4ELZC

Ccdbvfi:gyra14vfi
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
SQFTLYKNKDKSSAKTYPYFVDVQSDLLDNLNTRLVIPLTPIELLDKKAPSHLCPTIHIDEGDFIMLTQQMTSVPVKILSEPVNELSTFRNEIIAAIDFLITGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit A
publication title Alternative interactions define gyrase specificity in the CcdB family.
pubmed doi rcsb
source organism Vibrio fischeri
molecule tags Toxin/isomerase
total genus 25
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4elzC00
3JSCA 1NE8A 1X75C 3HPWA 5HK0A 3TCJA 5CK9A 2MF2A 2C06A 4HKEA 5CCAA 3G7ZA 4MDXA 5CR2A 3NFCA 4OF1A 5CKHA 5CO7A 3VUBA 5CKDA 5CKEA 1VUBA 5CQXA 4MZMA 2KMTA 5HKCA 4ELZC 4ELYC 5HK3A 3JRZA 4MZPA 1M1FA 4MZTA 1UB4A 4VUBA 5CKFA 5CKBA 4ME7A 5DLOA 5CQYA 2VUBA
chains in the Genus database with same CATH superfamily
4C8QF 3H6ZA 4C5IA 3I56A 2EQMA 2ZGWA 4M7AG 4M7DE 1HYOA 2C0IA 2DO3A 2VGNA 5GMKe 2L3RA 2B86A 2JZ2A 2CDTA 4M75E 2FG0A 1NZ9A 2M0OA 1Q81U 2BZ8A 2QQBA 3E1SA 4F16A 4RCBA 3CCST 1C6VX 3L2WA 3CPWP 1SEMA 4M7AF 1G8XA 1U3OA 1X27A 4UC4A 4C0DB 4OB0B 1Y96A 4ZGEB 3G4SQ 3RKWA 4BY6B 2RI2A 5CQXA 3CCQA 1Q86U 1BI2A 2OTLQ 2JN0A 3OW2S 5J26A 1OZ3A 4MZTA 4ESRA 3CCRA 4BACA 2K3BA 3UA7A 5FRNA 2XD0A 3P8HA 3EG9B 3RMSA 2FPEA 1VQ4T 3OSVA 2HBPA 4IUPA 3M0QA 3QDRB 2QA4T 3GPLA 2ABLA 2KR3A 1FXXA 4EMKA 2LQWA 1RUWA 2JOYA 1ZSZA 4BDYA 2X3WD 3PE0A 5CKHA 4CI0C 1M3CA 1N27A 2DBKA 4JZ3A 2SRCA 1OPLA 4Q5WA 3V8LA 2GF7A 1YJ9Q 5HY6A 1YWOA 3L2VA 4Y92A 4M78G 4PJMA 2HEQA 2EGEA 1KQ1A 1D1BA 3QIIA 2LQ8A 3M4GA 3CXCP 1VQ5Q 3CC7Q 4L6V5 4IUUA 1LJOA 1K9MC 3RMQA 1X69A 2DTOA 2JJ9A 1TXQA 3VS6A 4RMOA 1I1JA 4LUDA 3KBGA 2L5QA 4X9DA 4XU2A 1MNDA 2EJ9A 2P0QA 2DRMA 5CKDA 1GCPA 4JLGA 1IHWA 1YWPA 2KGTA 4XTVA 4M78F 1BKBA 4N4IA 4GLKA 5I2MA 4FCYA 2LNHB 5GAMg 5KYUB 2DIGA 2IVWA 2C0OA 1K76A 3OS2A 1AEYA 1QCFA 1KHCA 3JCMQ 2VXFA 3T9NA 3VRYA 2VC8A 1N8RC 4JUVA 3CQTA 3RDVA 4RTXA 3H8ZA 3OBYA 5KCHA 4IUTA 2QGFB 2RHZA 3FC3A 2E3HA 4XQ3A 3KUFA 3CCVA 2EQJA 1YHQA 2BE9B 1J3TA 1K73C 4NOYA 3QUIA 3VU3C 3CCLA 3OS5A 4LDUA 1HSQA 4M7DD 2VB6A 3TREA 2M1HA 4DBQA 4X34A 1SRLA 1T0JA 2OJ2A 2KT1A 3THKA 2MYSA 4E47A 4F14A 1GFDA 4M75D 2M02A 1WJRA 3CCUT 3A98A 2ED0A 1E6HA 2QASA 1Q7YU 2LJ3A 5GAOp 1R0CB 1SHFA 4EIKA 3LLRA 2NWMA 3VS3A 1IGUA 1TUCA 2K5LA 3G6ET 2H3EB 4NL3A 5LJ5g 3MEAA 3MKDA 2NYSA 3G4SA 2JTFA 5CIUA 5IHKA 3PNWC 3GF5A 5C6SA 1NJIC 4FYWB 2PVGB 2QTXA 2DD4A 2QQ9A 1K8AR 4ZTJA 4AFUC 1QWFA 1NBEB 5CQYA 1BB9A 1XTDA 4M7DG 4FU6A 2CUDA 1G3WA 3QWXX 4J9HA 1WHMA 2DETA 3M58A 4LUEA 2C0TA 1RAEB 4M75G 2FPDA 1YJ9A 3CXCS 2CT3A 1W4SA 2DFUA 5FW9A 2XICA 2BIVA 3DKMA 2COWA 4X1VA 3CC7A 4PFPA 3GBQA 1KHIA 3TVTA 4C92B 2MWPA 3EGXA 4PJOB 3OYMA 4XTYA 1IXDA 2ATCB 2YRVA 2R5MA 1ZSZC 5DY9A 5D7UA 4BUGA 3OS0A 4PLLA 4JRQA 1H8KA 1IB8A 4AG1C 3NTKA 3LGFA 1WHGA 2CP5A 3FIFA 2JM9A 1T3SA 1VQ9A 1PNJA 3OA6A 4AFZC 4RKUE 3A1PA 4GLMA 4M77D 5GMKl 2CZ1B 1ZA2B 4RTYA 1PD1A 2DF6A 3MHXA 2XDPA 3H0FA 2B8AA 2LJ0A 2CH4A 1OEBA 2DRKA 3NTIA 3ZBDA 1S1NA 1VQKT 1W2BP 2W0ZA 3PGGA 4QT7A 3HFNA 3ER0A 3RUXA 1H3HA 2GTOA 8AT1B 1Q81C 2ZPEB 3RIRA 1KD1U 1UUEA 4EDUA 2CYZB 1RLQC 2AZSA 4KUIA 3EFOB 1JO8A 1MV0B 2HMAA 1M27C 1ZUYA 1KK7A 1M4ZA 2M0YA 3TCJA 1HD3A 3JB9F 3JCMf 1YJNA 1TWBA 5DLQE 4FSSA 5GANg 2DVJA 1Q86C 2RJDA 1JU5C 3LYIA 3EFSA 4MMKA 3CBOA 1IHVA 3C0CA 3CD6T 2O9VA 3R6OA 4M77G 5GAOn 1JQQA 5FU7C 3CMAT 1Y7XA 3EH1A 2EBPA 1RAHB 2YLBA 4OMPA 4E7ZA 4N0AC 2XDDA 1RADB 1VQMQ 4R55A 5KYXA 5FWBA 1VQPT 4DOVA 2KYBA 2F2WA 4F17A 3OQ5A 2CP7A 2J05A 1U06A 3C95A 1OU8A 5GAMj 3CCSA 3UPUA 2J06A 2LT4A 1NPRA 1NLOC 4F7UB 2PNIA 4M4ZA 1ZBXA 2FZKB 1NYGA 4LN2A 2RA2A 3JCMJ 3QG1A 5I11A 3LGLA 2ZPHB 1X43A 4C0ZA 4JPBW 3RERA 3M4YA 5HKCA 1YBYA 4HCBA 2FO0A 3BDLA 2R57A 3QPHA 2QA4A 4DBHA 4C8QB 1PC0A 4OMNA 4FW1A 5IT9E 4XU0A 4MMLA 2K3YA 1WNLA 3M5AA 2O31A 2GCXA 2YUPA 1N5ZA 2KSSA 3HRUA 2JT4A 2F69A 4HVUA 2A08A 2NUPB 1NPPA 2V1QA 3UA6A 1G83A 3X25B 2ZPIB 1WQWA 2E6ZA 1W2BS 4M7AB 5LJ5j 2KYMA 1GRIA 3M54A 3QYHB 4HKEA 4QQGA 2E1HA 1Q7YC 1UECA 1M1KU 3A8OB 2XI9A 2K79A 2P0PA 2QQSA 1KJWA 2JW4A 3M0UA 3M55A 3KFVA 2YUOA 5CVIA 4GBQA 5KYUA 3PMIA 3CCJQ 2O4XB 1Z9ZA 3I56Q 2V8JA 1TOVA 4A4GA 5LJ3j 2DE0X 1OU9A 4R56A 4QW2A 3V7SA 3HTRA 2X51A 2HD0A 2JM8A 3CBMA 1H92A 2CKKA 1UHCA 3QDFA 2RMOA 3OW2A 3A5ZB 4J6WA 1VQMA 1VQ8T 4F04B 1I81A 3X20B 1YCYA 1UDLA 1VQKQ 4KBMB 1KC8R 2E5QA 2F1LA 4OP0A 3VJPA 1MNEA 5CR2A 4AFSC 3S3MA 3L2QA 2A37A 2RB6A 4M78B 2P0KA 1VUBA 1EFNA 3S3OA 3EG3A 5GAOq 1WXUA 2DA9A 3CCQQ 1D0YA 2PQWA 5FROA 3FEOA 1R8OB 2ZPGB 2ECZA 1NLPC 1UGVA 3FB9A 2DTHA 3WVDB 2OX7A 5FU6B 2JXBA 2KRMA 2YUQA 2ZAEA 1GL5A 2HQEA 3CMAQ 4JLIA 4OMOA 2KT8A 4RG8A 1HXDA 3I55T 3VS0A 2LNVA 1WX6A 2PVDB 3PFSA 1YN8A 4LD6A 2LCCA 2D6FA 3MO8A 4IIOA 2LTOA 2WSFE 1AWWA 4HT8A 4IURA 2RHIA 1PHTA 1WQ7A 5KYWA 4RTTA 3F70A 3BY7A 3QSUA 4E7KA 2KMTA 3M0SA 2DX1A 4C0DC 7AT1B 3QXEB 2ESWA 4BY6C 2CP3A 2K2VA 1ZHIA 3EGDA 3JCMb 2FVUA 3V8JA 4F7UF 5GANj 2K9GA 4BE2A 3HKSA 2HQHA 3PIOA 4PJOA 1JXMA 2K7AA 1PG5B 3OYJA 3J81E 3CPWA 2CSQA 1KD1C 1YHQQ 2NUZA 2DXUA 3QZ5B 4FYVB 3M53A 4PJLA 2AKKA 4OB2B 1TUGB 1CKAA 4QQ6A 1YI2Q 2YRCA 1JJ2P 1ZSGA 1IO6A 3MP8A 2F2VA 2O88A 2DL8A 1VOMA 3AT1B 3OYBA 1PSEA 4KGVB 2EQUA 1D09B 3CEYA 1WHHA 1NEGA 4XU3A 1AD5A 3HP9A 2H3JA 1VQKA 2JS0A 2DMOA 2CZ6B 1OI1A 2AZVA 4M75B 5M9OA 2LQNA 5GMKj 3PIPA 3EGUA 2GBQA 4OGCA 2L3PA 1M2VB 2WSEE 3H9NA 1MMNA 5GAMf 2EVRA 5CKEA 2FEIA 2DEQA 1KG1A 1QKWA 4II1A 1VQNT 5CKFA 6AT1B 5DLOA 1XJWB 2AHJB 1YJWT 3QKJA 3MP6A 2RJFA 1M8VA 2HDAA 3HFOA 4XTZA 2KXDA 1QMCA 2EWNA 3ULRB 2KEAA 1TG0A 4FYYB 1QCNA 3CMAA 4ELZC 3A8MB 1AWXA 3P8BB 2LZ6B 1N9RA 1PKSA 2WACA 3CMET 1VQ8Q 3V7RA 2Y90A 3JCMh 1X6GA 4L5GA 3ME9A 2DM1A 3JCMd 4PFZA 2BKDN 4BI4A 4Z02A 2EQKA 4OF1A 3LH5A 4PNOA 3OMGA 4BI3A 2EKOA 2GFUA 4AG2C 1I07A 2QI2A 3JAME 5LJ5f 3G1JA 2KRSA 2PUKB 1IGQA 3X28B 2XIDA 3EFRA 1M90C 2MPXC 4JRKA 4J6YA 1W70A 4XTWA 4PJNA 1B3QA 5A0LA 2QXFA 1QVPA 2GQVA 1M1KC 1VQ9Q 5EC7A 1U8RA 4BE1A 5HK3A 1MMAA 5KE3A 2K2MA 3I55Q 1JJ2S 3X24B 1ZA1B 3G71T 3GNFB 2DPPB 4C8QA 1YI2A 4A4HA 1NE8A 5LJ3f 3M0RA 1K8AU 4JRIA 1NEBA 3O8VA 2RK2A 2EYXA 2A7YA 2RHXA 4M77B 1PKTA 2KDSA 5KH6A 3HRTA 3VS5A 4C92C 2VASA 1SSFA 2HBWA 3OYLA 4PJOC 3CCMT 2BTTA 4EPCA 1P92A 2AIRB 1JRIA 2HSEB 2BZXA 2NUPA 4N0AA 2YLCA 4CC3A 2YUNA 2QGGA 1VQ7T 1X01A 4RUGA 1AVZC 2XDBA 1UE9A 3U23A 1WXBA 3OYAA 1YJNQ 1TU0B 3REAB 1RABB 3BW1A 1C1AA 3OB9A 4D8KA 3RKYA 1UB4A 4IKFA 4J9CA 3TQ7P 3CCJA 3TSZA 3M0TA 1QWEA 3EHRA 5EG2A 2CGHA 3A8HB 1ABOA 2RQRA 3LX7A 4NS5A 1UFFA 3QJYA 2A0FB 1YCSB 2KROA 3QHSA 2X4XA 1JXOA 2MK5A 1BI3A 1AWJA 2DEUA 2RO0A 1K4US 1VQ8A 1M1FA 3A8LB 3CCSQ 4KUDK 1HJDA 1VIEA 4JDSA 4M7DF 5GAN8 4BI8B 3JSCA 2YSQA 2K4YA 1M2OA 1JB0E 5CAIA 4ATOA 2DNUA 3SDZA 1WA7A 3ZEHA 3PVQA 4M75F 4JZ4A 3BDUA 3C12A 1AZEA 2LVMA 2E4HA 4J9IA 4HA8A 1VQLT 3DLLA 2XHCA 4BD3A 4C92E 4M78A 2D8JA 4PJOE 3BFMA 1AOJA 3CC4T 1VQ4Q 3EG2A 2QA4Q 1D3BB 3RBBB 1GCQC 5GANf 2GTJA 3LH0A 2XG8D 3JB9I 3G7ZA 1QVFA 5GJVB 1WFWA 1LPLA 5GAN2 2EJGA 3I55A 1DJ7B 1WYXA 4J8OA 4MZPA 2J6FA 4QVZA 2OTJT 3SHWA 2DVEA 4PL6A 3FJ5A 2KE9A 3FJPA 1OPKA 1SPKA 3INZA 1ZX6A 3FDRA 2E64A 1MHNA 4JS5A 4FIBA 4LDWA 2EJFA 2RQTA 1IRXA 3H41A 3QYGB 1T0HA 4A4EA 3O5ZA 3SWNA 1R0BG 2IG0A 1G2BA 1WJSA 5FRMA 2Y4XA 2EQIA 1G3SA 1Q82R 2AK5A 1GFCA 3VV0A 4BE0A 4GY5A 3VS1A 2W10A 5IHNA 4A63B 4C8QC 5GMKm 1X6BA 3JCMP 2I0NA 3NFCA 2QEXT 2CP6A 2I2LA 2EYQA 1QKXA 1QLYA 3TEEA 3CBPA 1MMGA 3REBB 4EMKB 1V29B 5IXFA 2PZ1A 3CCRT 1ZSZB 4JRPA 3C4SA 2MMPA 1FWZA 1CKBA 2P4RA 3LWHA 2PUOB 2DL3A 5GAN6 1RAAB 4M7AC 3CCUQ 4KRTA 5D6WA 5I22A 1S72T 4MZMA 2V8KA 1ARKA 4ELYC 4C0GA 2EGAA 4FM4B 4DA4A 5GAN3 3OYDA 4M77F 3QBYA 4ZN3A 2DBMA 2DILA 4HT9A 3G6EQ 2HCKA 3PVLA 4KULA 4B6MA 5I21A 1X2KA 1AHJB 2DL4A 2K57A 1Z9QA 2MWOA 2M9UA 2R58A 1JBMA 4PJOD 4C5EA 5KCOA 1Y71A 1WXTA 3RKXA 1M2VA 2HKQB 4F7UE 2L2PA 2JTEA 1VQ4A 2E70A 2PVOB 1FMKA 4ZTFA 2WSCE 3VUZA 1YITT 1UTIA 3OYHA 2GQIA 2EYZA 2DXCA 3EG9A 2C06A 5GAMd 4HCCA 4C8QE 3URGA 1JEGA 1SF9A 5GAN7 2MI6A 1YIJT 1ABQA 2LMJA 1K1ZA 1TSFA 1AT1B 3CCVT 1KQSA 4M78C 1EX4A 1QVGA 2M16A 4CC2A 2E5KA 1K8AC 4Y28E 1G3YA 2ZCFB 1K9MU 1KIKA 1UGQB 2G6FX 1U1SA 5FU7B 1K9AA 3MEUA 2NUTB 3VUBA 4M7AE 2DK3A 2X4JA 5KYYB 2EGCA 3FRNA 5KE2A 2J6KA 2RHUA 2RNAA 3META 2KY9A 1KC8U 4XK8E 5FU6C 4RCCA 3UWNA 4MDWA 3E9GA 3L2RA 3UATA 1FX7A 1N8RU 5LJ5h 1QQJA 3RR6A 4CRIA 2L89A 2A3LA 1V1CA 4LD9K 5LJ5d 2HL3A 4E7LA 4IIMA 2OTLT 1K9MR 3HSBA 4QKUA 3SWNC 2EYWA 3HPWA 4J9GA 3WXMB 2BZYA 1WHKA 2YRDA 3NHNA 2QTVA 2HZYA 3CCUA 4X9CA 3LW5E 2LT1A 3CCMA 4ZN1A 2HQXA 5LJ3h 1BI0A 2CUBA 3V7CA 1YJ9T 2K5FA 4HCZA 2J6OA 3NMZC 1ZUUA 4R0KA 3G6EA 2L3QA 4QVCA 3E2UA 3EGXB 1N8RR 5LJ3d 3DB3A 4M78E 2X4YA 2F5KA 2O9SA 1VQ5T 3CC7T 4KH0B 1RACB 1M3AA 1PM3A 2QEXQ 1Y0MA 1K73R 1A0NB 1U5SA 4J5YA 3CD6Q 3QWYA 3OYNA 1I4K1 2E6NA 1X2QA 1V76A 4C8QD 3IQLA 4N4HA 4P5NA 1SRMA 1G3TA 1VQPQ 1N9SA 5J39A 5DM7R 2XKOC 3VYGA 5IXBA 1WGSA 3DB4A 2LX9A 2X3XD 1NM7A 3ZFJA 3J7AF 1BBZA 1BI1A 2Z0WA 4ANJA 2RI5A 2QQRA 4IUVA 5FLXE 2RM4A 1OX9A 1TUDA 4DOWA 1NJIR 2RD1A 3X26B 2D1XA 3EH2A 1PD0A 9ATCB 1B7TA 4OMLA 3EG1A 2KI7A 3GIBA 4PLIA 3EG0A 1VQLA 2RN8A 2XMFA 4C92A 2DYBA 4AMCA 1E6GA 3JB9H 3JB9J 2V1RA 4DBFA 2QG9B 1VQ6T 2CT4A 5GMKi 2V8IA 2DZCA 4E7JA 4C8QG 1AZGB 4A4FA 2D0NA 1XOVA 3C94A 2FHDA 2MIOA 2GNCA 2QAZA 3QO3A 4Z89A 1YIJQ 4E7HA 2VKNA 4M7DB 2DAQA 1UEBA 5GANd 3S6WA 3I5RA 1Q95G 2M51A 4BB7A 1D1AA 1R77A 1VYUA 4PJJA 2RHYA 5FWCA 2RJEA 3OYYA 2KNBB 2F2XA 1K0SA 4PK4A 1ZBJA 2QYZA 2VV5A 4M78D 2RPNA 1MMDA 3CXCA 3JCMe 4LNPA 2RF0A 4PKCC 3PMTA 1VYTA 3OYFA 3UT1A 2J7IA 1RAIB 2QEXA 5CK9A 1SHGA 2DJZA 4J9DA 3EFOA 2VVKA 4LDXA 4CC4B 1BU1A 3CD6A 3I5SA 1UJ0A 3M9QA 3VYHB 1TS9A 4D6WA 5GMKh 1TTHB 2LC4A 3FLGA 3GNGA 2ZPBB 1WJQA 5LL6S 1M8MA 4JJBA 1O75A 1KQ2A 4M77C 2LX7A 3ZL7C 1GCQA 1VQPA 2DXBA 2BE7D 4WF2A 4DEYA 4LXCA 1WI7A 2A28A 1I0CA 1S72A 5L23A 4OVAA 3SD4A 2H8HA 1Q81R 2IPOB 1RI0A 2GFAA 4ORZA 1QCOA 2E41A 2LJ1A 3HRSA 2QK0A 8ATCB 1RAGB 3N5BB 4TVRA 1QW1A 3DLMA 1E7OA 2BUDA 1Q86R 4PFOA 4EMHA 2COYA 1WZOA 2HAXA 4XTUA 2LDMA 2FRYA 4F7UA 5ECAA 5IH2A 3JCMW 2DXTA 1D0ZA 4O5VA 1YITA 1KC8C 3J80E 1T3LA 1U1TA 4HCKA 1RI9A 1UJYA 3VS7A 3HHTB 3GP8A 2P4TA 1LNXA 4XTXA 3KXTA 3TSWA 4FT2A 5I2SA 5IAYA 3P8DA 3E19A 2EPDA 3HL8A 5IN1A 1EZZB 3JCMV 4RG2A 4HVVA 4V2SA 3OYKA 4LDYA 4B9XA 2CH4W 2L8DA 3LWIA 2RH2A 3V8KA 1YIJA 3VS4A 4NL2A 3M57A 1W6XA 1BK2A 3QJ6A 1NYFA 2CREA 2DL5A 2RQVA 2LP5A 4M77E 1YP5A 1OX8A 4KGXB 4CC7A 3MPUB 3JCMc 1VQMT 2KXCA 4DQ2A 4M7AA 1F1BB 2MOXA 4FW2A 4JJDA 1VQOT 5CO7A 2A36A 3CPWS 2GGRA 1VQ6Q 2NUTA 5KYYA 4RTUA 2RQUA 1MUZA 2X9HA 3MP1A 5A0DA 2CP2A 3CC2T 1NG2A 1K0XA 3CCET 1X75C 3S3NA 5CCAA 2YXYA 4LDVA 2O4XA 2QDLA 2OTLA 1WDXA 4C5HA 2LRQA 1UGPB 4OB3B 4AFQC 3NGPA 2PTKA 3BE3A 4ME7A 2COZA 2FZCB 1B34B 4E7IA 5KYWB 4HXJA 1Q7YR 4FL6A 2DJQA 2ROTA 1WIEA 5LJ3g 1MV3A 2CZ0B 4YTLA 5A2QE 1VQNQ 4O6JA 2YT6A 2FYKA 2K3XA 2ZPFB 4KH1B 3EGDB 1VQ5A 1B07A 2EYYA 3D7SB 1YJWQ 1QP2A 2YDLA 1M30A 5KYNA 4C0FA 3SFMA 1W2BA 3JB9D 1WHJA 4E7SA 2D0QB 3OYEA 4EMKC 1OYXA 1OULA 1Q82U 2KBTA 2HNIA 3EAEA 1ZUKA 5GJWB 3CMEQ 1GBQA 2KRNA 1OQKA 1SG5A 5GAN4 4OMQA 2ROLA 3OMCA 4E6RA 2FL7A 3EHQA 3CCJT 1G5VA 3I56T 3L2UA 2RQWA 4Y91A 1YFNA 1CSKA 1I5LA 3L1AA 4XAXB 1LCKA 5C0MA 3PT9A 4Z88A 1W1FA 2QDYB 1OOTA 4C5GA 1LVKA 1Y96B 1WLPB 3JB9G 1Y07A 3UDCA 2LQKA 5D6XA 1VQ6A 2CSIA 4IUQA 1QVFP 3OYCA 3G71Q 4J83A 3CCQT 4QQDA 2D9TA 1TH7A 3RESA 5GAOr 2EIFA 2VXEA 3VRZA 3TU4K 5L8RE 4JS4A 3I9QA 2F5TX 3CCMQ 4J7IA 2HL5C 2JTMA 1GXIE 5GAMe 1KFZA 3MEWA 4E2FB 2DL7A 2NLUA 2VUBA 2ENMA 2KK4A 4M7DA 4Z8AA 1VQ7Q 1VQOQ 3R6NA 1PCXA 3OS1A 4C92D 1PRLC 1UGRB 4J9EA 4K11A 3UF4A 1KD1R 4XU1A 2AKLA 4M75A 2IIMA 1VIFA 1BIBA 2X35A 1VQNA 3I35A 3PTAA 3JV3A 5CKBA 1YJWA 3CC2Q 2EW3A 3CCEQ 2ED1A 5GAMh 1ZQ1A 2JNGA 4OB1B 1M5Q1 2MF2A 2KQWA 2QQAA 4RTWA 2L0AA 1BIAA 3OYIA 2E3IA 3A8GB 4WCIA 4AT1B 4JJNK 2XU8A 2KAFA 5AT1B 3VS2A 1VA7A 3OY9A 3CMEA 2G3RA 2RI3A 4ZGDB 3JCMg 3WVEB 1RL2A 1UGSB 5A0GA 2R5AA 4OMMA 1YHQT 3NPFA 3SB2A 1KSWA 3SEMA 3CCLT 4JJCA 5LJ5e 2K6DA 1YI2T 1GBRA 4MDXA 2PU9B 4C92G 5HCKA 2E65A 1BCOA 3L42A 3JCMX 1VQLQ 4PJOG 1M9SA 2MCNA 2FRWA 2RK1A 2LCLA 3CC4Q 2YWWA 1VYVA 2CS7A 3H0IA 4A54A 2X4WA 1M90U 1QVFS 4A4KA 4HVWA 1I8FA 2L3SA 1UG1A 3MEVA 4C92F 2E12A 5LJ3e 4PJOF 2VWFA 3G4ST 5AYFA 2DZ9A 3G71A 1K73U 2OTJQ 1RAFB 3AHUA 2VYTA 4OMFB 4A53A 2P84A 2LCSA 1ZLMA 1FMWA 5GAOl 1EIFA 1O9SA 2CP0A 2JMAA 3H0HA 3M59A 1KQSP 2OAUA 4J6XA 3NTHA 1QVGP 1RLPC 3OSSC 4KGZB 2D8HA 1HK9A 2EAYA 3CPFA 3M56A 4RTZA 2JUFA 1M90R 4LE9A 2K5IA 2OI3A 4M77A 4J7FA 1C0MA 3OBWA 2HSPA 2ZZDA 2HKNA 1X6OA 1PSFA 1VQ7A 4RTVA 1VQOA 1OZ2A 1M1KR 1LOJA 5D6YA 2FB7A 4DEXA 3M0PA 1FMVA 3MCAB 4D8DA 2SEMA 1OV3A 1PWTA 1NJIU 2DTIA 4KT0E 2CZ7B 1N6AA 2DIQA 3OYGA 5GAOm 2V26A 1ACMB 4BDZA 3CC2A 3CCEA 4ZNXA 2O2OA 2RJCA 3CCRQ 2DKGA 1SSHA 3E9FA 1YNZA 5HK0A 4M7DC 1AWOA 3OW2P 1QP3A 1FYNA 2JMCA 3RNJA 1D1CA 3Q1JA 1Q82C 2JS2A 4J9BA 1M1GA 1S72Q 4ZGJB 5IHIA 1MGQA 2XK0A 1VQ9T 2O01E 4OGEA 4M75C 4J9FA 1BCMA 4VUBA 4DBRA 2MAMA 2DERA 3GOXA 3MJXA 1D0XA 1JJ2A 5GAN5 2EKHA 4QVDA 4L59A 4M7AD 2E10A 4FYXB 4WTOB 3L2ZA 1B34A 4F7UG 1WPYA 5GANe 1I5OB 3QZ9B 3SWNB 4FT4A 2JVVA 3CC4A 1SKUB 2DLPA 3JRZA 1M3BA 1YITQ 4EMGA 2EFIA 1IREB 1H3ZA 3VKIA 4FSXA 1Y57A 2KVQG 3ASKA 2FZGB 1XQHA 1D3BA 5J3BA 2DD5A 1IZ6A 2VGMA 4N4GA 1H641 1YJNT 1KQSS 1PRMC 2DYIA 1XNIA 1UHFA 5GANh 3CCVQ 3GLXA 1QVGS 2OTJA 1WHLA 2FPFA 2AT1B 4B9WA 2OAWA 3CCLQ 1BYMA 5KYXB 2Y4YA 2YHTA
chains in the Genus database with same CATH topology
4C8QF 5CVIA 3H6ZA 4C5IA 3I56A 3VV0A 3PMIA 4BE0A 2EQMA 2O4XB 2ZGWA 4GY5A 3JCMc 1VQMT 4C8QC 4DQ2A 5GMKm 2V8JA 4A4GA 4M7AA 4M7AG 4M7DE 5LJ3j 1VQOT 2DO3A 2VGNA 3JCMP 4R56A 5GMKe 4QW2A 3NFCA 5CO7A 3V7SA 2QEXT 3CPWS 2L3RA 2I2LA 2EYQA 2HD0A 3CBMA 2JZ2A 2CKKA 3TEEA 4M75E 3CBPA 3OW2A 1NZ9A 2M0OA 3MP1A 1Q81U 2QQBA 3E1SA 4RCBA 3A5ZB 5A0DA 4EMKB 3CCST 1V29B 4J6WA 3L2WA 1VQMA 1VQ8T 3CCRT 3CC2T 4JRPA 3CCET 1X75C 3C4SA 2MMPA 1I81A 3X20B 1YCYA 3S3NA 4M7AF 1FWZA 4KBMB 4UC4A 4C0DB 5CCAA 2E5QA 4OB0B 4OP0A 3VJPA 3LWHA 2PUOB 1Y96A 5GAN6 4ZGEB 5CR2A 3S3MA 3RKWA 4LDVA 4BY6B 4M7AC 2O4XA 3L2QA 2OTLA 2RB6A 4M78B 2RI2A 2P0KA 4C5HA 1VUBA 5D6WA 5CQXA 3CCQA 2LRQA 3S3OA 1S72T 1Q86U 4MZMA 2V8KA 1BI2A 1UGPB 4C0GA 4ELYC 4FM4B 2JN0A 5GAOq 4OB3B 4DA4A 5GAN3 3OYDA 4M77F 3QBYA 5J26A 4ZN3A 3OW2S 1OZ3A 4MZTA 2PQWA 3CCRA 4ME7A 4BACA 5FROA 5FRNA 2XD0A 3FEOA 3P8HA 3RMSA 4HT9A 1VQ4T 3OSVA 2HBPA 4IUPA 4KULA 5I21A 3QDRB 2QA4T 1R8OB 3GPLA 1AHJB 1B34B 4E7IA 2K57A 2ZPGB 1FXXA 4FL6A 4EMKA 2MWOA 2M9UA 2R58A 1JBMA 2JOYA 3FB9A 2DTHA 4PJOD 4BDYA 4C5EA 5KCOA 5CKHA 4CI0C 5LJ3g 3WVDB 1N27A 1Y71A 2CZ0B 5FU6B 3RKXA 4Q5WA 3V8LA 2GF7A 4F7UE 4YTLA 5HY6A 5A2QE 4O6JA 3L2VA 2FYKA 2HQEA 2E70A 2K3XA 2PVOB 2ZPFB 1VQ4A 4M78G 4JLIA 4ZTFA 2WSCE 4RG8A 1HXDA 3VUZA 3I55T 3OYHA 1YITT 2LNVA 1VQ5A 1KQ1A 2PVDB 3QIIA 2LQ8A 1QP2A 3PFSA 1VQLT 3M4GA 4LD6A 2LCCA 4L6V5 2D6FA 3MO8A 4C0FA 3SFMA 4IUUA 2LTOA 1W2BA 1LJOA 3JB9D 3RMQA 2WSFE 1K9MC 2DTOA 2D0QB 2DXCA 4HT8A 4RMOA 4IURA 5GAMd 2C06A 4HCCA 3OYEA 3KBGA 2RHIA 4C8QE 2L5QA 3URGA 4X9DA 4XU2A 4EMKC 1WQ7A 1OYXA 2EJ9A 3F70A 1Q82U 2P0QA 5CKDA 3BY7A 3QSUA 2HNIA 4E7KA 3EAEA 2KMTA 4JLGA 5GAN7 2MI6A 1YIJT 4XTVA 4M78F 1BKBA 4N4IA 4GLKA 4C0DC 5I2MA 5GAMg 3QXEB 3CCVT 4BY6C 1KQSA 4M78C 5GAN4 1QVGA 2DIGA 2M16A 2K2VA 2IVWA 1K8AC 3OMCA 1ZHIA 4Y28E 1G3YA 2ZCFB 3OS2A 3JCMQ 1KHCA 1K9MU 1UGQB 2FL7A 2VXFA 3JCMb 3CCJT 2FVUA 1U1SA 3T9NA 2VC8A 1G5VA 3V8JA 4JUVA 5FU7B 4F7UF 3I56T 3L2UA 5GANj 4BE2A 4Y91A 1N8RC 3H8ZA 3HKSA 3MEUA 3OBYA 4IUTA 5KCHA 3VUBA 2RHZA 3FC3A 3PIOA 4M7AE 2DK3A 2X4JA 4XQ3A 1I5LA 4PJOA 3FRNA 5KE2A 3KUFA 3CCVA 2EQJA 3L1AA 3OYJA 3J81E 3CPWA 1YHQA 4XAXB 2RHUA 3META 1K73C 2KY9A 4NOYA 1KC8U 1KD1C 3QUIA 3VU3C 3CCLA 5C0MA 3OS5A 4LDUA 4XK8E 4M7DD 3PT9A 5FU6C 2DXUA 3QZ5B 2M1HA 3TREA 2QDYB 3M53A 4X34A 4RCCA 4OB2B 3UWNA 4C5GA 4MDWA 4QQ6A 1Y96B 3E9GA 3L2RA 4E47A 3JB9G 3MP8A 4M75D 1FX7A 1Y07A 1N8RU 5LJ5h 1WJRA 3UDCA 2LQKA 5D6XA 3CCUT 1VQ6A 4CRIA 3OYBA 1PSEA 2L89A 4IUQA 2A3LA 4LD9K 5LJ5d 1Q7YU 3OYCA 4E7LA 2OTLT 5GAOp 4J83A 2EQUA 3HSBA 3CCQT 4QQDA 3CEYA 3LLRA 2D9TA 1VQ9T 2K5LA 4XU3A 3SWNC 3G6ET 3HP9A 1TH7A 2H3JA 3HPWA 3RESA 3WXMB 4NL3A 1VQKA 2CZ6B 1OI1A 4M75B 5M9OA 5LJ5g 3MEAA 5GAOr 2EIFA 5GMKj 3PIPA 3G4SA 4OGCA 2JTFA 3CCUA 5CIUA 2WSEE 2VXEA 4X9CA 3LW5E 2LT1A 3PNWC 3TU4K 3GF5A 5GAMf 5C6SA 1NJIC 3M55A 3CCMA 5CKEA 5L8RE 4JS4A 4ZN1A 2DEQA 2PVGB 2F5TX 2HQXA 1KG1A 4J7IA 1BI0A 2DD4A 2JTMA 2QQ9A 2QTXA 2K5FA 5LJ3h 3V7CA 4ZTJA 4HCZA 1YJ9T 1H3ZA 1GXIE 5GAMe 4II1A 1VQNT 5CKFA 3G6EA 3MEWA 4QVCA 5DLOA 2NLUA 5CQYA 5LJ3d 2VUBA 1XTDA 2KK4A 3DB3A 4M7DA 4M78E 4M7DG 2X4YA 2AHJB 1YJWT 3QKJA 3MP6A 2F5KA 2RJFA 1M8VA 3HFOA 4FU6A 1VQ5T 3CC7T 4XTZA 1G3WA 3OS1A 4C92D 3M58A 1UGRB 2EWNA 4XU1A 4J5YA 4M75G 4M75A 1YJ9A 1VIFA 1BIBA 2X35A 3CXCS 1VQNA 3CMAA 4ELZC 1W4SA 3A8MB 3P8BB 3OYNA 3PTAA 1I4K1 1N9RA 2XICA 2E6NA 2WACA 2BIVA 5CKBA 1YJWA 3DKMA 3CMET 3V7RA 2Y90A 4C8QD 3CC7A 3JCMh 4N4HA 4P5NA 4L5GA 5GAMh 1KHIA 1ZQ1A 3ME9A 1G3TA 2JNGA 4C92B 4OB1B 2MWPA 1N9SA 1M5Q1 3JCMd 2BKDN 2MF2A 2KQWA 5J39A 5DM7R 4BI4A 2QQAA 4Z02A 2XKOC 4PJOB 2EQKA 3OYMA 1BIAA 3VYGA 3OYIA 4XTYA 1WGSA 3A8GB 3DB4A 2LX9A 4OF1A 3OMGA 4PNOA 2XU8A 4JJNK 2YRVA 4BI3A 2R5MA 2EKOA 2KAFA 2GFUA 5DY9A 3ZFJA 4BUGA 3OY9A 1BI1A 2G3RA 2RI3A 3CMEA 3J7AF 3OS0A 4ZGDB 3JCMg 2RI5A 3WVEB 4PLLA 2QQRA 1RL2A 2QI2A 3JAME 4JRQA 1UGSB 5A0GA 5LJ5f 2R5AA 4IUVA 5FLXE 2RM4A 1YHQT 2PUKB 3SB2A 3NTKA 3X28B 2XIDA 3EFRA 4DOWA 2RD1A 3X26B 1M90C 3CCLT 4JRKA 3LGFA 3FIFA 4J6YA 5LJ5e 3GIBA 4XTWA 1YI2T 4PLIA 5A0LA 1VQ9A 4MDXA 2PU9B 1VQLA 2QXFA 1QVPA 4C92G 4C92A 3OA6A 2E65A 3L42A 2GQVA 4RKUE 3JCMX 1M1KC 3JB9H 3JB9J 4PJOG 1M9SA 1U8RA 4BE1A 4M77D 5GMKl 5HK3A 5KE3A 2CZ1B 2RK1A 1JJ2S 2LCLA 3X24B 1VQ6T 3MHXA 2CS7A 2XDPA 3G71T 3GNFB 5GMKi 2B8AA 2Y4YA 2V8IA 2DZCA 2DPPB 4A54A 4E7JA 2X4WA 4C8QA 4C8QG 1YI2A 4A4HA 1NE8A 5LJ3f 1M90U 1QVFS 4A4FA 1XOVA 4A4KA 3NTIA 1K8AU 3C94A 4JRIA 3ZBDA 1I8FA 3O8VA 3MEVA 2RK2A 2FHDA 4C92F 1YIJA 2E12A 1VQKT 2A7YA 3QO3A 3PGGA 5LJ3e 2RHXA 4M77B 4PJOF 2KDSA 5KH6A 3HFNA 4E7HA 3HRTA 3ER0A 3RUXA 5AYFA 4C92C 1SSFA 3G4ST 2DZ9A 3G71A 3OYLA 4PJOC 3CCMT 4M7DB 1Q81C 4EPCA 1P92A 2ZPEB 1JRIA 2DAQA 1K73U 3RIRA 1KD1U 1UEBA 2YLCA 4N0AA 3S6WA 5GANd 4EDUA 2VYTA 2CYZB 4OMFB 3AHUA 4A53A 4BB7A 4KUIA 5GAOl 1EIFA 1M4ZA 1O9SA 3M59A 3TCJA 2OAUA 4J6XA 1VQ7T 3NTHA 1X01A 2RHYA 3JB9F 2RJEA 3OYYA 3JCMf 1YJNA 2XDBA 3OSSC 5DLQE 4M77E 5GANg 1Q86C 1HK9A 2RJDA 3OYAA 2EAYA 2VV5A 3CPFA 3LYIA 3EFSA 3M56A 2JUFA 3CBOA 4M78D 4MMKA 3BW1A 3CD6T 3R6OA 3OB9A 2K5IA 3CXCA 3RKYA 3JCMe 4J7FA 4M77G 4M77A 1UB4A 3OBWA 4PKCC 3PMTA 5FU7C 5GAOn 4IKFA 2ZZDA 3OYFA 3CMAT 3CCJA 1X6OA 1Y7XA 5EG2A 1PSFA 2YLBA 2CGHA 3A8HB 3UT1A 1VQ7A 4N0AC 1OZ2A 2XDDA 1VQOA 4R55A 3LX7A 4NS5A 2QEXA 1LOJA 3QJYA 5D6YA 5CK9A 1VQPT 4DOVA 2FB7A 2DJZA 3QHSA 2X4XA 4LDXA 3MCAB 3OQ5A 3CD6A 3C95A 1NJIU 1BI3A 3M9QA 2DTIA 3VYHB 4D6WA 4KT0E 2CZ7B 1N6AA 5GMKh 2DIQA 2LC4A 5GAMj 3FLGA 3GNGA 3OYGA 5GAOm 2ZPBB 3CCSA 2RO0A 1WJQA 5LL6S 3UPUA 1M1FA 4BDZA 1VQ8A 3CC2A 3CCEA 3A8LB 4KUDK 1KQ2A 1O75A 4M77C 1VIEA 2RJCA 4JDSA 2DKGA 4M7DF 5GAN8 2LT4A 4BI8B 3E9FA 2DXBA 1NPRA 3JSCA 1VQPA 4WF2A 4F7UB 2K4YA 1ZBXA 5HK0A 4M7DC 1JB0E 1QP3A 5CAIA 1S72A 4ATOA 3SDZA 2RA2A 4OVAA 3Q1JA 3ZEHA 3SD4A 3QG1A 3JCMJ 1Q82C 3LGLA 4M75F 2ZPHB 1M1GA 3BDUA 3C12A 1RI0A 2GFAA 4ZGJB 2LVMA 4C0ZA 3RERA 1MGQA 2XK0A 3M4YA 1YBYA 2E41A 2O01E 4HA8A 4OGEA 5HKCA 4M75C 2XHCA 4BD3A 4C92E 3DLLA 4HCBA 4M78A 3BDLA 3HRSA 2R57A 3QPHA 4VUBA 2MAMA 3BFMA 4C8QB 3CC4T 3GOXA 2QA4A 4PJOE 3N5BB 5IT9E 4XU0A 1JJ2A 4MMLA 4TVRA 1QW1A 1D3BB 2K3YA 3DLMA 5GAN5 1WNLA 2BUDA 4QVDA 3M5AA 5GANf 4L59A 4EMHA 2E10A 4M7AD 3LH0A 2GCXA 3L2ZA 2XG8D 3JB9I 3G7ZA 2HAXA 1QVFA 4XTUA 1B34A 2LDMA 4F7UG 4F7UA 2KSSA 3HRUA 1WPYA 3JCMW 5GANe 3SWNB 3QZ9B 2DXTA 4FT4A 2F69A 5GAN2 2EJGA 4O5VA 3I55A 1YITA 1DJ7B 2JVVA 3CC4A 4J8OA 3JRZA 1NPPA 4MZPA 1KC8C 3J80E 1U1TA 4QVZA 4EMGA 2EFIA 1IREB 3X25B 2ZPIB 1WQWA 2E6ZA 3HHTB 3GP8A 2P4TA 1W2BS 2OTJT 4M7AB 1LNXA 2DVEA 4XTXA 3VKIA 4FSXA 4PL6A 3KXTA 3FJPA 4FT2A 5I2SA 5LJ5j 5IAYA 2KVQG 3ASKA 3INZA 3M54A 3P8DA 3E19A 3FDRA 3QYHB 1XQHA 2E64A 1D3BA 3HL8A 5J3BA 2DD5A 1MHNA 5IN1A 4HKEA 4JS5A 4FIBA 3JCMV 4RG2A 4V2SA 1IZ6A 3OYKA 4LDYA 4QQGA 2L8DA 4LDWA 4B9XA 2RH2A 2EJFA 2VGMA 4N4GA 3V8KA 3LWIA 1H641 3QYGB 4NL2A 2E1HA 3M57A 1Q7YC 1M1KU 4A4EA 3A8OB 2XI9A 1YJNT 1KQSS 2P0PA 2QQSA 1XNIA 5GANh 1QVGS 3GLXA 3QJ6A 2OTJA 3SWNA 2IG0A 1WJSA 4B9WA 5FRMA 1BYMA 1G3SA 2Y4XA 2YHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSC A;  1NE8 A;  1X75 C;  3HPW A;  5HK0 A;  3TCJ A;  5CK9 A;  2MF2 A;  2C06 A;  4HKE A;  5CCA A;  3G7Z A;  4MDX A;  5CR2 A;  3NFC A;  4OF1 A;  5CKH A;  5CO7 A;  3VUB A;  5CKD A;  5CKE A;  1VUB A;  5CQX A;  4MZM A;  2KMT A;  5HKC A;  4ELZ C;  4ELY C;  5HK3 A;  3JRZ A;  4MZP A;  1M1F A;  4MZT A;  1UB4 A;  4VUB A;  5CKF A;  5CKB A;  4ME7 A;  5DLO A;  5CQY A;  2VUB A; 
#chains in the Genus database with same CATH topology
 4C8Q F;  3H6Z A;  4C5I A;  3I56 A;  2EQM A;  2ZGW A;  4M7A G;  4M7D E;  1HYO A;  2C0I A;  2DO3 A;  2VGN A;  5GMK e;  2L3R A;  2B86 A;  2JZ2 A;  2CDT A;  4M75 E;  2FG0 A;  1NZ9 A;  2M0O A;  1Q81 U;  2BZ8 A;  2QQB A;  3E1S A;  4F16 A;  4RCB A;  3CCS T;  1C6V X;  3L2W A;  3CPW P;  1SEM A;  4M7A F;  1G8X A;  1U3O A;  1X27 A;  4UC4 A;  4C0D B;  4OB0 B;  1Y96 A;  4ZGE B;  3G4S Q;  3RKW A;  4BY6 B;  2RI2 A;  5CQX A;  3CCQ A;  1Q86 U;  1BI2 A;  2OTL Q;  2JN0 A;  3OW2 S;  5J26 A;  1OZ3 A;  4MZT A;  4ESR A;  3CCR A;  4BAC A;  2K3B A;  3UA7 A;  5FRN A;  2XD0 A;  3P8H A;  3EG9 B;  3RMS A;  2FPE A;  1VQ4 T;  3OSV A;  2HBP A;  4IUP A;  3M0Q A;  3QDR B;  2QA4 T;  3GPL A;  2ABL A;  2KR3 A;  1FXX A;  4EMK A;  2LQW A;  1RUW A;  2JOY A;  1ZSZ A;  4BDY A;  2X3W D;  3PE0 A;  5CKH A;  4CI0 C;  1M3C A;  1N27 A;  2DBK A;  4JZ3 A;  2SRC A;  1OPL A;  4Q5W A;  3V8L A;  2GF7 A;  1YJ9 Q;  5HY6 A;  1YWO A;  3L2V A;  4Y92 A;  4M78 G;  4PJM A;  2HEQ A;  2EGE A;  1KQ1 A;  1D1B A;  3QII A;  2LQ8 A;  3M4G A;  3CXC P;  1VQ5 Q;  3CC7 Q;  4L6V 5;  4IUU A;  1LJO A;  1K9M C;  3RMQ A;  1X69 A;  2DTO A;  2JJ9 A;  1TXQ A;  3VS6 A;  4RMO A;  1I1J A;  4LUD A;  3KBG A;  2L5Q A;  4X9D A;  4XU2 A;  1MND A;  2EJ9 A;  2P0Q A;  2DRM A;  5CKD A;  1GCP A;  4JLG A;  1IHW A;  1YWP A;  2KGT A;  4XTV A;  4M78 F;  1BKB A;  4N4I A;  4GLK A;  5I2M A;  4FCY A;  2LNH B;  5GAM g;  5KYU B;  2DIG A;  2IVW A;  2C0O A;  1K76 A;  3OS2 A;  1AEY A;  1QCF A;  1KHC A;  3JCM Q;  2VXF A;  3T9N A;  3VRY A;  2VC8 A;  1N8R C;  4JUV A;  3CQT A;  3RDV A;  4RTX A;  3H8Z A;  3OBY A;  5KCH A;  4IUT A;  2QGF B;  2RHZ A;  3FC3 A;  2E3H A;  4XQ3 A;  3KUF A;  3CCV A;  2EQJ A;  1YHQ A;  2BE9 B;  1J3T A;  1K73 C;  4NOY A;  3QUI A;  3VU3 C;  3CCL A;  3OS5 A;  4LDU A;  1HSQ A;  4M7D D;  2VB6 A;  3TRE A;  2M1H A;  4DBQ A;  4X34 A;  1SRL A;  1T0J A;  2OJ2 A;  2KT1 A;  3THK A;  2MYS A;  4E47 A;  4F14 A;  1GFD A;  4M75 D;  2M02 A;  1WJR A;  3CCU T;  3A98 A;  2ED0 A;  1E6H A;  2QAS A;  1Q7Y U;  2LJ3 A;  5GAO p;  1R0C B;  1SHF A;  4EIK A;  3LLR A;  2NWM A;  3VS3 A;  1IGU A;  1TUC A;  2K5L A;  3G6E T;  2H3E B;  4NL3 A;  5LJ5 g;  3MEA A;  3MKD A;  2NYS A;  3G4S A;  2JTF A;  5CIU A;  5IHK A;  3PNW C;  3GF5 A;  5C6S A;  1NJI C;  4FYW B;  2PVG B;  2QTX A;  2DD4 A;  2QQ9 A;  1K8A R;  4ZTJ A;  4AFU C;  1QWF A;  1NBE B;  5CQY A;  1BB9 A;  1XTD A;  4M7D G;  4FU6 A;  2CUD A;  1G3W A;  3QWX X;  4J9H A;  1WHM A;  2DET A;  3M58 A;  4LUE A;  2C0T A;  1RAE B;  4M75 G;  2FPD A;  1YJ9 A;  3CXC S;  2CT3 A;  1W4S A;  2DFU A;  5FW9 A;  2XIC A;  2BIV A;  3DKM A;  2COW A;  4X1V A;  3CC7 A;  4PFP A;  3GBQ A;  1KHI A;  3TVT A;  4C92 B;  2MWP A;  3EGX A;  4PJO B;  3OYM A;  4XTY A;  1IXD A;  2ATC B;  2YRV A;  2R5M A;  1ZSZ C;  5DY9 A;  5D7U A;  4BUG A;  3OS0 A;  4PLL A;  4JRQ A;  1H8K A;  1IB8 A;  4AG1 C;  3NTK A;  3LGF A;  1WHG A;  2CP5 A;  3FIF A;  2JM9 A;  1T3S A;  1VQ9 A;  1PNJ A;  3OA6 A;  4AFZ C;  4RKU E;  3A1P A;  4GLM A;  4M77 D;  5GMK l;  2CZ1 B;  1ZA2 B;  4RTY A;  1PD1 A;  2DF6 A;  3MHX A;  2XDP A;  3H0F A;  2B8A A;  2LJ0 A;  2CH4 A;  1OEB A;  2DRK A;  3NTI A;  3ZBD A;  1S1N A;  1VQK T;  1W2B P;  2W0Z A;  3PGG A;  4QT7 A;  3HFN A;  3ER0 A;  3RUX A;  1H3H A;  2GTO A;  8AT1 B;  1Q81 C;  2ZPE B;  3RIR A;  1KD1 U;  1UUE A;  4EDU A;  2CYZ B;  1RLQ C;  2AZS A;  4KUI A;  3EFO B;  1JO8 A;  1MV0 B;  2HMA A;  1M27 C;  1ZUY A;  1KK7 A;  1M4Z A;  2M0Y A;  3TCJ A;  1HD3 A;  3JB9 F;  3JCM f;  1YJN A;  1TWB A;  5DLQ E;  4FSS A;  5GAN g;  2DVJ A;  1Q86 C;  2RJD A;  1JU5 C;  3LYI A;  3EFS A;  4MMK A;  3CBO A;  1IHV A;  3C0C A;  3CD6 T;  2O9V A;  3R6O A;  4M77 G;  5GAO n;  1JQQ A;  5FU7 C;  3CMA T;  1Y7X A;  3EH1 A;  2EBP A;  1RAH B;  2YLB A;  4OMP A;  4E7Z A;  4N0A C;  2XDD A;  1RAD B;  1VQM Q;  4R55 A;  5KYX A;  5FWB A;  1VQP T;  4DOV A;  2KYB A;  2F2W A;  4F17 A;  3OQ5 A;  2CP7 A;  2J05 A;  1U06 A;  3C95 A;  1OU8 A;  5GAM j;  3CCS A;  3UPU A;  2J06 A;  2LT4 A;  1NPR A;  1NLO C;  4F7U B;  2PNI A;  4M4Z A;  1ZBX A;  2FZK B;  1NYG A;  4LN2 A;  2RA2 A;  3JCM J;  3QG1 A;  5I11 A;  3LGL A;  2ZPH B;  1X43 A;  4C0Z A;  4JPB W;  3RER A;  3M4Y A;  5HKC A;  1YBY A;  4HCB A;  2FO0 A;  3BDL A;  2R57 A;  3QPH A;  2QA4 A;  4DBH A;  4C8Q B;  1PC0 A;  4OMN A;  4FW1 A;  5IT9 E;  4XU0 A;  4MML A;  2K3Y A;  1WNL A;  3M5A A;  2O31 A;  2GCX A;  2YUP A;  1N5Z A;  2KSS A;  3HRU A;  2JT4 A;  2F69 A;  4HVU A;  2A08 A;  2NUP B;  1NPP A;  2V1Q A;  3UA6 A;  1G83 A;  3X25 B;  2ZPI B;  1WQW A;  2E6Z A;  1W2B S;  4M7A B;  5LJ5 j;  2KYM A;  1GRI A;  3M54 A;  3QYH B;  4HKE A;  4QQG A;  2E1H A;  1Q7Y C;  1UEC A;  1M1K U;  3A8O B;  2XI9 A;  2K79 A;  2P0P A;  2QQS A;  1KJW A;  2JW4 A;  3M0U A;  3M55 A;  3KFV A;  2YUO A;  5CVI A;  4GBQ A;  5KYU A;  3PMI A;  3CCJ Q;  2O4X B;  1Z9Z A;  3I56 Q;  2V8J A;  1TOV A;  4A4G A;  5LJ3 j;  2DE0 X;  1OU9 A;  4R56 A;  4QW2 A;  3V7S A;  3HTR A;  2X51 A;  2HD0 A;  2JM8 A;  3CBM A;  1H92 A;  2CKK A;  1UHC A;  3QDF A;  2RMO A;  3OW2 A;  3A5Z B;  4J6W A;  1VQM A;  1VQ8 T;  4F04 B;  1I81 A;  3X20 B;  1YCY A;  1UDL A;  1VQK Q;  4KBM B;  1KC8 R;  2E5Q A;  2F1L A;  4OP0 A;  3VJP A;  1MNE A;  5CR2 A;  4AFS C;  3S3M A;  3L2Q A;  2A37 A;  2RB6 A;  4M78 B;  2P0K A;  1VUB A;  1EFN A;  3S3O A;  3EG3 A;  5GAO q;  1WXU A;  2DA9 A;  3CCQ Q;  1D0Y A;  2PQW A;  5FRO A;  3FEO A;  1R8O B;  2ZPG B;  2ECZ A;  1NLP C;  1UGV A;  3FB9 A;  2DTH A;  3WVD B;  2OX7 A;  5FU6 B;  2JXB A;  2KRM A;  2YUQ A;  2ZAE A;  1GL5 A;  2HQE A;  3CMA Q;  4JLI A;  4OMO A;  2KT8 A;  4RG8 A;  1HXD A;  3I55 T;  3VS0 A;  2LNV A;  1WX6 A;  2PVD B;  3PFS A;  1YN8 A;  4LD6 A;  2LCC A;  2D6F A;  3MO8 A;  4IIO A;  2LTO A;  2WSF E;  1AWW A;  4HT8 A;  4IUR A;  2RHI A;  1PHT A;  1WQ7 A;  5KYW A;  4RTT A;  3F70 A;  3BY7 A;  3QSU A;  4E7K A;  2KMT A;  3M0S A;  2DX1 A;  4C0D C;  7AT1 B;  3QXE B;  2ESW A;  4BY6 C;  2CP3 A;  2K2V A;  1ZHI A;  3EGD A;  3JCM b;  2FVU A;  3V8J A;  4F7U F;  5GAN j;  2K9G A;  4BE2 A;  3HKS A;  2HQH A;  3PIO A;  4PJO A;  1JXM A;  2K7A A;  1PG5 B;  3OYJ A;  3J81 E;  3CPW A;  2CSQ A;  1KD1 C;  1YHQ Q;  2NUZ A;  2DXU A;  3QZ5 B;  4FYV B;  3M53 A;  4PJL A;  2AKK A;  4OB2 B;  1TUG B;  1CKA A;  4QQ6 A;  1YI2 Q;  2YRC A;  1JJ2 P;  1ZSG A;  1IO6 A;  3MP8 A;  2F2V A;  2O88 A;  2DL8 A;  1VOM A;  3AT1 B;  3OYB A;  1PSE A;  4KGV B;  2EQU A;  1D09 B;  3CEY A;  1WHH A;  1NEG A;  4XU3 A;  1AD5 A;  3HP9 A;  2H3J A;  1VQK A;  2JS0 A;  2DMO A;  2CZ6 B;  1OI1 A;  2AZV A;  4M75 B;  5M9O A;  2LQN A;  5GMK j;  3PIP A;  3EGU A;  2GBQ A;  4OGC A;  2L3P A;  1M2V B;  2WSE E;  3H9N A;  1MMN A;  5GAM f;  2EVR A;  5CKE A;  2FEI A;  2DEQ A;  1KG1 A;  1QKW A;  4II1 A;  1VQN T;  5CKF A;  6AT1 B;  5DLO A;  1XJW B;  2AHJ B;  1YJW T;  3QKJ A;  3MP6 A;  2RJF A;  1M8V A;  2HDA A;  3HFO A;  4XTZ A;  2KXD A;  1QMC A;  2EWN A;  3ULR B;  2KEA A;  1TG0 A;  4FYY B;  1QCN A;  3CMA A;  4ELZ C;  3A8M B;  1AWX A;  3P8B B;  2LZ6 B;  1N9R A;  1PKS A;  2WAC A;  3CME T;  1VQ8 Q;  3V7R A;  2Y90 A;  3JCM h;  1X6G A;  4L5G A;  3ME9 A;  2DM1 A;  3JCM d;  4PFZ A;  2BKD N;  4BI4 A;  4Z02 A;  2EQK A;  4OF1 A;  3LH5 A;  4PNO A;  3OMG A;  4BI3 A;  2EKO A;  2GFU A;  4AG2 C;  1I07 A;  2QI2 A;  3JAM E;  5LJ5 f;  3G1J A;  2KRS A;  2PUK B;  1IGQ A;  3X28 B;  2XID A;  3EFR A;  1M90 C;  2MPX C;  4JRK A;  4J6Y A;  1W70 A;  4XTW A;  4PJN A;  1B3Q A;  5A0L A;  2QXF A;  1QVP A;  2GQV A;  1M1K C;  1VQ9 Q;  5EC7 A;  1U8R A;  4BE1 A;  5HK3 A;  1MMA A;  5KE3 A;  2K2M A;  3I55 Q;  1JJ2 S;  3X24 B;  1ZA1 B;  3G71 T;  3GNF B;  2DPP B;  4C8Q A;  1YI2 A;  4A4H A;  1NE8 A;  5LJ3 f;  3M0R A;  1K8A U;  4JRI A;  1NEB A;  3O8V A;  2RK2 A;  2EYX A;  2A7Y A;  2RHX A;  4M77 B;  1PKT A;  2KDS A;  5KH6 A;  3HRT A;  3VS5 A;  4C92 C;  2VAS A;  1SSF A;  2HBW A;  3OYL A;  4PJO C;  3CCM T;  2BTT A;  4EPC A;  1P92 A;  2AIR B;  1JRI A;  2HSE B;  2BZX A;  2NUP A;  4N0A A;  2YLC A;  4CC3 A;  2YUN A;  2QGG A;  1VQ7 T;  1X01 A;  4RUG A;  1AVZ C;  2XDB A;  1UE9 A;  3U23 A;  1WXB A;  3OYA A;  1YJN Q;  1TU0 B;  3REA B;  1RAB B;  3BW1 A;  1C1A A;  3OB9 A;  4D8K A;  3RKY A;  1UB4 A;  4IKF A;  4J9C A;  3TQ7 P;  3CCJ A;  3TSZ A;  3M0T A;  1QWE A;  3EHR A;  5EG2 A;  2CGH A;  3A8H B;  1ABO A;  2RQR A;  3LX7 A;  4NS5 A;  1UFF A;  3QJY A;  2A0F B;  1YCS B;  2KRO A;  3QHS A;  2X4X A;  1JXO A;  2MK5 A;  1BI3 A;  1AWJ A;  2DEU A;  2RO0 A;  1K4U S;  1VQ8 A;  1M1F A;  3A8L B;  3CCS Q;  4KUD K;  1HJD A;  1VIE A;  4JDS A;  4M7D F;  5GAN 8;  4BI8 B;  3JSC A;  2YSQ A;  2K4Y A;  1M2O A;  1JB0 E;  5CAI A;  4ATO A;  2DNU A;  3SDZ A;  1WA7 A;  3ZEH A;  3PVQ A;  4M75 F;  4JZ4 A;  3BDU A;  3C12 A;  1AZE A;  2LVM A;  2E4H A;  4J9I A;  4HA8 A;  1VQL T;  3DLL A;  2XHC A;  4BD3 A;  4C92 E;  4M78 A;  2D8J A;  4PJO E;  3BFM A;  1AOJ A;  3CC4 T;  1VQ4 Q;  3EG2 A;  2QA4 Q;  1D3B B;  3RBB B;  1GCQ C;  5GAN f;  2GTJ A;  3LH0 A;  2XG8 D;  3JB9 I;  3G7Z A;  1QVF A;  5GJV B;  1WFW A;  1LPL A;  5GAN 2;  2EJG A;  3I55 A;  1DJ7 B;  1WYX A;  4J8O A;  4MZP A;  2J6F A;  4QVZ A;  2OTJ T;  3SHW A;  2DVE A;  4PL6 A;  3FJ5 A;  2KE9 A;  3FJP A;  1OPK A;  1SPK A;  3INZ A;  1ZX6 A;  3FDR A;  2E64 A;  1MHN A;  4JS5 A;  4FIB A;  4LDW A;  2EJF A;  2RQT A;  1IRX A;  3H41 A;  3QYG B;  1T0H A;  4A4E A;  3O5Z A;  3SWN A;  1R0B G;  2IG0 A;  1G2B A;  1WJS A;  5FRM A;  2Y4X A;  2EQI A;  1G3S A;  1Q82 R;  2AK5 A;  1GFC A;  3VV0 A;  4BE0 A;  4GY5 A;  3VS1 A;  2W10 A;  5IHN A;  4A63 B;  4C8Q C;  5GMK m;  1X6B A;  3JCM P;  2I0N A;  3NFC A;  2QEX T;  2CP6 A;  2I2L A;  2EYQ A;  1QKX A;  1QLY A;  3TEE A;  3CBP A;  1MMG A;  3REB B;  4EMK B;  1V29 B;  5IXF A;  2PZ1 A;  3CCR T;  1ZSZ B;  4JRP A;  3C4S A;  2MMP A;  1FWZ A;  1CKB A;  2P4R A;  3LWH A;  2PUO B;  2DL3 A;  5GAN 6;  1RAA B;  4M7A C;  3CCU Q;  4KRT A;  5D6W A;  5I22 A;  1S72 T;  4MZM A;  2V8K A;  1ARK A;  4ELY C;  4C0G A;  2EGA A;  4FM4 B;  4DA4 A;  5GAN 3;  3OYD A;  4M77 F;  3QBY A;  4ZN3 A;  2DBM A;  2DIL A;  4HT9 A;  3G6E Q;  2HCK A;  3PVL A;  4KUL A;  4B6M A;  5I21 A;  1X2K A;  1AHJ B;  2DL4 A;  2K57 A;  1Z9Q A;  2MWO A;  2M9U A;  2R58 A;  1JBM A;  4PJO D;  4C5E A;  5KCO A;  1Y71 A;  1WXT A;  3RKX A;  1M2V A;  2HKQ B;  4F7U E;  2L2P A;  2JTE A;  1VQ4 A;  2E70 A;  2PVO B;  1FMK A;  4ZTF A;  2WSC E;  3VUZ A;  1YIT T;  1UTI A;  3OYH A;  2GQI A;  2EYZ A;  2DXC A;  3EG9 A;  2C06 A;  5GAM d;  4HCC A;  4C8Q E;  3URG A;  1JEG A;  1SF9 A;  5GAN 7;  2MI6 A;  1YIJ T;  1ABQ A;  2LMJ A;  1K1Z A;  1TSF A;  1AT1 B;  3CCV T;  1KQS A;  4M78 C;  1EX4 A;  1QVG A;  2M16 A;  4CC2 A;  2E5K A;  1K8A C;  4Y28 E;  1G3Y A;  2ZCF B;  1K9M U;  1KIK A;  1UGQ B;  2G6F X;  1U1S A;  5FU7 B;  1K9A A;  3MEU A;  2NUT B;  3VUB A;  4M7A E;  2DK3 A;  2X4J A;  5KYY B;  2EGC A;  3FRN A;  5KE2 A;  2J6K A;  2RHU A;  2RNA A;  3MET A;  2KY9 A;  1KC8 U;  4XK8 E;  5FU6 C;  4RCC A;  3UWN A;  4MDW A;  3E9G A;  3L2R A;  3UAT A;  1FX7 A;  1N8R U;  5LJ5 h;  1QQJ A;  3RR6 A;  4CRI A;  2L89 A;  2A3L A;  1V1C A;  4LD9 K;  5LJ5 d;  2HL3 A;  4E7L A;  4IIM A;  2OTL T;  1K9M R;  3HSB A;  4QKU A;  3SWN C;  2EYW A;  3HPW A;  4J9G A;  3WXM B;  2BZY A;  1WHK A;  2YRD A;  3NHN A;  2QTV A;  2HZY A;  3CCU A;  4X9C A;  3LW5 E;  2LT1 A;  3CCM A;  4ZN1 A;  2HQX A;  5LJ3 h;  1BI0 A;  2CUB A;  3V7C A;  1YJ9 T;  2K5F A;  4HCZ A;  2J6O A;  3NMZ C;  1ZUU A;  4R0K A;  3G6E A;  2L3Q A;  4QVC A;  3E2U A;  3EGX B;  1N8R R;  5LJ3 d;  3DB3 A;  4M78 E;  2X4Y A;  2F5K A;  2O9S A;  1VQ5 T;  3CC7 T;  4KH0 B;  1RAC B;  1M3A A;  1PM3 A;  2QEX Q;  1Y0M A;  1K73 R;  1A0N B;  1U5S A;  4J5Y A;  3CD6 Q;  3QWY A;  3OYN A;  1I4K 1;  2E6N A;  1X2Q A;  1V76 A;  4C8Q D;  3IQL A;  4N4H A;  4P5N A;  1SRM A;  1G3T A;  1VQP Q;  1N9S A;  5J39 A;  5DM7 R;  2XKO C;  3VYG A;  5IXB A;  1WGS A;  3DB4 A;  2LX9 A;  2X3X D;  1NM7 A;  3ZFJ A;  3J7A F;  1BBZ A;  1BI1 A;  2Z0W A;  4ANJ A;  2RI5 A;  2QQR A;  4IUV A;  5FLX E;  2RM4 A;  1OX9 A;  1TUD A;  4DOW A;  1NJI R;  2RD1 A;  3X26 B;  2D1X A;  3EH2 A;  1PD0 A;  9ATC B;  1B7T A;  4OML A;  3EG1 A;  2KI7 A;  3GIB A;  4PLI A;  3EG0 A;  1VQL A;  2RN8 A;  2XMF A;  4C92 A;  2DYB A;  4AMC A;  1E6G A;  3JB9 H;  3JB9 J;  2V1R A;  4DBF A;  2QG9 B;  1VQ6 T;  2CT4 A;  5GMK i;  2V8I A;  2DZC A;  4E7J A;  4C8Q G;  1AZG B;  4A4F A;  2D0N A;  1XOV A;  3C94 A;  2FHD A;  2MIO A;  2GNC A;  2QAZ A;  3QO3 A;  4Z89 A;  1YIJ Q;  4E7H A;  2VKN A;  4M7D B;  2DAQ A;  1UEB A;  5GAN d;  3S6W A;  3I5R A;  1Q95 G;  2M51 A;  4BB7 A;  1D1A A;  1R77 A;  1VYU A;  4PJJ A;  2RHY A;  5FWC A;  2RJE A;  3OYY A;  2KNB B;  2F2X A;  1K0S A;  4PK4 A;  1ZBJ A;  2QYZ A;  2VV5 A;  4M78 D;  2RPN A;  1MMD A;  3CXC A;  3JCM e;  4LNP A;  2RF0 A;  4PKC C;  3PMT A;  1VYT A;  3OYF A;  3UT1 A;  2J7I A;  1RAI B;  2QEX A;  5CK9 A;  1SHG A;  2DJZ A;  4J9D A;  3EFO A;  2VVK A;  4LDX A;  4CC4 B;  1BU1 A;  3CD6 A;  3I5S A;  1UJ0 A;  3M9Q A;  3VYH B;  1TS9 A;  4D6W A;  5GMK h;  1TTH B;  2LC4 A;  3FLG A;  3GNG A;  2ZPB B;  1WJQ A;  5LL6 S;  1M8M A;  4JJB A;  1O75 A;  1KQ2 A;  4M77 C;  2LX7 A;  3ZL7 C;  1GCQ A;  1VQP A;  2DXB A;  2BE7 D;  4WF2 A;  4DEY A;  4LXC A;  1WI7 A;  2A28 A;  1I0C A;  1S72 A;  5L23 A;  4OVA A;  3SD4 A;  2H8H A;  1Q81 R;  2IPO B;  1RI0 A;  2GFA A;  4ORZ A;  1QCO A;  2E41 A;  2LJ1 A;  3HRS A;  2QK0 A;  8ATC B;  1RAG B;  3N5B B;  4TVR A;  1QW1 A;  3DLM A;  1E7O A;  2BUD A;  1Q86 R;  4PFO A;  4EMH A;  2COY A;  1WZO A;  2HAX A;  4XTU A;  2LDM A;  2FRY A;  4F7U A;  5ECA A;  5IH2 A;  3JCM W;  2DXT A;  1D0Z A;  4O5V A;  1YIT A;  1KC8 C;  3J80 E;  1T3L A;  1U1T A;  4HCK A;  1RI9 A;  1UJY A;  3VS7 A;  3HHT B;  3GP8 A;  2P4T A;  1LNX A;  4XTX A;  3KXT A;  3TSW A;  4FT2 A;  5I2S A;  5IAY A;  3P8D A;  3E19 A;  2EPD A;  3HL8 A;  5IN1 A;  1EZZ B;  3JCM V;  4RG2 A;  4HVV A;  4V2S A;  3OYK A;  4LDY A;  4B9X A;  2CH4 W;  2L8D A;  3LWI A;  2RH2 A;  3V8K A;  1YIJ A;  3VS4 A;  4NL2 A;  3M57 A;  1W6X A;  1BK2 A;  3QJ6 A;  1NYF A;  2CRE A;  2DL5 A;  2RQV A;  2LP5 A;  4M77 E;  1YP5 A;  1OX8 A;  4KGX B;  4CC7 A;  3MPU B;  3JCM c;  1VQM T;  2KXC A;  4DQ2 A;  4M7A A;  1F1B B;  2MOX A;  4FW2 A;  4JJD A;  1VQO T;  5CO7 A;  2A36 A;  3CPW S;  2GGR A;  1VQ6 Q;  2NUT A;  5KYY A;  4RTU A;  2RQU A;  1MUZ A;  2X9H A;  3MP1 A;  5A0D A;  2CP2 A;  3CC2 T;  1NG2 A;  1K0X A;  3CCE T;  1X75 C;  3S3N A;  5CCA A;  2YXY A;  4LDV A;  2O4X A;  2QDL A;  2OTL A;  1WDX A;  4C5H A;  2LRQ A;  1UGP B;  4OB3 B;  4AFQ C;  3NGP A;  2PTK A;  3BE3 A;  4ME7 A;  2COZ A;  2FZC B;  1B34 B;  4E7I A;  5KYW B;  4HXJ A;  1Q7Y R;  4FL6 A;  2DJQ A;  2ROT A;  1WIE A;  5LJ3 g;  1MV3 A;  2CZ0 B;  4YTL A;  5A2Q E;  1VQN Q;  4O6J A;  2YT6 A;  2FYK A;  2K3X A;  2ZPF B;  4KH1 B;  3EGD B;  1VQ5 A;  1B07 A;  2EYY A;  3D7S B;  1YJW Q;  1QP2 A;  2YDL A;  1M30 A;  5KYN A;  4C0F A;  3SFM A;  1W2B A;  3JB9 D;  1WHJ A;  4E7S A;  2D0Q B;  3OYE A;  4EMK C;  1OYX A;  1OUL A;  1Q82 U;  2KBT A;  2HNI A;  3EAE A;  1ZUK A;  5GJW B;  3CME Q;  1GBQ A;  2KRN A;  1OQK A;  1SG5 A;  5GAN 4;  4OMQ A;  2ROL A;  3OMC A;  4E6R A;  2FL7 A;  3EHQ A;  3CCJ T;  1G5V A;  3I56 T;  3L2U A;  2RQW A;  4Y91 A;  1YFN A;  1CSK A;  1I5L A;  3L1A A;  4XAX B;  1LCK A;  5C0M A;  3PT9 A;  4Z88 A;  1W1F A;  2QDY B;  1OOT A;  4C5G A;  1LVK A;  1Y96 B;  1WLP B;  3JB9 G;  1Y07 A;  3UDC A;  2LQK A;  5D6X A;  1VQ6 A;  2CSI A;  4IUQ A;  1QVF P;  3OYC A;  3G71 Q;  4J83 A;  3CCQ T;  4QQD A;  2D9T A;  1TH7 A;  3RES A;  5GAO r;  2EIF A;  2VXE A;  3VRZ A;  3TU4 K;  5L8R E;  4JS4 A;  3I9Q A;  2F5T X;  3CCM Q;  4J7I A;  2HL5 C;  2JTM A;  1GXI E;  5GAM e;  1KFZ A;  3MEW A;  4E2F B;  2DL7 A;  2NLU A;  2VUB A;  2ENM A;  2KK4 A;  4M7D A;  4Z8A A;  1VQ7 Q;  1VQO Q;  3R6N A;  1PCX A;  3OS1 A;  4C92 D;  1PRL C;  1UGR B;  4J9E A;  4K11 A;  3UF4 A;  1KD1 R;  4XU1 A;  2AKL A;  4M75 A;  2IIM A;  1VIF A;  1BIB A;  2X35 A;  1VQN A;  3I35 A;  3PTA A;  3JV3 A;  5CKB A;  1YJW A;  3CC2 Q;  2EW3 A;  3CCE Q;  2ED1 A;  5GAM h;  1ZQ1 A;  2JNG A;  4OB1 B;  1M5Q 1;  2MF2 A;  2KQW A;  2QQA A;  4RTW A;  2L0A A;  1BIA A;  3OYI A;  2E3I A;  3A8G B;  4WCI A;  4AT1 B;  4JJN K;  2XU8 A;  2KAF A;  5AT1 B;  3VS2 A;  1VA7 A;  3OY9 A;  3CME A;  2G3R A;  2RI3 A;  4ZGD B;  3JCM g;  3WVE B;  1RL2 A;  1UGS B;  5A0G A;  2R5A A;  4OMM A;  1YHQ T;  3NPF A;  3SB2 A;  1KSW A;  3SEM A;  3CCL T;  4JJC A;  5LJ5 e;  2K6D A;  1YI2 T;  1GBR A;  4MDX A;  2PU9 B;  4C92 G;  5HCK A;  2E65 A;  1BCO A;  3L42 A;  3JCM X;  1VQL Q;  4PJO G;  1M9S A;  2MCN A;  2FRW A;  2RK1 A;  2LCL A;  3CC4 Q;  2YWW A;  1VYV A;  2CS7 A;  3H0I A;  4A54 A;  2X4W A;  1M90 U;  1QVF S;  4A4K A;  4HVW A;  1I8F A;  2L3S A;  1UG1 A;  3MEV A;  4C92 F;  2E12 A;  5LJ3 e;  4PJO F;  2VWF A;  3G4S T;  5AYF A;  2DZ9 A;  3G71 A;  1K73 U;  2OTJ Q;  1RAF B;  3AHU A;  2VYT A;  4OMF B;  4A53 A;  2P84 A;  2LCS A;  1ZLM A;  1FMW A;  5GAO l;  1EIF A;  1O9S A;  2CP0 A;  2JMA A;  3H0H A;  3M59 A;  1KQS P;  2OAU A;  4J6X A;  3NTH A;  1QVG P;  1RLP C;  3OSS C;  4KGZ B;  2D8H A;  1HK9 A;  2EAY A;  3CPF A;  3M56 A;  4RTZ A;  2JUF A;  1M90 R;  4LE9 A;  2K5I A;  2OI3 A;  4M77 A;  4J7F A;  1C0M A;  3OBW A;  2HSP A;  2ZZD A;  2HKN A;  1X6O A;  1PSF A;  1VQ7 A;  4RTV A;  1VQO A;  1OZ2 A;  1M1K R;  1LOJ A;  5D6Y A;  2FB7 A;  4DEX A;  3M0P A;  1FMV A;  3MCA B;  4D8D A;  2SEM A;  1OV3 A;  1PWT A;  1NJI U;  2DTI A;  4KT0 E;  2CZ7 B;  1N6A A;  2DIQ A;  3OYG A;  5GAO m;  2V26 A;  1ACM B;  4BDZ A;  3CC2 A;  3CCE A;  4ZNX A;  2O2O A;  2RJC A;  3CCR Q;  2DKG A;  1SSH A;  3E9F A;  1YNZ A;  5HK0 A;  4M7D C;  1AWO A;  3OW2 P;  1QP3 A;  1FYN A;  2JMC A;  3RNJ A;  1D1C A;  3Q1J A;  1Q82 C;  2JS2 A;  4J9B A;  1M1G A;  1S72 Q;  4ZGJ B;  5IHI A;  1MGQ A;  2XK0 A;  1VQ9 T;  2O01 E;  4OGE A;  4M75 C;  4J9F A;  1BCM A;  4VUB A;  4DBR A;  2MAM A;  2DER A;  3GOX A;  3MJX A;  1D0X A;  1JJ2 A;  5GAN 5;  2EKH A;  4QVD A;  4L59 A;  4M7A D;  2E10 A;  4FYX B;  4WTO B;  3L2Z A;  1B34 A;  4F7U G;  1WPY A;  5GAN e;  1I5O B;  3QZ9 B;  3SWN B;  4FT4 A;  2JVV A;  3CC4 A;  1SKU B;  2DLP A;  3JRZ A;  1M3B A;  1YIT Q;  4EMG A;  2EFI A;  1IRE B;  1H3Z A;  3VKI A;  4FSX A;  1Y57 A;  2KVQ G;  3ASK A;  2FZG B;  1XQH A;  1D3B A;  5J3B A;  2DD5 A;  1IZ6 A;  2VGM A;  4N4G A;  1H64 1;  1YJN T;  1KQS S;  1PRM C;  2DYI A;  1XNI A;  1UHF A;  5GAN h;  3CCV Q;  3GLX A;  1QVG S;  2OTJ A;  1WHL A;  2FPF A;  2AT1 B;  4B9W A;  2OAW A;  3CCL Q;  1BYM A;  5KYX B;  2Y4Y A;  2YHT A; 
#chains in the Genus database with same CATH homology
 4C8Q F;  5CVI A;  3H6Z A;  4C5I A;  3I56 A;  3VV0 A;  3PMI A;  4BE0 A;  2EQM A;  2O4X B;  2ZGW A;  4GY5 A;  3JCM c;  1VQM T;  4C8Q C;  4DQ2 A;  5GMK m;  2V8J A;  4A4G A;  4M7A A;  4M7A G;  4M7D E;  5LJ3 j;  1VQO T;  2DO3 A;  2VGN A;  3JCM P;  4R56 A;  5GMK e;  4QW2 A;  3NFC A;  5CO7 A;  3V7S A;  2QEX T;  3CPW S;  2L3R A;  2I2L A;  2EYQ A;  2HD0 A;  3CBM A;  2JZ2 A;  2CKK A;  3TEE A;  4M75 E;  3CBP A;  3OW2 A;  1NZ9 A;  2M0O A;  3MP1 A;  1Q81 U;  2QQB A;  3E1S A;  4RCB A;  3A5Z B;  5A0D A;  4EMK B;  3CCS T;  1V29 B;  4J6W A;  3L2W A;  1VQM A;  1VQ8 T;  3CCR T;  3CC2 T;  4JRP A;  3CCE T;  1X75 C;  3C4S A;  2MMP A;  1I81 A;  3X20 B;  1YCY A;  3S3N A;  4M7A F;  1FWZ A;  4KBM B;  4UC4 A;  4C0D B;  5CCA A;  2E5Q A;  4OB0 B;  4OP0 A;  3VJP A;  3LWH A;  2PUO B;  1Y96 A;  5GAN 6;  4ZGE B;  5CR2 A;  3S3M A;  3RKW A;  4LDV A;  4BY6 B;  4M7A C;  2O4X A;  3L2Q A;  2OTL A;  2RB6 A;  4M78 B;  2RI2 A;  2P0K A;  4C5H A;  1VUB A;  5D6W A;  5CQX A;  3CCQ A;  2LRQ A;  3S3O A;  1S72 T;  1Q86 U;  4MZM A;  2V8K A;  1BI2 A;  1UGP B;  4C0G A;  4ELY C;  4FM4 B;  2JN0 A;  5GAO q;  4OB3 B;  4DA4 A;  5GAN 3;  3OYD A;  4M77 F;  3QBY A;  5J26 A;  4ZN3 A;  3OW2 S;  1OZ3 A;  4MZT A;  2PQW A;  3CCR A;  4ME7 A;  4BAC A;  5FRO A;  5FRN A;  2XD0 A;  3FEO A;  3P8H A;  3RMS A;  4HT9 A;  1VQ4 T;  3OSV A;  2HBP A;  4IUP A;  4KUL A;  5I21 A;  3QDR B;  2QA4 T;  1R8O B;  3GPL A;  1AHJ B;  1B34 B;  4E7I A;  2K57 A;  2ZPG B;  1FXX A;  4FL6 A;  4EMK A;  2MWO A;  2M9U A;  2R58 A;  1JBM A;  2JOY A;  3FB9 A;  2DTH A;  4PJO D;  4BDY A;  4C5E A;  5KCO A;  5CKH A;  4CI0 C;  5LJ3 g;  3WVD B;  1N27 A;  1Y71 A;  2CZ0 B;  5FU6 B;  3RKX A;  4Q5W A;  3V8L A;  2GF7 A;  4F7U E;  4YTL A;  5HY6 A;  5A2Q E;  4O6J A;  3L2V A;  2FYK A;  2HQE A;  2E70 A;  2K3X A;  2PVO B;  2ZPF B;  1VQ4 A;  4M78 G;  4JLI A;  4ZTF A;  2WSC E;  4RG8 A;  1HXD A;  3VUZ A;  3I55 T;  3OYH A;  1YIT T;  2LNV A;  1VQ5 A;  1KQ1 A;  2PVD B;  3QII A;  2LQ8 A;  1QP2 A;  3PFS A;  1VQL T;  3M4G A;  4LD6 A;  2LCC A;  4L6V 5;  2D6F A;  3MO8 A;  4C0F A;  3SFM A;  4IUU A;  2LTO A;  1W2B A;  1LJO A;  3JB9 D;  3RMQ A;  2WSF E;  1K9M C;  2DTO A;  2D0Q B;  2DXC A;  4HT8 A;  4RMO A;  4IUR A;  5GAM d;  2C06 A;  4HCC A;  3OYE A;  3KBG A;  2RHI A;  4C8Q E;  2L5Q A;  3URG A;  4X9D A;  4XU2 A;  4EMK C;  1WQ7 A;  1OYX A;  2EJ9 A;  3F70 A;  1Q82 U;  2P0Q A;  5CKD A;  3BY7 A;  3QSU A;  2HNI A;  4E7K A;  3EAE A;  2KMT A;  4JLG A;  5GAN 7;  2MI6 A;  1YIJ T;  4XTV A;  4M78 F;  1BKB A;  4N4I A;  4GLK A;  4C0D C;  5I2M A;  5GAM g;  3QXE B;  3CCV T;  4BY6 C;  1KQS A;  4M78 C;  5GAN 4;  1QVG A;  2DIG A;  2M16 A;  2K2V A;  2IVW A;  1K8A C;  3OMC A;  1ZHI A;  4Y28 E;  1G3Y A;  2ZCF B;  3OS2 A;  3JCM Q;  1KHC A;  1K9M U;  1UGQ B;  2FL7 A;  2VXF A;  3JCM b;  3CCJ T;  2FVU A;  1U1S A;  3T9N A;  2VC8 A;  1G5V A;  3V8J A;  4JUV A;  5FU7 B;  4F7U F;  3I56 T;  3L2U A;  5GAN j;  4BE2 A;  4Y91 A;  1N8R C;  3H8Z A;  3HKS A;  3MEU A;  3OBY A;  4IUT A;  5KCH A;  3VUB A;  2RHZ A;  3FC3 A;  3PIO A;  4M7A E;  2DK3 A;  2X4J A;  4XQ3 A;  1I5L A;  4PJO A;  3FRN A;  5KE2 A;  3KUF A;  3CCV A;  2EQJ A;  3L1A A;  3OYJ A;  3J81 E;  3CPW A;  1YHQ A;  4XAX B;  2RHU A;  3MET A;  1K73 C;  2KY9 A;  4NOY A;  1KC8 U;  1KD1 C;  3QUI A;  3VU3 C;  3CCL A;  5C0M A;  3OS5 A;  4LDU A;  4XK8 E;  4M7D D;  3PT9 A;  5FU6 C;  2DXU A;  3QZ5 B;  2M1H A;  3TRE A;  2QDY B;  3M53 A;  4X34 A;  4RCC A;  4OB2 B;  3UWN A;  4C5G A;  4MDW A;  4QQ6 A;  1Y96 B;  3E9G A;  3L2R A;  4E47 A;  3JB9 G;  3MP8 A;  4M75 D;  1FX7 A;  1Y07 A;  1N8R U;  5LJ5 h;  1WJR A;  3UDC A;  2LQK A;  5D6X A;  3CCU T;  1VQ6 A;  4CRI A;  3OYB A;  1PSE A;  2L89 A;  4IUQ A;  2A3L A;  4LD9 K;  5LJ5 d;  1Q7Y U;  3OYC A;  4E7L A;  2OTL T;  5GAO p;  4J83 A;  2EQU A;  3HSB A;  3CCQ T;  4QQD A;  3CEY A;  3LLR A;  2D9T A;  1VQ9 T;  2K5L A;  4XU3 A;  3SWN C;  3G6E T;  3HP9 A;  1TH7 A;  2H3J A;  3HPW A;  3RES A;  3WXM B;  4NL3 A;  1VQK A;  2CZ6 B;  1OI1 A;  4M75 B;  5M9O A;  5LJ5 g;  3MEA A;  5GAO r;  2EIF A;  5GMK j;  3PIP A;  3G4S A;  4OGC A;  2JTF A;  3CCU A;  5CIU A;  2WSE E;  2VXE A;  4X9C A;  3LW5 E;  2LT1 A;  3PNW C;  3TU4 K;  3GF5 A;  5GAM f;  5C6S A;  1NJI C;  3M55 A;  3CCM A;  5CKE A;  5L8R E;  4JS4 A;  4ZN1 A;  2DEQ A;  2PVG B;  2F5T X;  2HQX A;  1KG1 A;  4J7I A;  1BI0 A;  2DD4 A;  2JTM A;  2QQ9 A;  2QTX A;  2K5F A;  5LJ3 h;  3V7C A;  4ZTJ A;  4HCZ A;  1YJ9 T;  1H3Z A;  1GXI E;  5GAM e;  4II1 A;  1VQN T;  5CKF A;  3G6E A;  3MEW A;  4QVC A;  5DLO A;  2NLU A;  5CQY A;  5LJ3 d;  2VUB A;  1XTD A;  2KK4 A;  3DB3 A;  4M7D A;  4M78 E;  4M7D G;  2X4Y A;  2AHJ B;  1YJW T;  3QKJ A;  3MP6 A;  2F5K A;  2RJF A;  1M8V A;  3HFO A;  4FU6 A;  1VQ5 T;  3CC7 T;  4XTZ A;  1G3W A;  3OS1 A;  4C92 D;  3M58 A;  1UGR B;  2EWN A;  4XU1 A;  4J5Y A;  4M75 G;  4M75 A;  1YJ9 A;  1VIF A;  1BIB A;  2X35 A;  3CXC S;  1VQN A;  3CMA A;  4ELZ C;  1W4S A;  3A8M B;  3P8B B;  3OYN A;  3PTA A;  1I4K 1;  1N9R A;  2XIC A;  2E6N A;  2WAC A;  2BIV A;  5CKB A;  1YJW A;  3DKM A;  3CME T;  3V7R A;  2Y90 A;  4C8Q D;  3CC7 A;  3JCM h;  4N4H A;  4P5N A;  4L5G A;  5GAM h;  1KHI A;  1ZQ1 A;  3ME9 A;  1G3T A;  2JNG A;  4C92 B;  4OB1 B;  2MWP A;  1N9S A;  1M5Q 1;  3JCM d;  2BKD N;  2MF2 A;  2KQW A;  5J39 A;  5DM7 R;  4BI4 A;  2QQA A;  4Z02 A;  2XKO C;  4PJO B;  2EQK A;  3OYM A;  1BIA A;  3VYG A;  3OYI A;  4XTY A;  1WGS A;  3A8G B;  3DB4 A;  2LX9 A;  4OF1 A;  3OMG A;  4PNO A;  2XU8 A;  4JJN K;  2YRV A;  4BI3 A;  2R5M A;  2EKO A;  2KAF A;  2GFU A;  5DY9 A;  3ZFJ A;  4BUG A;  3OY9 A;  1BI1 A;  2G3R A;  2RI3 A;  3CME A;  3J7A F;  3OS0 A;  4ZGD B;  3JCM g;  2RI5 A;  3WVE B;  4PLL A;  2QQR A;  1RL2 A;  2QI2 A;  3JAM E;  4JRQ A;  1UGS B;  5A0G A;  5LJ5 f;  2R5A A;  4IUV A;  5FLX E;  2RM4 A;  1YHQ T;  2PUK B;  3SB2 A;  3NTK A;  3X28 B;  2XID A;  3EFR A;  4DOW A;  2RD1 A;  3X26 B;  1M90 C;  3CCL T;  4JRK A;  3LGF A;  3FIF A;  4J6Y A;  5LJ5 e;  3GIB A;  4XTW A;  1YI2 T;  4PLI A;  5A0L A;  1VQ9 A;  4MDX A;  2PU9 B;  1VQL A;  2QXF A;  1QVP A;  4C92 G;  4C92 A;  3OA6 A;  2E65 A;  3L42 A;  2GQV A;  4RKU E;  3JCM X;  1M1K C;  3JB9 H;  3JB9 J;  4PJO G;  1M9S A;  1U8R A;  4BE1 A;  4M77 D;  5GMK l;  5HK3 A;  5KE3 A;  2CZ1 B;  2RK1 A;  1JJ2 S;  2LCL A;  3X24 B;  1VQ6 T;  3MHX A;  2CS7 A;  2XDP A;  3G71 T;  3GNF B;  5GMK i;  2B8A A;  2Y4Y A;  2V8I A;  2DZC A;  2DPP B;  4A54 A;  4E7J A;  2X4W A;  4C8Q A;  4C8Q G;  1YI2 A;  4A4H A;  1NE8 A;  5LJ3 f;  1M90 U;  1QVF S;  4A4F A;  1XOV A;  4A4K A;  3NTI A;  1K8A U;  3C94 A;  4JRI A;  3ZBD A;  1I8F A;  3O8V A;  3MEV A;  2RK2 A;  2FHD A;  4C92 F;  1YIJ A;  2E12 A;  1VQK T;  2A7Y A;  3QO3 A;  3PGG A;  5LJ3 e;  2RHX A;  4M77 B;  4PJO F;  2KDS A;  5KH6 A;  3HFN A;  4E7H A;  3HRT A;  3ER0 A;  3RUX A;  5AYF A;  4C92 C;  1SSF A;  3G4S T;  2DZ9 A;  3G71 A;  3OYL A;  4PJO C;  3CCM T;  4M7D B;  1Q81 C;  4EPC A;  1P92 A;  2ZPE B;  1JRI A;  2DAQ A;  1K73 U;  3RIR A;  1KD1 U;  1UEB A;  2YLC A;  4N0A A;  3S6W A;  5GAN d;  4EDU A;  2VYT A;  2CYZ B;  4OMF B;  3AHU A;  4A53 A;  4BB7 A;  4KUI A;  5GAO l;  1EIF A;  1M4Z A;  1O9S A;  3M59 A;  3TCJ A;  2OAU A;  4J6X A;  1VQ7 T;  3NTH A;  1X01 A;  2RHY A;  3JB9 F;  2RJE A;  3OYY A;  3JCM f;  1YJN A;  2XDB A;  3OSS C;  5DLQ E;  4M77 E;  5GAN g;  1Q86 C;  1HK9 A;  2RJD A;  3OYA A;  2EAY A;  2VV5 A;  3CPF A;  3LYI A;  3EFS A;  3M56 A;  2JUF A;  3CBO A;  4M78 D;  4MMK A;  3BW1 A;  3CD6 T;  3R6O A;  3OB9 A;  2K5I A;  3CXC A;  3RKY A;  3JCM e;  4J7F A;  4M77 G;  4M77 A;  1UB4 A;  3OBW A;  4PKC C;  3PMT A;  5FU7 C;  5GAO n;  4IKF A;  2ZZD A;  3OYF A;  3CMA T;  3CCJ A;  1X6O A;  1Y7X A;  5EG2 A;  1PSF A;  2YLB A;  2CGH A;  3A8H B;  3UT1 A;  1VQ7 A;  4N0A C;  1OZ2 A;  2XDD A;  1VQO A;  4R55 A;  3LX7 A;  4NS5 A;  2QEX A;  1LOJ A;  3QJY A;  5D6Y A;  5CK9 A;  1VQP T;  4DOV A;  2FB7 A;  2DJZ A;  3QHS A;  2X4X A;  4LDX A;  3MCA B;  3OQ5 A;  3CD6 A;  3C95 A;  1NJI U;  1BI3 A;  3M9Q A;  2DTI A;  3VYH B;  4D6W A;  4KT0 E;  2CZ7 B;  1N6A A;  5GMK h;  2DIQ A;  2LC4 A;  5GAM j;  3FLG A;  3GNG A;  3OYG A;  5GAO m;  2ZPB B;  3CCS A;  2RO0 A;  1WJQ A;  5LL6 S;  3UPU A;  1M1F A;  4BDZ A;  1VQ8 A;  3CC2 A;  3CCE A;  3A8L B;  4KUD K;  1KQ2 A;  1O75 A;  4M77 C;  1VIE A;  2RJC A;  4JDS A;  2DKG A;  4M7D F;  5GAN 8;  2LT4 A;  4BI8 B;  3E9F A;  2DXB A;  1NPR A;  3JSC A;  1VQP A;  4WF2 A;  4F7U B;  2K4Y A;  1ZBX A;  5HK0 A;  4M7D C;  1JB0 E;  1QP3 A;  5CAI A;  1S72 A;  4ATO A;  3SDZ A;  2RA2 A;  4OVA A;  3Q1J A;  3ZEH A;  3SD4 A;  3QG1 A;  3JCM J;  1Q82 C;  3LGL A;  4M75 F;  2ZPH B;  1M1G A;  3BDU A;  3C12 A;  1RI0 A;  2GFA A;  4ZGJ B;  2LVM A;  4C0Z A;  3RER A;  1MGQ A;  2XK0 A;  3M4Y A;  1YBY A;  2E41 A;  2O01 E;  4HA8 A;  4OGE A;  5HKC A;  4M75 C;  2XHC A;  4BD3 A;  4C92 E;  3DLL A;  4HCB A;  4M78 A;  3BDL A;  3HRS A;  2R57 A;  3QPH A;  4VUB A;  2MAM A;  3BFM A;  4C8Q B;  3CC4 T;  3GOX A;  2QA4 A;  4PJO E;  3N5B B;  5IT9 E;  4XU0 A;  1JJ2 A;  4MML A;  4TVR A;  1QW1 A;  1D3B B;  2K3Y A;  3DLM A;  5GAN 5;  1WNL A;  2BUD A;  4QVD A;  3M5A A;  5GAN f;  4L59 A;  4EMH A;  2E10 A;  4M7A D;  3LH0 A;  2GCX A;  3L2Z A;  2XG8 D;  3JB9 I;  3G7Z A;  2HAX A;  1QVF A;  4XTU A;  1B34 A;  2LDM A;  4F7U G;  4F7U A;  2KSS A;  3HRU A;  1WPY A;  3JCM W;  5GAN e;  3SWN B;  3QZ9 B;  2DXT A;  4FT4 A;  2F69 A;  5GAN 2;  2EJG A;  4O5V A;  3I55 A;  1YIT A;  1DJ7 B;  2JVV A;  3CC4 A;  4J8O A;  3JRZ A;  1NPP A;  4MZP A;  1KC8 C;  3J80 E;  1U1T A;  4QVZ A;  4EMG A;  2EFI A;  1IRE B;  3X25 B;  2ZPI B;  1WQW A;  2E6Z A;  3HHT B;  3GP8 A;  2P4T A;  1W2B S;  2OTJ T;  4M7A B;  1LNX A;  2DVE A;  4XTX A;  3VKI A;  4FSX A;  4PL6 A;  3KXT A;  3FJP A;  4FT2 A;  5I2S A;  5LJ5 j;  5IAY A;  2KVQ G;  3ASK A;  3INZ A;  3M54 A;  3P8D A;  3E19 A;  3FDR A;  3QYH B;  1XQH A;  2E64 A;  1D3B A;  3HL8 A;  5J3B A;  2DD5 A;  1MHN A;  5IN1 A;  4HKE A;  4JS5 A;  4FIB A;  3JCM V;  4RG2 A;  4V2S A;  1IZ6 A;  3OYK A;  4LDY A;  4QQG A;  2L8D A;  4LDW A;  4B9X A;  2RH2 A;  2EJF A;  2VGM A;  4N4G A;  3V8K A;  3LWI A;  1H64 1;  3QYG B;  4NL2 A;  2E1H A;  3M57 A;  1Q7Y C;  1M1K U;  4A4E A;  3A8O B;  2XI9 A;  1YJN T;  1KQS S;  2P0P A;  2QQS A;  1XNI A;  5GAN h;  1QVG S;  3GLX A;  3QJ6 A;  2OTJ A;  3SWN A;  2IG0 A;  1WJS A;  4B9W A;  5FRM A;  1BYM A;  1G3S A;  2Y4X A;  2YHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...