3VJPA 5GAN4 2RHXA 3KFVA 4CC2A 3MP6A 3RUXA 3L1AA 1O75A 2YWWA 3PGGA 2QQSA 1BI3A 1RAFB 2HL5C 3TU4K 2LCCA 2DPPB 4L6V5 5IT9E 4XTYA 1AZEA 2HD0A 2YLCA 4Y92A 4PJOA 3VS0A 2YRCA 2VGMA 1N9SA 1TWBA 5C0MA 1RACB 3T9NA 1I5LA 1RAAB 2KROA 3SD4A 1VQLA 5HY6A 2EQIA 5KCOA 2HKNA 4LDWA 1YI2A 3WXMB 1B7TA 4C92F 4M77B 4MDXA 1PM3A 1VQLT 2CS7A 4BB7A 4LXCA 1QVFP 1YI2T 3V8KA 5GANh 2E1HA 1QVFS 1AOJA 1ZBXA 4AG1C 1TUDA 5IHIA 1YJ9A 2E4HA 1M1GA 1TXQA 4BD3A 1KC8R 3CCJQ 1UGQB 1WQWA 2MI6A 5KE2A 2D8JA 2K7AA 2X3WD 1R0BG 2QASA 2K9GA 3M4GA 2DZCA 1YJ9T 1JXMA 3EG0A 4IUUA 5CR2A 2FG0A 3UA6A 3OS1A 4AG2C 4ZGDB 1M1KC 3JV3A 1M2OA 3VYHB 2EQKA 5I22A 3S3NA 1OZ2A 1PD1A 4QW2A 3CPWP 3BFMA 2JM8A 3UT1A 4EIKA 4LD9K 2HDAA 4X9CA 3MEVA 3CPWS 4BI4A 2OAUA 2DK3A 2QI2A 4RTWA 3X25B 2DL4A 3CMEQ 4OMPA 3LW5E 2LMJA 5D6YA 2MF2A 3INZA 1K0SA 5D7UA 3OMCA 4Q5WA 2K6DA 3I56Q 3M58A 1Y96A 3CC7A 1GL5A 2L2PA 3X26B 1VQKQ 1SPKA 2MYSA 1AWWA 4QT7A 1PCXA 3MKDA 3CC7T 1ZLMA 5HK0A 2RI5A 1KQSA 1MNEA 1YJNA 2COYA 1K9AA 2IPOB 3FJPA 3CCVA 1QP3A 5LJ5f 3CCRA 4PJLA 3GP8A 1YJNT 3OYAA 2I2LA 3MEAA 1Q95G 3CCVT 4C5GA 2EJGA 2YSQA 2RQVA 3OYMA 3QXEB 3CCRT 3I5RA 3PMIA 3GLXA 2KNBB 5GANe 2KXDA 5KYWB 2RD1A 2VKNA 5LJ3h 1XJWB 1VQ5A 4XQ3A 1W2BP 3QWYA 3PIPA 2XHCA 3SFMA 1W2BS 1QCFA 2QK0A 3CD6A 1VQ5T 4PFPA 2AKKA 1YFNA 1QW1A 4QVZA 4FU6A 3EG3A 3MJXA 1I5OB 4WF2A 1ZX6A 5GAN5 4PJJA 2KY9A 1K73U 2A36A 2WSEE 3C95A 4M77A 3CD6T 3JCMb 3EHQA 1QMCA 1UGPB 2NUTA 4FT4A 3JB9G 4M7DC 5GAMe 4KH1B 5LJ5g 2HBWA 2JMCA 5LJ5h 4MZTA 3OYJA 2OTLA 4DQ2A 4E7IA 4MZMA 2PVOB 5GAOp 1VUBA 2DERA 1M4ZA 2OTLT 2EYQA 9ATCB 3CBMA 2H8HA 1WHKA 2SRCA 3HL8A 1VQ9A 3CXCP 1M2VB 2JTEA 4CC4B 2KRNA 4JPBW 3SB2A 2RJCA 2P84A 2RH2A 3I35A 2LT4A 2KAFA 1VQ9T 4BE2A 1X2QA 1S72Q 2JMAA 2VXFA 4EDUA 2ED0A 1BU1A 4R0KA 2J06A 2MOXA 4HT8A 2SEMA 4IUTA 1D0ZA 3G71A 3CBOA 1Q81U 1C6VX 4LD6A 5FROA 4GLKA 2E6ZA 2MWOA 3G71T 1N8RU 3QUIA 2JS2A 4C8QC 1IZ6A 3JCMd 1SSFA 3VV0A 1V76A 5CQYA 4KH0B 5LJ3e 1ABOA 1T3SA 3EG2A 3PVLA 4M7DB 5GMKe 1M90R 5GAN7 3FB9A 2K57A 4J9FA 3FJ5A 3OSSC 2FEIA 2RPNA 2O01E 4FYXB 1XNIA 2MMPA 4JLGA 4ANJA 1RAHB 2M9UA 3HKSA 1D0XA 3JB9D 1NJIR 3HSBA 2ABLA 1MV3A 3CCEQ 2L3QA 4XU1A 1IO6A 1G3WA 1XQHA 3MEWA 4HA8A 2YUQA 1YHQQ 4EMKC 1UE9A 5GMKm 3LX7A 3CCUA 4M75G 2Y4XA 2PTKA 4JRKA 2ZPBB 4DBRA 3OS5A 3A5ZB 3M55A 5CAIA 4LN2A 5CKEA 5GJVB 3QYGB 2KRSA 3CCUT 4LUEA 4C8QB 1W1FA 3O8VA 1FMKA 4PJNA 4JUVA 2V1QA 1YJNQ 2XDDA 2ZPEB 3S3OA 1KQ1A 3H0HA 3QZ9B 4LE9A 2FZKB 3I55Q 4J83A 5HCKA 3CC4Q 1NZ9A 3M57A 4RTZA 2DTIA 3JB9F 1ZQ1A 1QVGS 5FW9A 3O5ZA 3OYKA 2ESWA 8AT1B 3META 1D0YA 2XKOC 2ENMA 3VRZA 2L8DA 2HQEA 2W10A 4KUIA 1QVGA 3URGA 2MPXC 2LT1A 4PJOC 3L2WA 5FU6C 2RK2A 5AYFA 1LCKA 3L2VA 1U06A 3GNFB 2GQIA 2B86A 1C0MA 1JB0E 2J6KA 1H3HA 5CQXA 4JS5A 2R5MA 4XTXA 4FSXA 2JW4A 1NG2A 2X4XA 2ZPFB 1VIFA 2CSQA 1Q86C 4AMCA 2DYBA 4ZTFA 2DIGA 2KYMA 1WDXA 3HRTA 5ECAA 3DKMA 5IAYA 2J7IA 4JS4A 4F7UB 2MAMA 1YCSB 2KDSA 4F16A 4IIOA 5A2QE 1RAEB 2VV5A 1R0CB 2AZVA 3M0TA 3CCJA 1KD1C 3OYLA 3UDCA 1YWOA 2BE7D 2RHZA 2LNHB 1MGQA 3QSUA 1Z9ZA 2DL8A 3EFRA 1PKSA 3CCJT 1PHTA 2YDLA 3RR6A 3JB9J 1H641 3A98A 1QWFA 2JN0A 3CBPA 4N0AA 4MMLA 2KBTA 1VQ6Q 1VQMQ 4JJCA 4PJOB 2BKDN 1M90U 4BE0A 1RI9A 1YIJQ 3JB9H 3OSVA 3E9GA 3GPLA 1IHWA 2QDYB 3DLLA 3DB3A 1CKBA 4BUGA 1CSKA 3J80E 2L3PA 3CMEA 5HK3A 1W70A 3NTIA 3REAB 1GFDA 4HXJA 1NJIU 1EFNA 1H3ZA 2GTJA 1UGVA 3HHTB 3CMET 1HYOA 3I56A 1Q86R 1QP2A 3CEYA 1UHFA 1VQKA 3ASKA 4M75F 3S3MA 1OX8A 1RL2A 2FZCB 3I56T 1ZSZB 1WXUA 1VQ7A 2V1RA 1CKAA 3QO3A 2PUOB 4ME7A 1TOVA 2F69A 2IVWA 1VQKT 4JJDA 1F1BB 4OMFB 3OW2S 2QA4Q 2O2OA 2KYBA 3BDLA 4RUGA 4DBFA 3FIFA 3OW2A 1PRLC 1JRIA 2XIDA 2CT4A 4A4EA 4MDWA 2FRYA 4M77C 5DY9A 4M7DE 1G3YA 3CMAA 2EQUA 2E64A 1RAGB 3NGPA 4OB0B 1M8MA 2LCSA 4J9DA 4F17A 1SHGA 3CMAT 4PJMA 2COZA 3GNGA 1NYFA 2F2XA 4BY6C 1IHVA 2YRVA 3OYFA 1QVPA 1Y96B 2K3XA 3OMGA 1ZUKA 3VU3C 2JNGA 3CCLA 3EHRA 4A4FA 4F7UA 1WHGA 3LH0A 4R55A 4M78F 1BI0A 1KHCA 3FLGA 1Q81C 3RESA 1B07A 1WYXA 3BW1A 4NL3A 3CCLT 2DFUA 4JRIA 2FB7A 2M02A 4LDXA 2LZ6B 1WQ7A 4J9IA 1BI1A 3JCMJ 2YLBA 3QDRB 2KE9A 1NPRA 3PTAA 2DRKA 1JQQA 1P92A 2K79A 3LYIA 6AT1B 2M1HA 2ZPIB 2P0PA 4ELYC 5GMKi 1OYXA 4HCBA 4ZTJA 4OMNA 2C0TA 2JJ9A 2LX9A 2JS0A 1MMGA 4C8QE 1PRMC 4DBQA 1S72A 3V7RA 2DILA 4M7AF 4PFZA 3EGUA 4XTVA 1K76A 1X69A 2KK4A 1S72T 2QGFB 2E12A 3QG1A 4N4HA 4OB3B 1BCMA 4L5GA 2RJDA 4C0ZA 2DJZA 2DA9A 2ZPHB 2NUTB 2DD5A 1M3BA 5GANd 2DEQA 2YHTA 4KGXB 1IGUA 4VUBA 2K5FA 1GFCA 2X51A 4O5VA 1LNXA 4BY6B 2PQWA 5KCHA 3A8LB 4J7FA 1R8OB 3JB9I 1M5Q1 2FVUA 4IIMA 1ZSZA 2MWPA 4JDSA 2EYXA 4O6JA 1OU9A 3OB9A 2J6FA 4B9WA 2EQMA 1OI1A 3WVEB 1KG1A 1SRMA 2RHIA 5GAMd 2PU9B 1PSFA 1WXBA 1QKWA 3QWXX 4NL2A 2JTMA 2FHDA 3IQLA 1Q82C 3CCEA 2EVRA 5J39A 4IUQA 4FW2A 1TG0A 4QVCA 1WJQA 1ACMB 2BTTA 3VS7A 2OTJA 2F2WA 2X3XD 3CCET 2Z0WA 1AWOA 4P5NA 1YHQA 2X4JA 2O88A 1XOVA 4WCIA 4HVUA 5CIUA 4XAXB 1YHQT 2D0NA 1KQSS 3EG1A 3G7ZA 3RERA 4XK8E 2XDBA 2CGHA 2VB6A 3VUZA 1VQ7Q 2AK5A 3A1PA 1I8FA 4J7IA 2DL7A 1IREB 3L2ZA 2HSPA 1ZA1B 3I55A 3RMSA 2JUFA 1G83A 2QXFA 3P8DA 4R56A 2LJ0A 4RTVA 1OZ3A 2FZGB 3EH1A 4PJOE 1RLPC 3ME9A 3QJYA 2PVDB 3V8JA 2EKOA 1UG1A 3CC4A 3I55T 2EIFA 2CUBA 1K9MC 1W6XA 2CP5A 3CQTA 1M1KR 1OQKA 3DB4A 5GAN2 3CC4T 1HK9A 3H8ZA 4MMKA 3CMAQ 1SEMA 1D1AA 2L3SA 1BKBA 3THKA 3VYGA 3R6NA 3C0CA 3RDVA 2AKLA 3M4YA 3TSZA 3LWHA 4FIBA 2HNIA 5J26A 2ATCB 2X4YA 3PE0A 5IN1A 3SWNB 3WVDB 1Q82R 1AEYA 3H41A 1R77A 1WPYA 2RM4A 1UB4A 4CI0C 4Y28E 1U5SA 3CCLQ 4HT9A 2QGGA 2LQWA 3JCMP 2EBPA 1TS9A 2PVGB 2RHYA 1BIAA 1X6GA 3L42A 4PLIA 1KK7A 3LH5A 5HKCA 1Z9QA 3OYNA 3QDFA 3MP8A 1UECA 1FXXA 3C4SA 3M56A 2G3RA 4TVRA 4C92B 3A8GB 1E6GA 2NUPB 2DAQA 3G4SQ 4RTYA 5KH6A 1NLOC 2HKQB 2HSEB 2VXEA 2XK0A 3OQ5A 3R6OA 4C0GA 1X2KA 1N6AA 4X34A 4FYVB 2GTOA 3GF5A 4KGZB 1WLPB 1Q7YC 4KGVB 4BDZA 3BE3A 2F5TX 2KGTA 2YUPA 3JCMf 2A7YA 4N0AC 4C5EA 4M75A 3FEOA 1GXIE 2D9TA 2IIMA 1YCYA 1YN8A 2GFUA 3A8MB 2WACA 1VQ4Q 2XG8D 2O4XA 1EX4A 1K8AC 2CZ6B 2LNVA 1H8KA 4PLLA 3MCAB 1PNJA 4PJOD 3GBQA 1KC8U 1XTDA 1KQ2A 2VYTA 1VQ6A 2ROTA 2RI3A 4RCCA 1VQMA 4Y91A 4RMOA 2P4TA 2CZ7B 3RIRA 1JJ2S 2WSCE 1VQNQ 3X20B 5GJWB 3CXCA 3H6ZA 1YIJA 4E2FB 1VQ6T 2ZPGB 3TQ7P 1VQMT 1VYUA 1PKTA 3M0PA 2E5KA 3GOXA 1JJ2A 4DOVA 3RMQA 2Y4YA 1MMAA 4OMQA 1YIJT 2LX7A 3OY9A 1JEGA 2BUDA 2CSIA 2CP6A 1X27A 3EGDA 3VS4A 3JCMg 2AIRB 3UPUA 3M5AA 1FX7A 3JCMh 2DE0X 3NTHA 2DM1A 3MEUA 2GQVA 4OB2B 5GAN3 3M53A 4IUVA 4M77G 3QJ6A 4UC4A 2KI7A 2LQKA 2RN8A 4HVWA 2PZ1A 5CO7A 5J3BA 5LJ5e 4M78A 2EAYA 2AT1B 4A4GA 2RI2A 4M77E 1VQ8Q 2DETA 3MPUB 2CUDA 3TCJA 1AWXA 1N5ZA 1OU8A 2OTJQ 1WHLA 5IXFA 2XD0A 4HCKA 2X35A 4LUDA 2M0YA 2QA4A 1EZZB 4HCCA 2NLUA 1NPPA 3PIOA 5GAOr 3SWNA 1Y7XA 3NMZC 4BACA 1GBRA 2A3LA 2YRDA 1K8AR 3EFOA 2QA4T 3BDUA 2A0FB 2LQ8A 4DA4A 1HXDA 2QQAA 4FCYA 1PC0A 5M9OA 1HD3A 1D1CA 1T0JA 1X6OA 4BDYA 4NOYA 4M7AA 1WHHA 3VS2A 1S1NA 3HPWA 2GF7A 2RO0A 2KQWA 2H3JA 4C92A 4X9DA 4K11A 1M1KU 3QPHA 2NUPA 1O9SA 1SHFA 1QVGP 2DXUA 4J9CA 4C0DC 4JZ4A 4KRTA 5CCAA 3M0RA 4ZN1A 2L5QA 1UUEA 2AHJB 3TREA 3RNJA 5FRNA 1SRLA 1TUGB 2JTFA 2RA2A 2F2VA 2LRQA 4OMMA 1OPKA 2QQBA 1WA7A 1KFZA 4ATOA 5D6XA 2A28A 2VGNA 2IG0A 1SKUB 2DXTA 2ED1A 2KMTA 3FRNA 4FM4B 1T0HA 2OAWA 3SEMA 3H0FA 3OBYA 1BCOA 3JCMX 2ZCFB 4M77D 3JRZA 3OYYA 2L89A 8ATCB 2O31A 1YJWQ 2DIQA 3ZEHA 1I4K1 4KULA 2A08A 4E7LA 2QEXQ 1LVKA 4V2SA 1ZSZC 2EFIA 4NS5A 1ZHIA 2QQRA 5GAOl 1PWTA 5GMKj 1TSFA 3CC2Q 1WIEA 2E65A 3KUFA 2COWA 3KXTA 2KXCA 2FPDA 2Y90A 4PFOA 1SG5A 4PNOA 4C0DB 4GY5A 1U1TA 1RI0A 3JCMV 3OYIA 1X43A 1KHIA 1NEGA 2M16A 1TUCA 3QBYA 2CH4W 3QIIA 1G5VA 4D6WA 3M59A 4RKUE 2OX7A 2H3EB 3ULRB 3UF4A 2CP3A 3CCMQ 1VYTA 5AT1B 3QHSA 1G3TA 1QQJA 4E7JA 2DTHA 4M77F 4XU0A 3PMTA 1WJSA 4C0FA 2DRMA 2OI3A 5D6WA 1M9SA 4XU3A 2R5AA 2DEUA 2D0QB 3QKJA 4J6XA 3HRUA 4F14A 5CK9A 2C0IA 1VA7A 5I2SA 4AFUC 4MZPA 1TH7A 5L23A 4CRIA 1FMWA 2CZ1B 4LDUA 1EIFA 1X01A 2K5IA
chains in the Genus database with same CATH topology
4DQ2A 5KCHA 3A8LB 4J7FA 4E7IA 1R8OB 3JB9I 1M5Q1 4MZMA 4EMGA 2FVUA 1VQPT 2PVOB 2MWPA 4C5HA 4JDSA 5GAOp 1Q82U 4O6JA 1VUBA 1K73C 1M4ZA 3OB9A 4B9XA 4BI3A 5GAN8 2EQJA 2OTLT 2EYQA 3CBMA 4KUDK 4E47A 3UWNA 2E70A 4ZGEB 1VQ7T 4B9WA 3TEEA 4MZTA 2EQMA 3HL8A 1VQ9A 1OI1A 3WVEB 1KG1A 3SB2A 2RHUA 2RHIA 2RJCA 2XI9A 5GAMd 2LVMA 2PU9B 1PSFA 2RH2A 2DXBA 3JCMe 2LT4A 4M7DG 2KAFA 4NL2A 4QQDA 1VQ9T 4BE2A 2JTMA 3OYEA 2FHDA 3DLMA 1G3SA 2VXFA 2K3YA 3ZBDA 4EDUA 1Q82C 2E10A 3CCEA 2ZZDA 4HT8A 3M9QA 3P8HA 5J39A 4IUQA 5DLOA 4IUTA 2V8IA 3G71A 3CBOA 2ZGWA 4QVCA 1Q81U 3LLRA 1WJQA 3CPFA 2OTJA 2GCXA 2DD4A 4LD6A 5FROA 3CCET 4GLKA 4P5NA 2QTXA 2KSSA 4BI8B 4OP0A 2E6ZA 2X4JA 1YITA 2MWOA 1YHQA 3RKXA 1XOVA 4XTUA 3G71T 1N8RU 5DM7R 3QUIA 3HFNA 5I21A 4C8QC 4QVDA 4M78G 1YBYA 1IZ6A 3JCMd 1SSFA 4OGCA 4XAXB 5CIUA 3VV0A 5LJ3j 4EMKB 5CQYA 5GAOn 1YHQT 1YITT 2DZ9A 4XTZA 4L59A 1KQSS 2E6NA 3G7ZA 5KE3A 3OYDA 3CCQA 3RERA 5LJ3e 4XK8E 2XDBA 3LGLA 4M78E 4N4IA 2CGHA 1VIEA 3VUZA 2CKKA 1K9MU 2GFAA 4M7DB 2EJFA 5GAN6 5GMKe 4M7DA 1I8FA 4J7IA 5GAN7 3OYCA 4C5IA 3JCMQ 1B34B 3FB9A 3LGFA 2K57A 1IREB 5GAOq 1N8RC 5EG2A 3PNWC 5A0LA 3L2ZA 3OSSC 1MHNA 1LJOA 3RMSA 2JUFA 2QXFA 3I55A 3P8DA 4KBMB 4YTLA 2O01E 3G4SA 4R56A 4BY6B 5GAOm 1OZ3A 2DVEA 3GIBA 4M75C 4PJOE 3ME9A 3QJYA 1Y71A 1XNIA 2MMPA 2PVDB 3MP1A 5LL6S 4JLGA 2K5LA 4C8QG 3V8JA 2R57A 2EKOA 4M7AG 2M9UA 4M75D 3HKSA 3CC4A 1V29B 3I55T 5LJ5j 2EIFA 3G4ST 3JB9D 1AHJB 5GANf 1K9MC 3HSBA 4C92G 3OS0A 2XICA 5A0DA 4A4HA 3DB4A 4M7AE 5FLXE 5GAN2 3CC4T 1HK9A 3H8ZA 4MMKA 2DTOA 2RK1A 4XU1A 3CXCA 1BKBA 1N27A 1VQ4A 5CKHA 3VYGA 4C92E 1G3WA 1XQHA 3L2UA 1W4SA 3MEWA 4HA8A 3A8OB 3M4YA 4ZGJB 3LWHA 4BE1A 2B8AA 2HNIA 4FIBA 4XTWA 5J26A 4EMKC 2KVQG 2K2VA 2X4YA 5IN1A 3SWNB 1BI2A 1UEBA 2EJ9A 2RJEA 4Z02A 3WVDB 2HBPA 2V8KA 1VQ4T 5GMKm 3NFCA 3LX7A 5FU6B 3CCUA 4M75G 2Y4XA 1WPYA 2M0OA 2ZPBB 4JRKA 4ELZC 3OS5A 3J7AF 4LDYA 2RM4A 1UB4A 4CI0C 4Y28E 3A5ZB 3M55A 5DLQE 5CAIA 4HT9A 3JAME 3JCMP 1VQNA 5CKEA 2CZ0B 5CVIA 3QYGB 2PVGB 3PFSA 3L2QA 3CCUT 2HQXA 2JOYA 1BIAA 2LCLA 2RHYA 3L42A 4PLIA 4C8QB 5GAMf 1Q7YU 3O8VA 4M7DD 4C8QA 5HKCA 2V8JA 4JUVA 4ZN3A 2L3RA 3Q1JA 3OYNA 1VQNT 3RKYA 2XDDA 3MP8A 5L8RE 2ZPEB 1FXXA 3C4SA 3S3OA 1KQ1A 3QZ9B 3M56A 2G3RA 4TVRA 4C92B 4KT0E 3A8GB 4IUPA 3CCSA 1VQOA 3AHUA 2FYKA 2WSFE 3PT9A 2HAXA 5GANg 2P0QA 4J83A 3C12A 2DAQA 5C6SA 1K8AU 5KH6A 2VUBA 2VXEA 3R6OA 4C0GA 2XK0A 3OQ5A 1VQOT 4M78C 2JZ2A 1N6AA 4X34A 3CCST 2F5KA 1WNLA 1X75C 3EFSA 1NZ9A 3GF5A 3M57A 1Q7YC 2DTIA 4M78D 3VUBA 3J81E 3QZ5B 4A4KA 1LOJA 4BDZA 3E9FA 1QVFA 3JB9F 1ZQ1A 1QVGS 2DXCA 4PKCC 2F5TX 4M75B 3JCMf 2A7YA 3OYKA 4N0AC 4OGEA 4M75A 4C5EA 3META 1U1SA 3BY7A 2XKOC 3FEOA 3OYGA 1BYMA 1GXIE 2D9TA 1YCYA 2GFUA 3A8MB 2WACA 2L8DA 2HQEA 3SWNC 2DO3A 1JBMA 4KUIA 2O4XB 2XG8D 1QVGA 3JCMc 3URGA 2LT1A 2O4XA 2PUKB 4F7UG 5FU6C 3L2WA 1VQ8A 2RK2A 1K8AC 2CZ6B 2LNVA 4J6YA 1Q86U 4OF1A 4PLLA 3SDZA 5AYFA 3JSCA 3MCAB 5GAMg 2P0KA 3L2VA 4PJOD 1KC8U 3GNFB 1XTDA 3MHXA 5GAMh 2X4WA 1KQ2A 2VYTA 3OYBA 4JRQA 5CKFA 1VQ6A 1VQ8T 4F7UE 3JCMW 4RCCA 2RI3A 1VQMA 4Y91A 4E7HA 4RMOA 2P4TA 3X24B 1JB0E 2CZ7B 3RIRA 4M7AC 2OTJT 1JJ2S 4FT2A 2WSCE 5CQXA 3C94A 2R5MA 3V7CA 2RB6A 2VC8A 3H6ZA 3X20B 4C8QD 4A54A 3HFOA 5A0GA 4EMKA 4XTXA 1YIJA 4FSXA 1VQ6T 4M7AD 2XU8A 2ZPGB 2D6FA 1WJRA 4FL6A 4E7KA 1VQMT 4C92C 3MO8A 4M7DF 2X4XA 2ZPFB 3FDRA 5LJ3f 1KD1U 1VIFA 1NE8A 3GOXA 1JJ2A 4DOVA 1D3BB 3CPWA 3RMQA 1Q86C 2Y4YA 2E41A 4C92D 5FU7C 1YIJT 4ZTFA 3OY9A 3CCQT 2K4YA 2DIGA 3ER0A 4JJNK 3ZFJA 1KC8C 2BUDA 4PJOG 4J8OA 1B34A 3HRTA 1FWZA 4EPCA 3JCMg 3E19A 3DKMA 5IAYA 3UPUA 4PJOC 2E5QA 3M5AA 1FX7A 3JCMh 4JS4A 2BIVA 4F7UB 3NTHA 2MAMA 2KDSA 3S6WA 4A53A 5A2QE 3VJPA 5GAN4 2RHXA 2VV5A 2LTOA 3MEUA 2GQVA 4OB2B 5LJ3d 3M53A 5GAN3 3MP6A 3CCJA 1KD1C 4IUVA 3OYLA 3UDCA 3RUXA 3L1AA 4M77G 3VKIA 3QJ6A 1O75A 4UC4A 2RHZA 3PGGA 1M8VA 2LQKA 1MGQA 2QQ9A 2QQSA 5CO7A 5J3BA 4M78B 3QSUA 4J6WA 5LJ5e 4M78A 1BI3A 4HCZA 3EFRA 2EAYA 3CCJT 2LDMA 4A4GA 3HP9A 2RI2A 4M77E 3TU4K 3JB9J 1H641 2FL7A 1N9RA 3TCJA 2JN0A 2LCCA 3CBPA 4IKFA 2DPPB 2XD0A 3E1SA 4N0AA 2X35A 4MMLA 4L6V5 2QA4A 5IT9E 4HCCA 5LJ3g 2NLUA 1NPPA 3PIOA 5GAOr 3SWNA 1Y7XA 4XTYA 4PJOB 2HD0A 2YLCA 4BACA 2BKDN 2A3LA 4PJOA 1M90U 4BE0A 2QA4T 2VGMA 1N9SA 3BDUA 4RG8A 3LWIA 3JB9H 4C8QF 3OSVA 5C0MA 3T9NA 3E9GA 2LQ8A 3GPLA 1I5LA 3EAEA 4QQGA 3SD4A 5GMKh 5LJ5d 1VQLA 2QDYB 5HY6A 4DA4A 3DLLA 3DB3A 5KCOA 1HXDA 3OA6A 2QQAA 2CYZB 3KBGA 4BUGA 5M9OA 4LDWA 1YI2A 4M7AB 3WXMB 1X6OA 3HRSA 4BDYA 4NOYA 4C92F 1Y07A 3J80E 4M7AA 3CMEA 5HK3A 4M77B 1W2BA 4MDXA 1VQLT 3HPWA 2GF7A 2CS7A 4BB7A 3NTIA 2RO0A 2KQWA 1YJWA 2H3JA 4C92A 1YI2T 1NJIU 4X9DA 3V8KA 1H3ZA 2QEXA 3HHTB 3CMET 1M1KU 3QYHB 4PL6A 3QPHA 5FU7B 5GANh 2E1HA 3I56A 1M90C 1QVFS 1O9SA 1QP2A 1ZBXA 3CEYA 4RG2A 5CKDA 1YJWT 1YJ9A 1VQKA 1M1GA 4BD3A 3ASKA 1UGQB 1WQWA 2DXUA 2MI6A 4M75F 2QEXT 4LDVA 3S3MA 4C0DC 3F70A 5KE2A 1RL2A 3I56T 5CCAA 3CC2A 1VQ7A 2PUOB 3QO3A 4ZN1A 2L5QA 3M4GA 2F69A 2DZCA 2IVWA 2AHJB 4ME7A 1YJ9T 3TREA 1VQKT 5FRNA 1DJ7B 4IUUA 5CR2A 4OMFB 2JTFA 2RA2A 4II1A 2LRQA 3CC2T 1NJIC 3OS1A 4HKEA 2QQBA 4QQ6A 3OW2S 4ZGDB 1M1KC 3V7SA 4ATOA 3VYHB 3BDLA 2EQKA 5D6XA 1BIBA 2VGNA 3CXCS 2LC4A 3FIFA 2IG0A 3S3NA 3OS2A 1OZ2A 4QW2A 3OW2A 3BFMA 3NTKA 3UT1A 4LD9K 4X9CA 1JRIA 2DXTA 4DOWA 2XIDA 4J5YA 4A4EA 4MDWA 3MEVA 2KMTA 3CPWS 3X28B 4M77C 4BI4A 5DY9A 3CCMA 2OAUA 4M7DE 3FRNA 4FM4B 1G3YA 3CMAA 2EQUA 3OBYA 2DK3A 2E64A 2QI2A 3X25B 4OB1B 3JCMX 2ZCFB 2JVVA 4OB0B 4M77D 3V8LA 4OVAA 3JRZA 3LW5E 3OYJA 3CCMT 1D3BA 3OYYA 5D6YA 2L89A 2MF2A 3INZA 2EWNA 3CMAT 3OMCA 3GNGA 2DIQA 4Q5WA 3ZEHA 1I4K1 2XDPA 4KULA 5I2MA 4BY6C 4E7LA 2YRVA 2DKGA 4F7UF 4V2SA 3M58A 3OYFA 1QVPA 1WGSA 1Y96B 2K3XA 1Y96A 3OMGA 3CC7A 3VU3C 4JRPA 2EFIA 1I81A 2JNGA 4NS5A 3X26B 1ZHIA 3CCLA 2QQRA 3M54A 4A4FA 4F7UA 4JS5A 5GAOl 3LH0A 5GMKj 3OBWA 4R55A 3FLGA 1BI0A 1KHCA 4M78F 1Q81C 3CC7T 2E65A 3KUFA 3RESA 3BW1A 4NL3A 3G6EA 4JLIA 5HK0A 2RI5A 3CCLT 2RJFA 4JRIA 1KQSA 2FB7A 1YJNA 3KXTA 2C06A 4LDXA 2Y90A 1WQ7A 3FJPA 3CCVA 4RCBA 1QP3A 3P8BB 4PNOA 3RKWA 1BI1A 3JCMJ 5LJ5f 2YLBA 4C0DB 1UGRB 3QDRB 4N4GA 4GY5A 3G6ET 1NPRA 1RI0A 1U1TA 3PTAA 3JCMV 3GP8A 3CCRA 4XU2A 3OYIA 1YJNT 3OYAA 2I2LA 1P92A 3MEAA 2R58A 3LYIA 2M1HA 1KHIA 2M16A 2ZPIB 3CCVT 5GANj 4PJOF 3QBYA 4C5GA 2EJGA 3N5BB 3OYMA 2P0PA 3QXEB 3OYHA 3FC3A 3CCRT 3PMIA 3QIIA 1G5VA 4D6WA 3GLXA 5GANe 4ELYC 3M59A 5GMKi 2RD1A 1OYXA 5LJ3h 4RKUE 4HCBA 4ZTJA 1VQ5A 4XQ3A 2LX9A 4C8QE 5GMKl 1PSEA 3L2RA 1S72A 3PIPA 5CKBA 2XHCA 3SFMA 3V7RA 3QHSA 1W2BS 1G3TA 4M7AF 3CD6A 4XTVA 1VQ5T 4E7JA 1QW1A 2DTHA 2KK4A 4M77F 3PMTA 4QVZA 1WJSA 4FU6A 4XU0A 4C0FA 4IURA 5D6WA 4WF2A 5GAN5 1S72T 1M9SA 2E12A 3QG1A 4N4HA 2KY9A 1M1FA 4OB3B 1K73U 2WSEE 4L5GA 4XU3A 2R5AA 2RJDA 3C95A 2DJZA 4M77A 4C0ZA 2ZPHB 3JCMb 3CD6T 2D0QB 3QKJA 4J6XA 3HRUA 2DD5A 5CK9A 5I2SA 1UGPB 5GANd 1U8RA 4FT4A 2DEQA 5GAMj 3A8HB 4MZPA 2YHTA 3JB9G 1TH7A 1UGSB 4VUBA 4M7DC 1VQPA 5GAMe 5FRMA 2K5FA 5LJ5g 4CRIA 4O5VA 2CZ1B 4LDUA 4M75E 1LNXA 5LJ5h 1EIFA 4EMHA 1X01A 2PQWA 2OTLA 2K5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VUB A;  5HKC A;  4MZM A;  5CKH A;  3TCJ A;  5CCA A;  5CQY A;  5CQX A;  5HK3 A;  4ME7 A;  4MDX A;  3HPW A;  1VUB A;  1M1F A;  2KMT A;  3G7Z A;  5CR2 A;  3NFC A;  4ELY C;  5CK9 A;  5DLO A;  4HKE A;  1NE8 A;  4MZP A;  3JRZ A;  4ELZ C;  5HK0 A;  2VUB A;  4VUB A;  4OF1 A;  1UB4 A;  2C06 A;  5CO7 A;  3JSC A;  2MF2 A;  5CKB A;  5CKE A;  5CKD A;  1X75 C;  4MZT A;  5CKF A; 
#chains in the Genus database with same CATH topology
 2DL5 A;  4EMG A;  1YP5 A;  3EGX B;  1K73 C;  4B9X A;  1ZUY A;  5GAN 8;  2EQJ A;  2RF0 A;  3OW2 P;  2X9H A;  4KUD K;  4E47 A;  2E70 A;  4ZGE B;  1VQ7 T;  1KD1 R;  5EC7 A;  1ZUU A;  1QWE A;  3TEE A;  3RBB B;  2A37 A;  2RHU A;  2XI9 A;  2DXB A;  2EYW A;  1PG5 B;  4M7D G;  1GCP A;  4HVV A;  4X1V A;  3OYE A;  1ZBJ A;  4J9G A;  3ZBD A;  2E10 A;  1RLQ C;  2ZZD A;  1K0X A;  4Z88 A;  1OOT A;  3P8H A;  5DLO A;  5KYU A;  3LLR A;  1M3C A;  1OPL A;  1I07 A;  2QTX A;  4BI8 B;  4OP0 A;  1YIT A;  4AFS C;  4FW1 A;  4XTU A;  3PVQ A;  5DM7 R;  3HFN A;  4JJB A;  1YBY A;  2RQT A;  4OGC A;  1VQP Q;  5GAO n;  1H92 A;  1YIT T;  2DZ9 A;  3I9Q A;  4L59 A;  5KE3 A;  3CCQ A;  3OYD A;  1GRI A;  2F1L A;  3LGL A;  1G2B A;  1WHM A;  4N4I A;  2RQW A;  2GFA A;  2EJF A;  1FMV A;  2D8H A;  1B34 B;  4FYW B;  1TTH B;  1N8R C;  3PNW C;  5A0L A;  1OX9 A;  1MHN A;  2ECZ A;  4KBM B;  1AWJ A;  3G4S A;  2DVE A;  1UJY A;  3GIB A;  4M75 C;  1Y71 A;  2XMF A;  3MP1 A;  4C8Q G;  1K73 R;  1AVZ C;  1V29 B;  2GNC A;  3G4S T;  5GAN f;  1NBE B;  1UFF A;  3VS5 A;  2KT8 A;  5A0D A;  5FLX E;  2DTO A;  3TSW A;  1VQ4 A;  1MND A;  1D1B A;  1AZG B;  3A8O B;  4ZGJ B;  1I1J A;  4BE1 A;  4XTW A;  2KVQ G;  1UEB A;  2EJ9 A;  2FO0 A;  1VQ4 T;  3NPF A;  3VS1 A;  2M0O A;  3J7A F;  4ELZ C;  2DVJ A;  1Y0M A;  5DLQ E;  3I5S A;  3JAM E;  1VQN A;  2K3B A;  5CVI A;  1JO8 A;  3PFS A;  2O9V A;  2JOY A;  2LCL A;  5GAM f;  4M7D D;  4ZN3 A;  2L3R A;  1VQN T;  2HCK A;  3RKY A;  3REB B;  3EGX A;  4KT0 E;  4IUP A;  1WX6 A;  5GAN g;  1QCN A;  3C12 A;  4AFZ C;  5C6S A;  5I11 A;  2DX1 A;  1Q81 R;  2M51 A;  4M78 C;  4FSS A;  2EW3 A;  2ZAE A;  5KYX B;  1WNL A;  1X75 C;  3EFS A;  1N8R R;  3VUB A;  1QVF A;  3QZ5 B;  4A4K A;  2FPF A;  3E9F A;  4E7Z A;  2DXC A;  2BE9 B;  1ZA2 B;  4M75 B;  3TVT A;  5KYY A;  4FYY B;  3OYG A;  1U1S A;  3BY7 A;  1BYM A;  1KIK A;  3SWN C;  2E3H A;  1JBM A;  2O4X B;  3JCM c;  2PUK B;  4F7U G;  4E7S A;  4IKF A;  1VQ8 A;  1UJ0 A;  4J6Y A;  1Q86 U;  4OF1 A;  3SDZ A;  1JXO A;  5GAM g;  2P0K A;  1C1A A;  5GAM h;  2X4W A;  4F04 B;  4JRQ A;  5CKF A;  1VQ8 T;  4F7U E;  3JCM W;  4E7H A;  1KQS P;  3X24 B;  3VRY A;  1UHC A;  3EG9 B;  4M7A C;  2OTJ T;  2CP2 A;  3C94 A;  3V7C A;  2RB6 A;  2VC8 A;  2VWF A;  4C8Q D;  1ZSG A;  4A54 A;  5A0G A;  1YWP A;  2YT6 A;  1AT1 B;  2D6F A;  1WJR A;  2DBM A;  2YUO A;  4C92 C;  3G1J A;  4M7D F;  1E6H A;  3FDR A;  5LJ3 f;  1KD1 U;  1NE8 A;  1D3B B;  3CPW A;  2QTV A;  2E41 A;  5FU7 C;  2K4Y A;  4JJN K;  3ER0 A;  1VQO Q;  1KJW A;  1LPL A;  3ZFJ A;  3CCS Q;  4PJO G;  3EGD B;  1B34 A;  4EPC A;  1ABQ A;  2DYI A;  3E19 A;  2E5Q A;  1J3T A;  2RNA A;  4A53 A;  2LJ1 A;  1SF9 A;  1MMD A;  2LTO A;  5LJ3 d;  3E2U A;  1OEB A;  4OMO A;  3VKI A;  3H9N A;  1M8V A;  1GCQ A;  2QQ9 A;  4M78 B;  1JU5 C;  4J6W A;  4HCZ A;  2LDM A;  3HP9 A;  3NHN A;  2FL7 A;  1N9R A;  2L0A A;  2QYZ A;  3E1S A;  2EPD A;  1YIT Q;  5LJ3 g;  1VOM A;  2HL3 A;  1U3O A;  3EFO B;  2QG9 B;  4RTT A;  2LQN A;  4RG8 A;  3LWI A;  4C8Q F;  3CCQ Q;  3EAE A;  4QQG A;  5GMK h;  5LJ5 d;  4J9E A;  3OA6 A;  2CYZ B;  3KBG A;  4ESR A;  5IXB A;  2BZX A;  4M7A B;  3HRS A;  1NEB A;  1Y07 A;  7AT1 B;  1W2B A;  1YJW A;  4RTU A;  1SSH A;  2QEX A;  4D8K A;  1QLY A;  3QYH B;  4PL6 A;  5FU7 B;  1M90 C;  2DBK A;  1WXT A;  4RG2 A;  5CKD A;  2VAS A;  1TU0 B;  5FWC A;  1OV3 A;  2YUN A;  4J9B A;  1YJW T;  2J6O A;  2QEX T;  5KYX A;  4LDV A;  3F70 A;  1E7O A;  3CC2 A;  1IGQ A;  3M0S A;  2CRE A;  3ZL7 C;  1DJ7 B;  1MMN A;  1V1C A;  4II1 A;  3CC2 T;  1NJI C;  4HKE A;  1NYG A;  4DEX A;  1Y57 A;  4QQ6 A;  3V7S A;  4Z89 A;  1K9M R;  3H0I A;  2W0Z A;  1BIB A;  3CXC S;  2LC4 A;  3OS2 A;  1JJ2 P;  1BK2 A;  3EH2 A;  4WTO B;  2EYZ A;  2GBQ A;  2HEQ A;  3NTK A;  4QKU A;  5IHN A;  4J5Y A;  4Z8A A;  3EG9 A;  1VQL Q;  3X28 B;  3CCM A;  4ORZ A;  1D09 B;  1YI2 Q;  4OB1 B;  2JVV A;  3V8L A;  4OVA A;  3VS6 A;  2DMO A;  2QDL A;  3CCM T;  1D3B A;  2KR3 A;  2EWN A;  2XDP A;  5I2M A;  2DKG A;  4F7U F;  4A63 B;  1WGS A;  4JRP A;  1I81 A;  1YJ9 Q;  1RUW A;  4CC7 A;  3M54 A;  5IH2 A;  1MUZ A;  3OBW A;  2AZS A;  2CT3 A;  3G6E A;  4JLI A;  2RJF A;  2KT1 A;  2C06 A;  1G8X A;  2YXY A;  3P8B B;  4RCB A;  4AT1 B;  3RKW A;  1UGR B;  4N4G A;  3G6E T;  1Q7Y R;  2QAZ A;  4XU2 A;  2MCN A;  2DLP A;  2R58 A;  3M0U A;  5GAN j;  4PJO F;  2JXB A;  3N5B B;  3OYH A;  3FC3 A;  2BZ8 A;  2LJ3 A;  5KYW A;  2D1X A;  3L2R A;  5GMK l;  1PSE A;  5CKB A;  1T3L A;  2OJ2 A;  4IUR A;  4DBH A;  2P4R A;  3UAT A;  1M1F A;  1WZO A;  1A0N B;  1M3A A;  1U8R A;  5GAM j;  3A8H B;  3CC7 Q;  1UGS B;  1VQP A;  1WI7 A;  5FRM A;  1VYV A;  4M75 E;  1YNZ A;  4DOW A;  4EMH A;  1ARK A;  4PK4 A;  1VQP T;  2LP5 A;  4C5H A;  2CDT A;  3CCV Q;  1Q82 U;  4RTX A;  4BI3 A;  4GBQ A;  3CCR Q;  3UWN A;  2EGE A;  1IRX A;  2V26 A;  1M2V A;  3U23 A;  2LVM A;  1I0C A;  4M4Z A;  2VVK A;  1VQ5 Q;  3JCM e;  4QQD A;  2E3I A;  3DLM A;  1G3S A;  2K3Y A;  3CD6 Q;  1FYN A;  4J9H A;  1IB8 A;  3M9Q A;  5KYU B;  2V8I A;  2ZGW A;  3CPF A;  2GCX A;  2DD4 A;  2DF6 A;  1MV0 B;  2KSS A;  1RAI B;  3RKX A;  4GLM A;  2J05 A;  5I21 A;  4QVD A;  4M78 G;  2NWM A;  2MK5 A;  1RAB B;  2MIO A;  1M30 A;  5LJ3 j;  4EMK B;  4XTZ A;  2E6N A;  1OUL A;  3M0Q A;  1X6B A;  2PNI A;  2OTL Q;  2HMA A;  2JT4 A;  1WFW A;  4M78 E;  4E6R A;  1BB9 A;  1M27 C;  1VIE A;  2RQU A;  2CKK A;  1K9M U;  4LNP A;  5GAN 6;  4M7D A;  3OYC A;  4C5I A;  3JCM Q;  1NM7 A;  2O9S A;  3LGF A;  1UTI A;  5GAO q;  3D7S B;  2FPE A;  5EG2 A;  1RAD B;  1LJO A;  1HJD A;  1VQ9 Q;  4YTL A;  2CP7 A;  5GAO m;  2K2M A;  5LL6 S;  2K5L A;  2R57 A;  4M7A G;  4M75 D;  4CC3 A;  5LJ5 j;  1QCO A;  2JM9 A;  1AHJ B;  4C92 G;  3OS0 A;  2XIC A;  4A4H A;  4M7A E;  1BBZ A;  3G71 Q;  2RK1 A;  2DJQ A;  1N27 A;  1B3Q A;  5CKH A;  1IXD A;  4C92 E;  3L2U A;  1W4S A;  2DL3 A;  2B8A A;  2K2V A;  1NLP C;  1BI2 A;  2RJE A;  4Z02 A;  1HSQ A;  2HBP A;  2V8K A;  1QKX A;  2GGR A;  3NFC A;  5FU6 B;  2RMO A;  1UDL A;  2RQR A;  3UA7 A;  4LDY A;  1AD5 A;  4JZ3 A;  2CZ0 B;  3L2Q A;  2HQX A;  1Q7Y U;  4C8Q A;  2V8J A;  3G6E Q;  2I0N A;  3Q1J A;  5L8R E;  2KEA A;  1VQO A;  3CCS A;  5FWB A;  2DNU A;  3AHU A;  2FYK A;  2WSF E;  3PT9 A;  2HAX A;  2NYS A;  2P0Q A;  1WHJ A;  2EKH A;  1K8A U;  2VUB A;  1GCQ C;  1VQO T;  2FRW A;  2JZ2 A;  3CCS T;  2F5K A;  3AT1 B;  2C0O A;  2CP0 A;  4M78 D;  3J81 E;  1LOJ A;  4D8D A;  4PKC C;  5KYY B;  4OGE A;  2HQH A;  2ROL A;  2DO3 A;  1GBQ A;  4AFQ C;  3JSC A;  3HTR A;  3MHX A;  2EGA A;  3CCU Q;  3OYB A;  1KSW A;  4FT2 A;  4OML A;  4DEY A;  3HFO A;  4EMK A;  1K1Z A;  4M7A D;  2XU8 A;  4FL6 A;  4E7K A;  3MO8 A;  4ZNX A;  2BZY A;  5KYN A;  2HZY A;  4C92 D;  2CH4 A;  2EYY A;  3CCQ T;  1KC8 C;  2G6F X;  4J8O A;  2KRM A;  1FWZ A;  1PD0 A;  3VS3 A;  4B6M A;  1K4U S;  5IHK A;  3SHW A;  2BIV A;  2NUZ A;  2EGC A;  3S6W A;  3VJP A;  5GAN 4;  2RHX A;  3KFV A;  4CC2 A;  3MP6 A;  3RUX A;  3L1A A;  1O75 A;  2YWW A;  3PGG A;  2QQS A;  1BI3 A;  1RAF B;  2HL5 C;  3TU4 K;  2LCC A;  2DPP B;  4L6V 5;  5IT9 E;  4XTY A;  1AZE A;  2HD0 A;  2YLC A;  4Y92 A;  4PJO A;  3VS0 A;  2YRC A;  2VGM A;  1N9S A;  1TWB A;  5C0M A;  1RAC B;  3T9N A;  1I5L A;  1RAA B;  2KRO A;  3SD4 A;  1VQL A;  5HY6 A;  2EQI A;  5KCO A;  2HKN A;  4LDW A;  1YI2 A;  3WXM B;  1B7T A;  4C92 F;  4M77 B;  4MDX A;  1PM3 A;  1VQL T;  2CS7 A;  4BB7 A;  4LXC A;  1QVF P;  1YI2 T;  3V8K A;  5GAN h;  2E1H A;  1QVF S;  1AOJ A;  1ZBX A;  4AG1 C;  1TUD A;  5IHI A;  1YJ9 A;  2E4H A;  1M1G A;  1TXQ A;  4BD3 A;  1KC8 R;  3CCJ Q;  1UGQ B;  1WQW A;  2MI6 A;  5KE2 A;  2D8J A;  2K7A A;  2X3W D;  1R0B G;  2QAS A;  2K9G A;  3M4G A;  2DZC A;  1YJ9 T;  1JXM A;  3EG0 A;  4IUU A;  5CR2 A;  2FG0 A;  3UA6 A;  3OS1 A;  4AG2 C;  4ZGD B;  1M1K C;  3JV3 A;  1M2O A;  3VYH B;  2EQK A;  5I22 A;  3S3N A;  1OZ2 A;  1PD1 A;  4QW2 A;  3CPW P;  3BFM A;  2JM8 A;  3UT1 A;  4EIK A;  4LD9 K;  2HDA A;  4X9C A;  3MEV A;  3CPW S;  4BI4 A;  2OAU A;  2DK3 A;  2QI2 A;  4RTW A;  3X25 B;  2DL4 A;  3CME Q;  4OMP A;  3LW5 E;  2LMJ A;  5D6Y A;  2MF2 A;  3INZ A;  1K0S A;  5D7U A;  3OMC A;  4Q5W A;  2K6D A;  3I56 Q;  3M58 A;  1Y96 A;  3CC7 A;  1GL5 A;  2L2P A;  3X26 B;  1VQK Q;  1SPK A;  2MYS A;  1AWW A;  4QT7 A;  1PCX A;  3MKD A;  3CC7 T;  1ZLM A;  5HK0 A;  2RI5 A;  1KQS A;  1MNE A;  1YJN A;  2COY A;  1K9A A;  2IPO B;  3FJP A;  3CCV A;  1QP3 A;  5LJ5 f;  3CCR A;  4PJL A;  3GP8 A;  1YJN T;  3OYA A;  2I2L A;  3MEA A;  1Q95 G;  3CCV T;  4C5G A;  2EJG A;  2YSQ A;  2RQV A;  3OYM A;  3QXE B;  3CCR T;  3I5R A;  3PMI A;  3GLX A;  2KNB B;  5GAN e;  2KXD A;  5KYW B;  2RD1 A;  2VKN A;  5LJ3 h;  1XJW B;  1VQ5 A;  4XQ3 A;  1W2B P;  3QWY A;  3PIP A;  2XHC A;  3SFM A;  1W2B S;  1QCF A;  2QK0 A;  3CD6 A;  1VQ5 T;  4PFP A;  2AKK A;  1YFN A;  1QW1 A;  4QVZ A;  4FU6 A;  3EG3 A;  3MJX A;  1I5O B;  4WF2 A;  1ZX6 A;  5GAN 5;  4PJJ A;  2KY9 A;  1K73 U;  2A36 A;  2WSE E;  3C95 A;  4M77 A;  3CD6 T;  3JCM b;  3EHQ A;  1QMC A;  1UGP B;  2NUT A;  4FT4 A;  3JB9 G;  4M7D C;  5GAM e;  4KH1 B;  5LJ5 g;  2HBW A;  2JMC A;  5LJ5 h;  4MZT A;  3OYJ A;  2OTL A;  4DQ2 A;  4E7I A;  4MZM A;  2PVO B;  5GAO p;  1VUB A;  2DER A;  1M4Z A;  2OTL T;  2EYQ A;  9ATC B;  3CBM A;  2H8H A;  1WHK A;  2SRC A;  3HL8 A;  1VQ9 A;  3CXC P;  1M2V B;  2JTE A;  4CC4 B;  2KRN A;  4JPB W;  3SB2 A;  2RJC A;  2P84 A;  2RH2 A;  3I35 A;  2LT4 A;  2KAF A;  1VQ9 T;  4BE2 A;  1X2Q A;  1S72 Q;  2JMA A;  2VXF A;  4EDU A;  2ED0 A;  1BU1 A;  4R0K A;  2J06 A;  2MOX A;  4HT8 A;  2SEM A;  4IUT A;  1D0Z A;  3G71 A;  3CBO A;  1Q81 U;  1C6V X;  4LD6 A;  5FRO A;  4GLK A;  2E6Z A;  2MWO A;  3G71 T;  1N8R U;  3QUI A;  2JS2 A;  4C8Q C;  1IZ6 A;  3JCM d;  1SSF A;  3VV0 A;  1V76 A;  5CQY A;  4KH0 B;  5LJ3 e;  1ABO A;  1T3S A;  3EG2 A;  3PVL A;  4M7D B;  5GMK e;  1M90 R;  5GAN 7;  3FB9 A;  2K57 A;  4J9F A;  3FJ5 A;  3OSS C;  2FEI A;  2RPN A;  2O01 E;  4FYX B;  1XNI A;  2MMP A;  4JLG A;  4ANJ A;  1RAH B;  2M9U A;  3HKS A;  1D0X A;  3JB9 D;  1NJI R;  3HSB A;  2ABL A;  1MV3 A;  3CCE Q;  2L3Q A;  4XU1 A;  1IO6 A;  1G3W A;  1XQH A;  3MEW A;  4HA8 A;  2YUQ A;  1YHQ Q;  4EMK C;  1UE9 A;  5GMK m;  3LX7 A;  3CCU A;  4M75 G;  2Y4X A;  2PTK A;  4JRK A;  2ZPB B;  4DBR A;  3OS5 A;  3A5Z B;  3M55 A;  5CAI A;  4LN2 A;  5CKE A;  5GJV B;  3QYG B;  2KRS A;  3CCU T;  4LUE A;  4C8Q B;  1W1F A;  3O8V A;  1FMK A;  4PJN A;  4JUV A;  2V1Q A;  1YJN Q;  2XDD A;  2ZPE B;  3S3O A;  1KQ1 A;  3H0H A;  3QZ9 B;  4LE9 A;  2FZK B;  3I55 Q;  4J83 A;  5HCK A;  3CC4 Q;  1NZ9 A;  3M57 A;  4RTZ A;  2DTI A;  3JB9 F;  1ZQ1 A;  1QVG S;  5FW9 A;  3O5Z A;  3OYK A;  2ESW A;  8AT1 B;  3MET A;  1D0Y A;  2XKO C;  2ENM A;  3VRZ A;  2L8D A;  2HQE A;  2W10 A;  4KUI A;  1QVG A;  3URG A;  2MPX C;  2LT1 A;  4PJO C;  3L2W A;  5FU6 C;  2RK2 A;  5AYF A;  1LCK A;  3L2V A;  1U06 A;  3GNF B;  2GQI A;  2B86 A;  1C0M A;  1JB0 E;  2J6K A;  1H3H A;  5CQX A;  4JS5 A;  2R5M A;  4XTX A;  4FSX A;  2JW4 A;  1NG2 A;  2X4X A;  2ZPF B;  1VIF A;  2CSQ A;  1Q86 C;  4AMC A;  2DYB A;  4ZTF A;  2DIG A;  2KYM A;  1WDX A;  3HRT A;  5ECA A;  3DKM A;  5IAY A;  2J7I A;  4JS4 A;  4F7U B;  2MAM A;  1YCS B;  2KDS A;  4F16 A;  4IIO A;  5A2Q E;  1RAE B;  2VV5 A;  1R0C B;  2AZV A;  3M0T A;  3CCJ A;  1KD1 C;  3OYL A;  3UDC A;  1YWO A;  2BE7 D;  2RHZ A;  2LNH B;  1MGQ A;  3QSU A;  1Z9Z A;  2DL8 A;  3EFR A;  1PKS A;  3CCJ T;  1PHT A;  2YDL A;  3RR6 A;  3JB9 J;  1H64 1;  3A98 A;  1QWF A;  2JN0 A;  3CBP A;  4N0A A;  4MML A;  2KBT A;  1VQ6 Q;  1VQM Q;  4JJC A;  4PJO B;  2BKD N;  1M90 U;  4BE0 A;  1RI9 A;  1YIJ Q;  3JB9 H;  3OSV A;  3E9G A;  3GPL A;  1IHW A;  2QDY B;  3DLL A;  3DB3 A;  1CKB A;  4BUG A;  1CSK A;  3J80 E;  2L3P A;  3CME A;  5HK3 A;  1W70 A;  3NTI A;  3REA B;  1GFD A;  4HXJ A;  1NJI U;  1EFN A;  1H3Z A;  2GTJ A;  1UGV A;  3HHT B;  3CME T;  1HYO A;  3I56 A;  1Q86 R;  1QP2 A;  3CEY A;  1UHF A;  1VQK A;  3ASK A;  4M75 F;  3S3M A;  1OX8 A;  1RL2 A;  2FZC B;  3I56 T;  1ZSZ B;  1WXU A;  1VQ7 A;  2V1R A;  1CKA A;  3QO3 A;  2PUO B;  4ME7 A;  1TOV A;  2F69 A;  2IVW A;  1VQK T;  4JJD A;  1F1B B;  4OMF B;  3OW2 S;  2QA4 Q;  2O2O A;  2KYB A;  3BDL A;  4RUG A;  4DBF A;  3FIF A;  3OW2 A;  1PRL C;  1JRI A;  2XID A;  2CT4 A;  4A4E A;  4MDW A;  2FRY A;  4M77 C;  5DY9 A;  4M7D E;  1G3Y A;  3CMA A;  2EQU A;  2E64 A;  1RAG B;  3NGP A;  4OB0 B;  1M8M A;  2LCS A;  4J9D A;  4F17 A;  1SHG A;  3CMA T;  4PJM A;  2COZ A;  3GNG A;  1NYF A;  2F2X A;  4BY6 C;  1IHV A;  2YRV A;  3OYF A;  1QVP A;  1Y96 B;  2K3X A;  3OMG A;  1ZUK A;  3VU3 C;  2JNG A;  3CCL A;  3EHR A;  4A4F A;  4F7U A;  1WHG A;  3LH0 A;  4R55 A;  4M78 F;  1BI0 A;  1KHC A;  3FLG A;  1Q81 C;  3RES A;  1B07 A;  1WYX A;  3BW1 A;  4NL3 A;  3CCL T;  2DFU A;  4JRI A;  2FB7 A;  2M02 A;  4LDX A;  2LZ6 B;  1WQ7 A;  4J9I A;  1BI1 A;  3JCM J;  2YLB A;  3QDR B;  2KE9 A;  1NPR A;  3PTA A;  2DRK A;  1JQQ A;  1P92 A;  2K79 A;  3LYI A;  6AT1 B;  2M1H A;  2ZPI B;  2P0P A;  4ELY C;  5GMK i;  1OYX A;  4HCB A;  4ZTJ A;  4OMN A;  2C0T A;  2JJ9 A;  2LX9 A;  2JS0 A;  1MMG A;  4C8Q E;  1PRM C;  4DBQ A;  1S72 A;  3V7R A;  2DIL A;  4M7A F;  4PFZ A;  3EGU A;  4XTV A;  1K76 A;  1X69 A;  2KK4 A;  1S72 T;  2QGF B;  2E12 A;  3QG1 A;  4N4H A;  4OB3 B;  1BCM A;  4L5G A;  2RJD A;  4C0Z A;  2DJZ A;  2DA9 A;  2ZPH B;  2NUT B;  2DD5 A;  1M3B A;  5GAN d;  2DEQ A;  2YHT A;  4KGX B;  1IGU A;  4VUB A;  2K5F A;  1GFC A;  2X51 A;  4O5V A;  1LNX A;  4BY6 B;  2PQW A;  5KCH A;  3A8L B;  4J7F A;  1R8O B;  3JB9 I;  1M5Q 1;  2FVU A;  4IIM A;  1ZSZ A;  2MWP A;  4JDS A;  2EYX A;  4O6J A;  1OU9 A;  3OB9 A;  2J6F A;  4B9W A;  2EQM A;  1OI1 A;  3WVE B;  1KG1 A;  1SRM A;  2RHI A;  5GAM d;  2PU9 B;  1PSF A;  1WXB A;  1QKW A;  3QWX X;  4NL2 A;  2JTM A;  2FHD A;  3IQL A;  1Q82 C;  3CCE A;  2EVR A;  5J39 A;  4IUQ A;  4FW2 A;  1TG0 A;  4QVC A;  1WJQ A;  1ACM B;  2BTT A;  3VS7 A;  2OTJ A;  2F2W A;  2X3X D;  3CCE T;  2Z0W A;  1AWO A;  4P5N A;  1YHQ A;  2X4J A;  2O88 A;  1XOV A;  4WCI A;  4HVU A;  5CIU A;  4XAX B;  1YHQ T;  2D0N A;  1KQS S;  3EG1 A;  3G7Z A;  3RER A;  4XK8 E;  2XDB A;  2CGH A;  2VB6 A;  3VUZ A;  1VQ7 Q;  2AK5 A;  3A1P A;  1I8F A;  4J7I A;  2DL7 A;  1IRE B;  3L2Z A;  2HSP A;  1ZA1 B;  3I55 A;  3RMS A;  2JUF A;  1G83 A;  2QXF A;  3P8D A;  4R56 A;  2LJ0 A;  4RTV A;  1OZ3 A;  2FZG B;  3EH1 A;  4PJO E;  1RLP C;  3ME9 A;  3QJY A;  2PVD B;  3V8J A;  2EKO A;  1UG1 A;  3CC4 A;  3I55 T;  2EIF A;  2CUB A;  1K9M C;  1W6X A;  2CP5 A;  3CQT A;  1M1K R;  1OQK A;  3DB4 A;  5GAN 2;  3CC4 T;  1HK9 A;  3H8Z A;  4MMK A;  3CMA Q;  1SEM A;  1D1A A;  2L3S A;  1BKB A;  3THK A;  3VYG A;  3R6N A;  3C0C A;  3RDV A;  2AKL A;  3M4Y A;  3TSZ A;  3LWH A;  4FIB A;  2HNI A;  5J26 A;  2ATC B;  2X4Y A;  3PE0 A;  5IN1 A;  3SWN B;  3WVD B;  1Q82 R;  1AEY A;  3H41 A;  1R77 A;  1WPY A;  2RM4 A;  1UB4 A;  4CI0 C;  4Y28 E;  1U5S A;  3CCL Q;  4HT9 A;  2QGG A;  2LQW A;  3JCM P;  2EBP A;  1TS9 A;  2PVG B;  2RHY A;  1BIA A;  1X6G A;  3L42 A;  4PLI A;  1KK7 A;  3LH5 A;  5HKC A;  1Z9Q A;  3OYN A;  3QDF A;  3MP8 A;  1UEC A;  1FXX A;  3C4S A;  3M56 A;  2G3R A;  4TVR A;  4C92 B;  3A8G B;  1E6G A;  2NUP B;  2DAQ A;  3G4S Q;  4RTY A;  5KH6 A;  1NLO C;  2HKQ B;  2HSE B;  2VXE A;  2XK0 A;  3OQ5 A;  3R6O A;  4C0G A;  1X2K A;  1N6A A;  4X34 A;  4FYV B;  2GTO A;  3GF5 A;  4KGZ B;  1WLP B;  1Q7Y C;  4KGV B;  4BDZ A;  3BE3 A;  2F5T X;  2KGT A;  2YUP A;  3JCM f;  2A7Y A;  4N0A C;  4C5E A;  4M75 A;  3FEO A;  1GXI E;  2D9T A;  2IIM A;  1YCY A;  1YN8 A;  2GFU A;  3A8M B;  2WAC A;  1VQ4 Q;  2XG8 D;  2O4X A;  1EX4 A;  1K8A C;  2CZ6 B;  2LNV A;  1H8K A;  4PLL A;  3MCA B;  1PNJ A;  4PJO D;  3GBQ A;  1KC8 U;  1XTD A;  1KQ2 A;  2VYT A;  1VQ6 A;  2ROT A;  2RI3 A;  4RCC A;  1VQM A;  4Y91 A;  4RMO A;  2P4T A;  2CZ7 B;  3RIR A;  1JJ2 S;  2WSC E;  1VQN Q;  3X20 B;  5GJW B;  3CXC A;  3H6Z A;  1YIJ A;  4E2F B;  1VQ6 T;  2ZPG B;  3TQ7 P;  1VQM T;  1VYU A;  1PKT A;  3M0P A;  2E5K A;  3GOX A;  1JJ2 A;  4DOV A;  3RMQ A;  2Y4Y A;  1MMA A;  4OMQ A;  1YIJ T;  2LX7 A;  3OY9 A;  1JEG A;  2BUD A;  2CSI A;  2CP6 A;  1X27 A;  3EGD A;  3VS4 A;  3JCM g;  2AIR B;  3UPU A;  3M5A A;  1FX7 A;  3JCM h;  2DE0 X;  3NTH A;  2DM1 A;  3MEU A;  2GQV A;  4OB2 B;  5GAN 3;  3M53 A;  4IUV A;  4M77 G;  3QJ6 A;  4UC4 A;  2KI7 A;  2LQK A;  2RN8 A;  4HVW A;  2PZ1 A;  5CO7 A;  5J3B A;  5LJ5 e;  4M78 A;  2EAY A;  2AT1 B;  4A4G A;  2RI2 A;  4M77 E;  1VQ8 Q;  2DET A;  3MPU B;  2CUD A;  3TCJ A;  1AWX A;  1N5Z A;  1OU8 A;  2OTJ Q;  1WHL A;  5IXF A;  2XD0 A;  4HCK A;  2X35 A;  4LUD A;  2M0Y A;  2QA4 A;  1EZZ B;  4HCC A;  2NLU A;  1NPP A;  3PIO A;  5GAO r;  3SWN A;  1Y7X A;  3NMZ C;  4BAC A;  1GBR A;  2A3L A;  2YRD A;  1K8A R;  3EFO A;  2QA4 T;  3BDU A;  2A0F B;  2LQ8 A;  4DA4 A;  1HXD A;  2QQA A;  4FCY A;  1PC0 A;  5M9O A;  1HD3 A;  1D1C A;  1T0J A;  1X6O A;  4BDY A;  4NOY A;  4M7A A;  1WHH A;  3VS2 A;  1S1N A;  3HPW A;  2GF7 A;  2RO0 A;  2KQW A;  2H3J A;  4C92 A;  4X9D A;  4K11 A;  1M1K U;  3QPH A;  2NUP A;  1O9S A;  1SHF A;  1QVG P;  2DXU A;  4J9C A;  4C0D C;  4JZ4 A;  4KRT A;  5CCA A;  3M0R A;  4ZN1 A;  2L5Q A;  1UUE A;  2AHJ B;  3TRE A;  3RNJ A;  5FRN A;  1SRL A;  1TUG B;  2JTF A;  2RA2 A;  2F2V A;  2LRQ A;  4OMM A;  1OPK A;  2QQB A;  1WA7 A;  1KFZ A;  4ATO A;  5D6X A;  2A28 A;  2VGN A;  2IG0 A;  1SKU B;  2DXT A;  2ED1 A;  2KMT A;  3FRN A;  4FM4 B;  1T0H A;  2OAW A;  3SEM A;  3H0F A;  3OBY A;  1BCO A;  3JCM X;  2ZCF B;  4M77 D;  3JRZ A;  3OYY A;  2L89 A;  8ATC B;  2O31 A;  1YJW Q;  2DIQ A;  3ZEH A;  1I4K 1;  4KUL A;  2A08 A;  4E7L A;  2QEX Q;  1LVK A;  4V2S A;  1ZSZ C;  2EFI A;  4NS5 A;  1ZHI A;  2QQR A;  5GAO l;  1PWT A;  5GMK j;  1TSF A;  3CC2 Q;  1WIE A;  2E65 A;  3KUF A;  2COW A;  3KXT A;  2KXC A;  2FPD A;  2Y90 A;  4PFO A;  1SG5 A;  4PNO A;  4C0D B;  4GY5 A;  1U1T A;  1RI0 A;  3JCM V;  3OYI A;  1X43 A;  1KHI A;  1NEG A;  2M16 A;  1TUC A;  3QBY A;  2CH4 W;  3QII A;  1G5V A;  4D6W A;  3M59 A;  4RKU E;  2OX7 A;  2H3E B;  3ULR B;  3UF4 A;  2CP3 A;  3CCM Q;  1VYT A;  5AT1 B;  3QHS A;  1G3T A;  1QQJ A;  4E7J A;  2DTH A;  4M77 F;  4XU0 A;  3PMT A;  1WJS A;  4C0F A;  2DRM A;  2OI3 A;  5D6W A;  1M9S A;  4XU3 A;  2R5A A;  2DEU A;  2D0Q B;  3QKJ A;  4J6X A;  3HRU A;  4F14 A;  5CK9 A;  2C0I A;  1VA7 A;  5I2S A;  4AFU C;  4MZP A;  1TH7 A;  5L23 A;  4CRI A;  1FMW A;  2CZ1 B;  4LDU A;  1EIF A;  1X01 A;  2K5I A; 
#chains in the Genus database with same CATH homology
 4DQ2 A;  5KCH A;  3A8L B;  4J7F A;  4E7I A;  1R8O B;  3JB9 I;  1M5Q 1;  4MZM A;  4EMG A;  2FVU A;  1VQP T;  2PVO B;  2MWP A;  4C5H A;  4JDS A;  5GAO p;  1Q82 U;  4O6J A;  1VUB A;  1K73 C;  1M4Z A;  3OB9 A;  4B9X A;  4BI3 A;  5GAN 8;  2EQJ A;  2OTL T;  2EYQ A;  3CBM A;  4KUD K;  4E47 A;  3UWN A;  2E70 A;  4ZGE B;  1VQ7 T;  4B9W A;  3TEE A;  4MZT A;  2EQM A;  3HL8 A;  1VQ9 A;  1OI1 A;  3WVE B;  1KG1 A;  3SB2 A;  2RHU A;  2RHI A;  2RJC A;  2XI9 A;  5GAM d;  2LVM A;  2PU9 B;  1PSF A;  2RH2 A;  2DXB A;  3JCM e;  2LT4 A;  4M7D G;  2KAF A;  4NL2 A;  4QQD A;  1VQ9 T;  4BE2 A;  2JTM A;  3OYE A;  2FHD A;  3DLM A;  1G3S A;  2VXF A;  2K3Y A;  3ZBD A;  4EDU A;  1Q82 C;  2E10 A;  3CCE A;  2ZZD A;  4HT8 A;  3M9Q A;  3P8H A;  5J39 A;  4IUQ A;  5DLO A;  4IUT A;  2V8I A;  3G71 A;  3CBO A;  2ZGW A;  4QVC A;  1Q81 U;  3LLR A;  1WJQ A;  3CPF A;  2OTJ A;  2GCX A;  2DD4 A;  4LD6 A;  5FRO A;  3CCE T;  4GLK A;  4P5N A;  2QTX A;  2KSS A;  4BI8 B;  4OP0 A;  2E6Z A;  2X4J A;  1YIT A;  2MWO A;  1YHQ A;  3RKX A;  1XOV A;  4XTU A;  3G71 T;  1N8R U;  5DM7 R;  3QUI A;  3HFN A;  5I21 A;  4C8Q C;  4QVD A;  4M78 G;  1YBY A;  1IZ6 A;  3JCM d;  1SSF A;  4OGC A;  4XAX B;  5CIU A;  3VV0 A;  5LJ3 j;  4EMK B;  5CQY A;  5GAO n;  1YHQ T;  1YIT T;  2DZ9 A;  4XTZ A;  4L59 A;  1KQS S;  2E6N A;  3G7Z A;  5KE3 A;  3OYD A;  3CCQ A;  3RER A;  5LJ3 e;  4XK8 E;  2XDB A;  3LGL A;  4M78 E;  4N4I A;  2CGH A;  1VIE A;  3VUZ A;  2CKK A;  1K9M U;  2GFA A;  4M7D B;  2EJF A;  5GAN 6;  5GMK e;  4M7D A;  1I8F A;  4J7I A;  5GAN 7;  3OYC A;  4C5I A;  3JCM Q;  1B34 B;  3FB9 A;  3LGF A;  2K57 A;  1IRE B;  5GAO q;  1N8R C;  5EG2 A;  3PNW C;  5A0L A;  3L2Z A;  3OSS C;  1MHN A;  1LJO A;  3RMS A;  2JUF A;  2QXF A;  3I55 A;  3P8D A;  4KBM B;  4YTL A;  2O01 E;  3G4S A;  4R56 A;  4BY6 B;  5GAO m;  1OZ3 A;  2DVE A;  3GIB A;  4M75 C;  4PJO E;  3ME9 A;  3QJY A;  1Y71 A;  1XNI A;  2MMP A;  2PVD B;  3MP1 A;  5LL6 S;  4JLG A;  2K5L A;  4C8Q G;  3V8J A;  2R57 A;  2EKO A;  4M7A G;  2M9U A;  4M75 D;  3HKS A;  3CC4 A;  1V29 B;  3I55 T;  5LJ5 j;  2EIF A;  3G4S T;  3JB9 D;  1AHJ B;  5GAN f;  1K9M C;  3HSB A;  4C92 G;  3OS0 A;  2XIC A;  5A0D A;  4A4H A;  3DB4 A;  4M7A E;  5FLX E;  5GAN 2;  3CC4 T;  1HK9 A;  3H8Z A;  4MMK A;  2DTO A;  2RK1 A;  4XU1 A;  3CXC A;  1BKB A;  1N27 A;  1VQ4 A;  5CKH A;  3VYG A;  4C92 E;  1G3W A;  1XQH A;  3L2U A;  1W4S A;  3MEW A;  4HA8 A;  3A8O B;  3M4Y A;  4ZGJ B;  3LWH A;  4BE1 A;  2B8A A;  2HNI A;  4FIB A;  4XTW A;  5J26 A;  4EMK C;  2KVQ G;  2K2V A;  2X4Y A;  5IN1 A;  3SWN B;  1BI2 A;  1UEB A;  2EJ9 A;  2RJE A;  4Z02 A;  3WVD B;  2HBP A;  2V8K A;  1VQ4 T;  5GMK m;  3NFC A;  3LX7 A;  5FU6 B;  3CCU A;  4M75 G;  2Y4X A;  1WPY A;  2M0O A;  2ZPB B;  4JRK A;  4ELZ C;  3OS5 A;  3J7A F;  4LDY A;  2RM4 A;  1UB4 A;  4CI0 C;  4Y28 E;  3A5Z B;  3M55 A;  5DLQ E;  5CAI A;  4HT9 A;  3JAM E;  3JCM P;  1VQN A;  5CKE A;  2CZ0 B;  5CVI A;  3QYG B;  2PVG B;  3PFS A;  3L2Q A;  3CCU T;  2HQX A;  2JOY A;  1BIA A;  2LCL A;  2RHY A;  3L42 A;  4PLI A;  4C8Q B;  5GAM f;  1Q7Y U;  3O8V A;  4M7D D;  4C8Q A;  5HKC A;  2V8J A;  4JUV A;  4ZN3 A;  2L3R A;  3Q1J A;  3OYN A;  1VQN T;  3RKY A;  2XDD A;  3MP8 A;  5L8R E;  2ZPE B;  1FXX A;  3C4S A;  3S3O A;  1KQ1 A;  3QZ9 B;  3M56 A;  2G3R A;  4TVR A;  4C92 B;  4KT0 E;  3A8G B;  4IUP A;  3CCS A;  1VQO A;  3AHU A;  2FYK A;  2WSF E;  3PT9 A;  2HAX A;  5GAN g;  2P0Q A;  4J83 A;  3C12 A;  2DAQ A;  5C6S A;  1K8A U;  5KH6 A;  2VUB A;  2VXE A;  3R6O A;  4C0G A;  2XK0 A;  3OQ5 A;  1VQO T;  4M78 C;  2JZ2 A;  1N6A A;  4X34 A;  3CCS T;  2F5K A;  1WNL A;  1X75 C;  3EFS A;  1NZ9 A;  3GF5 A;  3M57 A;  1Q7Y C;  2DTI A;  4M78 D;  3VUB A;  3J81 E;  3QZ5 B;  4A4K A;  1LOJ A;  4BDZ A;  3E9F A;  1QVF A;  3JB9 F;  1ZQ1 A;  1QVG S;  2DXC A;  4PKC C;  2F5T X;  4M75 B;  3JCM f;  2A7Y A;  3OYK A;  4N0A C;  4OGE A;  4M75 A;  4C5E A;  3MET A;  1U1S A;  3BY7 A;  2XKO C;  3FEO A;  3OYG A;  1BYM A;  1GXI E;  2D9T A;  1YCY A;  2GFU A;  3A8M B;  2WAC A;  2L8D A;  2HQE A;  3SWN C;  2DO3 A;  1JBM A;  4KUI A;  2O4X B;  2XG8 D;  1QVG A;  3JCM c;  3URG A;  2LT1 A;  2O4X A;  2PUK B;  4F7U G;  5FU6 C;  3L2W A;  1VQ8 A;  2RK2 A;  1K8A C;  2CZ6 B;  2LNV A;  4J6Y A;  1Q86 U;  4OF1 A;  4PLL A;  3SDZ A;  5AYF A;  3JSC A;  3MCA B;  5GAM g;  2P0K A;  3L2V A;  4PJO D;  1KC8 U;  3GNF B;  1XTD A;  3MHX A;  5GAM h;  2X4W A;  1KQ2 A;  2VYT A;  3OYB A;  4JRQ A;  5CKF A;  1VQ6 A;  1VQ8 T;  4F7U E;  3JCM W;  4RCC A;  2RI3 A;  1VQM A;  4Y91 A;  4E7H A;  4RMO A;  2P4T A;  3X24 B;  1JB0 E;  2CZ7 B;  3RIR A;  4M7A C;  2OTJ T;  1JJ2 S;  4FT2 A;  2WSC E;  5CQX A;  3C94 A;  2R5M A;  3V7C A;  2RB6 A;  2VC8 A;  3H6Z A;  3X20 B;  4C8Q D;  4A54 A;  3HFO A;  5A0G A;  4EMK A;  4XTX A;  1YIJ A;  4FSX A;  1VQ6 T;  4M7A D;  2XU8 A;  2ZPG B;  2D6F A;  1WJR A;  4FL6 A;  4E7K A;  1VQM T;  4C92 C;  3MO8 A;  4M7D F;  2X4X A;  2ZPF B;  3FDR A;  5LJ3 f;  1KD1 U;  1VIF A;  1NE8 A;  3GOX A;  1JJ2 A;  4DOV A;  1D3B B;  3CPW A;  3RMQ A;  1Q86 C;  2Y4Y A;  2E41 A;  4C92 D;  5FU7 C;  1YIJ T;  4ZTF A;  3OY9 A;  3CCQ T;  2K4Y A;  2DIG A;  3ER0 A;  4JJN K;  3ZFJ A;  1KC8 C;  2BUD A;  4PJO G;  4J8O A;  1B34 A;  3HRT A;  1FWZ A;  4EPC A;  3JCM g;  3E19 A;  3DKM A;  5IAY A;  3UPU A;  4PJO C;  2E5Q A;  3M5A A;  1FX7 A;  3JCM h;  4JS4 A;  2BIV A;  4F7U B;  3NTH A;  2MAM A;  2KDS A;  3S6W A;  4A53 A;  5A2Q E;  3VJP A;  5GAN 4;  2RHX A;  2VV5 A;  2LTO A;  3MEU A;  2GQV A;  4OB2 B;  5LJ3 d;  3M53 A;  5GAN 3;  3MP6 A;  3CCJ A;  1KD1 C;  4IUV A;  3OYL A;  3UDC A;  3RUX A;  3L1A A;  4M77 G;  3VKI A;  3QJ6 A;  1O75 A;  4UC4 A;  2RHZ A;  3PGG A;  1M8V A;  2LQK A;  1MGQ A;  2QQ9 A;  2QQS A;  5CO7 A;  5J3B A;  4M78 B;  3QSU A;  4J6W A;  5LJ5 e;  4M78 A;  1BI3 A;  4HCZ A;  3EFR A;  2EAY A;  3CCJ T;  2LDM A;  4A4G A;  3HP9 A;  2RI2 A;  4M77 E;  3TU4 K;  3JB9 J;  1H64 1;  2FL7 A;  1N9R A;  3TCJ A;  2JN0 A;  2LCC A;  3CBP A;  4IKF A;  2DPP B;  2XD0 A;  3E1S A;  4N0A A;  2X35 A;  4MML A;  4L6V 5;  2QA4 A;  5IT9 E;  4HCC A;  5LJ3 g;  2NLU A;  1NPP A;  3PIO A;  5GAO r;  3SWN A;  1Y7X A;  4XTY A;  4PJO B;  2HD0 A;  2YLC A;  4BAC A;  2BKD N;  2A3L A;  4PJO A;  1M90 U;  4BE0 A;  2QA4 T;  2VGM A;  1N9S A;  3BDU A;  4RG8 A;  3LWI A;  3JB9 H;  4C8Q F;  3OSV A;  5C0M A;  3T9N A;  3E9G A;  2LQ8 A;  3GPL A;  1I5L A;  3EAE A;  4QQG A;  3SD4 A;  5GMK h;  5LJ5 d;  1VQL A;  2QDY B;  5HY6 A;  4DA4 A;  3DLL A;  3DB3 A;  5KCO A;  1HXD A;  3OA6 A;  2QQA A;  2CYZ B;  3KBG A;  4BUG A;  5M9O A;  4LDW A;  1YI2 A;  4M7A B;  3WXM B;  1X6O A;  3HRS A;  4BDY A;  4NOY A;  4C92 F;  1Y07 A;  3J80 E;  4M7A A;  3CME A;  5HK3 A;  4M77 B;  1W2B A;  4MDX A;  1VQL T;  3HPW A;  2GF7 A;  2CS7 A;  4BB7 A;  3NTI A;  2RO0 A;  2KQW A;  1YJW A;  2H3J A;  4C92 A;  1YI2 T;  1NJI U;  4X9D A;  3V8K A;  1H3Z A;  2QEX A;  3HHT B;  3CME T;  1M1K U;  3QYH B;  4PL6 A;  3QPH A;  5FU7 B;  5GAN h;  2E1H A;  3I56 A;  1M90 C;  1QVF S;  1O9S A;  1QP2 A;  1ZBX A;  3CEY A;  4RG2 A;  5CKD A;  1YJW T;  1YJ9 A;  1VQK A;  1M1G A;  4BD3 A;  3ASK A;  1UGQ B;  1WQW A;  2DXU A;  2MI6 A;  4M75 F;  2QEX T;  4LDV A;  3S3M A;  4C0D C;  3F70 A;  5KE2 A;  1RL2 A;  3I56 T;  5CCA A;  3CC2 A;  1VQ7 A;  2PUO B;  3QO3 A;  4ZN1 A;  2L5Q A;  3M4G A;  2F69 A;  2DZC A;  2IVW A;  2AHJ B;  4ME7 A;  1YJ9 T;  3TRE A;  1VQK T;  5FRN A;  1DJ7 B;  4IUU A;  5CR2 A;  4OMF B;  2JTF A;  2RA2 A;  4II1 A;  2LRQ A;  3CC2 T;  1NJI C;  3OS1 A;  4HKE A;  2QQB A;  4QQ6 A;  3OW2 S;  4ZGD B;  1M1K C;  3V7S A;  4ATO A;  3VYH B;  3BDL A;  2EQK A;  5D6X A;  1BIB A;  2VGN A;  3CXC S;  2LC4 A;  3FIF A;  2IG0 A;  3S3N A;  3OS2 A;  1OZ2 A;  4QW2 A;  3OW2 A;  3BFM A;  3NTK A;  3UT1 A;  4LD9 K;  4X9C A;  1JRI A;  2DXT A;  4DOW A;  2XID A;  4J5Y A;  4A4E A;  4MDW A;  3MEV A;  2KMT A;  3CPW S;  3X28 B;  4M77 C;  4BI4 A;  5DY9 A;  3CCM A;  2OAU A;  4M7D E;  3FRN A;  4FM4 B;  1G3Y A;  3CMA A;  2EQU A;  3OBY A;  2DK3 A;  2E64 A;  2QI2 A;  3X25 B;  4OB1 B;  3JCM X;  2ZCF B;  2JVV A;  4OB0 B;  4M77 D;  3V8L A;  4OVA A;  3JRZ A;  3LW5 E;  3OYJ A;  3CCM T;  1D3B A;  3OYY A;  5D6Y A;  2L89 A;  2MF2 A;  3INZ A;  2EWN A;  3CMA T;  3OMC A;  3GNG A;  2DIQ A;  4Q5W A;  3ZEH A;  1I4K 1;  2XDP A;  4KUL A;  5I2M A;  4BY6 C;  4E7L A;  2YRV A;  2DKG A;  4F7U F;  4V2S A;  3M58 A;  3OYF A;  1QVP A;  1WGS A;  1Y96 B;  2K3X A;  1Y96 A;  3OMG A;  3CC7 A;  3VU3 C;  4JRP A;  2EFI A;  1I81 A;  2JNG A;  4NS5 A;  3X26 B;  1ZHI A;  3CCL A;  2QQR A;  3M54 A;  4A4F A;  4F7U A;  4JS5 A;  5GAO l;  3LH0 A;  5GMK j;  3OBW A;  4R55 A;  3FLG A;  1BI0 A;  1KHC A;  4M78 F;  1Q81 C;  3CC7 T;  2E65 A;  3KUF A;  3RES A;  3BW1 A;  4NL3 A;  3G6E A;  4JLI A;  5HK0 A;  2RI5 A;  3CCL T;  2RJF A;  4JRI A;  1KQS A;  2FB7 A;  1YJN A;  3KXT A;  2C06 A;  4LDX A;  2Y90 A;  1WQ7 A;  3FJP A;  3CCV A;  4RCB A;  1QP3 A;  3P8B B;  4PNO A;  3RKW A;  1BI1 A;  3JCM J;  5LJ5 f;  2YLB A;  4C0D B;  1UGR B;  3QDR B;  4N4G A;  4GY5 A;  3G6E T;  1NPR A;  1RI0 A;  1U1T A;  3PTA A;  3JCM V;  3GP8 A;  3CCR A;  4XU2 A;  3OYI A;  1YJN T;  3OYA A;  2I2L A;  1P92 A;  3MEA A;  2R58 A;  3LYI A;  2M1H A;  1KHI A;  2M16 A;  2ZPI B;  3CCV T;  5GAN j;  4PJO F;  3QBY A;  4C5G A;  2EJG A;  3N5B B;  3OYM A;  2P0P A;  3QXE B;  3OYH A;  3FC3 A;  3CCR T;  3PMI A;  3QII A;  1G5V A;  4D6W A;  3GLX A;  5GAN e;  4ELY C;  3M59 A;  5GMK i;  2RD1 A;  1OYX A;  5LJ3 h;  4RKU E;  4HCB A;  4ZTJ A;  1VQ5 A;  4XQ3 A;  2LX9 A;  4C8Q E;  5GMK l;  1PSE A;  3L2R A;  1S72 A;  3PIP A;  5CKB A;  2XHC A;  3SFM A;  3V7R A;  3QHS A;  1W2B S;  1G3T A;  4M7A F;  3CD6 A;  4XTV A;  1VQ5 T;  4E7J A;  1QW1 A;  2DTH A;  2KK4 A;  4M77 F;  3PMT A;  4QVZ A;  1WJS A;  4FU6 A;  4XU0 A;  4C0F A;  4IUR A;  5D6W A;  4WF2 A;  5GAN 5;  1S72 T;  1M9S A;  2E12 A;  3QG1 A;  4N4H A;  2KY9 A;  1M1F A;  4OB3 B;  1K73 U;  2WSE E;  4L5G A;  4XU3 A;  2R5A A;  2RJD A;  3C95 A;  2DJZ A;  4M77 A;  4C0Z A;  2ZPH B;  3JCM b;  3CD6 T;  2D0Q B;  3QKJ A;  4J6X A;  3HRU A;  2DD5 A;  5CK9 A;  5I2S A;  1UGP B;  5GAN d;  1U8R A;  4FT4 A;  2DEQ A;  5GAM j;  3A8H B;  4MZP A;  2YHT A;  3JB9 G;  1TH7 A;  1UGS B;  4VUB A;  4M7D C;  1VQP A;  5GAM e;  5FRM A;  2K5F A;  5LJ5 g;  4CRI A;  4O5V A;  2CZ1 B;  4LDU A;  4M75 E;  1LNX A;  5LJ5 h;  1EIF A;  4EMH A;  1X01 A;  2PQW A;  2OTL A;  2K5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...