4ELYC

Ccdbvfi:gyra14ec
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
98
Chain Sequence
SQFTLYKNKDKSSAKTYPYFVDVQSDLLDNLNTRLVIPLTPIEPSHLCPTIHIDEGDFIMLTQQMTSVPVKILSEPVNELSTFRNEIIAAIDFLITGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternative interactions define gyrase specificity in the CcdB family.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Toxin/isomerase
molecule keywords DNA gyrase subunit A
total genus 28
structure length 98
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4elyC00
3VUBA 3NFCA 3HPWA 5CKBA 5CKFA 4MZTA 5CQXA 2VUBA 5CCAA 5CKHA 4MZPA 4OF1A 2KMTA 1M1FA 5HK0A 5HKCA 4MDXA 1X75C 5CQYA 4VUBA 5CO7A 2MF2A 3G7ZA 1UB4A 3TCJA 5CK9A 4MZMA 1NE8A 4ME7A 3JSCA 5CKEA 5HK3A 2C06A 1VUBA 5DLOA 5CR2A 4ELZC 5CKDA 3JRZA 4ELYC 4HKEA
chains in the Genus database with same CATH superfamily
2GFUA 2RHZA 1ABOA 2FEIA 4A63B 1N9SA 3VYGA 2FPEA 3BY7A 2EGAA 3PE0A 2VXFA 2ROTA 1VQ6A 2OTJT 4XU3A 3Q1JA 3X20B 3QJYA 2KR3A 3QWXX 2LJ3A 1MUZA 1IO6A 1UB4A 3OYHA 2FZCB 5A0GA 1K73C 2O9SA 3RR6A 3OYCA 1SSHA 3UPUA 2OTJQ 3GLXA 3EFOB 2BTTA 2RJCA 1QWFA 1X6BA 3H0IA 4L6V5 2M02A 3VS4A 1GFDA 2K79A 5J3BA 2KT1A 5FRMA 5KYUA 2HMAA 2PVOB 4AFSC 5GAN6 3ZEHA 1Q95G 2BE9B 1M90R 4B6MA 1M2VA 4E2FB 3CXCA 3CC7T 1D0XA 3JSCA 2V8IA 2QYZA 1M3CA 2ED1A 2HKQB 1WPYA 1B34A 2RHUA 5IHKA 4JRKA 4C92G 2LX9A 1B07A 1X27A 1NYFA 4JJCA 3CCQT 1VQNQ 1R77A 3UATA 1PRMC 2CSIA 1TH7A 2QQBA 4ANJA 4HVVA 5GAOm 2KI7A 1G5VA 3HSBA 2HL3A 4NS5A 4J9EA 2X4JA 4ELZC 1BIAA 2EQMA 1O9SA 1BYMA 4PJOA 1SEMA 1BBZA 3FEOA 5GAMd 1QP3A 2LQ8A 3QHSA 1TTHB 1G3SA 1MV0B 1MHNA 2NUTA 5FWBA 4M7AG 3J7AF 2ZPGB 4ZN3A 3OSVA 4BY6B 1TS9A 3GP8A 1N8RC 4DBRA 3PIPA 1JBMA 2YXYA 1NEBA 2CT3A 4OMQA 4A4EA 4YTLA 1QVFS 5KYUB 2QTXA 4FU6A 3H0FA 4ZN1A 2QEXA 4BACA 1GRIA 1Q82C 1W70A 4PJOE 1KC8C 4F16A 3M55A 4C92E 2L0AA 4JPBW 5KYWB 2MF2A 2FRYA 3RMQA 2DZCA 3JCMc 3EH1A 4PFZA 4C92F 4L5GA 2LNHB 2QASA 3MP6A 1SRMA 4F17A 3HFNA 4N0AC 4B9XA 2GNCA 2NUPB 2LP5A 4KH0B 5GJVB 3OMGA 1X69A 3SWNC 1WJRA 3CCET 4QQ6A 2H8HA 2PZ1A 5KYYA 1ZHIA 1PHTA 3CCQA 2J7IA 3M0RA 4RKUE 2C06A 4M75G 1T3LA 1K1ZA 1T3SA 3TU4K 3OYBA 2EYYA 1WI7A 3CCVQ 1YHQQ 2O4XA 4C8QF 4WF2A 1GBRA 4PKCC 3G1JA 4EMHA 5LJ3j 2DNUA 1KQSA 3F70A 1XJWB 2RQVA 4IIOA 3X28B 2RQUA 2D6FA 3VU3C 1VQ8A 2ZGWA 1BK2A 3LLRA 1N8RU 4J9GA 5KCHA 3UDCA 1I07A 2DILA 1KD1R 4BE0A 3P8BB 3A1PA 2YSQA 1VUBA 4RTYA 3GF5A 1PSEA 3M59A 5HCKA 3JB9F 1M2VB 3C12A 4KGZB 1NBEB 1VQOT 2DJQA 2XDPA 2OTLT 3M4YA 2F2XA 2K6DA 4J9DA 1NYGA 3SWNA 1T0JA 3MJXA 1KC8R 2CH4W 2DEUA 3C94A 3HHTB 2FB7A 3R6NA 4WTOB 1YN8A 3A8HB 3I56Q 1QCNA 2BKDN 5GMKi 2KE9A 2QQ9A 3G6EA 4M78B 4N4HA 3JB9G 1PCXA 3CC2A 8ATCB 1MV3A 1NLPC 2C0IA 1X43A 4JLIA 4J9CA 2QEXT 4WCIA 3OYEA 4C8QD 2VXEA 3PFSA 2JM9A 2CZ1B 3PNWC 2CS7A 2G6FX 3OYAA 4NL3A 1RI0A 2NUZA 4OMPA 4RMOA 3PT9A 3CPWS 3M58A 2BE7D 2MAMA 3DLLA 2MK5A 3QZ5B 2X9HA 4RG2A 4ZGEB 4DEYA 4J6WA 3HFOA 1K9MU 1ZUKA 1YITQ 3M0PA 3EHQA 4DBFA 4BDZA 4FYVB 3CPWA 2BZ8A 2D8JA 1JJ2S 5GJWB 2XU8A 1Q86C 1LOJA 1BI2A 2JM8A 4C5IA 1MNEA 4C0ZA 1JU5C 5HK3A 3VRYA 4Q5WA 3RESA 3V7RA 1JJ2A 3ZL7C 4DBHA 3H41A 4LE9A 1VQPA 2E5QA 2RB6A 3MEAA 3VJPA 5LJ5h 3I56T 4QQGA 2VYTA 5CKHA 2FVUA 3VRZA 1M1KR 1WDXA 2ZCFB 2K5LA 2RNAA 2QAZA 2HZYA 2LT1A 1OULA 2YWWA 2E12A 4M77G 1Q82U 2JS0A 1VQKQ 2KYBA 3PGGA 1VA7A 1ZSZA 3NHNA 4X9CA 3MPUB 1NM7A 2E65A 1PD1A 3SFMA 4QW2A 1AT1B 3CCUT 2HCKA 1M1FA 2M51A 5HK0A 4JUVA 2QQSA 5AT1B 2YT6A 2OTLA 1ZBXA 4JS4A 2SEMA 3OY9A 1YJ9Q 2L3PA 3QZ9B 4FM4B 3V7CA 1Y07A 4RTVA 3TVTA 3OA6A 2ZPFB 3VS0A 5I11A 4MDXA 2BIVA 2DVEA 2DL3A 2FPFA 3M5AA 2CT4A 2KSSA 1C0MA 4M77C 5FU6C 4C8QB 2ESWA 4EPCA 2K3XA 1VQNA 3OYYA 1QP2A 2CYZB 1C1AA 3NTIA 3CMAA 2RPNA 3SEMA 1IGUA 2RQRA 1B7TA 2X3WD 2OX7A 2J05A 4Z89A 4KRTA 1U1TA 1WJQA 3H0HA 4R55A 2KXDA 4Z8AA 2J6FA 3TREA 4MMLA 1KD1C 1UGSB 2IIMA 3SHWA 4JJBA 1B3QA 4E7HA 2LRQA 1RABB 4GLKA 2NYSA 1V29B 1VYUA 3T9NA 4ZTFA 2DERA 3ZFJA 5IN1A 1K0XA 2YUNA 1U1SA 2DE0X 2KMTA 1RAAB 5A0LA 4GBQA 2A37A 2JMCA 1KG1A 5KE2A 4BI4A 1VQNT 1MGQA 2VGMA 3G71T 3CMEQ 2QG9B 5GAOq 3S3NA 2E6ZA 3EGUA 2LCSA 3GNGA 7AT1B 4HT9A 2JT4A 4PJNA 2EQIA 3LYIA 2R5AA 2ZAEA 3CBOA 5I2MA 5I2SA 4TVRA 1Y96B 4FL6A 3OYIA 2K4YA 2KK4A 5GMKh 1OOTA 2VV5A 1Y71A 1PM3A 1VQLQ 1K76A 4XTVA 1N8RR 1VQ9T 1FX7A 4XTZA 2I2LA 4DOWA 3KUFA 4C92A 2YRCA 2ZPHB 3G6EQ 3REBB 2E5KA 2AZVA 4HA8A 2YLBA 3G4SA 1UJ0A 3L2VA 3EFRA 5KYXA 2JTMA 3OYLA 2A08A 3EG0A 4CC3A 2MYSA 2HKNA 2X51A 3G6ET 5DLQE 4XU0A 3OB9A 1F1BB 3BE3A 1V1CA 5GMKe 4X1VA 1AWOA 4PL6A 3OBWA 1Y7XA 1GFCA 3X25B 1X75C 4KUIA 4RTTA 1X2QA 4M77A 3INZA 1VYTA 2HBPA 2CH4A 1AVZC 2LCLA 5CR2A 3GOXA 4P5NA 4XTWA 1GCPA 1AWWA 3RERA 3EGXA 2D1XA 2KVQG 1XTDA 2ZPBB 4C0GA 3LGFA 4F7UB 1HYOA 4J9BA 4C5HA 1K4US 1GCQA 4X9DA 3SB2A 2GGRA 4FW2A 4J6XA 2CKKA 4FW1A 5KE3A 1KFZA 3QPHA 4MMKA 5IT9E 4E7SA 4ZNXA 5J26A 3E19A 2O31A 2GF7A 1OX9A 1M9SA 3DLMA 3JCMP 1BKBA 1J3TA 1NPPA 4JRIA 1UECA 2YUPA 2Y4XA 1M27C 5CIUA 5GAOl 3ZBDA 4F14A 3THKA 4M75E 5C6SA 2YUOA 1OQKA 1IHWA 1M2OA 3QKJA 1WIEA 4ME7A 4KT0E 4M4ZA 1MMGA 2YDLA 1UDLA 3GIBA 1X2KA 4RUGA 1VQ5T 1WJSA 1WGSA 2C0TA 5FU7C 4AT1B 1I8FA 4MZPA 1K8AU 2QQAA 5FWCA 3EG9B 1KHCA 3KBGA 1M3BA 1PKTA 3HTRA 5GAN2 1WNLA 2QTVA 4QVZA 3OYMA 4HCBA 2DO3A 3WVEB 3BDLA 1G8XA 3VS2A 3L2UA 2F5TX 2EYZA 2HBWA 1VQ7A 5GMKl 1D3BB 3V8JA 1UGQB 1YJNA 4RG8A 2KROA 3I55T 4HT8A 1AD5A 2EYWA 4M7AE 1UFFA 4AMCA 1D0ZA 2DVJA 1KSWA 2DL8A 4EDUA 3SWNB 4B9WA 1HJDA 3OW2P 1IRXA 5D6WA 2EKHA 1XOVA 3JV3A 1KD1U 4LD6A 1YJWQ 2V8KA 5FW9A 3RBBB 3DKMA 2DRMA 2CZ7B 1WXBA 5IHNA 3MEUA 3M0UA 1EX4A 3G4SQ 1BI1A 4ZGDB 1K8AR 4PJJA 2WSEE 1Y57A 5FROA 5GANf 4BI3A 3CCUQ 3QO3A 1QVPA 2RMOA 3OQ5A 2E41A 3DB3A 3OSSC 1GL5A 1OI1A 3CCLA 1VQPT 2QA4A 4ELYC 3AHUA 4C8QC 4M7DG 3OS0A 2NWMA 2L89A 5A2QE 1WZOA 2P0QA 4AG2C 1ZUUA 2E4HA 1O75A 1TXQA 2DIQA 2E70A 2DXTA 4C92C 5I21A 5GANe 4M75A 1VQKA 2XK0A 3NMZC 3CBPA 2LQKA 3OW2A 1WQWA 3MEVA 2L3QA 2I0NA 4LUEA 2P4RA 2DF6A 2MIOA 1I5OB 2JTEA 2DEQA 3GBQA 4OB2B 1LJOA 2QA4Q 3I35A 4JS5A 3OS5A 6AT1B 1R0CB 2HSEB 5D7UA 1ZSZC 2EVRA 4RCBA 1VQ4A 4KH1B 1NZ9A 2RO0A 4LDWA 3MCAB 4EIKA 3CPFA 1Z9ZA 2QEXQ 1HK9A 2X4YA 5KYWA 3FJ5A 4C92B 4OMMA 2R5MA 5I22A 2L8DA 3HRUA 1AWXA 1JXMA 5GAMf 2E3HA 2VWFA 1QLYA 4R0KA 1D0YA 1NLOC 1W4SA 2XICA 1G83A 4CRIA 4RTZA 4Y28E 3VUBA 4ORZA 1Q7YC 1YCSB 1NEGA 3E1SA 3X24B 3LX7A 1BCMA 4EMGA 1YI2T 3N5BB 3J80E 1WHKA 2LJ0A 2DYIA 2RQTA 1S1NA 2M1HA 2D0NA 1E7OA 4J83A 1PNJA 2PQWA 1YBYA 3CXCP 3PIOA 2HEQA 3CCST 1WYXA 4E6RA 3FRNA 1UTIA 1U5SA 4FYXB 3RIRA 2DL4A 2AHJB 4M75F 5D6YA 1VQLA 2CP6A 2RD1A 2PNIA 1OX8A 4JRPA 2GFAA 2YRDA 2BUDA 2JS2A 4M77E 3CCJQ 3URGA 4ZTJA 2K3YA 4BE1A 3UA7A 2CP7A 2DTIA 4CC7A 1OPKA 2RI3A 5CAIA 1T0HA 1NJIU 1N9RA 4A4HA 2VUBA 1NJIC 1IB8A 2PUOB 3HRTA 4PJLA 2DBKA 2QXFA 1G3WA 2HNIA 4CC4B 4A4FA 1BB9A 1BU1A 1WLPB 2L3SA 3M9QA 2F5KA 4M7DE 4A4KA 3M54A 4GLMA 2K9GA 4MZTA 2EJ9A 1W6XA 1TUDA 3CMAT 2H3JA 4NL2A 3LW5E 5GAMg 4ATOA 2B8AA 4M7AF 1YCYA 1ZSGA 3A5ZB 5CK9A 3EGXB 1OU9A 2F69A 2QI2A 2MWPA 5KCOA 4HXJA 2EYXA 1SSFA 2RF0A 3CMAQ 4C0DB 5GMKj 5DY9A 4CI0C 1P92A 3EG2A 4M77F 5AYFA 2EBPA 2PVDB 2JN0A 2O2OA 1YP5A 1M8VA 4FSXA 2K2VA 3HL8A 3PMIA 1NG2A 3CCMA 4VUBA 2RHYA 3I9QA 1WFWA 2VKNA 3L1AA 2HL5C 4PJOF 2DLPA 5GAN7 1OYXA 3CCRT 1TWBA 4F04B 2GCXA 3V8KA 2V1QA 3CCJT 1AZEA 4J5YA 2FG0A 2ZPEB 1YI2A 2RJEA 1Q81R 4KGXB 1YFNA 4D8KA 2LX7A 2E1HA 1SHFA 4DBQA 4OGCA 2XIDA 2PUKB 4X34A 4JRQA 2PVGB 2DAQA 2E6NA 2CREA 1VQMT 4XK8E 1WHMA 2X4XA 1M90C 2QQRA 1RUWA 3C4SA 4M75D 1NPRA 4KUDK 3MKDA 3LGLA 1VOMA 4HVWA 1AHJB 2M0YA 2K3BA 5IHIA 1Q82R 4LUDA 5LJ5d 1YI2Q 1Y0MA 4LDYA 5CCAA 1PKSA 5GANd 3L2ZA 8AT1B 1AWJA 1VQ5A 3NTHA 1AZGB 1G3TA 5IH2A 5GAN8 2FRWA 2DM1A 1VIEA 4IUTA 4XAXB 3CC7Q 2DMOA 2K5FA 4O5VA 4PLLA 3M56A 5LJ5e 3EG1A 4NOYA 5CQXA 3IQLA 2OAUA 1QVGP 3TSWA 4M78A 2OI3A 4A53A 3FC3A 1U3OA 2YUQA 3CD6T 4QT7A 3JB9D 3MO8A 2EKOA 1VQ9Q 3KFVA 4JZ4A 5IXFA 4RTUA 4M7DB 4IUPA 2ZPIB 3O5ZA 2RI2A 1OZ2A 2Y90A 4M7AD 3RKXA 4FT4A 3A98A 2K5IA 3SDZA 1Q7YR 2CP5A 3RKWA 2K2MA 3RMSA 3CC4A 4LDUA 2K57A 3OBYA 3QXEB 1TSFA 2XHCA 5L8RE 5GANh 5IAYA 2LVMA 4EMKB 3E2UA 3TSZA 2DTHA 2VGNA 3WVDB 4FYWB 4J9FA 3CPWP 4IURA 1JEGA 1I1JA 4D6WA 3J81E 4PK4A 2OTLQ 4PFPA 3FLGA 1RAEB 5CO7A 3CMEA 2P84A 3TQ7P 3G7ZA 3REAB 4M7AA 1JB0E 4BB7A 4FCYA 3EG9A 2X4WA 3QYGB 3G71Q 3CMET 2KRMA 1Q81U 5KYYB 1IREB 2QDYB 2CSQA 4LN2A 2V1RA 2KEAA 2O4XB 3M0SA 1K9MR 1KK7A 3BDUA 5DM7R 4N0AA 1D3BA 2E3IA 4OVAA 4F7UG 2C0OA 2DFUA 3E9GA 4V2SA 3QSUA 3I5RA 5GAN5 3L2RA 1GBQA 2DL5A 1I5LA 2XD0A 2A3LA 3HPWA 1M30A 3M0TA 2K7AA 4M77D 2KBTA 5D6XA 1JQQA 4OB3B 2KAFA 3EGDB 1MMDA 1FYNA 1N6AA 2X3XD 3HKSA 2QK0A 2KRNA 2EGCA 3BW1A 5FU6B 3EG3A 3H8ZA 3QIIA 1IXDA 2JVVA 5GAN4 2FZKB 4HVUA 4M7AB 4QQDA 1H3ZA 1NJIR 2L2PA 2O88A 4C5EA 2CZ6B 2PU9B 3PTAA 5DLOA 1VIFA 3JB9I 1PD0A 1SG5A 2HQXA 1EZZB 3D7SB 4M77B 3OYGA 1X6OA 3E9FA 3CCVA 1YHQA 2A28A 4PLIA 3VS1A 3META 3JCMh 2LQNA 4PJOB 2ENMA 1X6GA 3A8GB 1CKAA 1VQ5Q 2NLUA 1M90U 2ATCB 2EQJA 1FXXA 2P0KA 1TUGB 1JO8A 1JJ2P 1ZQ1A 5LJ3f 4A54A 5KYNA 1OZ3A 1D1BA 1HSQA 1IHVA 2MWOA 2MPXC 4M7DA 1WQ7A 1ZLMA 2HD0A 3ASKA 4BY6C 3CBMA 2KY9A 1KJWA 1B34B 1PSFA 2V26A 2DIGA 1YITT 3OYFA 3CC4Q 2KT8A 5FLXE 4XTXA 1VQ4T 2DPPB 3CQTA 2LDMA 3CCUA 2VVKA 5CVIA 4LNPA 2F2WA 2HSPA 2QDLA 4CC2A 3EAEA 2COWA 4OF1A 4XU2A 3QWYA 3QYHB 3FJPA 3FB9A 4HCZA 4AG1C 4C0DC 4KGVB 1ARKA 1CSKA 2EW3A 1M3AA 4J9HA 1QVFP 1VQKT 1N27A 1IZ6A 2L3RA 3U23A 2GTJA 3G71A 2LCCA 4J9IA 2BZXA 1ACMB 5LJ5f 3EFOA 3WXMB 1S72T 1SRLA 2RK1A 2FO0A 4FSSA 2M0OA 4M7DF 2JMAA 3O8VA 2YHTA 2G3RA 5GAOn 3OYDA 5GAOp 3CCLT 5FU7B 1GCQC 2GQIA 4LD9K 3ER0A 1UG1A 1Y96A 1AEYA 4RTWA 2LTOA 1MNDA 3NTKA 4BUGA 1VQ8Q 1UHFA 1K0SA 1TOVA 1VQOQ 1D1CA 3OS1A 4QVCA 4M7DD 5GMKm 5FRNA 1KQSS 1I81A 1S72A 4M78C 4R56A 1UHCA 4C8QA 2RQWA 1G2BA 3EHRA 2KDSA 1W2BP 2V8JA 4M7DC 4J7IA 3P8DA 3UWNA 2WACA 2OTJA 4C0FA 4DOVA 4DA4A 1VQLT 3NPFA 2LZ6B 3S6WA 3CCJA 3QDFA 1U06A 2D0QB 1I0CA 4MDWA 1KQ2A 2QGGA 4JDSA 3MEWA 2KYMA 3RKYA 1KIKA 2NUTB 3CCMQ 1ZX6A 4E7IA 3V8LA 1FMVA 1QKXA 2RA2A 2LT4A 3BFMA 1YJ9A 1TU0B 1IGQA 3L2WA 4RTXA 4OB0B 1QVGS 1VQ7T 1YITA 2DZ9A 2IPOB 1VQMQ 2EAYA 4UC4A 4BD3A 3X26B 2RK2A 1YJWT 1YIJQ 3TCJA 1EFNA 2JNGA 2OAWA 2RN8A 2WSCE 1WX6A 5GAMe 4QKUA 2E10A 5LJ5g 2DXBA 2O9VA 1E6HA 1VQ6Q 5LJ3h 2DA9A 4LDXA 3JCMV 3JAME 3NFCA 4DQ2A 2RJDA 5J39A 1TG0A 5A0DA 5ECAA 2LQWA 1QCFA 3G4ST 4FT2A 2HQEA 4BI8B 4C8QG 3JCMf 5GAOr 3RUXA 2FL7A 3RDVA 4M78F 1RI9A 3CC4T 2IG0A 3H9NA 3CCVT 1YHQT 1BI3A 1QKWA 2FZGB 2XMFA 1ZSZB 2EQKA 1MMAA 2KGTA 4PJOG 1QMCA 9ATCB 3JCMb 1H641 1K73R 1GXIE 1UGRB 4PJOC 1KQ1A 2CP3A 2R57A 3VS5A 2L5QA 4IUVA 4IUUA 3CC2Q 2RM4A 4F7UE 1Q86R 1QVFA 4AFUC 4OGEA 1UGPB 1FMWA 2OJ2A 2XKOC 3OS2A 2A0FB 3NGPA 4RCCA 1R8OB 3QJ6A 3A8LB 2QGFB 3CD6A 5EC7A 4AFZC 4Y91A 2KRSA 1WXUA 4ZGJB 1UE9A 5L23A 1M1KU 2DETA 3FDRA 4LXCA 1A0NB 1G3YA 4M75C 1RAFB 1QCOA 2ED0A 3C95A 2FPDA 5LJ3g 3CCSA 2LMJA 1CKBA 4IUQA 3JB9H 2HAXA 2CDTA 1XNIA 2JTFA 3OYNA 1FWZA 2CP0A 2O01E 5GAN3 4C92D 4J6YA 3JCMQ 1JXOA 3GPLA 1WHLA 2D9TA 1X01A 3JCMg 5LJ3e 1SKUB 2AKKA 2DXUA 2LC4A 3OYJA 2JW4A 3VS3A 5CQYA 2KNBB 1QWEA 4PNOA 4JJDA 2XDDA 2JJ9A 3CXCS 3H6ZA 1K9AA 1YIJT 1VQMA 2LNVA 1M1GA 1H8KA 2HDAA 5GANj 3CC2T 4BDYA 4LDVA 3MHXA 5CKFA 5LJ3d 3S3OA 1UGVA 5KH6A 4M78D 2SRCA 5C0MA 1UEBA 2ZZDA 2VASA 3ULRB 4N4IA 4D8DA 3DB4A 2AKLA 1YWOA 4M75B 1W1FA 1DJ7B 4AFQC 3CCRA 1KQSP 1YWPA 4E7KA 2GQVA 1JRIA 4XU1A 4M78G 3RNJA 4M7AC 3LWIA 4MZMA 2CZ0B 2GTOA 1YJ9T 1VQOA 1WHGA 2AT1B 1YNZA 2DL7A 2P4TA 1LVKA 2MOXA 3JCMJ 1R0BG 4OP0A 1BCOA 4PJMA 2J6OA 4C5GA 3VKIA 4EMKA 2ECZA 3OYKA 1YJNQ 1HXDA 1RAIB 1K73U 4J8OA 4QVDA 3CCLQ 2KQWA 1KHIA 1RLPC 4E7JA 2DD5A 2EIFA 3M4GA 1EIFA 3OMCA 1SHGA 1Q86U 2XG8D 1OV3A 4E47A 5GANg 2P0PA 4F7UA 1D1AA 5LJ5j 4HKEA 4IKFA 2WSFE 2CUBA 3M53A 2CGHA 3CD6Q 4JJNK 1SPKA 2BZYA 2COYA 2AK5A 3QDRB 1Z9QA 3LH0A 1OPLA 1N5ZA 3QUIA 5EG2A 3P8HA 4HCCA 2QA4T 3JCMW 4II1A 5KYXB 2D8HA 2FHDA 2J06A 4E7LA 3SD4A 4EMKC 4Z02A 1K8AC 5M9OA 1M5Q1 2DXCA 2DYBA 1RAGB 5GAMj 1VQ8T 3QBYA 1ZBJA 1BI0A 1E6GA 1VQ4Q 1U8RA 2R58A 3OW2S 2XDBA 2DK3A 1I4K1 3QG1A 4PJOD 3JCMX 3UT1A 2CP2A 3GNFB 1S72Q 4OMFB 3V7SA 1WA7A 2MI6A 1H3HA 2VC8A 1QQJA 2XI9A 4N4GA 1VQPQ 3R6OA 4IIMA 3HP9A 4FYYB 4M78E 2YRVA 4HCKA 1W2BA 1RL2A 2DKGA 2F2VA 1FMKA 3S3MA 4XTYA 2EYQA 1LPLA 1YJNT 2RHXA 3EGDA 1QVGA 2AIRB 1RAHB 3PVLA 1KC8U 2FYKA 4OMLA 1Q7YU 1ZA1B 2A36A 4A4GA 2M9UA 1OU8A 3A8MB 3UF4A 3VS7A 2HQHA 4GY5A 2W10A 4KULA 3MP1A 2DTOA 1RLQC 2X35A 2RJFA 2EJGA 3PVQA 4L59A 1OEBA 1YIJA 3VYHB 1M8MA 3JCMe 3LWHA 1XQHA 2EFIA 3HRSA 4OMNA 1Q81C 4KBMB 1D09B 2CUDA 2JXBA 5LL6S 4JLGA 2IVWA 3I5SA 2EWNA 3EH2A 1QW1A 3I56A 1HD3A 1VQ9A 4PFOA 2AZSA 1H92A 4XQ3A 1WXTA 1WHJA 1W2BS 1M4ZA 4Z88A 3CCRQ 2B86A 3JCMd 1LNXA 3JB9J 5CKDA 1V76A 1TUCA 5IXBA 1K9MC 4BE2A 2RHIA 3L2QA 3AT1B 2DX1A 1WHHA 3A8OB 3CC7A 1PWTA 2MCNA 4J7FA 3VV0A 2DJZA 1SF9A 2EJFA 1ZA2B 2F1LA 2MMPA 3MP8A 2JUFA 2KXCA 3M0QA 3ME9A 3JRZA 1ZUYA 3KXTA 3CCEQ 2Y4YA 1BIBA 4F7UF 3VUZA 1C6VX 4K11A 2DD4A 1PRLC 3I55Q 5HY6A 3PMTA 2PTKA 2VB6A 3FIFA 1UJYA 4FIBA 3TEEA 4C8QE 2W0ZA 4OMOA 4Y92A 3C0CA 1VQ7Q 3CCSQ 2DRKA 2H3EB 2COZA 1MMNA 2ABLA 2EGEA 1RADB 1M1KC 2Z0WA 3I55A 4O6JA 3CCMT 1RACB 2EPDA 2EQUA 3VS6A 2YLCA 3CCEA 2GBQA 3LH5A 4E7ZA 4ESRA 2LJ1A 2NUPA 1YJWA 3UA6A 2JOYA 2M16A 1VQ6T 1ABQA 5CKBA 4JZ3A 2DBMA 2ROLA 3M57A 3L42A 1VYVA 2E64A 5HKCA 1UUEA 5GAMh 3CCQQ 2A7YA 3EFSA 2JZ2A 4XTUA 2RH2A 4OB1B 1NE8A 1LCKA 1PC0A 5CKEA 3CEYA 4DEXA 2J6KA 1AOJA 1PG5B 2RI5A
chains in the Genus database with same CATH topology
4M7DE 2GFUA 2RA2A 2RHZA 3M54A 4A4KA 2LRQA 4E7HA 4GLKA 1V29B 2LT4A 1N9SA 3BFMA 4MZTA 2EJ9A 1YJ9A 3VYGA 3BY7A 3T9NA 3L2WA 4ZTFA 3ZFJA 2VXFA 5IN1A 4OB0B 3CMAT 1U1SA 1VQ6A 2OTJT 2H3JA 4XU3A 1QVGS 1VQ7T 1YITA 2KMTA 2DZ9A 3Q1JA 4NL2A 3X20B 3LW5E 5GAMg 2EAYA 3QJYA 4UC4A 4ATOA 5A0LA 4BD3A 2B8AA 3X26B 4M7AF 1YCYA 2RK2A 3A5ZB 1UB4A 1YJWT 3TCJA 5CK9A 1KG1A 5KE2A 2WSCE 2JNGA 4BI4A 3OYHA 5A0GA 2F69A 2QI2A 5GAMe 2MWPA 2E10A 5KCOA 1MGQA 1K73C 1SSFA 2VGMA 2DXBA 5LJ5g 3OYCA 3G71T 3UPUA 5GAOq 3GLXA 5LJ3h 3S3NA 4LDXA 3JCMV 4C0DB 3JAME 2E6ZA 5GMKj 2RJCA 3NFCA 5DY9A 4CI0C 1P92A 3GNGA 4DQ2A 2RJDA 4L6V5 5J39A 4HT9A 5A0DA 4M77F 5AYFA 2PVDB 2JN0A 5J3BA 5FRMA 4FSXA 5GAN6 2PVOB 2K2VA 1M8VA 3HL8A 3LYIA 3PMIA 2R5AA 3ZEHA 3G4ST 4FT2A 3CCMA 2HQEA 4VUBA 2RHYA 3CBOA 4BI8B 4C8QG 5I2MA 5I2SA 3JCMf 5GAOr 4TVRA 3L1AA 3CXCA 3RUXA 4PJOF 3CC7T 1Y96B 2FL7A 3JSCA 4FL6A 2K4YA 2V8IA 5GAN7 3OYIA 1B34A 1WPYA 4M78F 1OYXA 3CC4T 2IG0A 2KK4A 2RHUA 2GCXA 5GMKh 3CCRT 3V8KA 3CCVT 1YHQT 2VV5A 1Y71A 4JRKA 4C92G 1BI3A 3CCJT 2LX9A 4J5YA 4XTVA 2EQKA 2ZPEB 1FX7A 4XTZA 1VQ9T 1YI2A 2I2LA 2RJEA 4PJOG 3JCMb 4DOWA 3CCQT 1H641 1GXIE 1UGRB 3KUFA 4PJOC 1KQ1A 2R57A 2L5QA 4C92A 4IUVA 4IUUA 2E1HA 2RM4A 4OGCA 2XIDA 2PUKB 2ZPHB 4X34A 4F7UE 2PVGB 4JRQA 1QVFA 1TH7A 2DAQA 2E6NA 4HA8A 2QQBA 2YLBA 4XK8E 3G4SA 1VQMT 4OGEA 5GAOm 2X4XA 1UGPB 2XKOC 2QQRA 3OS2A 3L2VA 1M90C 3EFRA 1G5VA 3HSBA 3QJ6A 1R8OB 2JTMA 4NS5A 4RCCA 3A8LB 3C4SA 2X4JA 1NPRA 4M75D 4ELZC 3OYLA 1BIAA 3LGLA 2EQMA 1O9SA 4KUDK 3CD6A 1BYMA 4Y91A 4PJOA 1AHJB 1M1KU 4ZGJB 3FEOA 5GAMd 1QP3A 2LQ8A 5DLQE 3G6ET 4XU0A 3FDRA 3OB9A 3QHSA 1G3SA 5LJ5d 4LDYA 5CCAA 1MHNA 1G3YA 4M75C 5GMKe 5GANd 3L2ZA 3OBWA 4PL6A 1Y7XA 1VQ5A 3X25B 3NTHA 4M7AG 3C95A 1G3TA 1X75C 5LJ3g 3CCSA 4KUIA 2ZPGB 4ZN3A 3J7AF 5GAN8 4IUQA 3OSVA 3JB9H 4BY6B 4M77A 3INZA 2HAXA 1XNIA 3GP8A 1N8RC 2HBPA 1VIEA 2JTFA 1JBMA 4IUTA 4XAXB 3PIPA 2LCLA 3OYNA 4A4EA 5CR2A 1FWZA 2O01E 5GAN3 3GOXA 4C92D 4J6YA 4P5NA 4YTLA 3JCMQ 1QVFS 4XTWA 3GPLA 4O5VA 2K5FA 2QTXA 4FU6A 2D9TA 1X01A 4PLLA 3M56A 3RERA 3JCMg 4ZN1A 2QEXA 5LJ5e 2KVQG 4BACA 1XTDA 2ZPBB 4NOYA 4C0GA 5CQXA 5LJ3e 3LGFA 1Q82C 4F7UB 2OAUA 2LC4A 2DXUA 4M78A 4C5HA 3OYJA 1KC8C 4PJOE 4A53A 3FC3A 3M55A 4C92E 3CD6T 5CQYA 4X9DA 3SB2A 3JB9D 4PNOA 2MF2A 3MO8A 2XDDA 4J6XA 2CKKA 2EKOA 3RMQA 2DZCA 5KE3A 3H6ZA 3CXCS 3JCMc 3QPHA 1YIJT 4MMKA 1VQMA 5IT9E 4C92F 2LNVA 4M7DB 1M1GA 3M9QA 5J26A 3E19A 4IUPA 4L5GA 2GF7A 5GANj 3CC2T 4BDYA 2ZPIB 1M9SA 3DLMA 3MP6A 2RI2A 3JCMP 4LDVA 1BKBA 3MHXA 5CKFA 1OZ2A 5LJ3d 3S3OA 2Y90A 3HFNA 5KH6A 1NPPA 4N0AC 4JRIA 4M78D 4B9XA 4M7AD 5C0MA 1UEBA 2ZZDA 3RKXA 4FT4A 3OMGA 2K5IA 2Y4XA 4N4IA 3SDZA 3RKWA 5CIUA 5GAOl 3DB4A 3ZBDA 4M75B 3SWNC 1WJRA 1DJ7B 3RMSA 4QQ6A 4LDUA 4M75E 5C6SA 3CCRA 2K57A 2GQVA 1JRIA 1ZHIA 4XU1A 4M78G 4E7KA 3OBYA 4M7AC 3QXEB 3LWIA 3QKJA 2XHCA 4ME7A 2CZ0B 4KT0E 4MZMA 5L8RE 3CCQA 4RKUE 1VQOA 1YJ9T 2C06A 5GANh 4M75G 5IAYA 2LVMA 3GIBA 2P4TA 3TU4K 4EMKB 3OYBA 1VQ5T 1WGSA 1WJSA 5FU7C 2O4XA 4OP0A 3JCMJ 2DTHA 4C8QF 4WF2A 2VGNA 3WVDB 4C5GA 3VKIA 4PKCC 4EMKA 4EMHA 5LJ3j 3OYKA 1I8FA 1HXDA 4IURA 4MZPA 1K73U 1K8AU 4J8OA 4D6WA 4QVDA 3J81E 2KQWA 3FLGA 1KQSA 1KHIA 3F70A 5CO7A 3CMEA 4E7JA 2DD5A 2EIFA 3G7ZA 2QQAA 3M4GA 1EIFA 3OMCA 1KHCA 1Q86U 2XG8D 4E47A 1JB0E 4BB7A 4M7AA 5GANg 2P0PA 3KBGA 4F7UA 3X28B 2X4WA 4HKEA 5LJ5j 3QYGB 4IKFA 2D6FA 5GAN2 2WSFE 3VU3C 1VQ8A 1WNLA 3CMET 3M53A 2ZGWA 1Q81U 1IREB 3LLRA 2QDYB 2CGHA 4QVZA 3OYMA 4JJNK 2DO3A 3WVEB 1N8RU 4HCBA 3BDLA 5KCHA 3QDRB 3LH0A 3UDCA 2O4XB 3BDUA 3L2UA 2F5TX 5DM7R 4N0AA 3QUIA 5EG2A 3P8HA 1VQ7A 1D3BA 5GMKl 1D3BB 4HCCA 2QA4T 4BE0A 3JCMW 3P8BB 4II1A 4OVAA 3V8JA 4F7UG 1UGQB 2FHDA 4E7LA 1YJNA 4RG8A 3SD4A 3E9GA 3I55T 1VUBA 4Z02A 4EMKC 3QSUA 4V2SA 4HT8A 3GF5A 1K8AC 5GAN5 1PSEA 3L2RA 4M7AE 3M59A 5M9OA 3JB9F 1I5LA 3C12A 2XD0A 2A3LA 3HPWA 1M5Q1 2DXCA 4EDUA 3SWNB 4B9WA 5GAMj 4M77D 1VQOT 2XDPA 5D6WA 2OTLT 3M4YA 1VQ8T 1XOVA 3SWNA 1KD1U 3QBYA 4LD6A 1BI0A 5D6XA 1U8RA 3C94A 2V8KA 2R58A 3HHTB 2KAFA 4OB3B 3OW2S 2DK3A 2XDBA 2FB7A 3DKMA 1I4K1 3QG1A 2CZ7B 4PJOD 3JCMX 3UT1A 3GNFB 1N6AA 3A8HB 3HKSA 3MEUA 4OMFB 3V7SA 1BI1A 2BKDN 2MI6A 3BW1A 5GMKi 5FU6B 4ZGDB 2VC8A 2QQ9A 3G6EA 4M78B 2WSEE 4N4HA 3JB9G 2XI9A 4N4GA 3CC2A 3H8ZA 3QIIA 5FROA 5GANf 4BI3A 2JVVA 5GAN4 3QO3A 3R6OA 4JLIA 3HP9A 1QVPA 4QQDA 4M7AB 1H3ZA 4M78E 2YRVA 3OQ5A 2QEXT 2E41A 3OYEA 3DB3A 4C8QD 2VXEA 3PFSA 4C5EA 1W2BA 1RL2A 2CZ1B 2DKGA 3PNWC 3S3MA 2CZ6B 2PU9B 4XTYA 2CS7A 2EYQA 1YJNT 3OSSC 2RHXA 1OI1A 3OYAA 3PTAA 3CCLA 1QVGA 5DLOA 4NL3A 1VQPT 2QA4A 3CCET 1VIFA 3JB9I 2HQXA 4ELYC 1KC8U 3AHUA 1RI0A 2FYKA 1Q7YU 4C8QC 4M77B 4RMOA 3OYGA 1X6OA 3E9FA 3PT9A 3OS0A 4M7DG 4A4GA 3CPWS 2L89A 3CCVA 1YHQA 5A2QE 2P0QA 2M9UA 4PLIA 1O75A 3A8MB 2DIQA 2E70A 3M58A 3META 2DXTA 3JCMh 4C92C 5I21A 4PJOB 2MAMA 5GANe 1VQNT 3DLLA 3A8GB 4GY5A 4M75A 1VQKA 4KULA 3MP1A 2XK0A 2DTOA 1M90U 2NLUA 2RJFA 2EJGA 2X35A 3CBPA 2LQKA 3QZ5B 2EQJA 4L59A 3OW2A 1FXXA 1YIJA 4RG2A 2P0KA 3VYHB 4ZGEB 3JCMe 3LWHA 1WQWA 1XQHA 2EFIA 4J6WA 1Q86C 3MEVA 3HFOA 3HRSA 1ZQ1A 5LJ3f 1K9MU 1Q81C 4A54A 4KBMB 1OZ3A 4BDZA 3CPWA 2MWOA 5LL6S 4M7DA 1JJ2S 1WQ7A 2XU8A 2IVWA 2DEQA 4JLGA 1LOJA 2EWNA 1BI2A 1LJOA 2HD0A 3ASKA 4OB2B 4BY6C 1QW1A 3I56A 4JS5A 4C5IA 3CBMA 1VQ9A 3OS5A 2KY9A 1B34B 1PSFA 4XQ3A 4C0ZA 1W2BS 2DIGA 1M4ZA 3OYFA 1YITT 5HK3A 4RCBA 5FLXE 1VQ4A 3JCMd 1NZ9A 4XTXA 1LNXA 4Q5WA 1VQ4T 2RO0A 2DPPB 3RESA 3V7RA 5CKDA 3JB9J 1JJ2A 4LDWA 3MCAB 1K9MC 2LDMA 3CCUA 3CPFA 5CVIA 1HK9A 2X4YA 1VQPA 4C92B 2E5QA 2RB6A 3MEAA 3VJPA 2RHIA 5LJ5h 3I56T 3L2QA 4BE2A 4QQGA 2R5MA 2VYTA 3EAEA 5CKHA 2FVUA 3A8OB 4OF1A 2L8DA 3HRUA 3CC7A 4XU2A 3QYHB 2ZCFB 4J7FA 5GAMf 2K5LA 3FJPA 3VV0A 2DJZA 3FB9A 4HCZA 2LT1A 2EJFA 1W4SA 4C0DC 2XICA 2MMPA 2E12A 3MP8A 4M77G 1Q82U 2JUFA 4CRIA 3ME9A 3JRZA 3KXTA 2Y4YA 1BIBA 1VQKT 4Y28E 4F7UF 3VUZA 1N27A 3PGGA 3VUBA 1Q7YC 1IZ6A 2L3RA 2DD4A 4X9CA 5HY6A 3PMTA 2E65A 3G71A 2LCCA 3E1SA 3X24B 3SFMA 3LX7A 4QW2A 3FIFA 4EMGA 5LJ5f 1YI2T 4FIBA 3N5BB 3TEEA 3J80E 3CCUT 4C8QE 1M1FA 3WXMB 5HK0A 1S72T 4JUVA 2M1HA 2RK1A 2M0OA 2QQSA 4M7DF 3O8VA 4J83A 2YHTA 1ZBXA 1YBYA 2G3RA 2PQWA 5GAOn 4JS4A 3PIOA 2OTLA 3OYDA 5GAOp 3CCLT 3OY9A 5FU7B 3CCST 4LD9K 3ER0A 3FRNA 3QZ9B 4FM4B 3V7CA 1M1KC 1Y07A 3RIRA 1Y96A 2LTOA 3OA6A 3NTKA 2AHJB 4M75F 5D6YA 4BUGA 2ZPFB 1VQLA 3I55A 2RD1A 4O6JA 3CCMT 4JRPA 2GFAA 4MDXA 2BUDA 2EQUA 2BIVA 2DVEA 3OS1A 2YLCA 3CCEA 4QVCA 4M7DD 5GMKm 4M77E 5FRNA 1KQSS 1I81A 3M5AA 1S72A 3URGA 4M78C 4ZTJA 2K3YA 4R56A 2KSSA 4BE1A 5FU6C 4M77C 4C8QA 4C8QB 3CC4A 2KDSA 4EPCA 1YJWA 2DTIA 2V8JA 2JOYA 2M16A 2K3XA 4M7DC 1VQ6T 1VQNA 2RI3A 3OYYA 4J7IA 5CAIA 3P8DA 5CKBA 1QP2A 3UWNA 2CYZB 1NJIU 2WACA 1N9RA 3NTIA 4A4HA 2VUBA 3CMAA 1NJIC 2OTJA 2PUOB 4C0FA 3HRTA 4DOVA 4DA4A 1VQLT 3M57A 3L42A 3S6WA 3CCJA 2E64A 5HKCA 5GAMh 2QXFA 1U1TA 2D0QB 1WJQA 4MDWA 1G3WA 2A7YA 3EFSA 2HNIA 1KQ2A 2JZ2A 4XTUA 4R55A 2RH2A 3MEWA 4JDSA 4OB1B 1NE8A 3RKYA 4A4FA 5CKEA 3CEYA 3TREA 4MMLA 1KD1C 1UGSB 4E7IA 3V8LA 2RI5A 2F5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VUB A;  3NFC A;  3HPW A;  5CKB A;  5CKF A;  4MZT A;  5CQX A;  2VUB A;  5CCA A;  5CKH A;  4MZP A;  4OF1 A;  2KMT A;  1M1F A;  5HK0 A;  5HKC A;  4MDX A;  1X75 C;  5CQY A;  4VUB A;  5CO7 A;  2MF2 A;  3G7Z A;  1UB4 A;  3TCJ A;  5CK9 A;  4MZM A;  1NE8 A;  4ME7 A;  3JSC A;  5CKE A;  5HK3 A;  2C06 A;  1VUB A;  5DLO A;  5CR2 A;  4ELZ C;  5CKD A;  3JRZ A;  4ELY C;  4HKE A; 
#chains in the Genus database with same CATH topology
 2GFU A;  2RHZ A;  1ABO A;  2FEI A;  4A63 B;  1N9S A;  3VYG A;  2FPE A;  3BY7 A;  2EGA A;  3PE0 A;  2VXF A;  2ROT A;  1VQ6 A;  2OTJ T;  4XU3 A;  3Q1J A;  3X20 B;  3QJY A;  2KR3 A;  3QWX X;  2LJ3 A;  1MUZ A;  1IO6 A;  1UB4 A;  3OYH A;  2FZC B;  5A0G A;  1K73 C;  2O9S A;  3RR6 A;  3OYC A;  1SSH A;  3UPU A;  2OTJ Q;  3GLX A;  3EFO B;  2BTT A;  2RJC A;  1QWF A;  1X6B A;  3H0I A;  4L6V 5;  2M02 A;  3VS4 A;  1GFD A;  2K79 A;  5J3B A;  2KT1 A;  5FRM A;  5KYU A;  2HMA A;  2PVO B;  4AFS C;  5GAN 6;  3ZEH A;  1Q95 G;  2BE9 B;  1M90 R;  4B6M A;  1M2V A;  4E2F B;  3CXC A;  3CC7 T;  1D0X A;  3JSC A;  2V8I A;  2QYZ A;  1M3C A;  2ED1 A;  2HKQ B;  1WPY A;  1B34 A;  2RHU A;  5IHK A;  4JRK A;  4C92 G;  2LX9 A;  1B07 A;  1X27 A;  1NYF A;  4JJC A;  3CCQ T;  1VQN Q;  1R77 A;  3UAT A;  1PRM C;  2CSI A;  1TH7 A;  2QQB A;  4ANJ A;  4HVV A;  5GAO m;  2KI7 A;  1G5V A;  3HSB A;  2HL3 A;  4NS5 A;  4J9E A;  2X4J A;  4ELZ C;  1BIA A;  2EQM A;  1O9S A;  1BYM A;  4PJO A;  1SEM A;  1BBZ A;  3FEO A;  5GAM d;  1QP3 A;  2LQ8 A;  3QHS A;  1TTH B;  1G3S A;  1MV0 B;  1MHN A;  2NUT A;  5FWB A;  4M7A G;  3J7A F;  2ZPG B;  4ZN3 A;  3OSV A;  4BY6 B;  1TS9 A;  3GP8 A;  1N8R C;  4DBR A;  3PIP A;  1JBM A;  2YXY A;  1NEB A;  2CT3 A;  4OMQ A;  4A4E A;  4YTL A;  1QVF S;  5KYU B;  2QTX A;  4FU6 A;  3H0F A;  4ZN1 A;  2QEX A;  4BAC A;  1GRI A;  1Q82 C;  1W70 A;  4PJO E;  1KC8 C;  4F16 A;  3M55 A;  4C92 E;  2L0A A;  4JPB W;  5KYW B;  2MF2 A;  2FRY A;  3RMQ A;  2DZC A;  3JCM c;  3EH1 A;  4PFZ A;  4C92 F;  4L5G A;  2LNH B;  2QAS A;  3MP6 A;  1SRM A;  4F17 A;  3HFN A;  4N0A C;  4B9X A;  2GNC A;  2NUP B;  2LP5 A;  4KH0 B;  5GJV B;  3OMG A;  1X69 A;  3SWN C;  1WJR A;  3CCE T;  4QQ6 A;  2H8H A;  2PZ1 A;  5KYY A;  1ZHI A;  1PHT A;  3CCQ A;  2J7I A;  3M0R A;  4RKU E;  2C06 A;  4M75 G;  1T3L A;  1K1Z A;  1T3S A;  3TU4 K;  3OYB A;  2EYY A;  1WI7 A;  3CCV Q;  1YHQ Q;  2O4X A;  4C8Q F;  4WF2 A;  1GBR A;  4PKC C;  3G1J A;  4EMH A;  5LJ3 j;  2DNU A;  1KQS A;  3F70 A;  1XJW B;  2RQV A;  4IIO A;  3X28 B;  2RQU A;  2D6F A;  3VU3 C;  1VQ8 A;  2ZGW A;  1BK2 A;  3LLR A;  1N8R U;  4J9G A;  5KCH A;  3UDC A;  1I07 A;  2DIL A;  1KD1 R;  4BE0 A;  3P8B B;  3A1P A;  2YSQ A;  1VUB A;  4RTY A;  3GF5 A;  1PSE A;  3M59 A;  5HCK A;  3JB9 F;  1M2V B;  3C12 A;  4KGZ B;  1NBE B;  1VQO T;  2DJQ A;  2XDP A;  2OTL T;  3M4Y A;  2F2X A;  2K6D A;  4J9D A;  1NYG A;  3SWN A;  1T0J A;  3MJX A;  1KC8 R;  2CH4 W;  2DEU A;  3C94 A;  3HHT B;  2FB7 A;  3R6N A;  4WTO B;  1YN8 A;  3A8H B;  3I56 Q;  1QCN A;  2BKD N;  5GMK i;  2KE9 A;  2QQ9 A;  3G6E A;  4M78 B;  4N4H A;  3JB9 G;  1PCX A;  3CC2 A;  8ATC B;  1MV3 A;  1NLP C;  2C0I A;  1X43 A;  4JLI A;  4J9C A;  2QEX T;  4WCI A;  3OYE A;  4C8Q D;  2VXE A;  3PFS A;  2JM9 A;  2CZ1 B;  3PNW C;  2CS7 A;  2G6F X;  3OYA A;  4NL3 A;  1RI0 A;  2NUZ A;  4OMP A;  4RMO A;  3PT9 A;  3CPW S;  3M58 A;  2BE7 D;  2MAM A;  3DLL A;  2MK5 A;  3QZ5 B;  2X9H A;  4RG2 A;  4ZGE B;  4DEY A;  4J6W A;  3HFO A;  1K9M U;  1ZUK A;  1YIT Q;  3M0P A;  3EHQ A;  4DBF A;  4BDZ A;  4FYV B;  3CPW A;  2BZ8 A;  2D8J A;  1JJ2 S;  5GJW B;  2XU8 A;  1Q86 C;  1LOJ A;  1BI2 A;  2JM8 A;  4C5I A;  1MNE A;  4C0Z A;  1JU5 C;  5HK3 A;  3VRY A;  4Q5W A;  3RES A;  3V7R A;  1JJ2 A;  3ZL7 C;  4DBH A;  3H41 A;  4LE9 A;  1VQP A;  2E5Q A;  2RB6 A;  3MEA A;  3VJP A;  5LJ5 h;  3I56 T;  4QQG A;  2VYT A;  5CKH A;  2FVU A;  3VRZ A;  1M1K R;  1WDX A;  2ZCF B;  2K5L A;  2RNA A;  2QAZ A;  2HZY A;  2LT1 A;  1OUL A;  2YWW A;  2E12 A;  4M77 G;  1Q82 U;  2JS0 A;  1VQK Q;  2KYB A;  3PGG A;  1VA7 A;  1ZSZ A;  3NHN A;  4X9C A;  3MPU B;  1NM7 A;  2E65 A;  1PD1 A;  3SFM A;  4QW2 A;  1AT1 B;  3CCU T;  2HCK A;  1M1F A;  2M51 A;  5HK0 A;  4JUV A;  2QQS A;  5AT1 B;  2YT6 A;  2OTL A;  1ZBX A;  4JS4 A;  2SEM A;  3OY9 A;  1YJ9 Q;  2L3P A;  3QZ9 B;  4FM4 B;  3V7C A;  1Y07 A;  4RTV A;  3TVT A;  3OA6 A;  2ZPF B;  3VS0 A;  5I11 A;  4MDX A;  2BIV A;  2DVE A;  2DL3 A;  2FPF A;  3M5A A;  2CT4 A;  2KSS A;  1C0M A;  4M77 C;  5FU6 C;  4C8Q B;  2ESW A;  4EPC A;  2K3X A;  1VQN A;  3OYY A;  1QP2 A;  2CYZ B;  1C1A A;  3NTI A;  3CMA A;  2RPN A;  3SEM A;  1IGU A;  2RQR A;  1B7T A;  2X3W D;  2OX7 A;  2J05 A;  4Z89 A;  4KRT A;  1U1T A;  1WJQ A;  3H0H A;  4R55 A;  2KXD A;  4Z8A A;  2J6F A;  3TRE A;  4MML A;  1KD1 C;  1UGS B;  2IIM A;  3SHW A;  4JJB A;  1B3Q A;  4E7H A;  2LRQ A;  1RAB B;  4GLK A;  2NYS A;  1V29 B;  1VYU A;  3T9N A;  4ZTF A;  2DER A;  3ZFJ A;  5IN1 A;  1K0X A;  2YUN A;  1U1S A;  2DE0 X;  2KMT A;  1RAA B;  5A0L A;  4GBQ A;  2A37 A;  2JMC A;  1KG1 A;  5KE2 A;  4BI4 A;  1VQN T;  1MGQ A;  2VGM A;  3G71 T;  3CME Q;  2QG9 B;  5GAO q;  3S3N A;  2E6Z A;  3EGU A;  2LCS A;  3GNG A;  7AT1 B;  4HT9 A;  2JT4 A;  4PJN A;  2EQI A;  3LYI A;  2R5A A;  2ZAE A;  3CBO A;  5I2M A;  5I2S A;  4TVR A;  1Y96 B;  4FL6 A;  3OYI A;  2K4Y A;  2KK4 A;  5GMK h;  1OOT A;  2VV5 A;  1Y71 A;  1PM3 A;  1VQL Q;  1K76 A;  4XTV A;  1N8R R;  1VQ9 T;  1FX7 A;  4XTZ A;  2I2L A;  4DOW A;  3KUF A;  4C92 A;  2YRC A;  2ZPH B;  3G6E Q;  3REB B;  2E5K A;  2AZV A;  4HA8 A;  2YLB A;  3G4S A;  1UJ0 A;  3L2V A;  3EFR A;  5KYX A;  2JTM A;  3OYL A;  2A08 A;  3EG0 A;  4CC3 A;  2MYS A;  2HKN A;  2X51 A;  3G6E T;  5DLQ E;  4XU0 A;  3OB9 A;  1F1B B;  3BE3 A;  1V1C A;  5GMK e;  4X1V A;  1AWO A;  4PL6 A;  3OBW A;  1Y7X A;  1GFC A;  3X25 B;  1X75 C;  4KUI A;  4RTT A;  1X2Q A;  4M77 A;  3INZ A;  1VYT A;  2HBP A;  2CH4 A;  1AVZ C;  2LCL A;  5CR2 A;  3GOX A;  4P5N A;  4XTW A;  1GCP A;  1AWW A;  3RER A;  3EGX A;  2D1X A;  2KVQ G;  1XTD A;  2ZPB B;  4C0G A;  3LGF A;  4F7U B;  1HYO A;  4J9B A;  4C5H A;  1K4U S;  1GCQ A;  4X9D A;  3SB2 A;  2GGR A;  4FW2 A;  4J6X A;  2CKK A;  4FW1 A;  5KE3 A;  1KFZ A;  3QPH A;  4MMK A;  5IT9 E;  4E7S A;  4ZNX A;  5J26 A;  3E19 A;  2O31 A;  2GF7 A;  1OX9 A;  1M9S A;  3DLM A;  3JCM P;  1BKB A;  1J3T A;  1NPP A;  4JRI A;  1UEC A;  2YUP A;  2Y4X A;  1M27 C;  5CIU A;  5GAO l;  3ZBD A;  4F14 A;  3THK A;  4M75 E;  5C6S A;  2YUO A;  1OQK A;  1IHW A;  1M2O A;  3QKJ A;  1WIE A;  4ME7 A;  4KT0 E;  4M4Z A;  1MMG A;  2YDL A;  1UDL A;  3GIB A;  1X2K A;  4RUG A;  1VQ5 T;  1WJS A;  1WGS A;  2C0T A;  5FU7 C;  4AT1 B;  1I8F A;  4MZP A;  1K8A U;  2QQA A;  5FWC A;  3EG9 B;  1KHC A;  3KBG A;  1M3B A;  1PKT A;  3HTR A;  5GAN 2;  1WNL A;  2QTV A;  4QVZ A;  3OYM A;  4HCB A;  2DO3 A;  3WVE B;  3BDL A;  1G8X A;  3VS2 A;  3L2U A;  2F5T X;  2EYZ A;  2HBW A;  1VQ7 A;  5GMK l;  1D3B B;  3V8J A;  1UGQ B;  1YJN A;  4RG8 A;  2KRO A;  3I55 T;  4HT8 A;  1AD5 A;  2EYW A;  4M7A E;  1UFF A;  4AMC A;  1D0Z A;  2DVJ A;  1KSW A;  2DL8 A;  4EDU A;  3SWN B;  4B9W A;  1HJD A;  3OW2 P;  1IRX A;  5D6W A;  2EKH A;  1XOV A;  3JV3 A;  1KD1 U;  4LD6 A;  1YJW Q;  2V8K A;  5FW9 A;  3RBB B;  3DKM A;  2DRM A;  2CZ7 B;  1WXB A;  5IHN A;  3MEU A;  3M0U A;  1EX4 A;  3G4S Q;  1BI1 A;  4ZGD B;  1K8A R;  4PJJ A;  2WSE E;  1Y57 A;  5FRO A;  5GAN f;  4BI3 A;  3CCU Q;  3QO3 A;  1QVP A;  2RMO A;  3OQ5 A;  2E41 A;  3DB3 A;  3OSS C;  1GL5 A;  1OI1 A;  3CCL A;  1VQP T;  2QA4 A;  4ELY C;  3AHU A;  4C8Q C;  4M7D G;  3OS0 A;  2NWM A;  2L89 A;  5A2Q E;  1WZO A;  2P0Q A;  4AG2 C;  1ZUU A;  2E4H A;  1O75 A;  1TXQ A;  2DIQ A;  2E70 A;  2DXT A;  4C92 C;  5I21 A;  5GAN e;  4M75 A;  1VQK A;  2XK0 A;  3NMZ C;  3CBP A;  2LQK A;  3OW2 A;  1WQW A;  3MEV A;  2L3Q A;  2I0N A;  4LUE A;  2P4R A;  2DF6 A;  2MIO A;  1I5O B;  2JTE A;  2DEQ A;  3GBQ A;  4OB2 B;  1LJO A;  2QA4 Q;  3I35 A;  4JS5 A;  3OS5 A;  6AT1 B;  1R0C B;  2HSE B;  5D7U A;  1ZSZ C;  2EVR A;  4RCB A;  1VQ4 A;  4KH1 B;  1NZ9 A;  2RO0 A;  4LDW A;  3MCA B;  4EIK A;  3CPF A;  1Z9Z A;  2QEX Q;  1HK9 A;  2X4Y A;  5KYW A;  3FJ5 A;  4C92 B;  4OMM A;  2R5M A;  5I22 A;  2L8D A;  3HRU A;  1AWX A;  1JXM A;  5GAM f;  2E3H A;  2VWF A;  1QLY A;  4R0K A;  1D0Y A;  1NLO C;  1W4S A;  2XIC A;  1G83 A;  4CRI A;  4RTZ A;  4Y28 E;  3VUB A;  4ORZ A;  1Q7Y C;  1YCS B;  1NEG A;  3E1S A;  3X24 B;  3LX7 A;  1BCM A;  4EMG A;  1YI2 T;  3N5B B;  3J80 E;  1WHK A;  2LJ0 A;  2DYI A;  2RQT A;  1S1N A;  2M1H A;  2D0N A;  1E7O A;  4J83 A;  1PNJ A;  2PQW A;  1YBY A;  3CXC P;  3PIO A;  2HEQ A;  3CCS T;  1WYX A;  4E6R A;  3FRN A;  1UTI A;  1U5S A;  4FYX B;  3RIR A;  2DL4 A;  2AHJ B;  4M75 F;  5D6Y A;  1VQL A;  2CP6 A;  2RD1 A;  2PNI A;  1OX8 A;  4JRP A;  2GFA A;  2YRD A;  2BUD A;  2JS2 A;  4M77 E;  3CCJ Q;  3URG A;  4ZTJ A;  2K3Y A;  4BE1 A;  3UA7 A;  2CP7 A;  2DTI A;  4CC7 A;  1OPK A;  2RI3 A;  5CAI A;  1T0H A;  1NJI U;  1N9R A;  4A4H A;  2VUB A;  1NJI C;  1IB8 A;  2PUO B;  3HRT A;  4PJL A;  2DBK A;  2QXF A;  1G3W A;  2HNI A;  4CC4 B;  4A4F A;  1BB9 A;  1BU1 A;  1WLP B;  2L3S A;  3M9Q A;  2F5K A;  4M7D E;  4A4K A;  3M54 A;  4GLM A;  2K9G A;  4MZT A;  2EJ9 A;  1W6X A;  1TUD A;  3CMA T;  2H3J A;  4NL2 A;  3LW5 E;  5GAM g;  4ATO A;  2B8A A;  4M7A F;  1YCY A;  1ZSG A;  3A5Z B;  5CK9 A;  3EGX B;  1OU9 A;  2F69 A;  2QI2 A;  2MWP A;  5KCO A;  4HXJ A;  2EYX A;  1SSF A;  2RF0 A;  3CMA Q;  4C0D B;  5GMK j;  5DY9 A;  4CI0 C;  1P92 A;  3EG2 A;  4M77 F;  5AYF A;  2EBP A;  2PVD B;  2JN0 A;  2O2O A;  1YP5 A;  1M8V A;  4FSX A;  2K2V A;  3HL8 A;  3PMI A;  1NG2 A;  3CCM A;  4VUB A;  2RHY A;  3I9Q A;  1WFW A;  2VKN A;  3L1A A;  2HL5 C;  4PJO F;  2DLP A;  5GAN 7;  1OYX A;  3CCR T;  1TWB A;  4F04 B;  2GCX A;  3V8K A;  2V1Q A;  3CCJ T;  1AZE A;  4J5Y A;  2FG0 A;  2ZPE B;  1YI2 A;  2RJE A;  1Q81 R;  4KGX B;  1YFN A;  4D8K A;  2LX7 A;  2E1H A;  1SHF A;  4DBQ A;  4OGC A;  2XID A;  2PUK B;  4X34 A;  4JRQ A;  2PVG B;  2DAQ A;  2E6N A;  2CRE A;  1VQM T;  4XK8 E;  1WHM A;  2X4X A;  1M90 C;  2QQR A;  1RUW A;  3C4S A;  4M75 D;  1NPR A;  4KUD K;  3MKD A;  3LGL A;  1VOM A;  4HVW A;  1AHJ B;  2M0Y A;  2K3B A;  5IHI A;  1Q82 R;  4LUD A;  5LJ5 d;  1YI2 Q;  1Y0M A;  4LDY A;  5CCA A;  1PKS A;  5GAN d;  3L2Z A;  8AT1 B;  1AWJ A;  1VQ5 A;  3NTH A;  1AZG B;  1G3T A;  5IH2 A;  5GAN 8;  2FRW A;  2DM1 A;  1VIE A;  4IUT A;  4XAX B;  3CC7 Q;  2DMO A;  2K5F A;  4O5V A;  4PLL A;  3M56 A;  5LJ5 e;  3EG1 A;  4NOY A;  5CQX A;  3IQL A;  2OAU A;  1QVG P;  3TSW A;  4M78 A;  2OI3 A;  4A53 A;  3FC3 A;  1U3O A;  2YUQ A;  3CD6 T;  4QT7 A;  3JB9 D;  3MO8 A;  2EKO A;  1VQ9 Q;  3KFV A;  4JZ4 A;  5IXF A;  4RTU A;  4M7D B;  4IUP A;  2ZPI B;  3O5Z A;  2RI2 A;  1OZ2 A;  2Y90 A;  4M7A D;  3RKX A;  4FT4 A;  3A98 A;  2K5I A;  3SDZ A;  1Q7Y R;  2CP5 A;  3RKW A;  2K2M A;  3RMS A;  3CC4 A;  4LDU A;  2K57 A;  3OBY A;  3QXE B;  1TSF A;  2XHC A;  5L8R E;  5GAN h;  5IAY A;  2LVM A;  4EMK B;  3E2U A;  3TSZ A;  2DTH A;  2VGN A;  3WVD B;  4FYW B;  4J9F A;  3CPW P;  4IUR A;  1JEG A;  1I1J A;  4D6W A;  3J81 E;  4PK4 A;  2OTL Q;  4PFP A;  3FLG A;  1RAE B;  5CO7 A;  3CME A;  2P84 A;  3TQ7 P;  3G7Z A;  3REA B;  4M7A A;  1JB0 E;  4BB7 A;  4FCY A;  3EG9 A;  2X4W A;  3QYG B;  3G71 Q;  3CME T;  2KRM A;  1Q81 U;  5KYY B;  1IRE B;  2QDY B;  2CSQ A;  4LN2 A;  2V1R A;  2KEA A;  2O4X B;  3M0S A;  1K9M R;  1KK7 A;  3BDU A;  5DM7 R;  4N0A A;  1D3B A;  2E3I A;  4OVA A;  4F7U G;  2C0O A;  2DFU A;  3E9G A;  4V2S A;  3QSU A;  3I5R A;  5GAN 5;  3L2R A;  1GBQ A;  2DL5 A;  1I5L A;  2XD0 A;  2A3L A;  3HPW A;  1M30 A;  3M0T A;  2K7A A;  4M77 D;  2KBT A;  5D6X A;  1JQQ A;  4OB3 B;  2KAF A;  3EGD B;  1MMD A;  1FYN A;  1N6A A;  2X3X D;  3HKS A;  2QK0 A;  2KRN A;  2EGC A;  3BW1 A;  5FU6 B;  3EG3 A;  3H8Z A;  3QII A;  1IXD A;  2JVV A;  5GAN 4;  2FZK B;  4HVU A;  4M7A B;  4QQD A;  1H3Z A;  1NJI R;  2L2P A;  2O88 A;  4C5E A;  2CZ6 B;  2PU9 B;  3PTA A;  5DLO A;  1VIF A;  3JB9 I;  1PD0 A;  1SG5 A;  2HQX A;  1EZZ B;  3D7S B;  4M77 B;  3OYG A;  1X6O A;  3E9F A;  3CCV A;  1YHQ A;  2A28 A;  4PLI A;  3VS1 A;  3MET A;  3JCM h;  2LQN A;  4PJO B;  2ENM A;  1X6G A;  3A8G B;  1CKA A;  1VQ5 Q;  2NLU A;  1M90 U;  2ATC B;  2EQJ A;  1FXX A;  2P0K A;  1TUG B;  1JO8 A;  1JJ2 P;  1ZQ1 A;  5LJ3 f;  4A54 A;  5KYN A;  1OZ3 A;  1D1B A;  1HSQ A;  1IHV A;  2MWO A;  2MPX C;  4M7D A;  1WQ7 A;  1ZLM A;  2HD0 A;  3ASK A;  4BY6 C;  3CBM A;  2KY9 A;  1KJW A;  1B34 B;  1PSF A;  2V26 A;  2DIG A;  1YIT T;  3OYF A;  3CC4 Q;  2KT8 A;  5FLX E;  4XTX A;  1VQ4 T;  2DPP B;  3CQT A;  2LDM A;  3CCU A;  2VVK A;  5CVI A;  4LNP A;  2F2W A;  2HSP A;  2QDL A;  4CC2 A;  3EAE A;  2COW A;  4OF1 A;  4XU2 A;  3QWY A;  3QYH B;  3FJP A;  3FB9 A;  4HCZ A;  4AG1 C;  4C0D C;  4KGV B;  1ARK A;  1CSK A;  2EW3 A;  1M3A A;  4J9H A;  1QVF P;  1VQK T;  1N27 A;  1IZ6 A;  2L3R A;  3U23 A;  2GTJ A;  3G71 A;  2LCC A;  4J9I A;  2BZX A;  1ACM B;  5LJ5 f;  3EFO A;  3WXM B;  1S72 T;  1SRL A;  2RK1 A;  2FO0 A;  4FSS A;  2M0O A;  4M7D F;  2JMA A;  3O8V A;  2YHT A;  2G3R A;  5GAO n;  3OYD A;  5GAO p;  3CCL T;  5FU7 B;  1GCQ C;  2GQI A;  4LD9 K;  3ER0 A;  1UG1 A;  1Y96 A;  1AEY A;  4RTW A;  2LTO A;  1MND A;  3NTK A;  4BUG A;  1VQ8 Q;  1UHF A;  1K0S A;  1TOV A;  1VQO Q;  1D1C A;  3OS1 A;  4QVC A;  4M7D D;  5GMK m;  5FRN A;  1KQS S;  1I81 A;  1S72 A;  4M78 C;  4R56 A;  1UHC A;  4C8Q A;  2RQW A;  1G2B A;  3EHR A;  2KDS A;  1W2B P;  2V8J A;  4M7D C;  4J7I A;  3P8D A;  3UWN A;  2WAC A;  2OTJ A;  4C0F A;  4DOV A;  4DA4 A;  1VQL T;  3NPF A;  2LZ6 B;  3S6W A;  3CCJ A;  3QDF A;  1U06 A;  2D0Q B;  1I0C A;  4MDW A;  1KQ2 A;  2QGG A;  4JDS A;  3MEW A;  2KYM A;  3RKY A;  1KIK A;  2NUT B;  3CCM Q;  1ZX6 A;  4E7I A;  3V8L A;  1FMV A;  1QKX A;  2RA2 A;  2LT4 A;  3BFM A;  1YJ9 A;  1TU0 B;  1IGQ A;  3L2W A;  4RTX A;  4OB0 B;  1QVG S;  1VQ7 T;  1YIT A;  2DZ9 A;  2IPO B;  1VQM Q;  2EAY A;  4UC4 A;  4BD3 A;  3X26 B;  2RK2 A;  1YJW T;  1YIJ Q;  3TCJ A;  1EFN A;  2JNG A;  2OAW A;  2RN8 A;  2WSC E;  1WX6 A;  5GAM e;  4QKU A;  2E10 A;  5LJ5 g;  2DXB A;  2O9V A;  1E6H A;  1VQ6 Q;  5LJ3 h;  2DA9 A;  4LDX A;  3JCM V;  3JAM E;  3NFC A;  4DQ2 A;  2RJD A;  5J39 A;  1TG0 A;  5A0D A;  5ECA A;  2LQW A;  1QCF A;  3G4S T;  4FT2 A;  2HQE A;  4BI8 B;  4C8Q G;  3JCM f;  5GAO r;  3RUX A;  2FL7 A;  3RDV A;  4M78 F;  1RI9 A;  3CC4 T;  2IG0 A;  3H9N A;  3CCV T;  1YHQ T;  1BI3 A;  1QKW A;  2FZG B;  2XMF A;  1ZSZ B;  2EQK A;  1MMA A;  2KGT A;  4PJO G;  1QMC A;  9ATC B;  3JCM b;  1H64 1;  1K73 R;  1GXI E;  1UGR B;  4PJO C;  1KQ1 A;  2CP3 A;  2R57 A;  3VS5 A;  2L5Q A;  4IUV A;  4IUU A;  3CC2 Q;  2RM4 A;  4F7U E;  1Q86 R;  1QVF A;  4AFU C;  4OGE A;  1UGP B;  1FMW A;  2OJ2 A;  2XKO C;  3OS2 A;  2A0F B;  3NGP A;  4RCC A;  1R8O B;  3QJ6 A;  3A8L B;  2QGF B;  3CD6 A;  5EC7 A;  4AFZ C;  4Y91 A;  2KRS A;  1WXU A;  4ZGJ B;  1UE9 A;  5L23 A;  1M1K U;  2DET A;  3FDR A;  4LXC A;  1A0N B;  1G3Y A;  4M75 C;  1RAF B;  1QCO A;  2ED0 A;  3C95 A;  2FPD A;  5LJ3 g;  3CCS A;  2LMJ A;  1CKB A;  4IUQ A;  3JB9 H;  2HAX A;  2CDT A;  1XNI A;  2JTF A;  3OYN A;  1FWZ A;  2CP0 A;  2O01 E;  5GAN 3;  4C92 D;  4J6Y A;  3JCM Q;  1JXO A;  3GPL A;  1WHL A;  2D9T A;  1X01 A;  3JCM g;  5LJ3 e;  1SKU B;  2AKK A;  2DXU A;  2LC4 A;  3OYJ A;  2JW4 A;  3VS3 A;  5CQY A;  2KNB B;  1QWE A;  4PNO A;  4JJD A;  2XDD A;  2JJ9 A;  3CXC S;  3H6Z A;  1K9A A;  1YIJ T;  1VQM A;  2LNV A;  1M1G A;  1H8K A;  2HDA A;  5GAN j;  3CC2 T;  4BDY A;  4LDV A;  3MHX A;  5CKF A;  5LJ3 d;  3S3O A;  1UGV A;  5KH6 A;  4M78 D;  2SRC A;  5C0M A;  1UEB A;  2ZZD A;  2VAS A;  3ULR B;  4N4I A;  4D8D A;  3DB4 A;  2AKL A;  1YWO A;  4M75 B;  1W1F A;  1DJ7 B;  4AFQ C;  3CCR A;  1KQS P;  1YWP A;  4E7K A;  2GQV A;  1JRI A;  4XU1 A;  4M78 G;  3RNJ A;  4M7A C;  3LWI A;  4MZM A;  2CZ0 B;  2GTO A;  1YJ9 T;  1VQO A;  1WHG A;  2AT1 B;  1YNZ A;  2DL7 A;  2P4T A;  1LVK A;  2MOX A;  3JCM J;  1R0B G;  4OP0 A;  1BCO A;  4PJM A;  2J6O A;  4C5G A;  3VKI A;  4EMK A;  2ECZ A;  3OYK A;  1YJN Q;  1HXD A;  1RAI B;  1K73 U;  4J8O A;  4QVD A;  3CCL Q;  2KQW A;  1KHI A;  1RLP C;  4E7J A;  2DD5 A;  2EIF A;  3M4G A;  1EIF A;  3OMC A;  1SHG A;  1Q86 U;  2XG8 D;  1OV3 A;  4E47 A;  5GAN g;  2P0P A;  4F7U A;  1D1A A;  5LJ5 j;  4HKE A;  4IKF A;  2WSF E;  2CUB A;  3M53 A;  2CGH A;  3CD6 Q;  4JJN K;  1SPK A;  2BZY A;  2COY A;  2AK5 A;  3QDR B;  1Z9Q A;  3LH0 A;  1OPL A;  1N5Z A;  3QUI A;  5EG2 A;  3P8H A;  4HCC A;  2QA4 T;  3JCM W;  4II1 A;  5KYX B;  2D8H A;  2FHD A;  2J06 A;  4E7L A;  3SD4 A;  4EMK C;  4Z02 A;  1K8A C;  5M9O A;  1M5Q 1;  2DXC A;  2DYB A;  1RAG B;  5GAM j;  1VQ8 T;  3QBY A;  1ZBJ A;  1BI0 A;  1E6G A;  1VQ4 Q;  1U8R A;  2R58 A;  3OW2 S;  2XDB A;  2DK3 A;  1I4K 1;  3QG1 A;  4PJO D;  3JCM X;  3UT1 A;  2CP2 A;  3GNF B;  1S72 Q;  4OMF B;  3V7S A;  1WA7 A;  2MI6 A;  1H3H A;  2VC8 A;  1QQJ A;  2XI9 A;  4N4G A;  1VQP Q;  3R6O A;  4IIM A;  3HP9 A;  4FYY B;  4M78 E;  2YRV A;  4HCK A;  1W2B A;  1RL2 A;  2DKG A;  2F2V A;  1FMK A;  3S3M A;  4XTY A;  2EYQ A;  1LPL A;  1YJN T;  2RHX A;  3EGD A;  1QVG A;  2AIR B;  1RAH B;  3PVL A;  1KC8 U;  2FYK A;  4OML A;  1Q7Y U;  1ZA1 B;  2A36 A;  4A4G A;  2M9U A;  1OU8 A;  3A8M B;  3UF4 A;  3VS7 A;  2HQH A;  4GY5 A;  2W10 A;  4KUL A;  3MP1 A;  2DTO A;  1RLQ C;  2X35 A;  2RJF A;  2EJG A;  3PVQ A;  4L59 A;  1OEB A;  1YIJ A;  3VYH B;  1M8M A;  3JCM e;  3LWH A;  1XQH A;  2EFI A;  3HRS A;  4OMN A;  1Q81 C;  4KBM B;  1D09 B;  2CUD A;  2JXB A;  5LL6 S;  4JLG A;  2IVW A;  3I5S A;  2EWN A;  3EH2 A;  1QW1 A;  3I56 A;  1HD3 A;  1VQ9 A;  4PFO A;  2AZS A;  1H92 A;  4XQ3 A;  1WXT A;  1WHJ A;  1W2B S;  1M4Z A;  4Z88 A;  3CCR Q;  2B86 A;  3JCM d;  1LNX A;  3JB9 J;  5CKD A;  1V76 A;  1TUC A;  5IXB A;  1K9M C;  4BE2 A;  2RHI A;  3L2Q A;  3AT1 B;  2DX1 A;  1WHH A;  3A8O B;  3CC7 A;  1PWT A;  2MCN A;  4J7F A;  3VV0 A;  2DJZ A;  1SF9 A;  2EJF A;  1ZA2 B;  2F1L A;  2MMP A;  3MP8 A;  2JUF A;  2KXC A;  3M0Q A;  3ME9 A;  3JRZ A;  1ZUY A;  3KXT A;  3CCE Q;  2Y4Y A;  1BIB A;  4F7U F;  3VUZ A;  1C6V X;  4K11 A;  2DD4 A;  1PRL C;  3I55 Q;  5HY6 A;  3PMT A;  2PTK A;  2VB6 A;  3FIF A;  1UJY A;  4FIB A;  3TEE A;  4C8Q E;  2W0Z A;  4OMO A;  4Y92 A;  3C0C A;  1VQ7 Q;  3CCS Q;  2DRK A;  2H3E B;  2COZ A;  1MMN A;  2ABL A;  2EGE A;  1RAD B;  1M1K C;  2Z0W A;  3I55 A;  4O6J A;  3CCM T;  1RAC B;  2EPD A;  2EQU A;  3VS6 A;  2YLC A;  3CCE A;  2GBQ A;  3LH5 A;  4E7Z A;  4ESR A;  2LJ1 A;  2NUP A;  1YJW A;  3UA6 A;  2JOY A;  2M16 A;  1VQ6 T;  1ABQ A;  5CKB A;  4JZ3 A;  2DBM A;  2ROL A;  3M57 A;  3L42 A;  1VYV A;  2E64 A;  5HKC A;  1UUE A;  5GAM h;  3CCQ Q;  2A7Y A;  3EFS A;  2JZ2 A;  4XTU A;  2RH2 A;  4OB1 B;  1NE8 A;  1LCK A;  1PC0 A;  5CKE A;  3CEY A;  4DEX A;  2J6K A;  1AOJ A;  1PG5 B;  2RI5 A; 
#chains in the Genus database with same CATH homology
 4M7D E;  2GFU A;  2RA2 A;  2RHZ A;  3M54 A;  4A4K A;  2LRQ A;  4E7H A;  4GLK A;  1V29 B;  2LT4 A;  1N9S A;  3BFM A;  4MZT A;  2EJ9 A;  1YJ9 A;  3VYG A;  3BY7 A;  3T9N A;  3L2W A;  4ZTF A;  3ZFJ A;  2VXF A;  5IN1 A;  4OB0 B;  3CMA T;  1U1S A;  1VQ6 A;  2OTJ T;  2H3J A;  4XU3 A;  1QVG S;  1VQ7 T;  1YIT A;  2KMT A;  2DZ9 A;  3Q1J A;  4NL2 A;  3X20 B;  3LW5 E;  5GAM g;  2EAY A;  3QJY A;  4UC4 A;  4ATO A;  5A0L A;  4BD3 A;  2B8A A;  3X26 B;  4M7A F;  1YCY A;  2RK2 A;  3A5Z B;  1UB4 A;  1YJW T;  3TCJ A;  5CK9 A;  1KG1 A;  5KE2 A;  2WSC E;  2JNG A;  4BI4 A;  3OYH A;  5A0G A;  2F69 A;  2QI2 A;  5GAM e;  2MWP A;  2E10 A;  5KCO A;  1MGQ A;  1K73 C;  1SSF A;  2VGM A;  2DXB A;  5LJ5 g;  3OYC A;  3G71 T;  3UPU A;  5GAO q;  3GLX A;  5LJ3 h;  3S3N A;  4LDX A;  3JCM V;  4C0D B;  3JAM E;  2E6Z A;  5GMK j;  2RJC A;  3NFC A;  5DY9 A;  4CI0 C;  1P92 A;  3GNG A;  4DQ2 A;  2RJD A;  4L6V 5;  5J39 A;  4HT9 A;  5A0D A;  4M77 F;  5AYF A;  2PVD B;  2JN0 A;  5J3B A;  5FRM A;  4FSX A;  5GAN 6;  2PVO B;  2K2V A;  1M8V A;  3HL8 A;  3LYI A;  3PMI A;  2R5A A;  3ZEH A;  3G4S T;  4FT2 A;  3CCM A;  2HQE A;  4VUB A;  2RHY A;  3CBO A;  4BI8 B;  4C8Q G;  5I2M A;  5I2S A;  3JCM f;  5GAO r;  4TVR A;  3L1A A;  3CXC A;  3RUX A;  4PJO F;  3CC7 T;  1Y96 B;  2FL7 A;  3JSC A;  4FL6 A;  2K4Y A;  2V8I A;  5GAN 7;  3OYI A;  1B34 A;  1WPY A;  4M78 F;  1OYX A;  3CC4 T;  2IG0 A;  2KK4 A;  2RHU A;  2GCX A;  5GMK h;  3CCR T;  3V8K A;  3CCV T;  1YHQ T;  2VV5 A;  1Y71 A;  4JRK A;  4C92 G;  1BI3 A;  3CCJ T;  2LX9 A;  4J5Y A;  4XTV A;  2EQK A;  2ZPE B;  1FX7 A;  4XTZ A;  1VQ9 T;  1YI2 A;  2I2L A;  2RJE A;  4PJO G;  3JCM b;  4DOW A;  3CCQ T;  1H64 1;  1GXI E;  1UGR B;  3KUF A;  4PJO C;  1KQ1 A;  2R57 A;  2L5Q A;  4C92 A;  4IUV A;  4IUU A;  2E1H A;  2RM4 A;  4OGC A;  2XID A;  2PUK B;  2ZPH B;  4X34 A;  4F7U E;  2PVG B;  4JRQ A;  1QVF A;  1TH7 A;  2DAQ A;  2E6N A;  4HA8 A;  2QQB A;  2YLB A;  4XK8 E;  3G4S A;  1VQM T;  4OGE A;  5GAO m;  2X4X A;  1UGP B;  2XKO C;  2QQR A;  3OS2 A;  3L2V A;  1M90 C;  3EFR A;  1G5V A;  3HSB A;  3QJ6 A;  1R8O B;  2JTM A;  4NS5 A;  4RCC A;  3A8L B;  3C4S A;  2X4J A;  1NPR A;  4M75 D;  4ELZ C;  3OYL A;  1BIA A;  3LGL A;  2EQM A;  1O9S A;  4KUD K;  3CD6 A;  1BYM A;  4Y91 A;  4PJO A;  1AHJ B;  1M1K U;  4ZGJ B;  3FEO A;  5GAM d;  1QP3 A;  2LQ8 A;  5DLQ E;  3G6E T;  4XU0 A;  3FDR A;  3OB9 A;  3QHS A;  1G3S A;  5LJ5 d;  4LDY A;  5CCA A;  1MHN A;  1G3Y A;  4M75 C;  5GMK e;  5GAN d;  3L2Z A;  3OBW A;  4PL6 A;  1Y7X A;  1VQ5 A;  3X25 B;  3NTH A;  4M7A G;  3C95 A;  1G3T A;  1X75 C;  5LJ3 g;  3CCS A;  4KUI A;  2ZPG B;  4ZN3 A;  3J7A F;  5GAN 8;  4IUQ A;  3OSV A;  3JB9 H;  4BY6 B;  4M77 A;  3INZ A;  2HAX A;  1XNI A;  3GP8 A;  1N8R C;  2HBP A;  1VIE A;  2JTF A;  1JBM A;  4IUT A;  4XAX B;  3PIP A;  2LCL A;  3OYN A;  4A4E A;  5CR2 A;  1FWZ A;  2O01 E;  5GAN 3;  3GOX A;  4C92 D;  4J6Y A;  4P5N A;  4YTL A;  3JCM Q;  1QVF S;  4XTW A;  3GPL A;  4O5V A;  2K5F A;  2QTX A;  4FU6 A;  2D9T A;  1X01 A;  4PLL A;  3M56 A;  3RER A;  3JCM g;  4ZN1 A;  2QEX A;  5LJ5 e;  2KVQ G;  4BAC A;  1XTD A;  2ZPB B;  4NOY A;  4C0G A;  5CQX A;  5LJ3 e;  3LGF A;  1Q82 C;  4F7U B;  2OAU A;  2LC4 A;  2DXU A;  4M78 A;  4C5H A;  3OYJ A;  1KC8 C;  4PJO E;  4A53 A;  3FC3 A;  3M55 A;  4C92 E;  3CD6 T;  5CQY A;  4X9D A;  3SB2 A;  3JB9 D;  4PNO A;  2MF2 A;  3MO8 A;  2XDD A;  4J6X A;  2CKK A;  2EKO A;  3RMQ A;  2DZC A;  5KE3 A;  3H6Z A;  3CXC S;  3JCM c;  3QPH A;  1YIJ T;  4MMK A;  1VQM A;  5IT9 E;  4C92 F;  2LNV A;  4M7D B;  1M1G A;  3M9Q A;  5J26 A;  3E19 A;  4IUP A;  4L5G A;  2GF7 A;  5GAN j;  3CC2 T;  4BDY A;  2ZPI B;  1M9S A;  3DLM A;  3MP6 A;  2RI2 A;  3JCM P;  4LDV A;  1BKB A;  3MHX A;  5CKF A;  1OZ2 A;  5LJ3 d;  3S3O A;  2Y90 A;  3HFN A;  5KH6 A;  1NPP A;  4N0A C;  4JRI A;  4M78 D;  4B9X A;  4M7A D;  5C0M A;  1UEB A;  2ZZD A;  3RKX A;  4FT4 A;  3OMG A;  2K5I A;  2Y4X A;  4N4I A;  3SDZ A;  3RKW A;  5CIU A;  5GAO l;  3DB4 A;  3ZBD A;  4M75 B;  3SWN C;  1WJR A;  1DJ7 B;  3RMS A;  4QQ6 A;  4LDU A;  4M75 E;  5C6S A;  3CCR A;  2K57 A;  2GQV A;  1JRI A;  1ZHI A;  4XU1 A;  4M78 G;  4E7K A;  3OBY A;  4M7A C;  3QXE B;  3LWI A;  3QKJ A;  2XHC A;  4ME7 A;  2CZ0 B;  4KT0 E;  4MZM A;  5L8R E;  3CCQ A;  4RKU E;  1VQO A;  1YJ9 T;  2C06 A;  5GAN h;  4M75 G;  5IAY A;  2LVM A;  3GIB A;  2P4T A;  3TU4 K;  4EMK B;  3OYB A;  1VQ5 T;  1WGS A;  1WJS A;  5FU7 C;  2O4X A;  4OP0 A;  3JCM J;  2DTH A;  4C8Q F;  4WF2 A;  2VGN A;  3WVD B;  4C5G A;  3VKI A;  4PKC C;  4EMK A;  4EMH A;  5LJ3 j;  3OYK A;  1I8F A;  1HXD A;  4IUR A;  4MZP A;  1K73 U;  1K8A U;  4J8O A;  4D6W A;  4QVD A;  3J81 E;  2KQW A;  3FLG A;  1KQS A;  1KHI A;  3F70 A;  5CO7 A;  3CME A;  4E7J A;  2DD5 A;  2EIF A;  3G7Z A;  2QQA A;  3M4G A;  1EIF A;  3OMC A;  1KHC A;  1Q86 U;  2XG8 D;  4E47 A;  1JB0 E;  4BB7 A;  4M7A A;  5GAN g;  2P0P A;  3KBG A;  4F7U A;  3X28 B;  2X4W A;  4HKE A;  5LJ5 j;  3QYG B;  4IKF A;  2D6F A;  5GAN 2;  2WSF E;  3VU3 C;  1VQ8 A;  1WNL A;  3CME T;  3M53 A;  2ZGW A;  1Q81 U;  1IRE B;  3LLR A;  2QDY B;  2CGH A;  4QVZ A;  3OYM A;  4JJN K;  2DO3 A;  3WVE B;  1N8R U;  4HCB A;  3BDL A;  5KCH A;  3QDR B;  3LH0 A;  3UDC A;  2O4X B;  3BDU A;  3L2U A;  2F5T X;  5DM7 R;  4N0A A;  3QUI A;  5EG2 A;  3P8H A;  1VQ7 A;  1D3B A;  5GMK l;  1D3B B;  4HCC A;  2QA4 T;  4BE0 A;  3JCM W;  3P8B B;  4II1 A;  4OVA A;  3V8J A;  4F7U G;  1UGQ B;  2FHD A;  4E7L A;  1YJN A;  4RG8 A;  3SD4 A;  3E9G A;  3I55 T;  1VUB A;  4Z02 A;  4EMK C;  3QSU A;  4V2S A;  4HT8 A;  3GF5 A;  1K8A C;  5GAN 5;  1PSE A;  3L2R A;  4M7A E;  3M59 A;  5M9O A;  3JB9 F;  1I5L A;  3C12 A;  2XD0 A;  2A3L A;  3HPW A;  1M5Q 1;  2DXC A;  4EDU A;  3SWN B;  4B9W A;  5GAM j;  4M77 D;  1VQO T;  2XDP A;  5D6W A;  2OTL T;  3M4Y A;  1VQ8 T;  1XOV A;  3SWN A;  1KD1 U;  3QBY A;  4LD6 A;  1BI0 A;  5D6X A;  1U8R A;  3C94 A;  2V8K A;  2R58 A;  3HHT B;  2KAF A;  4OB3 B;  3OW2 S;  2DK3 A;  2XDB A;  2FB7 A;  3DKM A;  1I4K 1;  3QG1 A;  2CZ7 B;  4PJO D;  3JCM X;  3UT1 A;  3GNF B;  1N6A A;  3A8H B;  3HKS A;  3MEU A;  4OMF B;  3V7S A;  1BI1 A;  2BKD N;  2MI6 A;  3BW1 A;  5GMK i;  5FU6 B;  4ZGD B;  2VC8 A;  2QQ9 A;  3G6E A;  4M78 B;  2WSE E;  4N4H A;  3JB9 G;  2XI9 A;  4N4G A;  3CC2 A;  3H8Z A;  3QII A;  5FRO A;  5GAN f;  4BI3 A;  2JVV A;  5GAN 4;  3QO3 A;  3R6O A;  4JLI A;  3HP9 A;  1QVP A;  4QQD A;  4M7A B;  1H3Z A;  4M78 E;  2YRV A;  3OQ5 A;  2QEX T;  2E41 A;  3OYE A;  3DB3 A;  4C8Q D;  2VXE A;  3PFS A;  4C5E A;  1W2B A;  1RL2 A;  2CZ1 B;  2DKG A;  3PNW C;  3S3M A;  2CZ6 B;  2PU9 B;  4XTY A;  2CS7 A;  2EYQ A;  1YJN T;  3OSS C;  2RHX A;  1OI1 A;  3OYA A;  3PTA A;  3CCL A;  1QVG A;  5DLO A;  4NL3 A;  1VQP T;  2QA4 A;  3CCE T;  1VIF A;  3JB9 I;  2HQX A;  4ELY C;  1KC8 U;  3AHU A;  1RI0 A;  2FYK A;  1Q7Y U;  4C8Q C;  4M77 B;  4RMO A;  3OYG A;  1X6O A;  3E9F A;  3PT9 A;  3OS0 A;  4M7D G;  4A4G A;  3CPW S;  2L89 A;  3CCV A;  1YHQ A;  5A2Q E;  2P0Q A;  2M9U A;  4PLI A;  1O75 A;  3A8M B;  2DIQ A;  2E70 A;  3M58 A;  3MET A;  2DXT A;  3JCM h;  4C92 C;  5I21 A;  4PJO B;  2MAM A;  5GAN e;  1VQN T;  3DLL A;  3A8G B;  4GY5 A;  4M75 A;  1VQK A;  4KUL A;  3MP1 A;  2XK0 A;  2DTO A;  1M90 U;  2NLU A;  2RJF A;  2EJG A;  2X35 A;  3CBP A;  2LQK A;  3QZ5 B;  2EQJ A;  4L59 A;  3OW2 A;  1FXX A;  1YIJ A;  4RG2 A;  2P0K A;  3VYH B;  4ZGE B;  3JCM e;  3LWH A;  1WQW A;  1XQH A;  2EFI A;  4J6W A;  1Q86 C;  3MEV A;  3HFO A;  3HRS A;  1ZQ1 A;  5LJ3 f;  1K9M U;  1Q81 C;  4A54 A;  4KBM B;  1OZ3 A;  4BDZ A;  3CPW A;  2MWO A;  5LL6 S;  4M7D A;  1JJ2 S;  1WQ7 A;  2XU8 A;  2IVW A;  2DEQ A;  4JLG A;  1LOJ A;  2EWN A;  1BI2 A;  1LJO A;  2HD0 A;  3ASK A;  4OB2 B;  4BY6 C;  1QW1 A;  3I56 A;  4JS5 A;  4C5I A;  3CBM A;  1VQ9 A;  3OS5 A;  2KY9 A;  1B34 B;  1PSF A;  4XQ3 A;  4C0Z A;  1W2B S;  2DIG A;  1M4Z A;  3OYF A;  1YIT T;  5HK3 A;  4RCB A;  5FLX E;  1VQ4 A;  3JCM d;  1NZ9 A;  4XTX A;  1LNX A;  4Q5W A;  1VQ4 T;  2RO0 A;  2DPP B;  3RES A;  3V7R A;  5CKD A;  3JB9 J;  1JJ2 A;  4LDW A;  3MCA B;  1K9M C;  2LDM A;  3CCU A;  3CPF A;  5CVI A;  1HK9 A;  2X4Y A;  1VQP A;  4C92 B;  2E5Q A;  2RB6 A;  3MEA A;  3VJP A;  2RHI A;  5LJ5 h;  3I56 T;  3L2Q A;  4BE2 A;  4QQG A;  2R5M A;  2VYT A;  3EAE A;  5CKH A;  2FVU A;  3A8O B;  4OF1 A;  2L8D A;  3HRU A;  3CC7 A;  4XU2 A;  3QYH B;  2ZCF B;  4J7F A;  5GAM f;  2K5L A;  3FJP A;  3VV0 A;  2DJZ A;  3FB9 A;  4HCZ A;  2LT1 A;  2EJF A;  1W4S A;  4C0D C;  2XIC A;  2MMP A;  2E12 A;  3MP8 A;  4M77 G;  1Q82 U;  2JUF A;  4CRI A;  3ME9 A;  3JRZ A;  3KXT A;  2Y4Y A;  1BIB A;  1VQK T;  4Y28 E;  4F7U F;  3VUZ A;  1N27 A;  3PGG A;  3VUB A;  1Q7Y C;  1IZ6 A;  2L3R A;  2DD4 A;  4X9C A;  5HY6 A;  3PMT A;  2E65 A;  3G71 A;  2LCC A;  3E1S A;  3X24 B;  3SFM A;  3LX7 A;  4QW2 A;  3FIF A;  4EMG A;  5LJ5 f;  1YI2 T;  4FIB A;  3N5B B;  3TEE A;  3J80 E;  3CCU T;  4C8Q E;  1M1F A;  3WXM B;  5HK0 A;  1S72 T;  4JUV A;  2M1H A;  2RK1 A;  2M0O A;  2QQS A;  4M7D F;  3O8V A;  4J83 A;  2YHT A;  1ZBX A;  1YBY A;  2G3R A;  2PQW A;  5GAO n;  4JS4 A;  3PIO A;  2OTL A;  3OYD A;  5GAO p;  3CCL T;  3OY9 A;  5FU7 B;  3CCS T;  4LD9 K;  3ER0 A;  3FRN A;  3QZ9 B;  4FM4 B;  3V7C A;  1M1K C;  1Y07 A;  3RIR A;  1Y96 A;  2LTO A;  3OA6 A;  3NTK A;  2AHJ B;  4M75 F;  5D6Y A;  4BUG A;  2ZPF B;  1VQL A;  3I55 A;  2RD1 A;  4O6J A;  3CCM T;  4JRP A;  2GFA A;  4MDX A;  2BUD A;  2EQU A;  2BIV A;  2DVE A;  3OS1 A;  2YLC A;  3CCE A;  4QVC A;  4M7D D;  5GMK m;  4M77 E;  5FRN A;  1KQS S;  1I81 A;  3M5A A;  1S72 A;  3URG A;  4M78 C;  4ZTJ A;  2K3Y A;  4R56 A;  2KSS A;  4BE1 A;  5FU6 C;  4M77 C;  4C8Q A;  4C8Q B;  3CC4 A;  2KDS A;  4EPC A;  1YJW A;  2DTI A;  2V8J A;  2JOY A;  2M16 A;  2K3X A;  4M7D C;  1VQ6 T;  1VQN A;  2RI3 A;  3OYY A;  4J7I A;  5CAI A;  3P8D A;  5CKB A;  1QP2 A;  3UWN A;  2CYZ B;  1NJI U;  2WAC A;  1N9R A;  3NTI A;  4A4H A;  2VUB A;  3CMA A;  1NJI C;  2OTJ A;  2PUO B;  4C0F A;  3HRT A;  4DOV A;  4DA4 A;  1VQL T;  3M57 A;  3L42 A;  3S6W A;  3CCJ A;  2E64 A;  5HKC A;  5GAM h;  2QXF A;  1U1T A;  2D0Q B;  1WJQ A;  4MDW A;  1G3W A;  2A7Y A;  3EFS A;  2HNI A;  1KQ2 A;  2JZ2 A;  4XTU A;  4R55 A;  2RH2 A;  3MEW A;  4JDS A;  4OB1 B;  1NE8 A;  3RKY A;  4A4F A;  5CKE A;  3CEY A;  3TRE A;  4MML A;  1KD1 C;  1UGS B;  4E7I A;  3V8L A;  2RI5 A;  2F5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...