4EMHA

Crystal structure of splsm4
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
GRPILVELKNGETFNGHLENCDNYMNLTLREVIRTMPDGDKFFRLPECYIRGNNIKYLRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Lsm3, Lsm4 and Lsm5/6/7 from Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
molecule keywords Probable U6 snRNA-associated Sm-like protein LSm4
total genus 10
structure length 60
sequence length 60
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, T, U, V, W, X, Y
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4emhA00
4J6WA 4QVDA 4M7DA 2DEQA 3JCMc 4C92B 2EJ9A 4JUVA 1WNLA 5GAMg 5GAN5 4XTUA 5GANj 3QHSA 4Y91A 1H641 3SWNB 4F7UE 3BDUA 3PGGA 4C8QD 4EMHA 2EWNA 4XTXA 5GAOp 2FB7A 4M77G 1BIBA 4M7DB 3FB9A 3JCMf 4C8QC 1X01A 3RKWA 5GAN7 3V7RA 4A54A 5LJ3j 4EMGA 3BFMA 4C8QA 4PNOA 2RB6A 3RKXA 3JCMb 5LJ5j 2E64A 1U1TA 4F7UA 4M7AC 2YLCA 2E10A 4C8QG 4F7UF 1I8FA 2ZGWA 2EAYA 5GMKh 5LJ5g 5GAMj 2CGHA 5GAOq 1TH7A 4MMLA 4V2SA 2DTHA 1D3BA 4M77D 3V8LA 3JCMJ 3RESA 2HNIA 3RERA 1KQ1A 4M78F 4XQ3A 4M75A 1MGQA 1LJOA 1Y96B 2QTXA 5LJ3e 3JB9I 2EJGA 4NOYA 3SWNC 3L1AA 5GANh 5GMKe 3HFOA 3V8KA 5GAMh 3V7CA 2DTIA 4M78B 2JN0A 4QVCA 4C92C 1LOJA 5GMKj 5LJ3g 4N0AA 2EJFA 4F7UG 4C8QF 1I81A 2DVEA 1B34A 1N9SA 2DZCA 4M78C 4M75D 2I2LA 3RIRA 5LJ3h 4DQ2A 3GIBA 4PJOB 5GANe 3BY7A 4JRIA 3BW1A 5GANd 4JRKA 5GANg 2RM4A 1M5Q1 4M77F 4EMKA 5GAMe 5GAOl 4NL3A 3JCMX 1YCYA 1M8VA 5GAMd 4RCCA 4M7DC 3JCMP 3AHUA 1HXDA 5LJ3f 4XTWA 3V7SA 3EFSA 5CAIA 3JCMg 5GMKi 2DTOA 4OP0A 5GAOr 4N0AC 3JB9G 4PJOD 2DJZA 1LNXA 4M78E 4M77A 4XU3A 4J6XA 1BIAA 4M75G 5GMKl 4HA8A 4M7AB 4XU0A 3JB9D 4PJOG 5GAMf 2FYKA 5GAN4 3QUIA 5LJ5f 5LJ3d 5GAN8 4M78G 5GAOn 4C92F 4PJOA 4M75E 4EMKC 3JCMh 4PJOC 5GAOm 5LJ5h 3SB2A 4M7AA 3INZA 4EMKB 3FJPA 1I4K1 5GAN3 2K57A 3EFRA 4XU2A 4C8QE 5GAN6 4NL2A 5LJ5e 4WF2A 4M7DD 4M7DF 1I5LA 3M4GA 4J5YA 4HT9A 1KQ2A 1JRIA 4PJOF 3JCMd 4A53A 2VXEA 2VC8A 4C8QB 1JBMA 4JLIA 4J6YA 4XTYA 3JB9H 2DZ9A 4HT8A 4PJOE 4MMKA 2E41A 4M75C 2DKGA 2RA2A 4M78D 4XTZA 3RKYA 5GANf 4M7AG 3L2ZA 3V8JA 2DXUA 1Y96A 5DY9A 4C92D 4M75B 3JCMV 4M7AE 4XTVA 3JCMQ 1WQWA 3JCMW 4M7DE 1B34B 3JB9F 2E65A 2VXFA 4M7DG 4M77E 4M77B 3HFNA 4M78A 1WQ7A 2DXTA 2YLBA 4M75F 5GMKm 5GAN2 4X9CA 3QO3A 4C92A 3HSBA 4M77C 4XU1A 3JCMe 3JB9J 2RD1A 1U1SA 3RUXA 4C92E 3FIFA 5I21A 4M7AF 2Y90A 3SWNA 3QSUA 4M7AD 1N9RA 3VU3C 2YHTA 4RCBA 4C92G 4X9DA 5LJ5d 1WPYA 1D3BB 1HK9A 4F7UB 2E1HA
chains in the Genus database with same CATH superfamily
3Q1JA 3G6EQ 3QHSA 1N6AA 2R58A 5I2SA 3C4SA 3CXCS 3QIIA 2MMPA 2CUDA 1EZZB 5CVIA 1JJ2A 2E70A 2KBTA 3VYHB 3QJYA 1AVZC 1MNDA 4JZ3A 1KIKA 3CCUT 2X4XA 1X75C 1YI2A 1RLQC 1AT1B 2O2OA 2LX9A 4CC7A 1RAHB 2P0KA 2X3XD 5GAMh 2QDLA 4QVCA 5KYWA 1SKUB 2JMAA 3O5ZA 4JRPA 2JUFA 4OMLA 1P92A 1MUZA 5DLQE 5FROA 2JM8A 4Y28E 3JCMX 3HKSA 2RK1A 3UATA 2JTFA 5FWCA 1NM7A 4FSXA 3ZEHA 3X24B 4M78E 4O6JA 1TXQA 4ZTFA 1VQ8Q 2K5LA 2FPDA 3LGLA 2JXBA 1ABQA 2MCNA 3INZA 4BB7A 2BTTA 2XDBA 2HDAA 4Q5WA 1UTIA 4LDVA 1SG5A 4HT9A 4DOWA 2F2WA 1GFDA 1BCOA 1ZHIA 1CSKA 2VXEA 2VC8A 2RH2A 1MMDA 1UB4A 3EGXB 4M78D 1IGQA 2AKLA 1M4ZA 4RMOA 4PFOA 2JVVA 4FT2A 2KY9A 2CZ0B 2KMTA 2QAZA 3QDRB 2DL7A 4JDSA 3CCVT 3JCMe 1WGSA 1U1SA 1PKTA 3FJ5A 2M9UA 4C92G 2OTJQ 3CCJQ 2LQKA 1F1BB 1HK9A 2BE9B 1RAIB 1D1AA 1QQJA 2OTLQ 4QVDA 1K4US 4A63B 3OS0A 3C94A 1RAAB 1MMNA 2KNBB 4HCCA 1EX4A 2COZA 4E7HA 2QDYB 1BIBA 2KGTA 3JCMf 2V1RA 3CMAT 2VGMA 5KYYA 2DO3A 3RKXA 4LD6A 5DLOA 2CGHA 1VQKT 4FIBA 2YUQA 3A8GB 3M56A 5GANh 1GRIA 2YUOA 1M27C 1RI0A 2DVEA 2XKOC 3TCJA 3EGDA 4BY6B 2X4JA 3MEWA 3VS2A 1YIJA 3OS2A 1YCYA 2A3LA 3CCLQ 3OYEA 3UDCA 3H0IA 3L2RA 4XU3A 4J6XA 2KSSA 2AZVA 3CMET 2FYKA 1VQLT 1FX7A 5FRMA 1GCPA 3C95A 4D6WA 1I5OB 3I56Q 2JNGA 3M0RA 5FW9A 2R5MA 3QBYA 1D09B 4DBQA 2LDMA 1WFWA 3A5ZB 4HXJA 1S72A 4JLIA 3HTRA 2JTMA 5DY9A 1VQMA 3JCMV 3EAEA 1T3SA 4RTUA 4M75F 4IIOA 1BI0A 3E19A 2MF2A 1RAFB 2Y90A 1N9RA 2CS7A 3CCJT 3VJPA 4Y92A 5D6XA 1NE8A 3R6NA 3UPUA 1RUWA 1QW1A 2CH4W 3CCMA 1PG5B 2XI9A 4PK4A 5CR2A 2VYTA 1X2KA 5A0DA 1OX8A 2JM9A 2M16A 2PTKA 1MMGA 2XHCA 1ZUUA 1OEBA 4YTLA 2WACA 1N27A 2OAUA 1H92A 3EG9B 3OYYA 5CKHA 3A8OB 4RTYA 3GF5A 3CCST 2YLCA 4C8QG 5GAMj 1I8FA 2D0NA 2DF6A 5LJ5g 2F5KA 4MMLA 2CZ7B 3H6ZA 2LCLA 1UHCA 1ZSZB 2EJGA 1UECA 1HD3A 4JJNK 1VQMQ 4BDZA 4M78B 1PCXA 4ATOA 2YRVA 2QQAA 1ZA2B 2P4TA 2YRDA 2OI3A 2FVUA 2Y4YA 2K2VA 2L89A 4NL3A 3F70A 1YHQA 1VQ6A 4ELZC 4XTWA 1OZ3A 3QPHA 2NUTA 4BI3A 1PC0A 2MWOA 1OZ2A 2DFUA 2LX7A 2D8JA 3U23A 5IXFA 4BACA 3OYDA 3EGXA 2SRCA 2HSPA 1G3YA 1HYOA 5GAOn 4M75E 1CKAA 3CC2T 3JCMh 4KGVB 4QQDA 1V29B 2FL7A 3EFRA 5GAN6 2V8JA 4LUDA 3M4GA 4C0DB 3X28B 2KI7A 3UA7A 2K9GA 4OMFB 1KD1R 5ECAA 1YCSB 1GBQA 3H8ZA 4Z02A 1D0YA 2FPEA 4DEYA 3I55A 3E2UA 2Y4XA 3P8BB 3EG2A 2DXTA 5GAN2 1YJ9A 1OULA 2FHDA 2RD1A 1W4SA 2HEQA 4KULA 4RCBA 2ZAEA 1Q86R 3IQLA 4JUVA 1YJNA 4ELYC 1UUEA 3SWNB 4JPBW 4BI8B 5D7UA 3EG9A 3FDRA 1EFNA 5A0LA 1Q7YR 4FW2A 1VQ7Q 1G8XA 1WHHA 2F1LA 2BKDN 2QXFA 2MPXC 2ENMA 3JSCA 3G4ST 2J05A 2PVGB 3MJXA 4PNOA 2YRCA 3LLRA 4RTZA 5HKCA 2XICA 1TH7A 1VQKA 2DYIA 4EPCA 1AWOA 3RESA 4KT0E 2IPOB 2E5QA 2PQWA 5CKBA 5GMKe 2DXBA 1YI2T 3QYHB 2KXDA 1VQ6Q 1M3CA 5LJ3g 2RNAA 4C0ZA 4E7SA 1Z9QA 4ZN1A 2GTJA 2RM4A 3I5SA 1M5Q1 2L0AA 5HK0A 3CC7A 1YJWA 1AZEA 2DIGA 1SSFA 1QP3A 4J8OA 4J9IA 1TG0A 4RG2A 1Y57A 3C12A 3OS1A 4OGEA 3E1SA 2E12A 1VQ5T 2LJ0A 1KQSP 1YBYA 3KBGA 3I55Q 1S1NA 2J7IA 2FRYA 2KVQG 2G6FX 2YUNA 4HT8A 1ZX6A 1VQ9T 2QYZA 3EGDB 1VIEA 3JCMQ 3HL8A 1YITT 3PTAA 1OU8A 2A28A 3A8HB 4QKUA 1K76A 3J81E 1MV3A 2QTVA 3CMEQ 2LRQA 2W10A 2R5AA 4LDYA 1WPYA 3REBB 3RMQA 5GANj 4Y91A 2GFUA 2OTJT 3CC4Q 4XTXA 1HJDA 3HRSA 1AOJA 2BE7D 4M77G 2MI6A 4PFZA 3RKWA 3I35A 2P0QA 2PVDB 4CC3A 2ESWA 2IVWA 1PSFA 3X26B 4RG8A 2RJCA 3FEOA 1BB9A 2DD5A 1E6HA 2D9TA 5M9OA 4V2SA 1YWOA 4PKCC 3A8LB 3VUBA 3JV3A 2X51A 4BDYA 2EFIA 1G2BA 4AFZC 2QI2A 4N0AA 2K3BA 2HZYA 1M3BA 4E7JA 5C0MA 4FYWB 2DPPB 3BY7A 1NYFA 1QKWA 3LX7A 3MCAB 4RCCA 1VQ7T 1VQ4T 1NPRA 1VQOA 1JO8A 1PM3A 1Y0MA 2EQMA 2O4XA 5GAOr 3JB9G 2RO0A 3D7SB 1TSFA 4PJOG 4J9CA 4PJLA 2VV5A 3OMGA 4AG2C 1I4K1 4ORZA 1YIJT 1Y71A 3NPFA 4RUGA 4A53A 2RJFA 2YT6A 2FZGB 2DKGA 1VQ9Q 1ZA1B 2ZPIB 1K0SA 1WIEA 1Q7YU 2KYBA 1QVGP 1QCOA 2AK5A 2J6OA 4M7DG 2O88A 4J9DA 1YFNA 5D6YA 1TU0B 2DJQA 2EVRA 2DA9A 1J3TA 1VQ8A 2L3PA 1D3BB 4M7DA 5GAN5 1KD1U 3MEVA 1JJ2P 3THKA 1K73U 3WVDB 4CI0C 4IUVA 2FB7A 4M7DB 4C8QC 2JS0A 2A0FB 1K8AU 3MPUB 1OQKA 4CRIA 1WYXA 1G3TA 4L5GA 2EIFA 5GMKh 2RQVA 4Z89A 4LN2A 3CCUQ 5KCOA 1GCQA 4KUDK 3A1PA 5IHIA 3SWNC 1GFCA 2WSEE 1TOVA 1VQ9A 1A0NB 4C0FA 3EH1A 1M1GA 1I0CA 1I81A 2CREA 4PJOB 1IXDA 1SPKA 4JRKA 4UC4A 4M77F 1C0MA 2FZCB 2QEXQ 3G6ET 1N8RC 2CP7A 2DTOA 1MHNA 3FLGA 4E2FB 1YHQQ 1X6GA 2L5QA 4GLKA 2PZ1A 1BBZA 2GTOA 3HPWA 3CC2A 2GFAA 1TS9A 4DEXA 1C6VX 3M5AA 1ZLMA 3VS4A 4GBQA 1UE9A 3M57A 5GAOm 4HCBA 3CCRA 4E7LA 2QG9B 1KQ2A 4PJOF 3E9GA 1BK2A 3S3MA 3RDVA 3L2ZA 2GNCA 2DXUA 3V8JA 2DEUA 8AT1B 2KXCA 5IAYA 4WTOB 2O31A 4M7DE 2E65A 2LTOA 2AIRB 4M78A 5IXBA 3HFNA 1WQ7A 2OAWA 4OMNA 2IIMA 3NTHA 3VS3A 1Q82C 3VS0A 1K9MU 1KG1A 4OMQA 1VQLQ 3X25B 4FL6A 1T3LA 2RHZA 2EQKA 4OF1A 3TVTA 1W2BS 2OTLT 2X35A 3QDFA 1M90R 1WX6A 2B8AA 1KQSA 1N8RU 4F14A 2DLPA 5IH2A 3G4SA 1S72Q 2DMOA 1WHLA 2V8KA 4A4KA 3QKJA 3ER0A 4FSSA 1D3BA 1KQ1A 4M78F 1K8AR 3OS5A 1SSHA 4IKFA 1X69A 3L1AA 2EPDA 3VYGA 4AFQC 1YI2Q 4A4EA 4C5IA 1AEYA 4ZNXA 2KAFA 2JTEA 2DZCA 2D8HA 2E6NA 2KQWA 5I22A 2C06A 5GAMd 2RHYA 1M90C 2EQIA 4ZTJA 1EIFA 2KRNA 1BKBA 1IHVA 4N0AC 2E3IA 1PSEA 4CC4B 4VUBA 1G83A 1TUDA 3CCVA 5LJ5f 1VYTA 4LXCA 4D8DA 2HD0A 1O9SA 4OB0B 1QVGS 5KYWB 4AFSC 2LQNA 2KE9A 1WQWA 3CCSQ 1GXIE 2ED1A 2LP5A 3QZ9B 2VB6A 1VQKQ 3ULRB 3M0UA 1SHFA 5GMKm 2CUBA 1QKXA 4J9FA 3EHQA 3QO3A 2LCCA 1YJ9T 5I11A 4OB3B 1ABOA 1Q95G 1VOMA 2QK0A 4A4GA 9ATCB 2XU8A 3SEMA 5LJ5h 5KCHA 2DL3A 2KK4A 3OYMA 4OMOA 4C8QD 3VRZA 1WA7A 2V26A 1HSQA 4LUEA 3V7RA 3OSVA 2DAQA 4IURA 2HKNA 1M1KC 1IREB 2AT1B 2QQRA 2VASA 2RHXA 2MOXA 4J83A 5FRNA 3JAME 4J7FA 4K11A 3JCMJ 3CMEA 1G3WA 5IN1A 3P8DA 4KBMB 2BZXA 4NOYA 2DBKA 1VQMT 4KUIA 2WSCE 2COYA 4II1A 4QVZA 3CCQA 2EYZA 3OQ5A 3L42A 4KGZB 5GANg 4C5EA 3R6OA 2RHIA 3N5BB 1K73R 3JRZA 4OP0A 3TU4K 4FCYA 1VQ4A 2DJZA 4KH1B 2C0OA 2DRMA 2XMFA 4PJJA 4LDWA 4AFUC 2J06A 2L2PA 3I5RA 4M78G 5J39A 4X34A 1JB0E 2GBQA 2X4WA 3WVEB 1TTHB 2X9HA 2QGGA 3PIOA 1JRIA 1BYMA 1NYGA 3QWXX 4C8QB 3CCJA 1VQPA 4LD9K 1U8RA 1Y96A 5CQYA 4OMMA 3HRUA 4ANJA 5GJVB 3OW2P 3PMIA 4EDUA 3JB9F 3M58A 2GF7A 2XDDA 4E7ZA 2QEXA 2FPFA 1RI9A 1XOVA 1FMWA 4XU1A 2VKNA 1MNEA 2XIDA 4IIMA 1QVFS 2LQWA 8ATCB 1B07A 4DBRA 2RQUA 4HKEA 3GLXA 2DM1A 4PLIA 1B7TA 1H3ZA 3J80E 1O75A 4FYXB 5FWBA 1PD0A 4F7UE 1YN8A 1QP2A 2RQTA 4A4HA 2JT4A 5GJWB 3EGUA 1QMCA 5GAN7 4A54A 5FU6C 3J7AF 4JZ4A 2O01E 3MEAA 4JS4A 1U1TA 1IZ6A 4ZGJB 1VQ6T 2G3RA 2C0TA 2KEAA 5AT1B 4XQ3A 2VVKA 3NTIA 2DIQA 3HFOA 1N5ZA 2JOYA 3MEUA 1RABB 1UEBA 1M2VA 4M78C 4PFPA 3RIRA 4DQ2A 1WHMA 2EYQA 1QVGA 1FYNA 5GAMe 1KHCA 3TSWA 3JCMP 3OMCA 2OJ2A 4FM4B 1PD1A 4PJNA 2HCKA 1NZ9A 1C1AA 4M77A 5GMKl 1BIAA 1W1FA 2M0YA 1OX9A 4M7AB 1VIFA 2EGAA 2ABLA 4EMKC 5CIUA 4L6V5 1AZGB 4J9EA 1IGUA 1M8MA 5LJ5e 1I5LA 2PNIA 2FRWA 4E47A 3E9FA 4C0GA 1GL5A 4XTZA 3UT1A 1BI1A 2ROTA 1YJNT 1AWXA 3QWYA 4NS5A 1V1CA 4E6RA 4JS5A 1AWWA 2ZCFB 2XG8D 1RADB 1VYVA 2LJ1A 3CD6A 4JLGA 4MZMA 1KD1C 4QQGA 4BE0A 2M1HA 4NL2A 1X6OA 2AHJB 2JS2A 3HP9A 2QASA 2DL4A 3CD6Q 2XD0A 1K8AC 3RMSA 4LDXA 2EBPA 2EYXA 1NBEB 1D0ZA 2OTLA 4C8QA 3VUZA 3CQTA 3PT9A 2E64A 4F7UA 1X43A 2WSFE 3RERA 2COWA 3EG1A 3REAB 2EYYA 3QZ5B 2DBMA 5EG2A 3G1JA 5KYNA 3OBYA 1QVFA 4C92C 5J26A 4IUPA 2I2LA 1KFZA 3ASKA 3GNGA 1Q86U 3G7ZA 1T0HA 1PKSA 1OPLA 1AHJB 3UF4A 3V7SA 2XDPA 1QWFA 3JCMg 3CCUA 7AT1B 2LZ6B 4QQ6A 1LCKA 3QYGB 2LT1A 4HA8A 2P4RA 5AYFA 1M2OA 2MWPA 5LJ3d 2XK0A 3M55A 4FU6A 4PJOA 4CC2A 1ZUYA 1YITA 1TUCA 2QA4T 2CYZB 5GAN3 2EYWA 3CC4T 4M7DD 4M7DF 1K9MR 5HK3A 2X3WD 4BE2A 4M75C 3WXMB 1IB8A 3DKMA 1IO6A 1UGQB 4QT7A 2RF0A 5HCKA 2RHUA 3OYJA 5I2MA 4HVUA 3S3OA 2JW4A 1Q82U 3CBMA 4LE9A 1W6XA 2E4HA 3CCRT 3LGFA 4M77C 3JB9J 2YDLA 4Z88A 2HMAA 4M7AF 1BU1A 3M4YA 3JCMc 5L8RE 3VS7A 1K0XA 3ZFJA 1PRLC 2ZPBB 3RR6A 1BCMA 4OB2B 2EWNA 2PUKB 2CP6A 1OPKA 3M53A 3PIPA 1E7OA 1RAEB 4M4ZA 4EMGA 2K4YA 1Q7YC 3VKIA 4R55A 2RB6A 2GQIA 1KK7A 3OYLA 1KC8U 1VQPQ 2RI3A 2O9SA 2E10A 1T0JA 3CC7T 1YJWT 3A98A 3MP8A 3G71A 1VQ7A 3NMZC 1VQOQ 1FMKA 1Q82R 3NTKA 3CCEA 4MZPA 2QA4Q 1AWJA 2KR3A 1NLPC 3V8KA 2RMOA 1IRXA 4DOVA 2JN0A 4FW1A 2DVJA 1M90U 3PFSA 2VUBA 2BZYA 2DK3A 1QVFP 4F04B 1YJ9Q 2NWMA 3TREA 4KGXB 1G5VA 1WLPB 3LW5E 4DBFA 1YITQ 3CPWP 1ZBXA 2QGFB 1QLYA 3DB3A 4M75G 2D0QB 1SRLA 1M1KR 3OYNA 2DL5A 3JB9D 1NLOC 1SEMA 3S6WA 2EGEA 1VQ8T 2LNHB 2M02A 1RLPC 4XU2A 1GBRA 2L8DA 3EG0A 2NLUA 2CZ6B 1G3SA 4XTYA 3EH2A 2EGCA 3HHTB 5GANf 3C0CA 4M75B 4R56A 1XJWB 1VQPT 2QEXT 2I0NA 3JCMW 1WXTA 2DERA 2PVOB 4L59A 2ATCB 2HQEA 3CPWS 4C92A 4D8KA 1K9AA 3M0SA 1R77A 3I56A 3CEYA 1ACMB 3VU3C 3ZL7C 2YHTA 2ZPHB 3CXCA 1M3AA 1JQQA 3A8MB 4XTUA 3FRNA 2HSEB 1UJYA 1ZSZC 2CKKA 3PGGA 4EMHA 4ZN3A 3NFCA 2KT8A 4B6MA 5GAOp 1ARKA 2VGNA 5KYUB 4E7KA 3S3NA 1X01A 1Q81R 2CP2A 2X4YA 3BFMA 1NG2A 1R8OB 5KE2A 2P84A 2NUPB 2Z0WA 4BD3A 3NHNA 2DNUA 5LJ5j 1WJQA 2ZPFB 2QA4A 2O9VA 1VYUA 1YJWQ 4J7IA 2LC4A 4PL6A 5KYXA 1MGQA 2QTXA 3QG1A 1U3OA 2KRMA 1VQNQ 2V8IA 3OYGA 5GMKj 2MAMA 3CCVQ 2OX7A 1B34A 3GIBA 3OW2A 3EFOA 5J3BA 5GANd 2MK5A 5FLXE 3CMAA 6AT1B 3M54A 4OMPA 2R57A 1QVPA 3PNWC 3NGPA 3FC3A 3G71Q 2HQXA 2GGRA 2CP0A 4TVRA 3OYAA 2M51A 1OV3A 1GCQC 3CC2Q 2J6KA 4HCKA 2YUPA 1W70A 1NPPA 2H3EB 3VS1A 4AT1B 1FXXA 4J5YA 2K79A 4BY6C 1JBMA 1I07A 3VRYA 1XNIA 2RA2A 1UGSB 3RKYA 3OA6A 3UWNA 2CT4A 3TEEA 1KSWA 2O4XB 4FYVB 1IHWA 1RL2A 3DLMA 4JJDA 2DD4A 4M77B 3CCLA 1WXBA 1DJ7B 2A08A 4KRTA 1WJRA 2M0OA 3HSBA 3RUXA 1R0BG 1V76A 2ZPEB 2HKQB 5LJ5d 3CD6T 2BUDA 4MDXA 3CCQQ 1VUBA 3SD4A 4J6WA 5L23A 3EG3A 3I9QA 3M0PA 4ME7A 2K7AA 4MZTA 5C6SA 2K6DA 1KHIA 1QWEA 3H0FA 3CXCP 3FB9A 3H0HA 3RNJA 5CKFA 2A37A 3L2VA 4F16A 1NJIC 4EIKA 1KQSS 3OB9A 4E7IA 3P8HA 4RTVA 3CBOA 3M9QA 2MIOA 2L3SA 5FU6B 1LJOA 2QQBA 3JB9I 3GP8A 1QCNA 2C0IA 3TSZA 2E5KA 1X27A 1YP5A 1OOTA 3MHXA 4F7UG 2P0PA 3DLLA 4BE1A 3BW1A 3MP6A 3OYFA 1LPLA 3OYIA 2HBPA 2KROA 1WHJA 2RI2A 2JJ9A 5LJ3f 4JJBA 3EFSA 5CAIA 3CCSA 4PJOD 3H41A 1FMVA 1PRMC 1U06A 2LVMA 4B9WA 1UGPB 2L3QA 1VQNA 3KUFA 4PJOC 4M7AA 2K57A 4GY5A 3OBWA 1VQOT 3OYHA 2EKHA 3JCMd 3EHRA 4M7AG 4MDWA 1TUGB 3GOXA 2DL8A 2A36A 1M2VB 4R0KA 1NJIU 2K2MA 3T9NA 2YLBA 1JXOA 1VQ5A 4C5GA 3OYCA 2FZKB 3FIFA 2K5IA 1KJWA 4WCIA 4IUTA 4C0DC 2E1HA 2DEQA 5GAMg 1ZUKA 1WZOA 2H3JA 2LMJA 1E6GA 5FU7B 1WHKA 3BDUA 2ROLA 5KYYB 3CCQT 4FYYB 2ZZDA 4LDUA 2JZ2A 3GPLA 3G4SQ 2CZ1B 2K3YA 2LCSA 3PVLA 3JCMb 2E3HA 4P5NA 1VQ5Q 3OY9A 4J9HA 5CKDA 1M1KU 4N4GA 2HNIA 3TQ7P 3LWIA 3HRTA 2HL3A 1UG1A 2PU9B 3L2QA 1CKBA 1LOJA 4PLLA 5LJ3h 1N9SA 3OYBA 2YXYA 4BUGA 1SF9A 5CKEA 2CSIA 1XQHA 3UA6A 1MMAA 2AZSA 2LJ3A 3AHUA 1HXDA 5GMKi 4XK8E 1N8RR 3H9NA 2BIVA 4HVVA 2DILA 4N4IA 4B9XA 2LNVA 4XU0A 5GAMf 1D1BA 5GAN8 4C92F 3LYIA 1WHGA 2K3XA 5KH6A 4A4FA 3CCEQ 2KT1A 4FT4A 4HCZA 1OU9A 4RTWA 5CO7A 1M1FA 5A0GA 1I1JA 5CQXA 1WJSA 2JMCA 2L3RA 4J9GA 1S72T 4J6YA 1MV0B 4MMKA 1QCFA 2FG0A 5IHKA 5FU7C 3QJ6A 1Q81U 4RTXA 4M7AE 1M30A 2DETA 3QXEB 1VA7A 2GQVA 3BE3A 2QQ9A 3SDZA 1U5SA 4M77E 2H8HA 4OVAA 1R0CB 4OB1B 3CC4A 4X9CA 5KE3A 2D1XA 1JJ2S 5I21A 4M7AD 5IT9E 1NEBA 2BZ8A 2HQHA 1VQ4Q 2EJ9A 1ZSZA 3PVQA 2A7YA 3CPWA 3BDLA 2VWFA 2RK2A 2NYSA 3URGA 4GLMA 4RKUE 1WXUA 5LJ3j 3ZBDA 3X20B 3PMTA 3I56T 1YJNQ 2RPNA 4PJMA 4M7AC 4JJCA 4F17A 2EW3A 1UFFA 2DTHA 2KRSA 3OYKA 1W2BA 4ZGEB 3META 4RTTA 5A2QE 1NEGA 3M0TA 1D0XA 2AKKA 3V7CA 3GNFB 2EJFA 3MP1A 3CPFA 2RJDA 4AMCA 2KDSA 4JRIA 3VS6A 2HAXA 1H8KA 1JEGA 2DRKA 3M59A 1SRMA 2W0ZA 4EMKA 5GAOl 4IUQA 1YHQT 1TWBA 1YWPA 1M8VA 3VV0A 1H3HA 1Q81C 2F5TX 2PUOB 2EQUA 2CP5A 2HL5C 3EFOB 4IUUA 4DA4A 1LNXA 1XTDA 4LNPA 5DM7R 2OTJA 3G71T 1UGVA 5GAN4 3CCET 4N4HA 1KC8R 3O8VA 5KYXB 4C5HA 3I55T 3SB2A 1LVKA 1BI2A 4EMKB 1M9SA 2IG0A 1UGRB 3CMAQ 4C8QE 2DXCA 5EC7A 1FWZA 1X2QA 4BI4A 2F2VA 3G6EA 1Q86C 1WDXA 3GBQA 1ZSGA 2RQWA 4PJOE 2E41A 1JXMA 4DBHA 5D6WA 2EKOA 1AD5A 1Z9ZA 3ME9A 2YWWA 3CCLT 3OW2S 2CDTA 5CCAA 3MO8A 2EQJA 4HVWA 4OGCA 2CT3A 2NUPA 3SWNA 3CBPA 1UDLA 2LT4A 4F7UB 2D6FA 1X6BA 5KYUA 4C92B 1WNLA 4O5VA 1H641 1YNZA 3L2WA 2SEMA 4Z8AA 2LQ8A 2NUZA 1OYXA 3CCMT 2DX1A 2E6ZA 3LH0A 1JU5C 1K1ZA 2ECZA 2F69A 4KH0B 3CCMQ 2KYMA 3VS5A 1OI1A 4F7UF 2FEIA 2ZGWA 3AT1B 2EAYA 3SHWA 2RN8A 5GAOq 3PE0A 4M77D 3V8LA 1ZBJA 1SHGA 4M75A 5LJ3e 3KXTA 1Y96B 2RQRA 2YSQA 1PHTA 2ED0A 1W2BP 1PWTA 2DTIA 2QQSA 3LH5A 4C8QF 2DYBA 4M75D 1D1CA 4XAXB 2J6FA 3MKDA 5GANe 1RAGB 4ZGDB 2F2XA 5HY6A 3KFVA 4X1VA 1ZQ1A 2V1QA 4M7DC 4J9BA 2CH4A 1KC8C 2NUTB 2HBWA 4ESRA 2CSQA 2B86A 2DE0X 1NJIR 3RBBB 3QUIA 2ZPGB 3OSSC 3FJPA 4QW2A 1Y7XA 4WF2A 1WI7A 1K73C 2RJEA 1YIJQ 3JB9H 3SFMA 2DZ9A 4AG1C 2K5FA 4C92D 5IHNA 3CCRQ 5CK9A 4XTVA 4JRQA 3M0QA 2CP3A 2FO0A 1B34B 1VQLA 1UJ0A 3DB4A 5LL6S 2VXFA 1BI3A 1K9MC 3CC7Q 1VQNT 2GCXA 2RI5A 2MYSA 1UHFA 3LWHA 4C92E 1PNJA 3QSUA 4X9DA 1RACB 1B3QA 3L2UA 1Y07A
chains in the Genus database with same CATH topology
3Q1JA 4J6WA 1H3ZA 3J80E 1O75A 3RMQA 5GANj 4ME7A 3QHSA 4Y91A 2GFUA 1N6AA 4F7UE 2R58A 4MZTA 2OTJT 5C6SA 1QP2A 4A4HA 4XTXA 1KHIA 3HRSA 4M77G 5I2SA 2MI6A 3C4SA 3CXCS 3FB9A 3RKWA 3QIIA 2MMPA 5GAN7 5CVIA 4A54A 5CKFA 5FU6C 3L2VA 1JJ2A 3J7AF 2P0QA 2PVDB 2E70A 2O01E 2IVWA 1NJIC 1PSFA 3X26B 3MEAA 4JS4A 4RG8A 2RJCA 3VYHB 1U1TA 3FEOA 1KQSS 3OB9A 3QJYA 2DD5A 4E7IA 2D9TA 1IZ6A 3P8HA 4ZGJB 5M9OA 4V2SA 3CBOA 3CCUT 2X4XA 3M9QA 1X75C 1VQ6T 2G3RA 5FU6B 1YI2A 4XQ3A 3NTIA 1LJOA 2QQBA 2LX9A 4PKCC 2DIQA 3A8LB 3VUBA 3JB9I 3GP8A 2P0KA 4BDYA 2EFIA 3HFOA 5GAMh 2JOYA 4QVCA 3MEUA 1UEBA 3SD4A 2QI2A 3MHXA 4N0AA 4F7UG 4JRPA 4M78C 2JUFA 3RIRA 4DQ2A 5C0MA 4E7JA 2P0PA 2DPPB 3BY7A 3DLLA 2EYQA 4BE1A 1QVGA 1P92A 3BW1A 3MP6A 5DLQE 3OYFA 5FROA 3OYIA 5GAMe 1KHCA 2HBPA 4Y28E 3JCMX 2RI2A 3LX7A 3HKSA 3MCAB 4RCCA 3OMCA 3JCMP 1NPRA 1VQ4T 1VQ7T 2RK1A 1VQOA 5LJ3f 3EFSA 4FM4B 5CAIA 2EQMA 2JTFA 2O4XA 4FSXA 3ZEHA 3X24B 5GAOr 3CCSA 1NZ9A 3JB9G 4PJOD 4M78E 4M77A 5GMKl 1BIAA 2RO0A 4O6JA 4ZTFA 4M7AB 2K5LA 2LVMA 4B9WA 4PJOG 1VIFA 1UGPB 2VV5A 3OMGA 4EMKC 5CIUA 4L6V5 1VQNA 3KUFA 4PJOC 3LGLA 4M7AA 3INZA 4BB7A 1I4K1 1YIJT 2K57A 2XDBA 1Y71A 4Q5WA 5LJ5e 4GY5A 1I5LA 4LDVA 3OBWA 1VQOT 3OYHA 4DOWA 4HT9A 4E47A 3E9FA 1ZHIA 4A53A 4C0GA 2VXEA 2RJFA 2VC8A 3JCMd 2RH2A 1UB4A 4M78D 4XTZA 2DKGA 4M7AG 3UT1A 1M4ZA 4MDWA 1BI1A 2ZPIB 1YJNT 4RMOA 3GOXA 4NS5A 2JVVA 4FT2A 1Q7YU 2KY9A 2CZ0B 2KMTA 4JS5A 3QDRB 1NJIU 4M7DG 2ZCFB 3T9NA 2XG8D 2YLBA 4JDSA 3CCVT 5D6YA 3JCMe 1VQ5A 1WGSA 4C5GA 3CD6A 4JLGA 4MZMA 1U1SA 3OYCA 1KD1C 4QQGA 3FIFA 2K5IA 1VQ8A 2M9UA 4C92G 4BE0A 2M1HA 2LQKA 1D3BB 1HK9A 4IUTA 4NL2A 1X6OA 2E1HA 4C0DC 2AHJB 3HP9A 4QVDA 4M7DA 2DEQA 5GAMg 5GAN5 1KD1U 2H3JA 3OS0A 3MEVA 3C94A 5FU7B 3BDUA 1K73U 3WVDB 2XD0A 4CI0C 3JB9F 3CCQT 1K8AC 4HCCA 3RMSA 4E7HA 2QDYB 2FB7A 4IUVA 4LDXA 1BIBA 4M7DB 2ZZDA 3JCMf 4C8QC 4LDUA 2JZ2A 3GPLA 2OTLA 3CMAT 1K8AU 4C8QA 2VGMA 4CRIA 2CZ1B 2DO3A 3VUZA 3RKXA 2K3YA 1G3TA 3JCMb 3PT9A 2E64A 4P5NA 4F7UA 4LD6A 3OY9A 4L5GA 5DLOA 2EIFA 5GMKh 2CGHA 5CKDA 1M1KU 1VQKT 5KCOA 2WSFE 4N4GA 4KUDK 2HNIA 4FIBA 3RERA 3LWIA 3HRTA 3QZ5B 3A8GB 3M56A 3SWNC 5GANh 5EG2A 2WSEE 2PU9B 3OBYA 3L2QA 1VQ9A 1QVFA 4C0FA 4C92C 1LOJA 1RI0A 1M1GA 4IUPA 4PLLA 5J26A 1I81A 2DVEA 1N9SA 2XKOC 5LJ3h 3TCJA 3OYBA 2I2LA 4PJOB 4BY6B 3ASKA 4BUGA 5CKEA 2X4JA 3GNGA 1XQHA 3MEWA 4JRKA 4UC4A 1Q86U 4M77F 3G7ZA 1YIJA 3OS2A 1YCYA 1AHJB 2A3LA 3AHUA 1HXDA 3V7SA 2XDPA 3OYEA 3JCMg 3G6ET 5GMKi 3CCUA 4XK8E 1N8RC 2DTOA 1MHNA 3FLGA 3UDCA 4QQ6A 2L5QA 3QYGB 3L2RA 4GLKA 2BIVA 2LT1A 4J6XA 4XU3A 2KSSA 4N4IA 4HA8A 3HPWA 4B9XA 3CMET 2LNVA 5AYFA 3CC2A 4XU0A 2GFAA 5GAMf 2FYKA 2MWPA 1VQLT 3M5AA 2XK0A 3M55A 4FU6A 5LJ3d 1FX7A 4C92F 5GAN8 5FRMA 4PJOA 3LYIA 3C95A 4D6WA 3M57A 5GAOm 2K3XA 2JNGA 1YITA 5KH6A 2QA4T 2CYZB 4A4FA 5GAN3 2R5MA 4FT4A 4HCZA 5CO7A 4HCBA 1M1FA 3QBYA 5A0GA 3CC4T 3CCRA 4E7LA 4M7DD 5CQXA 4M7DF 2LDMA 1WJSA 1KQ2A 2L3RA 4PJOF 3A5ZB 5HK3A 4BE2A 1S72T 1S72A 4JLIA 4J6YA 3E9GA 4M75C 4MMKA 2JTMA 3WXMB 3S3MA 3DKMA 5FU7C 3QJ6A 1Q81U 1UGQB 3L2ZA 3V8JA 2DXUA 5DY9A 1VQMA 3JCMV 4M7AE 3OYJA 2RHUA 3QXEB 5I2MA 5IAYA 2GQVA 4M7DE 3EAEA 3S3OA 3SDZA 2QQ9A 2E65A 2LTOA 1Q82U 3CBMA 4M77E 4M78A 3HFNA 1WQ7A 4M75F 4OVAA 4OB1B 3CCRT 3CC4A 1BI0A 3LGFA 4X9CA 3E19A 5KE3A 4M77C 3JB9J 1JJ2S 3NTHA 2MF2A 1Q82C 5I21A 4M7AF 2Y90A 1K9MU 4M7AD 1KG1A 1N9RA 2CS7A 3X25B 4FL6A 3CCJT 3VJPA 5IT9E 3M4YA 5D6XA 1NE8A 3JCMc 2EJ9A 2RHZA 5L8RE 3UPUA 1QW1A 2EQKA 3CCMA 2XI9A 4OF1A 3ZFJA 2A7YA 5CR2A 2VYTA 2ZPBB 5A0DA 3CPWA 4OB2B 2EWNA 2PUKB 2OTLT 1W2BS 3BDLA 2M16A 2RK2A 3M53A 3PIPA 3URGA 2X35A 2XHCA 4RKUE 5LJ3j 4EMGA 2K4YA 4YTLA 2WACA 3X20B 3ZBDA 1N27A 2B8AA 2OAUA 3PMTA 3VKIA 4R55A 2RB6A 3OYYA 1N8RU 5CKHA 1KQSA 3I56T 3A8OB 3OYLA 1KC8U 3G4SA 2RI3A 3GF5A 3CCST 4M7AC 2YLCA 2E10A 2V8KA 4A4KA 1I8FA 4C8QG 3QKJA 3ER0A 5LJ5g 5GAMj 2F5KA 4MMLA 3CC7T 2DTHA 1D3BA 1YJWT 3MP8A 3OYKA 2CZ7B 3G71A 1W2BA 4ZGEB 1VQ7A 3H6ZA 2LCLA 1KQ1A 4M78F 3META 3NTKA 3OS5A 3CCEA 4MZPA 5A2QE 2EJGA 4IKFA 3L1AA 3VYGA 4JJNK 3V8KA 4A4EA 4C5IA 4BDZA 3V7CA 4DOVA 4M78B 2JN0A 4ATOA 2YRVA 3GNFB 2QQAA 2KAFA 2EJFA 2P4TA 3MP1A 1M90U 2DZCA 2RJDA 3CPFA 2E6NA 3PFSA 2KQWA 2FVUA 2KDSA 2Y4YA 2K2VA 2VUBA 2L89A 4JRIA 2HAXA 2DK3A 3M59A 2C06A 4EMKA 4NL3A 5GAOl 4IUQA 1YHQT 3F70A 1YHQA 1M8VA 3VV0A 2RHYA 3TREA 5GAMd 1M90C 1VQ6A 1G5VA 4ELZC 4XTWA 3LW5E 1OZ3A 3QPHA 4ZTJA 4BI3A 1Q81C 1EIFA 2F5TX 1BKBA 2EQUA 1OZ2A 2MWOA 2PUOB 4N0AC 4IUUA 4DA4A 1PSEA 1LNXA 1XTDA 1ZBXA 3DB3A 4BACA 4M75G 5DM7R 3OYDA 2OTJA 2D0QB 3G71T 4VUBA 3OYNA 3JB9D 1G3YA 5GAN4 3CCET 4N4HA 3CCVA 5LJ5f 3O8VA 3S6WA 5GAOn 4M75E 3CC2T 3JCMh 4C5HA 1VQ8T 3I55T 4QQDA 3SB2A 1BI2A 4EMKB 1M9SA 2IG0A 1UGRB 1V29B 2FL7A 2HD0A 3EFRA 2DXCA 4XU2A 1O9SA 2L8DA 4C8QE 2V8JA 5GAN6 1FWZA 4BI4A 4OB0B 3M4GA 3G6EA 1Q86C 4C0DB 2NLUA 1QVGS 2CZ6B 3X28B 1G3SA 4XTYA 4PJOE 3HHTB 2E41A 4OMFB 5GANf 5D6WA 2EKOA 3H8ZA 4M75B 4R56A 3ME9A 4Z02A 1VQPT 2QEXT 3CCLT 1WQWA 3JCMW 3OW2S 3I55A 1GXIE 5CCAA 2Y4XA 2PVOB 3P8BB 4L59A 3QZ9B 2DXTA 2HQEA 3CPWS 5GMKm 5GAN2 1YJ9A 3QO3A 3MO8A 2LCCA 4C92A 1YJ9T 4OB3B 2FHDA 2EQJA 2RD1A 4OGCA 3I56A 3CEYA 1W4SA 3SWNA 3VU3C 2YHTA 4KULA 4RCBA 4A4GA 3CBPA 2XU8A 2LT4A 4F7UB 5LJ5h 2D6FA 2ZPHB 3CXCA 4C92B 5KCHA 4JUVA 1WNLA 2KK4A 3A8MB 4XTUA 3FRNA 4ELYC 4O5VA 3OYMA 1YJNA 1H641 2CKKA 3SWNB 3L2WA 4BI8B 3PGGA 3FDRA 4C8QD 4EMHA 4ZN3A 3NFCA 5A0LA 2LQ8A 5GAOp 1OYXA 3CCMT 2VGNA 2E6ZA 4E7KA 1Q7YC 3S3NA 2BKDN 1X01A 2QXFA 3LH0A 3OSVA 3V7RA 2DAQA 3JSCA 3G4ST 2X4YA 3BFMA 2F69A 4IURA 2PVGB 1R8OB 1M1KC 4PNOA 1IREB 5KE2A 2QQRA 4BD3A 3LLRA 5LJ5j 1WJQA 1OI1A 2RHXA 2ZPFB 4J83A 4F7UF 2QA4A 2ZGWA 5HKCA 2EAYA 5FRNA 2XICA 3JAME 5GAOq 1TH7A 4J7FA 1VQKA 4M77D 3V8LA 4EPCA 3JCMJ 4J7IA 3RESA 3CMEA 4KT0E 1G3WA 2E5QA 2LC4A 4PL6A 4M75A 1MGQA 5IN1A 1Y96B 2QTXA 3P8DA 4KBMB 5LJ3e 3KXTA 3QG1A 4NOYA 2PQWA 5CKBA 1VQMT 4KUIA 5GMKe 2DXBA 1YI2T 3QYHB 2WSCE 2V8IA 3OYGA 2DTIA 4II1A 5GMKj 5LJ3g 2QQSA 2MAMA 4QVZA 4C8QF 3CCQA 1B34A 3GIBA 4M75D 3OQ5A 4C0ZA 3OW2A 4XAXB 5GANe 3L42A 5J3BA 4ZGDB 4ZN1A 5GANd 5GANg 2RM4A 5HY6A 1M5Q1 4C5EA 5FLXE 3CMAA 1ZQ1A 4M7DC 3R6OA 2RHIA 3N5BB 3M54A 5HK0A 3JRZA 3CC7A 1YJWA 2R57A 1QVPA 2DIGA 4OP0A 1KC8C 3PNWC 1SSFA 3TU4K 1VQ4A 1QP3A 4J8OA 2DJZA 4RG2A 3FC3A 3C12A 2HQXA 3OS1A 4TVRA 4LDWA 3OYAA 4OGEA 3QUIA 4M78G 5J39A 2ZPGB 1JB0E 3OSSC 4X34A 3E1SA 2E12A 2X4WA 3GLXA 3FJPA 1VQ5T 1NPPA 4QW2A 3WVEB 1Y7XA 1FXXA 1YBYA 3KBGA 4WF2A 4J5YA 3PIOA 1JRIA 1BYMA 4C8QB 4BY6C 2RJEA 1JBMA 1K73C 2KVQG 3JB9H 3SFMA 3CCJA 2DZ9A 1XNIA 1VQPA 4HT8A 2K5FA 4LD9K 1VQ9T 2RA2A 1UGSB 3RKYA 3OA6A 4MDXA 1U8RA 3UWNA 1Y96A 5CQYA 4C92D 1VIEA 3TEEA 3HRUA 5CK9A 4XTVA 2O4XB 3JCMQ 4JRQA 3HL8A 1YITT 1B34B 1VQLA 3PMIA 1RL2A 3DB4A 3DLMA 2VXFA 5LL6S 4EDUA 3PTAA 1BI3A 3M58A 1K9MC 1VQNT 2GF7A 2DD4A 4M77B 2GCXA 2XDDA 2QEXA 2RI5A 3CCLA 1DJ7B 1XOVA 1WJRA 2M0OA 3HSBA 3A8HB 4XU1A 3J81E 3LWHA 2XIDA 2LRQA 3RUXA 4C92E 1QVFS 2ZPEB 3QSUA 5LJ5d 3CD6T 4X9DA 2R5AA 4HKEA 2BUDA 1WPYA 4LDYA 3L2UA 1Y07A 1VUBA 4PLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J6W A;  4QVD A;  4M7D A;  2DEQ A;  3JCM c;  4C92 B;  2EJ9 A;  4JUV A;  1WNL A;  5GAM g;  5GAN 5;  4XTU A;  5GAN j;  3QHS A;  4Y91 A;  1H64 1;  3SWN B;  4F7U E;  3BDU A;  3PGG A;  4C8Q D;  4EMH A;  2EWN A;  4XTX A;  5GAO p;  2FB7 A;  4M77 G;  1BIB A;  4M7D B;  3FB9 A;  3JCM f;  4C8Q C;  1X01 A;  3RKW A;  5GAN 7;  3V7R A;  4A54 A;  5LJ3 j;  4EMG A;  3BFM A;  4C8Q A;  4PNO A;  2RB6 A;  3RKX A;  3JCM b;  5LJ5 j;  2E64 A;  1U1T A;  4F7U A;  4M7A C;  2YLC A;  2E10 A;  4C8Q G;  4F7U F;  1I8F A;  2ZGW A;  2EAY A;  5GMK h;  5LJ5 g;  5GAM j;  2CGH A;  5GAO q;  1TH7 A;  4MML A;  4V2S A;  2DTH A;  1D3B A;  4M77 D;  3V8L A;  3JCM J;  3RES A;  2HNI A;  3RER A;  1KQ1 A;  4M78 F;  4XQ3 A;  4M75 A;  1MGQ A;  1LJO A;  1Y96 B;  2QTX A;  5LJ3 e;  3JB9 I;  2EJG A;  4NOY A;  3SWN C;  3L1A A;  5GAN h;  5GMK e;  3HFO A;  3V8K A;  5GAM h;  3V7C A;  2DTI A;  4M78 B;  2JN0 A;  4QVC A;  4C92 C;  1LOJ A;  5GMK j;  5LJ3 g;  4N0A A;  2EJF A;  4F7U G;  4C8Q F;  1I81 A;  2DVE A;  1B34 A;  1N9S A;  2DZC A;  4M78 C;  4M75 D;  2I2L A;  3RIR A;  5LJ3 h;  4DQ2 A;  3GIB A;  4PJO B;  5GAN e;  3BY7 A;  4JRI A;  3BW1 A;  5GAN d;  4JRK A;  5GAN g;  2RM4 A;  1M5Q 1;  4M77 F;  4EMK A;  5GAM e;  5GAO l;  4NL3 A;  3JCM X;  1YCY A;  1M8V A;  5GAM d;  4RCC A;  4M7D C;  3JCM P;  3AHU A;  1HXD A;  5LJ3 f;  4XTW A;  3V7S A;  3EFS A;  5CAI A;  3JCM g;  5GMK i;  2DTO A;  4OP0 A;  5GAO r;  4N0A C;  3JB9 G;  4PJO D;  2DJZ A;  1LNX A;  4M78 E;  4M77 A;  4XU3 A;  4J6X A;  1BIA A;  4M75 G;  5GMK l;  4HA8 A;  4M7A B;  4XU0 A;  3JB9 D;  4PJO G;  5GAM f;  2FYK A;  5GAN 4;  3QUI A;  5LJ5 f;  5LJ3 d;  5GAN 8;  4M78 G;  5GAO n;  4C92 F;  4PJO A;  4M75 E;  4EMK C;  3JCM h;  4PJO C;  5GAO m;  5LJ5 h;  3SB2 A;  4M7A A;  3INZ A;  4EMK B;  3FJP A;  1I4K 1;  5GAN 3;  2K57 A;  3EFR A;  4XU2 A;  4C8Q E;  5GAN 6;  4NL2 A;  5LJ5 e;  4WF2 A;  4M7D D;  4M7D F;  1I5L A;  3M4G A;  4J5Y A;  4HT9 A;  1KQ2 A;  1JRI A;  4PJO F;  3JCM d;  4A53 A;  2VXE A;  2VC8 A;  4C8Q B;  1JBM A;  4JLI A;  4J6Y A;  4XTY A;  3JB9 H;  2DZ9 A;  4HT8 A;  4PJO E;  4MMK A;  2E41 A;  4M75 C;  2DKG A;  2RA2 A;  4M78 D;  4XTZ A;  3RKY A;  5GAN f;  4M7A G;  3L2Z A;  3V8J A;  2DXU A;  1Y96 A;  5DY9 A;  4C92 D;  4M75 B;  3JCM V;  4M7A E;  4XTV A;  3JCM Q;  1WQW A;  3JCM W;  4M7D E;  1B34 B;  3JB9 F;  2E65 A;  2VXF A;  4M7D G;  4M77 E;  4M77 B;  3HFN A;  4M78 A;  1WQ7 A;  2DXT A;  2YLB A;  4M75 F;  5GMK m;  5GAN 2;  4X9C A;  3QO3 A;  4C92 A;  3HSB A;  4M77 C;  4XU1 A;  3JCM e;  3JB9 J;  2RD1 A;  1U1S A;  3RUX A;  4C92 E;  3FIF A;  5I21 A;  4M7A F;  2Y90 A;  3SWN A;  3QSU A;  4M7A D;  1N9R A;  3VU3 C;  2YHT A;  4RCB A;  4C92 G;  4X9D A;  5LJ5 d;  1WPY A;  1D3B B;  1HK9 A;  4F7U B;  2E1H A; 
#chains in the Genus database with same CATH topology
 3Q1J A;  3G6E Q;  3QHS A;  1N6A A;  2R58 A;  5I2S A;  3C4S A;  3CXC S;  3QII A;  2MMP A;  2CUD A;  1EZZ B;  5CVI A;  1JJ2 A;  2E70 A;  2KBT A;  3VYH B;  3QJY A;  1AVZ C;  1MND A;  4JZ3 A;  1KIK A;  3CCU T;  2X4X A;  1X75 C;  1YI2 A;  1RLQ C;  1AT1 B;  2O2O A;  2LX9 A;  4CC7 A;  1RAH B;  2P0K A;  2X3X D;  5GAM h;  2QDL A;  4QVC A;  5KYW A;  1SKU B;  2JMA A;  3O5Z A;  4JRP A;  2JUF A;  4OML A;  1P92 A;  1MUZ A;  5DLQ E;  5FRO A;  2JM8 A;  4Y28 E;  3JCM X;  3HKS A;  2RK1 A;  3UAT A;  2JTF A;  5FWC A;  1NM7 A;  4FSX A;  3ZEH A;  3X24 B;  4M78 E;  4O6J A;  1TXQ A;  4ZTF A;  1VQ8 Q;  2K5L A;  2FPD A;  3LGL A;  2JXB A;  1ABQ A;  2MCN A;  3INZ A;  4BB7 A;  2BTT A;  2XDB A;  2HDA A;  4Q5W A;  1UTI A;  4LDV A;  1SG5 A;  4HT9 A;  4DOW A;  2F2W A;  1GFD A;  1BCO A;  1ZHI A;  1CSK A;  2VXE A;  2VC8 A;  2RH2 A;  1MMD A;  1UB4 A;  3EGX B;  4M78 D;  1IGQ A;  2AKL A;  1M4Z A;  4RMO A;  4PFO A;  2JVV A;  4FT2 A;  2KY9 A;  2CZ0 B;  2KMT A;  2QAZ A;  3QDR B;  2DL7 A;  4JDS A;  3CCV T;  3JCM e;  1WGS A;  1U1S A;  1PKT A;  3FJ5 A;  2M9U A;  4C92 G;  2OTJ Q;  3CCJ Q;  2LQK A;  1F1B B;  1HK9 A;  2BE9 B;  1RAI B;  1D1A A;  1QQJ A;  2OTL Q;  4QVD A;  1K4U S;  4A63 B;  3OS0 A;  3C94 A;  1RAA B;  1MMN A;  2KNB B;  4HCC A;  1EX4 A;  2COZ A;  4E7H A;  2QDY B;  1BIB A;  2KGT A;  3JCM f;  2V1R A;  3CMA T;  2VGM A;  5KYY A;  2DO3 A;  3RKX A;  4LD6 A;  5DLO A;  2CGH A;  1VQK T;  4FIB A;  2YUQ A;  3A8G B;  3M56 A;  5GAN h;  1GRI A;  2YUO A;  1M27 C;  1RI0 A;  2DVE A;  2XKO C;  3TCJ A;  3EGD A;  4BY6 B;  2X4J A;  3MEW A;  3VS2 A;  1YIJ A;  3OS2 A;  1YCY A;  2A3L A;  3CCL Q;  3OYE A;  3UDC A;  3H0I A;  3L2R A;  4XU3 A;  4J6X A;  2KSS A;  2AZV A;  3CME T;  2FYK A;  1VQL T;  1FX7 A;  5FRM A;  1GCP A;  3C95 A;  4D6W A;  1I5O B;  3I56 Q;  2JNG A;  3M0R A;  5FW9 A;  2R5M A;  3QBY A;  1D09 B;  4DBQ A;  2LDM A;  1WFW A;  3A5Z B;  4HXJ A;  1S72 A;  4JLI A;  3HTR A;  2JTM A;  5DY9 A;  1VQM A;  3JCM V;  3EAE A;  1T3S A;  4RTU A;  4M75 F;  4IIO A;  1BI0 A;  3E19 A;  2MF2 A;  1RAF B;  2Y90 A;  1N9R A;  2CS7 A;  3CCJ T;  3VJP A;  4Y92 A;  5D6X A;  1NE8 A;  3R6N A;  3UPU A;  1RUW A;  1QW1 A;  2CH4 W;  3CCM A;  1PG5 B;  2XI9 A;  4PK4 A;  5CR2 A;  2VYT A;  1X2K A;  5A0D A;  1OX8 A;  2JM9 A;  2M16 A;  2PTK A;  1MMG A;  2XHC A;  1ZUU A;  1OEB A;  4YTL A;  2WAC A;  1N27 A;  2OAU A;  1H92 A;  3EG9 B;  3OYY A;  5CKH A;  3A8O B;  4RTY A;  3GF5 A;  3CCS T;  2YLC A;  4C8Q G;  5GAM j;  1I8F A;  2D0N A;  2DF6 A;  5LJ5 g;  2F5K A;  4MML A;  2CZ7 B;  3H6Z A;  2LCL A;  1UHC A;  1ZSZ B;  2EJG A;  1UEC A;  1HD3 A;  4JJN K;  1VQM Q;  4BDZ A;  4M78 B;  1PCX A;  4ATO A;  2YRV A;  2QQA A;  1ZA2 B;  2P4T A;  2YRD A;  2OI3 A;  2FVU A;  2Y4Y A;  2K2V A;  2L89 A;  4NL3 A;  3F70 A;  1YHQ A;  1VQ6 A;  4ELZ C;  4XTW A;  1OZ3 A;  3QPH A;  2NUT A;  4BI3 A;  1PC0 A;  2MWO A;  1OZ2 A;  2DFU A;  2LX7 A;  2D8J A;  3U23 A;  5IXF A;  4BAC A;  3OYD A;  3EGX A;  2SRC A;  2HSP A;  1G3Y A;  1HYO A;  5GAO n;  4M75 E;  1CKA A;  3CC2 T;  3JCM h;  4KGV B;  4QQD A;  1V29 B;  2FL7 A;  3EFR A;  5GAN 6;  2V8J A;  4LUD A;  3M4G A;  4C0D B;  3X28 B;  2KI7 A;  3UA7 A;  2K9G A;  4OMF B;  1KD1 R;  5ECA A;  1YCS B;  1GBQ A;  3H8Z A;  4Z02 A;  1D0Y A;  2FPE A;  4DEY A;  3I55 A;  3E2U A;  2Y4X A;  3P8B B;  3EG2 A;  2DXT A;  5GAN 2;  1YJ9 A;  1OUL A;  2FHD A;  2RD1 A;  1W4S A;  2HEQ A;  4KUL A;  4RCB A;  2ZAE A;  1Q86 R;  3IQL A;  4JUV A;  1YJN A;  4ELY C;  1UUE A;  3SWN B;  4JPB W;  4BI8 B;  5D7U A;  3EG9 A;  3FDR A;  1EFN A;  5A0L A;  1Q7Y R;  4FW2 A;  1VQ7 Q;  1G8X A;  1WHH A;  2F1L A;  2BKD N;  2QXF A;  2MPX C;  2ENM A;  3JSC A;  3G4S T;  2J05 A;  2PVG B;  3MJX A;  4PNO A;  2YRC A;  3LLR A;  4RTZ A;  5HKC A;  2XIC A;  1TH7 A;  1VQK A;  2DYI A;  4EPC A;  1AWO A;  3RES A;  4KT0 E;  2IPO B;  2E5Q A;  2PQW A;  5CKB A;  5GMK e;  2DXB A;  1YI2 T;  3QYH B;  2KXD A;  1VQ6 Q;  1M3C A;  5LJ3 g;  2RNA A;  4C0Z A;  4E7S A;  1Z9Q A;  4ZN1 A;  2GTJ A;  2RM4 A;  3I5S A;  1M5Q 1;  2L0A A;  5HK0 A;  3CC7 A;  1YJW A;  1AZE A;  2DIG A;  1SSF A;  1QP3 A;  4J8O A;  4J9I A;  1TG0 A;  4RG2 A;  1Y57 A;  3C12 A;  3OS1 A;  4OGE A;  3E1S A;  2E12 A;  1VQ5 T;  2LJ0 A;  1KQS P;  1YBY A;  3KBG A;  3I55 Q;  1S1N A;  2J7I A;  2FRY A;  2KVQ G;  2G6F X;  2YUN A;  4HT8 A;  1ZX6 A;  1VQ9 T;  2QYZ A;  3EGD B;  1VIE A;  3JCM Q;  3HL8 A;  1YIT T;  3PTA A;  1OU8 A;  2A28 A;  3A8H B;  4QKU A;  1K76 A;  3J81 E;  1MV3 A;  2QTV A;  3CME Q;  2LRQ A;  2W10 A;  2R5A A;  4LDY A;  1WPY A;  3REB B;  3RMQ A;  5GAN j;  4Y91 A;  2GFU A;  2OTJ T;  3CC4 Q;  4XTX A;  1HJD A;  3HRS A;  1AOJ A;  2BE7 D;  4M77 G;  2MI6 A;  4PFZ A;  3RKW A;  3I35 A;  2P0Q A;  2PVD B;  4CC3 A;  2ESW A;  2IVW A;  1PSF A;  3X26 B;  4RG8 A;  2RJC A;  3FEO A;  1BB9 A;  2DD5 A;  1E6H A;  2D9T A;  5M9O A;  4V2S A;  1YWO A;  4PKC C;  3A8L B;  3VUB A;  3JV3 A;  2X51 A;  4BDY A;  2EFI A;  1G2B A;  4AFZ C;  2QI2 A;  4N0A A;  2K3B A;  2HZY A;  1M3B A;  4E7J A;  5C0M A;  4FYW B;  2DPP B;  3BY7 A;  1NYF A;  1QKW A;  3LX7 A;  3MCA B;  4RCC A;  1VQ7 T;  1VQ4 T;  1NPR A;  1VQO A;  1JO8 A;  1PM3 A;  1Y0M A;  2EQM A;  2O4X A;  5GAO r;  3JB9 G;  2RO0 A;  3D7S B;  1TSF A;  4PJO G;  4J9C A;  4PJL A;  2VV5 A;  3OMG A;  4AG2 C;  1I4K 1;  4ORZ A;  1YIJ T;  1Y71 A;  3NPF A;  4RUG A;  4A53 A;  2RJF A;  2YT6 A;  2FZG B;  2DKG A;  1VQ9 Q;  1ZA1 B;  2ZPI B;  1K0S A;  1WIE A;  1Q7Y U;  2KYB A;  1QVG P;  1QCO A;  2AK5 A;  2J6O A;  4M7D G;  2O88 A;  4J9D A;  1YFN A;  5D6Y A;  1TU0 B;  2DJQ A;  2EVR A;  2DA9 A;  1J3T A;  1VQ8 A;  2L3P A;  1D3B B;  4M7D A;  5GAN 5;  1KD1 U;  3MEV A;  1JJ2 P;  3THK A;  1K73 U;  3WVD B;  4CI0 C;  4IUV A;  2FB7 A;  4M7D B;  4C8Q C;  2JS0 A;  2A0F B;  1K8A U;  3MPU B;  1OQK A;  4CRI A;  1WYX A;  1G3T A;  4L5G A;  2EIF A;  5GMK h;  2RQV A;  4Z89 A;  4LN2 A;  3CCU Q;  5KCO A;  1GCQ A;  4KUD K;  3A1P A;  5IHI A;  3SWN C;  1GFC A;  2WSE E;  1TOV A;  1VQ9 A;  1A0N B;  4C0F A;  3EH1 A;  1M1G A;  1I0C A;  1I81 A;  2CRE A;  4PJO B;  1IXD A;  1SPK A;  4JRK A;  4UC4 A;  4M77 F;  1C0M A;  2FZC B;  2QEX Q;  3G6E T;  1N8R C;  2CP7 A;  2DTO A;  1MHN A;  3FLG A;  4E2F B;  1YHQ Q;  1X6G A;  2L5Q A;  4GLK A;  2PZ1 A;  1BBZ A;  2GTO A;  3HPW A;  3CC2 A;  2GFA A;  1TS9 A;  4DEX A;  1C6V X;  3M5A A;  1ZLM A;  3VS4 A;  4GBQ A;  1UE9 A;  3M57 A;  5GAO m;  4HCB A;  3CCR A;  4E7L A;  2QG9 B;  1KQ2 A;  4PJO F;  3E9G A;  1BK2 A;  3S3M A;  3RDV A;  3L2Z A;  2GNC A;  2DXU A;  3V8J A;  2DEU A;  8AT1 B;  2KXC A;  5IAY A;  4WTO B;  2O31 A;  4M7D E;  2E65 A;  2LTO A;  2AIR B;  4M78 A;  5IXB A;  3HFN A;  1WQ7 A;  2OAW A;  4OMN A;  2IIM A;  3NTH A;  3VS3 A;  1Q82 C;  3VS0 A;  1K9M U;  1KG1 A;  4OMQ A;  1VQL Q;  3X25 B;  4FL6 A;  1T3L A;  2RHZ A;  2EQK A;  4OF1 A;  3TVT A;  1W2B S;  2OTL T;  2X35 A;  3QDF A;  1M90 R;  1WX6 A;  2B8A A;  1KQS A;  1N8R U;  4F14 A;  2DLP A;  5IH2 A;  3G4S A;  1S72 Q;  2DMO A;  1WHL A;  2V8K A;  4A4K A;  3QKJ A;  3ER0 A;  4FSS A;  1D3B A;  1KQ1 A;  4M78 F;  1K8A R;  3OS5 A;  1SSH A;  4IKF A;  1X69 A;  3L1A A;  2EPD A;  3VYG A;  4AFQ C;  1YI2 Q;  4A4E A;  4C5I A;  1AEY A;  4ZNX A;  2KAF A;  2JTE A;  2DZC A;  2D8H A;  2E6N A;  2KQW A;  5I22 A;  2C06 A;  5GAM d;  2RHY A;  1M90 C;  2EQI A;  4ZTJ A;  1EIF A;  2KRN A;  1BKB A;  1IHV A;  4N0A C;  2E3I A;  1PSE A;  4CC4 B;  4VUB A;  1G83 A;  1TUD A;  3CCV A;  5LJ5 f;  1VYT A;  4LXC A;  4D8D A;  2HD0 A;  1O9S A;  4OB0 B;  1QVG S;  5KYW B;  4AFS C;  2LQN A;  2KE9 A;  1WQW A;  3CCS Q;  1GXI E;  2ED1 A;  2LP5 A;  3QZ9 B;  2VB6 A;  1VQK Q;  3ULR B;  3M0U A;  1SHF A;  5GMK m;  2CUB A;  1QKX A;  4J9F A;  3EHQ A;  3QO3 A;  2LCC A;  1YJ9 T;  5I11 A;  4OB3 B;  1ABO A;  1Q95 G;  1VOM A;  2QK0 A;  4A4G A;  9ATC B;  2XU8 A;  3SEM A;  5LJ5 h;  5KCH A;  2DL3 A;  2KK4 A;  3OYM A;  4OMO A;  4C8Q D;  3VRZ A;  1WA7 A;  2V26 A;  1HSQ A;  4LUE A;  3V7R A;  3OSV A;  2DAQ A;  4IUR A;  2HKN A;  1M1K C;  1IRE B;  2AT1 B;  2QQR A;  2VAS A;  2RHX A;  2MOX A;  4J83 A;  5FRN A;  3JAM E;  4J7F A;  4K11 A;  3JCM J;  3CME A;  1G3W A;  5IN1 A;  3P8D A;  4KBM B;  2BZX A;  4NOY A;  2DBK A;  1VQM T;  4KUI A;  2WSC E;  2COY A;  4II1 A;  4QVZ A;  3CCQ A;  2EYZ A;  3OQ5 A;  3L42 A;  4KGZ B;  5GAN g;  4C5E A;  3R6O A;  2RHI A;  3N5B B;  1K73 R;  3JRZ A;  4OP0 A;  3TU4 K;  4FCY A;  1VQ4 A;  2DJZ A;  4KH1 B;  2C0O A;  2DRM A;  2XMF A;  4PJJ A;  4LDW A;  4AFU C;  2J06 A;  2L2P A;  3I5R A;  4M78 G;  5J39 A;  4X34 A;  1JB0 E;  2GBQ A;  2X4W A;  3WVE B;  1TTH B;  2X9H A;  2QGG A;  3PIO A;  1JRI A;  1BYM A;  1NYG A;  3QWX X;  4C8Q B;  3CCJ A;  1VQP A;  4LD9 K;  1U8R A;  1Y96 A;  5CQY A;  4OMM A;  3HRU A;  4ANJ A;  5GJV B;  3OW2 P;  3PMI A;  4EDU A;  3JB9 F;  3M58 A;  2GF7 A;  2XDD A;  4E7Z A;  2QEX A;  2FPF A;  1RI9 A;  1XOV A;  1FMW A;  4XU1 A;  2VKN A;  1MNE A;  2XID A;  4IIM A;  1QVF S;  2LQW A;  8ATC B;  1B07 A;  4DBR A;  2RQU A;  4HKE A;  3GLX A;  2DM1 A;  4PLI A;  1B7T A;  1H3Z A;  3J80 E;  1O75 A;  4FYX B;  5FWB A;  1PD0 A;  4F7U E;  1YN8 A;  1QP2 A;  2RQT A;  4A4H A;  2JT4 A;  5GJW B;  3EGU A;  1QMC A;  5GAN 7;  4A54 A;  5FU6 C;  3J7A F;  4JZ4 A;  2O01 E;  3MEA A;  4JS4 A;  1U1T A;  1IZ6 A;  4ZGJ B;  1VQ6 T;  2G3R A;  2C0T A;  2KEA A;  5AT1 B;  4XQ3 A;  2VVK A;  3NTI A;  2DIQ A;  3HFO A;  1N5Z A;  2JOY A;  3MEU A;  1RAB B;  1UEB A;  1M2V A;  4M78 C;  4PFP A;  3RIR A;  4DQ2 A;  1WHM A;  2EYQ A;  1QVG A;  1FYN A;  5GAM e;  1KHC A;  3TSW A;  3JCM P;  3OMC A;  2OJ2 A;  4FM4 B;  1PD1 A;  4PJN A;  2HCK A;  1NZ9 A;  1C1A A;  4M77 A;  5GMK l;  1BIA A;  1W1F A;  2M0Y A;  1OX9 A;  4M7A B;  1VIF A;  2EGA A;  2ABL A;  4EMK C;  5CIU A;  4L6V 5;  1AZG B;  4J9E A;  1IGU A;  1M8M A;  5LJ5 e;  1I5L A;  2PNI A;  2FRW A;  4E47 A;  3E9F A;  4C0G A;  1GL5 A;  4XTZ A;  3UT1 A;  1BI1 A;  2ROT A;  1YJN T;  1AWX A;  3QWY A;  4NS5 A;  1V1C A;  4E6R A;  4JS5 A;  1AWW A;  2ZCF B;  2XG8 D;  1RAD B;  1VYV A;  2LJ1 A;  3CD6 A;  4JLG A;  4MZM A;  1KD1 C;  4QQG A;  4BE0 A;  2M1H A;  4NL2 A;  1X6O A;  2AHJ B;  2JS2 A;  3HP9 A;  2QAS A;  2DL4 A;  3CD6 Q;  2XD0 A;  1K8A C;  3RMS A;  4LDX A;  2EBP A;  2EYX A;  1NBE B;  1D0Z A;  2OTL A;  4C8Q A;  3VUZ A;  3CQT A;  3PT9 A;  2E64 A;  4F7U A;  1X43 A;  2WSF E;  3RER A;  2COW A;  3EG1 A;  3REA B;  2EYY A;  3QZ5 B;  2DBM A;  5EG2 A;  3G1J A;  5KYN A;  3OBY A;  1QVF A;  4C92 C;  5J26 A;  4IUP A;  2I2L A;  1KFZ A;  3ASK A;  3GNG A;  1Q86 U;  3G7Z A;  1T0H A;  1PKS A;  1OPL A;  1AHJ B;  3UF4 A;  3V7S A;  2XDP A;  1QWF A;  3JCM g;  3CCU A;  7AT1 B;  2LZ6 B;  4QQ6 A;  1LCK A;  3QYG B;  2LT1 A;  4HA8 A;  2P4R A;  5AYF A;  1M2O A;  2MWP A;  5LJ3 d;  2XK0 A;  3M55 A;  4FU6 A;  4PJO A;  4CC2 A;  1ZUY A;  1YIT A;  1TUC A;  2QA4 T;  2CYZ B;  5GAN 3;  2EYW A;  3CC4 T;  4M7D D;  4M7D F;  1K9M R;  5HK3 A;  2X3W D;  4BE2 A;  4M75 C;  3WXM B;  1IB8 A;  3DKM A;  1IO6 A;  1UGQ B;  4QT7 A;  2RF0 A;  5HCK A;  2RHU A;  3OYJ A;  5I2M A;  4HVU A;  3S3O A;  2JW4 A;  1Q82 U;  3CBM A;  4LE9 A;  1W6X A;  2E4H A;  3CCR T;  3LGF A;  4M77 C;  3JB9 J;  2YDL A;  4Z88 A;  2HMA A;  4M7A F;  1BU1 A;  3M4Y A;  3JCM c;  5L8R E;  3VS7 A;  1K0X A;  3ZFJ A;  1PRL C;  2ZPB B;  3RR6 A;  1BCM A;  4OB2 B;  2EWN A;  2PUK B;  2CP6 A;  1OPK A;  3M53 A;  3PIP A;  1E7O A;  1RAE B;  4M4Z A;  4EMG A;  2K4Y A;  1Q7Y C;  3VKI A;  4R55 A;  2RB6 A;  2GQI A;  1KK7 A;  3OYL A;  1KC8 U;  1VQP Q;  2RI3 A;  2O9S A;  2E10 A;  1T0J A;  3CC7 T;  1YJW T;  3A98 A;  3MP8 A;  3G71 A;  1VQ7 A;  3NMZ C;  1VQO Q;  1FMK A;  1Q82 R;  3NTK A;  3CCE A;  4MZP A;  2QA4 Q;  1AWJ A;  2KR3 A;  1NLP C;  3V8K A;  2RMO A;  1IRX A;  4DOV A;  2JN0 A;  4FW1 A;  2DVJ A;  1M90 U;  3PFS A;  2VUB A;  2BZY A;  2DK3 A;  1QVF P;  4F04 B;  1YJ9 Q;  2NWM A;  3TRE A;  4KGX B;  1G5V A;  1WLP B;  3LW5 E;  4DBF A;  1YIT Q;  3CPW P;  1ZBX A;  2QGF B;  1QLY A;  3DB3 A;  4M75 G;  2D0Q B;  1SRL A;  1M1K R;  3OYN A;  2DL5 A;  3JB9 D;  1NLO C;  1SEM A;  3S6W A;  2EGE A;  1VQ8 T;  2LNH B;  2M02 A;  1RLP C;  4XU2 A;  1GBR A;  2L8D A;  3EG0 A;  2NLU A;  2CZ6 B;  1G3S A;  4XTY A;  3EH2 A;  2EGC A;  3HHT B;  5GAN f;  3C0C A;  4M75 B;  4R56 A;  1XJW B;  1VQP T;  2QEX T;  2I0N A;  3JCM W;  1WXT A;  2DER A;  2PVO B;  4L59 A;  2ATC B;  2HQE A;  3CPW S;  4C92 A;  4D8K A;  1K9A A;  3M0S A;  1R77 A;  3I56 A;  3CEY A;  1ACM B;  3VU3 C;  3ZL7 C;  2YHT A;  2ZPH B;  3CXC A;  1M3A A;  1JQQ A;  3A8M B;  4XTU A;  3FRN A;  2HSE B;  1UJY A;  1ZSZ C;  2CKK A;  3PGG A;  4EMH A;  4ZN3 A;  3NFC A;  2KT8 A;  4B6M A;  5GAO p;  1ARK A;  2VGN A;  5KYU B;  4E7K A;  3S3N A;  1X01 A;  1Q81 R;  2CP2 A;  2X4Y A;  3BFM A;  1NG2 A;  1R8O B;  5KE2 A;  2P84 A;  2NUP B;  2Z0W A;  4BD3 A;  3NHN A;  2DNU A;  5LJ5 j;  1WJQ A;  2ZPF B;  2QA4 A;  2O9V A;  1VYU A;  1YJW Q;  4J7I A;  2LC4 A;  4PL6 A;  5KYX A;  1MGQ A;  2QTX A;  3QG1 A;  1U3O A;  2KRM A;  1VQN Q;  2V8I A;  3OYG A;  5GMK j;  2MAM A;  3CCV Q;  2OX7 A;  1B34 A;  3GIB A;  3OW2 A;  3EFO A;  5J3B A;  5GAN d;  2MK5 A;  5FLX E;  3CMA A;  6AT1 B;  3M54 A;  4OMP A;  2R57 A;  1QVP A;  3PNW C;  3NGP A;  3FC3 A;  3G71 Q;  2HQX A;  2GGR A;  2CP0 A;  4TVR A;  3OYA A;  2M51 A;  1OV3 A;  1GCQ C;  3CC2 Q;  2J6K A;  4HCK A;  2YUP A;  1W70 A;  1NPP A;  2H3E B;  3VS1 A;  4AT1 B;  1FXX A;  4J5Y A;  2K79 A;  4BY6 C;  1JBM A;  1I07 A;  3VRY A;  1XNI A;  2RA2 A;  1UGS B;  3RKY A;  3OA6 A;  3UWN A;  2CT4 A;  3TEE A;  1KSW A;  2O4X B;  4FYV B;  1IHW A;  1RL2 A;  3DLM A;  4JJD A;  2DD4 A;  4M77 B;  3CCL A;  1WXB A;  1DJ7 B;  2A08 A;  4KRT A;  1WJR A;  2M0O A;  3HSB A;  3RUX A;  1R0B G;  1V76 A;  2ZPE B;  2HKQ B;  5LJ5 d;  3CD6 T;  2BUD A;  4MDX A;  3CCQ Q;  1VUB A;  3SD4 A;  4J6W A;  5L23 A;  3EG3 A;  3I9Q A;  3M0P A;  4ME7 A;  2K7A A;  4MZT A;  5C6S A;  2K6D A;  1KHI A;  1QWE A;  3H0F A;  3CXC P;  3FB9 A;  3H0H A;  3RNJ A;  5CKF A;  2A37 A;  3L2V A;  4F16 A;  1NJI C;  4EIK A;  1KQS S;  3OB9 A;  4E7I A;  3P8H A;  4RTV A;  3CBO A;  3M9Q A;  2MIO A;  2L3S A;  5FU6 B;  1LJO A;  2QQB A;  3JB9 I;  3GP8 A;  1QCN A;  2C0I A;  3TSZ A;  2E5K A;  1X27 A;  1YP5 A;  1OOT A;  3MHX A;  4F7U G;  2P0P A;  3DLL A;  4BE1 A;  3BW1 A;  3MP6 A;  3OYF A;  1LPL A;  3OYI A;  2HBP A;  2KRO A;  1WHJ A;  2RI2 A;  2JJ9 A;  5LJ3 f;  4JJB A;  3EFS A;  5CAI A;  3CCS A;  4PJO D;  3H41 A;  1FMV A;  1PRM C;  1U06 A;  2LVM A;  4B9W A;  1UGP B;  2L3Q A;  1VQN A;  3KUF A;  4PJO C;  4M7A A;  2K57 A;  4GY5 A;  3OBW A;  1VQO T;  3OYH A;  2EKH A;  3JCM d;  3EHR A;  4M7A G;  4MDW A;  1TUG B;  3GOX A;  2DL8 A;  2A36 A;  1M2V B;  4R0K A;  1NJI U;  2K2M A;  3T9N A;  2YLB A;  1JXO A;  1VQ5 A;  4C5G A;  3OYC A;  2FZK B;  3FIF A;  2K5I A;  1KJW A;  4WCI A;  4IUT A;  4C0D C;  2E1H A;  2DEQ A;  5GAM g;  1ZUK A;  1WZO A;  2H3J A;  2LMJ A;  1E6G A;  5FU7 B;  1WHK A;  3BDU A;  2ROL A;  5KYY B;  3CCQ T;  4FYY B;  2ZZD A;  4LDU A;  2JZ2 A;  3GPL A;  3G4S Q;  2CZ1 B;  2K3Y A;  2LCS A;  3PVL A;  3JCM b;  2E3H A;  4P5N A;  1VQ5 Q;  3OY9 A;  4J9H A;  5CKD A;  1M1K U;  4N4G A;  2HNI A;  3TQ7 P;  3LWI A;  3HRT A;  2HL3 A;  1UG1 A;  2PU9 B;  3L2Q A;  1CKB A;  1LOJ A;  4PLL A;  5LJ3 h;  1N9S A;  3OYB A;  2YXY A;  4BUG A;  1SF9 A;  5CKE A;  2CSI A;  1XQH A;  3UA6 A;  1MMA A;  2AZS A;  2LJ3 A;  3AHU A;  1HXD A;  5GMK i;  4XK8 E;  1N8R R;  3H9N A;  2BIV A;  4HVV A;  2DIL A;  4N4I A;  4B9X A;  2LNV A;  4XU0 A;  5GAM f;  1D1B A;  5GAN 8;  4C92 F;  3LYI A;  1WHG A;  2K3X A;  5KH6 A;  4A4F A;  3CCE Q;  2KT1 A;  4FT4 A;  4HCZ A;  1OU9 A;  4RTW A;  5CO7 A;  1M1F A;  5A0G A;  1I1J A;  5CQX A;  1WJS A;  2JMC A;  2L3R A;  4J9G A;  1S72 T;  4J6Y A;  1MV0 B;  4MMK A;  1QCF A;  2FG0 A;  5IHK A;  5FU7 C;  3QJ6 A;  1Q81 U;  4RTX A;  4M7A E;  1M30 A;  2DET A;  3QXE B;  1VA7 A;  2GQV A;  3BE3 A;  2QQ9 A;  3SDZ A;  1U5S A;  4M77 E;  2H8H A;  4OVA A;  1R0C B;  4OB1 B;  3CC4 A;  4X9C A;  5KE3 A;  2D1X A;  1JJ2 S;  5I21 A;  4M7A D;  5IT9 E;  1NEB A;  2BZ8 A;  2HQH A;  1VQ4 Q;  2EJ9 A;  1ZSZ A;  3PVQ A;  2A7Y A;  3CPW A;  3BDL A;  2VWF A;  2RK2 A;  2NYS A;  3URG A;  4GLM A;  4RKU E;  1WXU A;  5LJ3 j;  3ZBD A;  3X20 B;  3PMT A;  3I56 T;  1YJN Q;  2RPN A;  4PJM A;  4M7A C;  4JJC A;  4F17 A;  2EW3 A;  1UFF A;  2DTH A;  2KRS A;  3OYK A;  1W2B A;  4ZGE B;  3MET A;  4RTT A;  5A2Q E;  1NEG A;  3M0T A;  1D0X A;  2AKK A;  3V7C A;  3GNF B;  2EJF A;  3MP1 A;  3CPF A;  2RJD A;  4AMC A;  2KDS A;  4JRI A;  3VS6 A;  2HAX A;  1H8K A;  1JEG A;  2DRK A;  3M59 A;  1SRM A;  2W0Z A;  4EMK A;  5GAO l;  4IUQ A;  1YHQ T;  1TWB A;  1YWP A;  1M8V A;  3VV0 A;  1H3H A;  1Q81 C;  2F5T X;  2PUO B;  2EQU A;  2CP5 A;  2HL5 C;  3EFO B;  4IUU A;  4DA4 A;  1LNX A;  1XTD A;  4LNP A;  5DM7 R;  2OTJ A;  3G71 T;  1UGV A;  5GAN 4;  3CCE T;  4N4H A;  1KC8 R;  3O8V A;  5KYX B;  4C5H A;  3I55 T;  3SB2 A;  1LVK A;  1BI2 A;  4EMK B;  1M9S A;  2IG0 A;  1UGR B;  3CMA Q;  4C8Q E;  2DXC A;  5EC7 A;  1FWZ A;  1X2Q A;  4BI4 A;  2F2V A;  3G6E A;  1Q86 C;  1WDX A;  3GBQ A;  1ZSG A;  2RQW A;  4PJO E;  2E41 A;  1JXM A;  4DBH A;  5D6W A;  2EKO A;  1AD5 A;  1Z9Z A;  3ME9 A;  2YWW A;  3CCL T;  3OW2 S;  2CDT A;  5CCA A;  3MO8 A;  2EQJ A;  4HVW A;  4OGC A;  2CT3 A;  2NUP A;  3SWN A;  3CBP A;  1UDL A;  2LT4 A;  4F7U B;  2D6F A;  1X6B A;  5KYU A;  4C92 B;  1WNL A;  4O5V A;  1H64 1;  1YNZ A;  3L2W A;  2SEM A;  4Z8A A;  2LQ8 A;  2NUZ A;  1OYX A;  3CCM T;  2DX1 A;  2E6Z A;  3LH0 A;  1JU5 C;  1K1Z A;  2ECZ A;  2F69 A;  4KH0 B;  3CCM Q;  2KYM A;  3VS5 A;  1OI1 A;  4F7U F;  2FEI A;  2ZGW A;  3AT1 B;  2EAY A;  3SHW A;  2RN8 A;  5GAO q;  3PE0 A;  4M77 D;  3V8L A;  1ZBJ A;  1SHG A;  4M75 A;  5LJ3 e;  3KXT A;  1Y96 B;  2RQR A;  2YSQ A;  1PHT A;  2ED0 A;  1W2B P;  1PWT A;  2DTI A;  2QQS A;  3LH5 A;  4C8Q F;  2DYB A;  4M75 D;  1D1C A;  4XAX B;  2J6F A;  3MKD A;  5GAN e;  1RAG B;  4ZGD B;  2F2X A;  5HY6 A;  3KFV A;  4X1V A;  1ZQ1 A;  2V1Q A;  4M7D C;  4J9B A;  2CH4 A;  1KC8 C;  2NUT B;  2HBW A;  4ESR A;  2CSQ A;  2B86 A;  2DE0 X;  1NJI R;  3RBB B;  3QUI A;  2ZPG B;  3OSS C;  3FJP A;  4QW2 A;  1Y7X A;  4WF2 A;  1WI7 A;  1K73 C;  2RJE A;  1YIJ Q;  3JB9 H;  3SFM A;  2DZ9 A;  4AG1 C;  2K5F A;  4C92 D;  5IHN A;  3CCR Q;  5CK9 A;  4XTV A;  4JRQ A;  3M0Q A;  2CP3 A;  2FO0 A;  1B34 B;  1VQL A;  1UJ0 A;  3DB4 A;  5LL6 S;  2VXF A;  1BI3 A;  1K9M C;  3CC7 Q;  1VQN T;  2GCX A;  2RI5 A;  2MYS A;  1UHF A;  3LWH A;  4C92 E;  1PNJ A;  3QSU A;  4X9D A;  1RAC B;  1B3Q A;  3L2U A;  1Y07 A; 
#chains in the Genus database with same CATH homology
 3Q1J A;  4J6W A;  1H3Z A;  3J80 E;  1O75 A;  3RMQ A;  5GAN j;  4ME7 A;  3QHS A;  4Y91 A;  2GFU A;  1N6A A;  4F7U E;  2R58 A;  4MZT A;  2OTJ T;  5C6S A;  1QP2 A;  4A4H A;  4XTX A;  1KHI A;  3HRS A;  4M77 G;  5I2S A;  2MI6 A;  3C4S A;  3CXC S;  3FB9 A;  3RKW A;  3QII A;  2MMP A;  5GAN 7;  5CVI A;  4A54 A;  5CKF A;  5FU6 C;  3L2V A;  1JJ2 A;  3J7A F;  2P0Q A;  2PVD B;  2E70 A;  2O01 E;  2IVW A;  1NJI C;  1PSF A;  3X26 B;  3MEA A;  4JS4 A;  4RG8 A;  2RJC A;  3VYH B;  1U1T A;  3FEO A;  1KQS S;  3OB9 A;  3QJY A;  2DD5 A;  4E7I A;  2D9T A;  1IZ6 A;  3P8H A;  4ZGJ B;  5M9O A;  4V2S A;  3CBO A;  3CCU T;  2X4X A;  3M9Q A;  1X75 C;  1VQ6 T;  2G3R A;  5FU6 B;  1YI2 A;  4XQ3 A;  3NTI A;  1LJO A;  2QQB A;  2LX9 A;  4PKC C;  2DIQ A;  3A8L B;  3VUB A;  3JB9 I;  3GP8 A;  2P0K A;  4BDY A;  2EFI A;  3HFO A;  5GAM h;  2JOY A;  4QVC A;  3MEU A;  1UEB A;  3SD4 A;  2QI2 A;  3MHX A;  4N0A A;  4F7U G;  4JRP A;  4M78 C;  2JUF A;  3RIR A;  4DQ2 A;  5C0M A;  4E7J A;  2P0P A;  2DPP B;  3BY7 A;  3DLL A;  2EYQ A;  4BE1 A;  1QVG A;  1P92 A;  3BW1 A;  3MP6 A;  5DLQ E;  3OYF A;  5FRO A;  3OYI A;  5GAM e;  1KHC A;  2HBP A;  4Y28 E;  3JCM X;  2RI2 A;  3LX7 A;  3HKS A;  3MCA B;  4RCC A;  3OMC A;  3JCM P;  1NPR A;  1VQ4 T;  1VQ7 T;  2RK1 A;  1VQO A;  5LJ3 f;  3EFS A;  4FM4 B;  5CAI A;  2EQM A;  2JTF A;  2O4X A;  4FSX A;  3ZEH A;  3X24 B;  5GAO r;  3CCS A;  1NZ9 A;  3JB9 G;  4PJO D;  4M78 E;  4M77 A;  5GMK l;  1BIA A;  2RO0 A;  4O6J A;  4ZTF A;  4M7A B;  2K5L A;  2LVM A;  4B9W A;  4PJO G;  1VIF A;  1UGP B;  2VV5 A;  3OMG A;  4EMK C;  5CIU A;  4L6V 5;  1VQN A;  3KUF A;  4PJO C;  3LGL A;  4M7A A;  3INZ A;  4BB7 A;  1I4K 1;  1YIJ T;  2K57 A;  2XDB A;  1Y71 A;  4Q5W A;  5LJ5 e;  4GY5 A;  1I5L A;  4LDV A;  3OBW A;  1VQO T;  3OYH A;  4DOW A;  4HT9 A;  4E47 A;  3E9F A;  1ZHI A;  4A53 A;  4C0G A;  2VXE A;  2RJF A;  2VC8 A;  3JCM d;  2RH2 A;  1UB4 A;  4M78 D;  4XTZ A;  2DKG A;  4M7A G;  3UT1 A;  1M4Z A;  4MDW A;  1BI1 A;  2ZPI B;  1YJN T;  4RMO A;  3GOX A;  4NS5 A;  2JVV A;  4FT2 A;  1Q7Y U;  2KY9 A;  2CZ0 B;  2KMT A;  4JS5 A;  3QDR B;  1NJI U;  4M7D G;  2ZCF B;  3T9N A;  2XG8 D;  2YLB A;  4JDS A;  3CCV T;  5D6Y A;  3JCM e;  1VQ5 A;  1WGS A;  4C5G A;  3CD6 A;  4JLG A;  4MZM A;  1U1S A;  3OYC A;  1KD1 C;  4QQG A;  3FIF A;  2K5I A;  1VQ8 A;  2M9U A;  4C92 G;  4BE0 A;  2M1H A;  2LQK A;  1D3B B;  1HK9 A;  4IUT A;  4NL2 A;  1X6O A;  2E1H A;  4C0D C;  2AHJ B;  3HP9 A;  4QVD A;  4M7D A;  2DEQ A;  5GAM g;  5GAN 5;  1KD1 U;  2H3J A;  3OS0 A;  3MEV A;  3C94 A;  5FU7 B;  3BDU A;  1K73 U;  3WVD B;  2XD0 A;  4CI0 C;  3JB9 F;  3CCQ T;  1K8A C;  4HCC A;  3RMS A;  4E7H A;  2QDY B;  2FB7 A;  4IUV A;  4LDX A;  1BIB A;  4M7D B;  2ZZD A;  3JCM f;  4C8Q C;  4LDU A;  2JZ2 A;  3GPL A;  2OTL A;  3CMA T;  1K8A U;  4C8Q A;  2VGM A;  4CRI A;  2CZ1 B;  2DO3 A;  3VUZ A;  3RKX A;  2K3Y A;  1G3T A;  3JCM b;  3PT9 A;  2E64 A;  4P5N A;  4F7U A;  4LD6 A;  3OY9 A;  4L5G A;  5DLO A;  2EIF A;  5GMK h;  2CGH A;  5CKD A;  1M1K U;  1VQK T;  5KCO A;  2WSF E;  4N4G A;  4KUD K;  2HNI A;  4FIB A;  3RER A;  3LWI A;  3HRT A;  3QZ5 B;  3A8G B;  3M56 A;  3SWN C;  5GAN h;  5EG2 A;  2WSE E;  2PU9 B;  3OBY A;  3L2Q A;  1VQ9 A;  1QVF A;  4C0F A;  4C92 C;  1LOJ A;  1RI0 A;  1M1G A;  4IUP A;  4PLL A;  5J26 A;  1I81 A;  2DVE A;  1N9S A;  2XKO C;  5LJ3 h;  3TCJ A;  3OYB A;  2I2L A;  4PJO B;  4BY6 B;  3ASK A;  4BUG A;  5CKE A;  2X4J A;  3GNG A;  1XQH A;  3MEW A;  4JRK A;  4UC4 A;  1Q86 U;  4M77 F;  3G7Z A;  1YIJ A;  3OS2 A;  1YCY A;  1AHJ B;  2A3L A;  3AHU A;  1HXD A;  3V7S A;  2XDP A;  3OYE A;  3JCM g;  3G6E T;  5GMK i;  3CCU A;  4XK8 E;  1N8R C;  2DTO A;  1MHN A;  3FLG A;  3UDC A;  4QQ6 A;  2L5Q A;  3QYG B;  3L2R A;  4GLK A;  2BIV A;  2LT1 A;  4J6X A;  4XU3 A;  2KSS A;  4N4I A;  4HA8 A;  3HPW A;  4B9X A;  3CME T;  2LNV A;  5AYF A;  3CC2 A;  4XU0 A;  2GFA A;  5GAM f;  2FYK A;  2MWP A;  1VQL T;  3M5A A;  2XK0 A;  3M55 A;  4FU6 A;  5LJ3 d;  1FX7 A;  4C92 F;  5GAN 8;  5FRM A;  4PJO A;  3LYI A;  3C95 A;  4D6W A;  3M57 A;  5GAO m;  2K3X A;  2JNG A;  1YIT A;  5KH6 A;  2QA4 T;  2CYZ B;  4A4F A;  5GAN 3;  2R5M A;  4FT4 A;  4HCZ A;  5CO7 A;  4HCB A;  1M1F A;  3QBY A;  5A0G A;  3CC4 T;  3CCR A;  4E7L A;  4M7D D;  5CQX A;  4M7D F;  2LDM A;  1WJS A;  1KQ2 A;  2L3R A;  4PJO F;  3A5Z B;  5HK3 A;  4BE2 A;  1S72 T;  1S72 A;  4JLI A;  4J6Y A;  3E9G A;  4M75 C;  4MMK A;  2JTM A;  3WXM B;  3S3M A;  3DKM A;  5FU7 C;  3QJ6 A;  1Q81 U;  1UGQ B;  3L2Z A;  3V8J A;  2DXU A;  5DY9 A;  1VQM A;  3JCM V;  4M7A E;  3OYJ A;  2RHU A;  3QXE B;  5I2M A;  5IAY A;  2GQV A;  4M7D E;  3EAE A;  3S3O A;  3SDZ A;  2QQ9 A;  2E65 A;  2LTO A;  1Q82 U;  3CBM A;  4M77 E;  4M78 A;  3HFN A;  1WQ7 A;  4M75 F;  4OVA A;  4OB1 B;  3CCR T;  3CC4 A;  1BI0 A;  3LGF A;  4X9C A;  3E19 A;  5KE3 A;  4M77 C;  3JB9 J;  1JJ2 S;  3NTH A;  2MF2 A;  1Q82 C;  5I21 A;  4M7A F;  2Y90 A;  1K9M U;  4M7A D;  1KG1 A;  1N9R A;  2CS7 A;  3X25 B;  4FL6 A;  3CCJ T;  3VJP A;  5IT9 E;  3M4Y A;  5D6X A;  1NE8 A;  3JCM c;  2EJ9 A;  2RHZ A;  5L8R E;  3UPU A;  1QW1 A;  2EQK A;  3CCM A;  2XI9 A;  4OF1 A;  3ZFJ A;  2A7Y A;  5CR2 A;  2VYT A;  2ZPB B;  5A0D A;  3CPW A;  4OB2 B;  2EWN A;  2PUK B;  2OTL T;  1W2B S;  3BDL A;  2M16 A;  2RK2 A;  3M53 A;  3PIP A;  3URG A;  2X35 A;  2XHC A;  4RKU E;  5LJ3 j;  4EMG A;  2K4Y A;  4YTL A;  2WAC A;  3X20 B;  3ZBD A;  1N27 A;  2B8A A;  2OAU A;  3PMT A;  3VKI A;  4R55 A;  2RB6 A;  3OYY A;  1N8R U;  5CKH A;  1KQS A;  3I56 T;  3A8O B;  3OYL A;  1KC8 U;  3G4S A;  2RI3 A;  3GF5 A;  3CCS T;  4M7A C;  2YLC A;  2E10 A;  2V8K A;  4A4K A;  1I8F A;  4C8Q G;  3QKJ A;  3ER0 A;  5LJ5 g;  5GAM j;  2F5K A;  4MML A;  3CC7 T;  2DTH A;  1D3B A;  1YJW T;  3MP8 A;  3OYK A;  2CZ7 B;  3G71 A;  1W2B A;  4ZGE B;  1VQ7 A;  3H6Z A;  2LCL A;  1KQ1 A;  4M78 F;  3MET A;  3NTK A;  3OS5 A;  3CCE A;  4MZP A;  5A2Q E;  2EJG A;  4IKF A;  3L1A A;  3VYG A;  4JJN K;  3V8K A;  4A4E A;  4C5I A;  4BDZ A;  3V7C A;  4DOV A;  4M78 B;  2JN0 A;  4ATO A;  2YRV A;  3GNF B;  2QQA A;  2KAF A;  2EJF A;  2P4T A;  3MP1 A;  1M90 U;  2DZC A;  2RJD A;  3CPF A;  2E6N A;  3PFS A;  2KQW A;  2FVU A;  2KDS A;  2Y4Y A;  2K2V A;  2VUB A;  2L89 A;  4JRI A;  2HAX A;  2DK3 A;  3M59 A;  2C06 A;  4EMK A;  4NL3 A;  5GAO l;  4IUQ A;  1YHQ T;  3F70 A;  1YHQ A;  1M8V A;  3VV0 A;  2RHY A;  3TRE A;  5GAM d;  1M90 C;  1VQ6 A;  1G5V A;  4ELZ C;  4XTW A;  3LW5 E;  1OZ3 A;  3QPH A;  4ZTJ A;  4BI3 A;  1Q81 C;  1EIF A;  2F5T X;  1BKB A;  2EQU A;  1OZ2 A;  2MWO A;  2PUO B;  4N0A C;  4IUU A;  4DA4 A;  1PSE A;  1LNX A;  1XTD A;  1ZBX A;  3DB3 A;  4BAC A;  4M75 G;  5DM7 R;  3OYD A;  2OTJ A;  2D0Q B;  3G71 T;  4VUB A;  3OYN A;  3JB9 D;  1G3Y A;  5GAN 4;  3CCE T;  4N4H A;  3CCV A;  5LJ5 f;  3O8V A;  3S6W A;  5GAO n;  4M75 E;  3CC2 T;  3JCM h;  4C5H A;  1VQ8 T;  3I55 T;  4QQD A;  3SB2 A;  1BI2 A;  4EMK B;  1M9S A;  2IG0 A;  1UGR B;  1V29 B;  2FL7 A;  2HD0 A;  3EFR A;  2DXC A;  4XU2 A;  1O9S A;  2L8D A;  4C8Q E;  2V8J A;  5GAN 6;  1FWZ A;  4BI4 A;  4OB0 B;  3M4G A;  3G6E A;  1Q86 C;  4C0D B;  2NLU A;  1QVG S;  2CZ6 B;  3X28 B;  1G3S A;  4XTY A;  4PJO E;  3HHT B;  2E41 A;  4OMF B;  5GAN f;  5D6W A;  2EKO A;  3H8Z A;  4M75 B;  4R56 A;  3ME9 A;  4Z02 A;  1VQP T;  2QEX T;  3CCL T;  1WQW A;  3JCM W;  3OW2 S;  3I55 A;  1GXI E;  5CCA A;  2Y4X A;  2PVO B;  3P8B B;  4L59 A;  3QZ9 B;  2DXT A;  2HQE A;  3CPW S;  5GMK m;  5GAN 2;  1YJ9 A;  3QO3 A;  3MO8 A;  2LCC A;  4C92 A;  1YJ9 T;  4OB3 B;  2FHD A;  2EQJ A;  2RD1 A;  4OGC A;  3I56 A;  3CEY A;  1W4S A;  3SWN A;  3VU3 C;  2YHT A;  4KUL A;  4RCB A;  4A4G A;  3CBP A;  2XU8 A;  2LT4 A;  4F7U B;  5LJ5 h;  2D6F A;  2ZPH B;  3CXC A;  4C92 B;  5KCH A;  4JUV A;  1WNL A;  2KK4 A;  3A8M B;  4XTU A;  3FRN A;  4ELY C;  4O5V A;  3OYM A;  1YJN A;  1H64 1;  2CKK A;  3SWN B;  3L2W A;  4BI8 B;  3PGG A;  3FDR A;  4C8Q D;  4EMH A;  4ZN3 A;  3NFC A;  5A0L A;  2LQ8 A;  5GAO p;  1OYX A;  3CCM T;  2VGN A;  2E6Z A;  4E7K A;  1Q7Y C;  3S3N A;  2BKD N;  1X01 A;  2QXF A;  3LH0 A;  3OSV A;  3V7R A;  2DAQ A;  3JSC A;  3G4S T;  2X4Y A;  3BFM A;  2F69 A;  4IUR A;  2PVG B;  1R8O B;  1M1K C;  4PNO A;  1IRE B;  5KE2 A;  2QQR A;  4BD3 A;  3LLR A;  5LJ5 j;  1WJQ A;  1OI1 A;  2RHX A;  2ZPF B;  4J83 A;  4F7U F;  2QA4 A;  2ZGW A;  5HKC A;  2EAY A;  5FRN A;  2XIC A;  3JAM E;  5GAO q;  1TH7 A;  4J7F A;  1VQK A;  4M77 D;  3V8L A;  4EPC A;  3JCM J;  4J7I A;  3RES A;  3CME A;  4KT0 E;  1G3W A;  2E5Q A;  2LC4 A;  4PL6 A;  4M75 A;  1MGQ A;  5IN1 A;  1Y96 B;  2QTX A;  3P8D A;  4KBM B;  5LJ3 e;  3KXT A;  3QG1 A;  4NOY A;  2PQW A;  5CKB A;  1VQM T;  4KUI A;  5GMK e;  2DXB A;  1YI2 T;  3QYH B;  2WSC E;  2V8I A;  3OYG A;  2DTI A;  4II1 A;  5GMK j;  5LJ3 g;  2QQS A;  2MAM A;  4QVZ A;  4C8Q F;  3CCQ A;  1B34 A;  3GIB A;  4M75 D;  3OQ5 A;  4C0Z A;  3OW2 A;  4XAX B;  5GAN e;  3L42 A;  5J3B A;  4ZGD B;  4ZN1 A;  5GAN d;  5GAN g;  2RM4 A;  5HY6 A;  1M5Q 1;  4C5E A;  5FLX E;  3CMA A;  1ZQ1 A;  4M7D C;  3R6O A;  2RHI A;  3N5B B;  3M54 A;  5HK0 A;  3JRZ A;  3CC7 A;  1YJW A;  2R57 A;  1QVP A;  2DIG A;  4OP0 A;  1KC8 C;  3PNW C;  1SSF A;  3TU4 K;  1VQ4 A;  1QP3 A;  4J8O A;  2DJZ A;  4RG2 A;  3FC3 A;  3C12 A;  2HQX A;  3OS1 A;  4TVR A;  4LDW A;  3OYA A;  4OGE A;  3QUI A;  4M78 G;  5J39 A;  2ZPG B;  1JB0 E;  3OSS C;  4X34 A;  3E1S A;  2E12 A;  2X4W A;  3GLX A;  3FJP A;  1VQ5 T;  1NPP A;  4QW2 A;  3WVE B;  1Y7X A;  1FXX A;  1YBY A;  3KBG A;  4WF2 A;  4J5Y A;  3PIO A;  1JRI A;  1BYM A;  4C8Q B;  4BY6 C;  2RJE A;  1JBM A;  1K73 C;  2KVQ G;  3JB9 H;  3SFM A;  3CCJ A;  2DZ9 A;  1XNI A;  1VQP A;  4HT8 A;  2K5F A;  4LD9 K;  1VQ9 T;  2RA2 A;  1UGS B;  3RKY A;  3OA6 A;  4MDX A;  1U8R A;  3UWN A;  1Y96 A;  5CQY A;  4C92 D;  1VIE A;  3TEE A;  3HRU A;  5CK9 A;  4XTV A;  2O4X B;  3JCM Q;  4JRQ A;  3HL8 A;  1YIT T;  1B34 B;  1VQL A;  3PMI A;  1RL2 A;  3DB4 A;  3DLM A;  2VXF A;  5LL6 S;  4EDU A;  3PTA A;  1BI3 A;  3M58 A;  1K9M C;  1VQN T;  2GF7 A;  2DD4 A;  4M77 B;  2GCX A;  2XDD A;  2QEX A;  2RI5 A;  3CCL A;  1DJ7 B;  1XOV A;  1WJR A;  2M0O A;  3HSB A;  3A8H B;  4XU1 A;  3J81 E;  3LWH A;  2XID A;  2LRQ A;  3RUX A;  4C92 E;  1QVF S;  2ZPE B;  3QSU A;  5LJ5 d;  3CD6 T;  4X9D A;  2R5A A;  4HKE A;  2BUD A;  1WPY A;  4LDY A;  3L2U A;  1Y07 A;  1VUB A;  4PLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...