4EMKA

Crystal structure of splsm5/6/7
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
LPLELIDKCIGSNLWVIMKSEREFAGTLVGFDDYVNIVLKDVTEYDTVTGVTEKHSEMLLNGNGMCMLIPGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Lsm3, Lsm4 and Lsm5/6/7 from Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm5
total genus 14
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4emkA00
3V8JA 5LJ5g 4A54A 4M7AE 3VU3C 1JBMA 2CGHA 2EJ9A 4C92C 5GANh 3HFOA 2VC8A 5GAMd 2QTXA 5GAN5 3QUIA 4C8QB 1WPYA 3JB9G 4WF2A 1HXDA 4OP0A 4XQ3A 1N9SA 2DXUA 3V7CA 2VXEA 4M78A 4C8QD 5GANj 5LJ5d 3JCMQ 4J6WA 4M7AG 2RD1A 4HT9A 3BY7A 4M75F 3JCMf 4XTVA 4NL3A 3FIFA 1I5LA 4M7AC 1Y96A 4RCBA 4M77F 4A53A 5GAMg 4XTZA 2HNIA 3JCMX 4N0AA 5DY9A 3JCMJ 4J5YA 3JCMW 4PNOA 1U1TA 1BIAA 2YHTA 3L1AA 4F7UE 3QHSA 4HT8A 2E41A 2ZGWA 4C92F 1B34A 3GIBA 3RUXA 2VXFA 4J6XA 5GAOl 4C92E 4M78E 3RERA 5GMKm 3JB9F 5GAOr 4M78D 4C8QA 5GAN6 1HK9A 2EJFA 2EJGA 1N9RA 3SWNA 1WQ7A 4F7UF 4NL2A 2E1HA 2RM4A 1LOJA 4M78G 2RA2A 4XTUA 4EMKC 4QVDA 5LJ3g 5LJ5j 5GAOm 4M7AF 2E65A 4M77B 3V7SA 5LJ3h 1YCYA 5LJ3f 4MMLA 4C92A 4M7DB 1H641 4M77G 1D3BA 4EMKB 4C92G 5GANf 5LJ3d 3JCMd 2Y90A 3M4GA 4M75E 5GAMe 2DTOA 4PJOA 4C92D 5GMKj 4XU2A 3INZA 4F7UB 4XU1A 2E10A 5GAN7 3JB9I 4JRKA 5LJ3e 5LJ5f 4F7UG 4Y91A 3V7RA 4C8QG 1JRIA 3V8KA 4C8QC 2DVEA 3JCMc 2FB7A 5GAN8 4M75A 2DXTA 5GANd 4M7AD 3FB9A 1KQ2A 4M77D 3SWNB 4DQ2A 4HA8A 1D3BB 4EMKA 4XU0A 4M78F 4M7DA 3JCMe 1U1SA 3JB9D 4M77A 3RKWA 3BDUA 4PJOC 3BFMA 2I2LA 4PJOD 5GMKh 3JCMV 3EFRA 4XTXA 5GMKi 1I4K1 1LJOA 4J6YA 2EWNA 2DTHA 3RKXA 1I81A 1X01A 4XTYA 5CAIA 4M7AA 3JCMh 5GAMh 4NOYA 2YLBA 5GANg 5LJ3j 5GAOn 4M75D 5GAN4 1B34B 5GAMf 4M7AB 2K57A 1MGQA 2YLCA 4RCCA 4C8QF 1I8FA 4QVCA 5GMKe 1TH7A 4JLIA 3HSBA 3RKYA 4M7DC 4PJOE 5GMKl 3BW1A 5LJ5e 2DTIA 3PGGA 5GAOp 4EMHA 4M78B 2DZCA 1WNLA 3EFSA 3JB9J 3SB2A 2RB6A 4JRIA 3HFNA 3V8LA 5GAN3 3JCMg 4M78C 4M77E 1KQ1A 1Y96B 4M7DG 2DZ9A 5GAMj 3JCMP 1M5Q1 4M7DE 4PJOF 2DEQA 5LJ5h 1M8VA 3RESA 4N0AC 4C8QE 2EAYA 1WQWA 3L2ZA 4M75B 5GAN2 5I21A 4X9CA 2E64A 3JCMb 1BIBA 4MMKA 4XTWA 4M75G 3AHUA 4M75C 3JB9H 2DKGA 4XU3A 4F7UA 4M77C 4M7DD 2DJZA 4PJOB 5GANe 2JN0A 1LNXA 4EMGA 3FJPA 5GAOq 3QSUA 3RIRA 4X9DA 4JUVA 4M7DF 2FYKA 4V2SA 4PJOG 3SWNC 3QO3A 4C92B
chains in the Genus database with same CATH superfamily
3A8GB 1M1KR 3VRZA 1JBMA 4E7HA 1VQ9Q 3H9NA 4D8KA 4QQ6A 1SPKA 4OP0A 1N9SA 5IHIA 2R58A 1WJRA 1Q86U 1YCSB 3CCRT 2GTJA 3RDVA 3CCQQ 4XTZA 3EGDB 2DIGA 4KGXB 5DY9A 4BI8B 2DL3A 3URGA 1JJ2P 2MWOA 2K5LA 2A28A 2PUKB 4C92F 5GJVB 4AMCA 3CPWA 1D0ZA 3PE0A 2X4WA 2K79A 4C92E 3RERA 5GMKm 4J9IA 1OYXA 3RR6A 4JDSA 4NL2A 2QEXT 1ZX6A 2KAFA 2CKKA 4M7AF 2DIQA 3H6ZA 3M54A 1YFNA 1H641 1D3BA 1RUWA 2RJFA 5GAMe 2BTTA 2WSEE 5FU7C 4CC7A 1WI7A 2COWA 1ZLMA 2XDDA 3CCJT 1X69A 1FMVA 1FXXA 1VYVA 4F14A 3CMET 2JZ2A 1AOJA 3I35A 2RQUA 3CPWP 1W6XA 3OS0A 3G71T 1VQNQ 1K4US 2XG8D 3M0TA 5GMKh 1QKXA 4BDZA 1VQKA 3C4SA 5KE3A 1AWOA 5GAOn 1VQ7A 3CBOA 4EMHA 1YITQ 4PJMA 3G4SA 2FPEA 3CC2A 2XD0A 2GFUA 2LNVA 3CCEA 2YWWA 1M5Q1 2KRNA 3CCMQ 5KE2A 1T3LA 2YRDA 4IUPA 7AT1B 1OZ2A 2DL7A 4NS5A 2PZ1A 2COZA 3O8VA 2MOXA 4M75C 2J06A 4M77C 3CCJA 5KCHA 3QBYA 4PJOB 3ZEHA 2JN0A 2EIFA 4FM4B 1I1JA 1GXIE 1R0BG 1YJNQ 3OSSC 1IGQA 5HCKA 4FYVB 2QQBA 3JB9G 5L23A 3QZ5B 3LX7A 2FZCB 1EX4A 3S3OA 4GY5A 4XTVA 4QT7A 4J5YA 2F2VA 2AKKA 1U1TA 1WYXA 2YHTA 4ORZA 1YWPA 3AT1B 4RTVA 2VVKA 2IVWA 3PT9A 3S6WA 3EH1A 3M0QA 1YNZA 2CH4W 2E3HA 4XK8E 3TU4K 2EQIA 2RHZA 2KY9A 1WQ7A 4ZTFA 4M78G 1ARKA 5GAOm 1Y57A 2O9SA 3L2WA 2QXFA 4C92A 2KQWA 5I11A 1YHQQ 4FT4A 3JB9I 5DLQE 3UT1A 2K9GA 2L8DA 4E6RA 1QQJA 2FPDA 3OYAA 2CP2A 2C0OA 1KC8C 5KYUA 2OX7A 3EG9A 2CSIA 3MEUA 3WXMB 2GCXA 1Z9ZA 1C6VX 4HKEA 1Q7YC 4KH1B 3VS3A 1QCFA 2QK0A 1LPLA 1KD1U 1IRXA 1UHFA 3BW1A 2DTIA 5CQXA 1BKBA 5KYXB 4LD9K 1QVFP 2RB6A 3HFNA 2YDLA 1CKBA 1KQ1A 1Y96B 2JS2A 2M0OA 2EAYA 2DF6A 1D0YA 1PCXA 3A8OB 2HL5C 2LX7A 1VQLT 4L59A 3CCVQ 4XU3A 1Q82C 4M7DD 1HYOA 4J8OA 3FJPA 3RIRA 1RAEB 1RAFB 2CP6A 2L2PA 4PJOG 3OYNA 3VS7A 3HTRA 1VQLA 1K76A 5FWBA 2CGHA 2HEQA 4VUBA 3CCUA 4C92C 4C5HA 3QUIA 4QQGA 4XQ3A 1ZSZA 4A4KA 1PKSA 3CCUQ 4M7AG 4J6WA 2ROTA 2XICA 3CC4A 2XMFA 5HK3A 3E19A 1VQ6Q 2A36A 1X6GA 3CCST 3EHRA 5EG2A 1MNDA 2CUBA 1ZUUA 1YP5A 2KYBA 2V8IA 4MZPA 4QQDA 1CKAA 3I56T 1ZA2B 1KJWA 3H0IA 4M77B 4DBHA 5DM7R 1A0NB 1ABOA 1M90C 3M59A 2Y4XA 3RMSA 4M7DB 3JCMd 2O9VA 1GCQC 1QKWA 3M4GA 1VA7A 1R8OB 5I2SA 2KEAA 2EKOA 4Z89A 1UGQB 2BZ8A 5GANd 3OMGA 3QDRB 4OMFB 2X51A 4JJCA 3E1SA 4IUVA 4M78F 4DBRA 3VRYA 4PJOD 4FW2A 5D6WA 2EQJA 1YJWQ 1G83A 1VQKT 2EWNA 3HL8A 3A8MB 1JJ2S 4Z8AA 3PVLA 1VQOA 1NJIR 1NM7A 4KGZB 3CEYA 2KRMA 2V8KA 3UWNA 3EG0A 4LDVA 4M78C 3CCSA 1YI2T 2K3XA 2VB6A 2VKNA 1M8VA 3REAB 5LJ5h 2RPNA 5CR2A 1MMAA 3CC4T 5CKBA 3QDFA 4F7UA 3REBB 4EMGA 2QEXA 1WHJA 4K11A 1RI9A 4F16A 3SEMA 2KK4A 3GNGA 2QAZA 3PMIA 2RI3A 1Q86C 5KYWB 8ATCB 4E47A 1M1KC 3NHNA 2RD1A 1OOTA 2DPPB 4ZN3A 4M77F 2AHJB 3M5AA 3A98A 2DERA 2GBQA 1I5OB 2SEMA 3LW5E 3QHSA 3S3MA 4JPBW 3G7ZA 2VXFA 2JVVA 3TSZA 4E2FB 2JM9A 1N5ZA 2EJFA 1D0XA 3LH5A 4JJBA 5IXFA 1UE9A 4IKFA 3G4SQ 3WVDB 4CC2A 4IUUA 3CMAT 2LNHB 4MDWA 2KGTA 2YUPA 3M57A 1MV0B 2DTOA 4XU2A 5GAN7 1AHJB 1FMWA 2A0FB 2KXDA 3CXCS 1WLPB 1MMDA 2HBWA 2RNAA 4M7AD 1UGPB 2LX9A 1YIJT 2QQ9A 1N8RU 1W70A 1AZGB 1Q7YU 2DFUA 1UEBA 3BFMA 3OY9A 2OTLT 2JTFA 3RKXA 1Q86R 4FL6A 1QVPA 3QWXX 3KFVA 1KQSA 3UA6A 5GMKl 4J9GA 2O4XB 3CPFA 2DZCA 4A4FA 2JNGA 4RTTA 1QLYA 4PFPA 2BUDA 2C0TA 2CDTA 1CSKA 3JCMP 3M53A 1ZHIA 3X25B 2HKNA 3M0PA 2MI6A 3G1JA 2HAXA 3OMCA 3OYBA 4ELZC 3HP9A 4E7LA 3EGXB 1ACMB 1WXTA 1X43A 4FSXA 1U8RA 3V8JA 2J05A 3CCVT 3UPUA 1X75C 2V1RA 3M0RA 2DX1A 2DYIA 2YT6A 1SKUB 4JS5A 2EGCA 4TVRA 2DM1A 1WIEA 4RTZA 4EDUA 3JCMX 4OB3B 4FYYB 1V1CA 1Q95G 4J9CA 5L8RE 1M2VB 1XNIA 2WACA 1JJ2A 3GIBA 4J6XA 5KH6A 3HRTA 2GTOA 3NGPA 2FHDA 2R5MA 4WTOB 4M78D 4WCIA 3CPWS 1HD3A 5I2MA 4KGVB 2NUZA 1OV3A 2QA4T 4UC4A 2XDPA 2ZPBB 1TG0A 4XU1A 1KHCA 1VQOQ 4MZTA 4AFZC 1QP2A 4HCCA 4PJJA 4IUTA 2FZGB 4O5VA 3OS5A 1UGRB 4HA8A 2OTLA 5J3BA 5FRNA 4M7DA 1RAIB 3JB9D 4RKUE 3CCMA 2ZCFB 2K2VA 3G71A 4M77A 3HHTB 3D7SB 1H3HA 4OMMA 2ROLA 1I4K1 1X2QA 3SDZA 4ME7A 2PVOB 2RJDA 2AZSA 1VQNT 2CP3A 5GAN4 1RLPC 2OTJA 1QWEA 1Y71A 3LWHA 4QW2A 1IZ6A 2V8JA 1IO6A 1OULA 2E5KA 1Q82R 3LGFA 2XIDA 4AG1C 2RHYA 1FX7A 3TEEA 2B8AA 2E64A 1K1ZA 1X27A 4M75G 3MP8A 1IGUA 1S72Q 1UECA 2LCSA 3QSUA 4JUVA 4BI4A 1GCQA 2DJQA 3CC4Q 4A54A 4IURA 5GANh 2LDMA 2VC8A 3LLRA 5CQYA 3FC3A 2LZ6B 2EQUA 2D8HA 4C8QD 1NBEB 1Q7YR 2EW3A 2IPOB 1PNJA 4J9DA 3M4YA 2SRCA 2DK3A 3LWIA 2HNIA 1MNEA 5FU6B 1QVGP 5IT9E 3CCQA 1AVZC 2LCCA 3EFOB 2GFAA 5HY6A 2KNBB 3QYHB 1KG1A 5GAN6 4X1VA 2K7AA 2QDLA 5GAMh 4F7UF 1U5SA 2RM4A 4FSSA 2XHCA 1NLOC 1BI3A 3N5BB 4CC4B 1OX8A 2E6ZA 5FW9A 3VS1A 1JRIA 1VQOT 1KHIA 2E6NA 2DXTA 2RMOA 1NEGA 5HK0A 1EIFA 4X34A 1PRLC 2RK2A 4II1A 1I07A 2YUQA 2LQKA 1QP3A 4XTYA 1KSWA 2RHXA 3PMTA 2X3WD 1MGQA 2FRYA 1XTDA 3OB9A 1YHQA 2DBMA 3ZBDA 5IHKA 1BU1A 1BI0A 4JJNK 3I56A 4BY6B 3I55A 4BACA 1WXUA 3JSCA 3QIIA 1ZSZC 2RJEA 1RACB 1VQLQ 2EVRA 3I5RA 4HXJA 3OSVA 1GBQA 2PNIA 1WHMA 2QTXA 1YHQT 2D6FA 1M4ZA 4FCYA 1S72A 2DBKA 1BB9A 2A08A 1SHFA 2DXUA 2VXEA 3QYGB 3ULRB 1YJNA 1Y96A 4OB0B 5GAMg 2F2WA 1W2BP 4OGCA 5CKFA 4J9HA 2CT3A 5GAOr 1D1AA 4KT0E 1H92A 1P92A 5LJ3g 2JOYA 5CVIA 1UGSB 4BDYA 2JUFA 3EGXA 4JRPA 5LJ3d 2CZ6B 1NLPC 2XKOC 3VS2A 1VQ8Q 2KT1A 3R6NA 1M30A 4F17A 2ZZDA 4LDYA 2KE9A 2K3YA 3U23A 1M3CA 3J81E 4HCZA 3SWNB 2I0NA 3MEAA 2VWFA 5AT1B 2LC4A 1D3BB 3RKWA 2I2LA 1G3YA 5FU6C 4DA4A 1MHNA 3ME9A 3X26B 2O01E 1I81A 1X01A 2WSCE 3JCMh 4GLKA 1W1FA 2K5FA 3CQTA 2RQTA 4M7AB 4CI0C 3Q1JA 1YI2A 3CCRA 1TUGB 3OW2S 3CCUT 3EGDA 3JCMg 3WVEB 3MEVA 4HVWA 4IIMA 2W0ZA 1K8AU 4RTXA 2PU9B 5GAN2 3GP8A 2CUDA 2LP5A 4XTWA 3UATA 1UG1A 5AYFA 2DJZA 4C0FA 2NYSA 3VYGA 2QGFB 1MUZA 2VGNA 2HCKA 5LJ5g 1ABQA 3VUBA 3I55Q 1RLQC 2BKDN 1SRMA 4C8QB 1FWZA 2L3SA 3P8DA 1YN8A 1ZA1B 2VUBA 3V7CA 5A0DA 4Z88A 2ENMA 4GLMA 1VQ9A 1I5LA 4KUIA 4RCBA 2QQSA 2DD4A 2QTVA 5FWCA 1RL2A 1ZQ1A 4DOWA 1NJIC 3CC2Q 3JCMW 1R0CB 4C5EA 3FDRA 1VQ7Q 3EG3A 2CS7A 1UGVA 4FT2A 4L6V5 4B9XA 2BE9B 1N9RA 1BK2A 2HZYA 1Y7XA 2RH2A 2HSEB 3EG9B 2EGAA 4Y92A 3VUZA 1AWWA 2E70A 2RN8A 4B6MA 2YXYA 3LH0A 3M56A 3PNWC 3CCET 1GFCA 2X9HA 4C5IA 4DEXA 4E7ZA 3OYGA 4F7UB 2E10A 1K73U 1OQKA 3CMAQ 3HPWA 3I56Q 1VQ8T 4FYXB 1JU5C 1SG5A 1M8MA 3VS4A 2QI2A 2ECZA 3RNJA 4JZ3A 1U1SA 3H8ZA 1G5VA 3OYLA 1M2VA 2RK1A 3DB3A 1KK7A 4J7IA 1GBRA 1PSFA 1JB0E 2RHUA 2LTOA 1YITA 4M7AA 4AFSC 2VV5A 1B34B 2FZKB 3HSBA 2FPFA 2QG9B 3CXCP 1Q82U 2AZVA 5LJ5e 1WNLA 4BE1A 1UHCA 3V8LA 4DOVA 1VQKQ 5IHNA 2FVUA 3P8BB 4M77E 5CCAA 4M7DE 4JS4A 2C06A 4BE0A 1UTIA 1WQWA 2CP0A 3CCQT 1N27A 2ZPGB 3FJ5A 1VQMT 4A4HA 3CD6T 3G6ET 1WA7A 3TQ7P 2JMCA 3MJXA 2DVJA 4LDUA 1LNXA 2K2MA 2KYMA 3SWNC 4C0DC 1M1GA 4OB2B 4ZGJB 3QXEB 3OYIA 1WHHA 2EJ9A 2KR3A 2R5AA 3G4ST 5ECAA 2QEXQ 5A0GA 4RUGA 1WX6A 2MK5A 1AZEA 2P0PA 2QDYB 2HDAA 4M7AC 1M9SA 2F1LA 2LQWA 2EPDA 2CZ1B 2GNCA 2HQHA 1MMNA 2PVGB 3G6EA 2L3RA 3L1AA 3CD6A 3VV0A 3KXTA 3CMEA 1WJSA 4FW1A 1QMCA 4BE2A 3G71Q 1FYNA 2DA9A 2MPXC 4RG8A 3LGLA 1KC8R 3FLGA 3SFMA 5GMKj 3INZA 3CMAA 4JRKA 4HVVA 2MWPA 3V8KA 4C8QC 2E5QA 2M51A 1K8AC 3QKJA 4D6WA 1T0JA 3FB9A 3CCMT 2RI5A 1B7TA 2XDBA 2DILA 4OMPA 1JXMA 2OI3A 4N4HA 1SRLA 1F1BB 2RQVA 3UA7A 1JO8A 2OTJQ 4A4EA 3NPFA 1OU8A 1V29B 1N6AA 1W2BS 5IH2A 4LUEA 3GLXA 2RF0A 1SHGA 4C8QF 2HKQB 4M7DC 1RAHB 4PJOE 3OW2A 2OTLQ 1VQ7T 2K6DA 4C0ZA 1NG2A 4YTLA 4MZMA 4CRIA 1K0SA 2YUOA 1Z9QA 1DJ7B 3OYCA 1OEBA 2QQRA 3G6EQ 2AT1B 2FYKA 3HKSA 3QG1A 5J39A 2RI2A 5GAN5 1PKTA 2JM8A 2QASA 4WF2A 3EG1A 2AKLA 3EFOA 1M27C 5LJ5d 3CXCA 3OYDA 1U06A 4J83A 2QYZA 5KYXA 3FEOA 2NUPA 2EYYA 2O88A 3OBWA 3M0SA 2KVQG 2XI9A 4A4GA 4DBQA 2EJGA 3SWNA 2E1HA 1LOJA 3VJPA 4EMKC 3OYJA 2P4RA 1K9MC 2KBTA 4KUDK 2JTMA 4LE9A 5KYYB 2KMTA 3IQLA 4M77G 1OI1A 4M75E 2QGGA 3VKIA 2W10A 5LJ3e 1KFZA 4F04B 1QVGS 2X3XD 5GAN8 5J26A 2D8JA 3GF5A 2D1XA 2MMPA 3VS0A 2G6FX 2X35A 1G3SA 5A0LA 4E7IA 3JCMV 3CCLT 2F5TX 5GMKi 2KSSA 1QCOA 4J6YA 4JLGA 4N4GA 2DTHA 3EHQA 1X6BA 2NWMA 1TH7A 2R57A 3PGGA 1Q81U 3JB9J 2EYXA 1WHLA 2EGEA 1IXDA 2LJ3A 1AWXA 2ZAEA 4P5NA 1VYUA 2CP7A 4N4IA 1E7OA 2L0AA 2VGMA 5GANe 4BI3A 3L42A 3META 4X9DA 2ZPHB 2KXCA 1D1CA 2M1HA 4OVAA 1VQ5A 1MMGA 5C6SA 2CZ7B 4M7AE 4PK4A 4HVUA 3CD6Q 4E7KA 1K9MU 2M0YA 3SD4A 1VOMA 1S72T 3L2QA 1UUEA 1HXDA 2H3JA 2CSQA 2LRQA 3I5SA 5FU7B 1E6HA 3JCMQ 3GOXA 4IUQA 1X2KA 1VQ4T 1PG5B 1X6OA 3JCMJ 2D0QB 2ED1A 2B86A 1BIAA 4OMNA 2EQKA 3RUXA 5KYWA 3VS5A 2X4XA 5KCOA 4C8QA 2RJCA 3L2UA 2X4YA 4JRQA 4EPCA 1NYGA 2A3LA 1OZ3A 3CC7Q 4MMLA 2L5QA 2DO3A 3CCRQ 4LN2A 2A7YA 2Y90A 4PLLA 1UJYA 2EYZA 2H8HA 2VYTA 1Q81C 3C95A 2E4HA 1YJ9A 1Y0MA 4RTYA 2EBPA 5IAYA 1LCKA 2Z0WA 4J7FA 1G8XA 3MPUB 1C0MA 2DL4A 3EAEA 4FYWB 2RQWA 9ATCB 5KYYA 2MAMA 4PJOC 3OQ5A 2H3EB 2O31A 2O4XA 1W2BA 4LD6A 1OPLA 4AFQC 1YBYA 4OMOA 1JEGA 1PC0A 4GBQA 2C0IA 5KYNA 3RKYA 3KUFA 1TWBA 1WGSA 3SB2A 5GAN3 2M9UA 4JZ4A 2FEIA 3TVTA 1UB4A 4C8QE 1TXQA 3L2ZA 4M75B 2BIVA 5GJWB 1BIBA 3T9NA 5D7UA 2DKGA 3VS6A 1KC8U 4LDWA 5KYUB 1BCOA 1D1BA 2J7IA 1R77A 1TUCA 1GRIA 2ESWA 1N8RR 2FG0A 4PJLA 5A2QE 1JXOA 2CP5A 3ZL7C 1VQ6A 4M75F 2CREA 1PM3A 3JCMf 2DD5A 3KBGA 4A53A 5CK9A 5IXBA 4AFUC 1V76A 2DLPA 5DLOA 4ZNXA 1BCMA 4PLIA 2P84A 2ZGWA 2LVMA 4HCBA 3E2UA 1IHVA 5LJ5j 4R55A 4RTUA 2JT4A 2COYA 1BBZA 3CC7T 4DBFA 2NUTA 4F7UG 1FMKA 4ANJA 2DVEA 4M4ZA 3JCMc 1PD1A 3PIPA 5CKHA 4OGEA 4LDXA 3JCMe 1BYMA 5CKEA 2J6FA 4B9WA 1YITT 4IIOA 1QVGA 4QKUA 1ZBXA 2E3IA 2YLBA 3TREA 2HD0A 5FLXE 2K57A 5GMKe 3J7AF 3OW2P 4KH0B 5GAOp 2FRWA 1OPKA 4JRIA 2QA4A 2D0NA 4BD3A 2LT4A 1M90U 1VQ8A 2DZ9A 1IREB 2DEQA 2GQVA 1YIJQ 3L2VA 8AT1B 1UJ0A 1WDXA 4PJNA 5I21A 3CMEQ 4MMKA 2F2XA 4BY6C 4R0KA 3OYMA 1KIKA 1QWFA 5D6XA 3OYHA 1TS9A 3HRUA 1VQMQ 2GQIA 2O2OA 1VQMA 1BI2A 3HFOA 5GAMd 1UFFA 2ZPEB 3ER0A 1PHTA 2GGRA 2D9TA 4C0GA 1PSEA 1C1AA 2F5KA 4R56A 1G3TA 1HSQA 2WSFE 2KDSA 2V26A 1RAAB 2IIMA 2E41A 2L3PA 3UF4A 1TTHB 2LQ8A 2FO0A 2DL8A 1KD1R 1ZSZB 3I9QA 5IN1A 1Q81R 2AK5A 1YWOA 3CC2T 1SF9A 3OYKA 2E65A 2JTEA 2CYZB 4DEYA 3MKDA 5HKCA 4OB1B 2PUOB 2HBPA 2LMJA 4Y28E 4J9EA 4L5GA 4OMLA 4PJOA 1YJ9T 5CO7A 1EFNA 2EFIA 1WJQA 2JXBA 1G2BA 3M55A 4ELYC 3ZFJA 4LXCA 1PD0A 1WHGA 2HSPA 3CCEQ 2G3RA 3OYEA 1M1KU 2JJ9A 2EYQA 3NMZC 4EMKA 4XU0A 1SEMA 1YJWA 2MYSA 4RG2A 4LUDA 2GF7A 1LJOA 2HQEA 2QA4Q 1D09B 3M0UA 1UDLA 3EGUA 2OTJT 3J80E 1I8FA 3TCJA 1VQNA 1VQ4A 4BB7A 3CBPA 3QJYA 4KULA 4M78B 3NTKA 3PFSA 3PIOA 3CC7A 1TU0B 2KROA 2XK0A 1NJIU 3C94A 2V1QA 4X9CA 1YJWT 3JB9H 5I22A 1RABB 4M7DF 5GAOq 3PVQA 1SSFA 3QO3A 3L2RA 4C92B 3E9FA 3DLMA 2L3QA 1H8KA 1K73C 2BZXA 1VUBA 2ABLA 1GCPA 2JMAA 1OU9A 6AT1B 1VQ6T 1K0XA 3BE3A 3CCSQ 3M9QA 3X28B 2L89A 2AIRB 1KQSP 3MEWA 3BY7A 4NL3A 3FIFA 2OAWA 2DXBA 2A37A 3OYYA 4N0AA 3C12A 1VYTA 1VQPQ 1RI0A 1AD5A 3R6OA 1AT1B 1S1NA 3RBBB 4M78E 1W4SA 2J6KA 4FIBA 5FRMA 1H3ZA 1LVKA 3V7SA 2J6OA 2MIOA 2YRCA 1YCYA 1HJDA 4E7JA 3OS2A 3VYHB 4C92D 1EZZB 5LJ5f 2CT4A 1G3WA 2FB7A 2LJ0A 1T3SA 1T0HA 3LYIA 3QPHA 1KQ2A 4M77D 1B07A 1TSFA 4DQ2A 1NYFA 1E6GA 2DYBA 3NFCA 1NE8A 2DAQA 4XTXA 2BE7D 1MV3A 4RMOA 4NOYA 4CC3A 5LJ3j 1ZBJA 4J9FA 2YLCA 4QVCA 1M90R 3ASKA 2NUPB 2P0KA 3GBQA 3UDCA 1M3BA 2ZPIB 1VQPA 4KRTA 2JW4A 3A8HB 3NTIA 4N0AC 1WZOA 2JS0A 4LNPA 2YRVA 2LQNA 1WHKA 4FU6A 3AHUA 1NZ9A 1VQ9T 3C0CA 2NLUA 1RAGB 1YJ9Q 3H0HA 1BI1A 2VASA 2LT1A 3S3NA 4O6JA 1VQ5Q 3VU3C 2NUTB 2K5IA 1QVFS 2RO0A 3HRSA 1WPYA 4ZGDB 2FL7A 1KQSS 4Q5WA 2MF2A 2LCLA 3QWYA 1TUDA 4HT9A 3O5ZA 3QJ6A 4EIKA 4HCKA 1K9AA 4KBMB 3F70A 4E7SA 2DL5A 2K4YA 4RTWA 1TOVA 1B3QA 4HT8A 2M16A 1VQ4Q 1N8RC 2F69A 5GAOl 2Y4YA 4ZTJA 1Y07A 4C0DB 1PWTA 4JJDA 4XTUA 1AEYA 4QVDA 5LJ3h 3A8LB 5LJ3f 4J9BA 4EMKB 2DRMA 4C92G 1I0CA 5LL6S 2DNUA 4A63B 2HQXA 1VIFA 1U3OA 1XOVA 4Y91A 3V7RA 1YIJA 2ED0A 3MP1A 1NEBA 1NPRA 1O75A 3CCLA 4XAXB 2KRSA 3X24B 3BDLA 2BZYA 2KI7A 3BDUA 2ATCB 1IHWA 2OJ2A 5D6YA 4AG2C 4Z02A 2RQRA 3GPLA 4RCCA 2DMOA 2P0QA 4JLIA 1VQPT 3GNFB 1YI2Q 2KT8A 3EH2A 3MP6A 3DB4A 1OX9A 3OYFA 3CCLQ 2EKHA 5M9OA 4M7DG 3FRNA 5GAMj 4PJOF 4PFZA 3RESA 1ZSGA 3QZ9B 2E12A 3JV3A 3JCMb 1ZUKA 1YJNT 1XQHA 4BUGA 3DKMA 2YSQA 1SSHA 1M3AA 4OMQA 3M58A 1VIEA 2IG0A 2PVDB 2ZPFB 3TSWA 4D8DA 3CCJQ 1K73R 3JRZA 4ZGEB 3SHWA 1J3TA 5C0MA 2OAUA 3OBYA 1QVFA 2EYWA 4C5GA 4M78A 4OF1A 2DRKA 5CKDA 5GANj 2LJ1A 2QQAA 3H41A 4PL6A 2RHIA 2M02A 2HL3A 2CH4A 4PFOA 4PNOA 3CBMA 4F7UE 2K3BA 3A5ZB 4ZN1A 2P4TA 1B34A 1QCNA 3CCVA 3JB9F 1K8AR 2DE0X 4ESRA 3I55T 1HK9A 2RA2A 3EG2A 3OA6A 3THKA 2DXCA 3MCAB 2HMAA 5GANf 1WXBA 2X4JA 4ATOA 1ZUYA 1AWJA 2XU8A 2CZ0B 1PRMC 3MHXA 4C8QG 1NPPA 4M75A 3RMQA 1IB8A 4AT1B 1VQ5T 2DEUA 3JAME 1O9SA 3EFRA 3NTHA 5FROA 1XJWB 3E9GA 5CAIA 2PQWA 5GANg 1GFDA 4M75D 5GAMf 4PKCC 4QVZA 3MO8A 1M2OA 2EQMA 1KD1C 3EFSA 2MCNA 1M1FA 3DLLA 5EC7A 2YUNA 2PTKA 3P8HA 3OS1A 3PTAA 5CIUA 3A1PA 3X20B 2DETA 1QW1A 1RADB 1WFWA 1K9MR 4MDXA 4V2SA 1JQQA 1GL5A 3H0FA
chains in the Genus database with same CATH topology
3A8GB 4FSXA 4ZGJB 1U8RA 3V8JA 3QXEB 1VQMA 1JBMA 3CCVT 3UPUA 4E7HA 3OYIA 2EJ9A 2R5AA 3G4ST 1BI2A 3HFOA 5GAMd 2ZPEB 1X75C 5A0GA 4QQ6A 4OP0A 3ER0A 1N9SA 2D9TA 2R58A 4C0GA 1PSEA 2P0PA 2QDYB 1WJRA 1Q86U 4M7AC 1M9SA 3CCRT 2F5KA 4JS5A 4R56A 1G3TA 4TVRA 4XTZA 2CZ1B 2DIGA 4EDUA 2WSFE 3JCMX 5DY9A 2KDSA 4BI8B 3URGA 4OB3B 2MWOA 2PVGB 2K5LA 2L3RA 3L1AA 3G6EA 3CD6A 2PUKB 2E41A 5L8RE 3VV0A 3KXTA 3CMEA 1XNIA 2LQ8A 2WACA 4C92F 3CPWA 1JJ2A 3GIBA 4J6XA 1WJSA 2X4WA 3HRTA 5KH6A 4C92E 3RERA 5GMKm 4BE2A 2FHDA 2R5MA 5IN1A 1OYXA 4M78D 3CPWS 4M7AF 4JDSA 4NL2A 5I2MA 2QEXT 3CC2T 2KAFA 2CKKA 2QA4T 4UC4A 4RG8A 2DIQA 2E65A 2CYZB 2XDPA 3H6ZA 3LGLA 3M54A 4OB1B 5HKCA 2PUOB 2HBPA 2ZPBB 1H641 3FLGA 1D3BA 4Y28E 3SFMA 2RJFA 4L5GA 5GAMe 4PJOA 1YJ9T 5GMKj 3INZA 5CO7A 4XU1A 1KHCA 2EFIA 2WSEE 5FU7C 4JRKA 1WJQA 4MZTA 3CMAA 1QP2A 2MWPA 2XDDA 4HCCA 3M55A 3V8KA 4ELYC 4C8QC 2E5QA 3ZFJA 4IUTA 3CCJT 4O5VA 1K8AC 3QKJA 4D6WA 3OS5A 1UGRB 3FB9A 2G3RA 3OYEA 1FXXA 3CCMT 1M1KU 2EYQA 2RI5A 4HA8A 3CMET 4EMKA 2JZ2A 4XU0A 2OTLA 2XDBA 5J3BA 5FRNA 4M7DA 3JB9D 4N4HA 4RKUE 3OS0A 2ZCFB 2K2VA 3G71T 4M77A 3G71A 3HHTB 3CCMA 1YJWA 2XG8D 4RG2A 5GMKh 2GF7A 4A4EA 1I4K1 1LJOA 2HQEA 4BDZA 1VQKA 1V29B 3C4SA 1N6AA 4ME7A 2PVOB 3SDZA 5KE3A 5GAOn 2RJDA 1W2BS 1VQNT 5GAN4 3GLXA 2OTJT 3J80E 4C8QF 1Y71A 1I8FA 2OTJA 4M7DC 3TCJA 4PJOE 1VQ7A 3LWHA 4QW2A 3OW2A 1VQ4A 1VQNA 4BB7A 3CBPA 3CBOA 4EMHA 3QJYA 4KULA 4M78B 3NTKA 3PFSA 3PIOA 3CC7A 1VQ7T 1IZ6A 3G4SA 2XK0A 1NJIU 3CC2A 2V8JA 4C0ZA 2XD0A 2GFUA 2LNVA 3CCEA 4YTLA 3LGFA 1M5Q1 4MZMA 2XIDA 5KE2A 4CRIA 3C94A 2RHYA 1FX7A 4IUPA 3TEEA 2B8AA 1OZ2A 2E64A 4NS5A 4X9CA 3O8VA 4M75G 4M75C 1YJWT 3JB9H 3MP8A 1DJ7B 4M77C 5KCHA 3QBYA 3OYCA 3ZEHA 2JN0A 3CCJA 3QSUA 4M7DF 5GAOq 4PJOB 2QQRA 4JUVA 2FYKA 1SSFA 2EIFA 4FM4B 3QO3A 3L2RA 4BI4A 3HKSA 4C92B 1GXIE 3E9FA 3QG1A 3DLMA 4A54A 5J39A 4IURA 3OSSC 1K73C 5GANh 2LDMA 2RI2A 2VC8A 3LLRA 5GAN5 1VUBA 2QQBA 3JB9G 4WF2A 1VQ6T 5CQYA 3FC3A 2EQUA 3M9QA 3QZ5B 3LX7A 2L89A 3X28B 4C8QD 5LJ5d 3CXCA 3MEWA 3OYDA 3S3OA 3BY7A 4GY5A 4NL3A 4XTVA 3FIFA 3M4YA 3LWIA 2DK3A 4J83A 2DXBA 2HNIA 3OYYA 4N0AA 3OYKA 3C12A 4J5YA 3FEOA 1U1TA 5FU6B 2YHTA 1RI0A 5IT9E 2IVWA 3PT9A 3S6WA 3OBWA 3CCQA 2LCCA 2GFAA 3R6OA 2KVQG 5HY6A 3QYHB 4M78E 4XK8E 1W4SA 3TU4K 2RHZA 1KG1A 2XI9A 4A4GA 5GAN6 2KY9A 2EJGA 4FIBA 3SWNA 5FRMA 1WQ7A 4F7UF 5GAMh 2E1HA 2RM4A 1LOJA 4M78G 3VJPA 4ZTFA 4EMKC 1H3ZA 2XHCA 5GAOm 3OYJA 1K9MC 3V7SA 4KUDK 3L2WA 2JTMA 1YCYA 2QXFA 1BI3A 4C92A 2KMTA 2KQWA 4M77G 3N5BB 4E7JA 3OS2A 1OI1A 4FT4A 4M75E 3VKIA 2E6ZA 3VYHB 4C92D 5DLQE 3UT1A 3JB9I 2L8DA 5LJ3e 5LJ5f 1JRIA 1G3WA 1QVGS 1VQOT 3OYAA 2FB7A 5GAN8 1KC8C 1KHIA 2E6NA 3LYIA 3QPHA 2DXTA 5J26A 3MEUA 4M77D 1KQ2A 5HK0A 4DQ2A 3GF5A 2MMPA 1EIFA 4X34A 3WXMB 2GCXA 2X35A 1G3SA 5A0LA 4E7IA 4HKEA 3NFCA 1NE8A 2RK2A 2DAQA 2F5TX 4II1A 3JCMV 3CCLT 4XTXA 2LQKA 2KSSA 4J6YA 4JLGA 5GMKi 4N4GA 1QP3A 2DTHA 4XTYA 2RHXA 3PMTA 4NOYA 4RMOA 5LJ3j 1MGQA 2YLCA 4QVCA 1KD1U 1TH7A 1XTDA 3ASKA 2P0KA 3BW1A 3UDCA 2DTIA 2R57A 3OB9A 3PGGA 5CQXA 1BKBA 1YHQA 1Q81U 4LD9K 3JB9J 2RB6A 2ZPIB 3ZBDA 3HFNA 1VQPA 1KQ1A 1Y96B 1BI0A 2M0OA 3A8HB 4JJNK 4P5NA 3NTIA 4N0AC 2EAYA 3A8OB 2YRVA 3I56A 4BY6B 3I55A 4BACA 4FU6A 4N4IA 3AHUA 1VQLT 1NZ9A 4L59A 1VQ9T 3JSCA 4XU3A 2NLUA 1Q82C 2VGMA 4M7DD 3QIIA 4J8OA 4BI3A 2RJEA 3FJPA 3L42A 5GANe 3META 4X9DA 3RIRA 2ZPHB 4PJOG 1BI1A 2M1HA 4OVAA 1VQ5A 3OYNA 2LT1A 3S3NA 5C6SA 2CZ7B 3OSVA 4O6JA 3VU3C 1VQLA 4M7AE 4E7KA 2CGHA 4VUBA 3CCUA 2K5IA 4C92C 1K9MU 2RO0A 1QVFS 2QTXA 3HRSA 3SD4A 4C5HA 3QUIA 1YHQT 1WPYA 2D6FA 1M4ZA 4QQGA 4ZGDB 2FL7A 3L2QA 1HXDA 1S72T 4XQ3A 1S72A 4Q5WA 1KQSS 2DXUA 2H3JA 4A4KA 2MF2A 2LCLA 2LRQA 2VXEA 3QYGB 5FU7B 3GOXA 3JCMQ 4J6WA 4M7AG 4HT9A 4IUQA 2XICA 1YJNA 3QJ6A 3CC4A 1Y96A 4OB0B 5GAMg 4KBMB 1VQ4T 3F70A 1X6OA 3JCMJ 2D0QB 5HK3A 1Q7YC 2K4YA 3E19A 1BIAA 4OGCA 5CKFA 3CCST 5EG2A 4HT8A 2EQKA 2M16A 2V8IA 4MZPA 3RUXA 1N8RC 2F69A 2X4XA 5GAOl 2Y4YA 4QQDA 1Y07A 4ZTJA 5KCOA 4C0DB 4C8QA 5GAOr 2RJCA 3L2UA 2X4YA 3I56T 4JRQA 4KT0E 4XTUA 4EPCA 1P92A 4QVDA 5LJ3g 2JOYA 2A3LA 5CVIA 1UGSB 1OZ3A 4M77B 5DM7R 1M90C 5LJ3h 3A8LB 2Y4XA 3M59A 5LJ3f 4MMLA 3RMSA 2L5QA 4BDYA 2JUFA 4M7DB 4EMKB 4JRPA 2DO3A 4C92G 5LJ3d 2CZ6B 3JCMd 2A7YA 5LL6S 2Y90A 2XKOC 3M4GA 4PLLA 2VYTA 1Q81C 2HQXA 1R8OB 1VIFA 3C95A 5I2SA 1XOVA 2ZZDA 4LDYA 4Y91A 3V7RA 1YJ9A 2EKOA 2K3YA 1YIJA 5IAYA 3J81E 3MP1A 1UGQB 4HCZA 3OMGA 5GANd 3QDRB 4OMFB 3E1SA 3SWNB 1NPRA 3MEAA 1O75A 2LC4A 1D3BB 4IUVA 3CCLA 4J7FA 4XAXB 4M78F 3EAEA 3X24B 3BDLA 2MAMA 3RKWA 3BDUA 4PJOC 3OQ5A 2I2LA 4PJOD 2O4XA 5D6WA 2EQJA 1W2BA 4LD6A 1G3YA 5FU6C 4DA4A 1VQKT 2EWNA 1MHNA 3ME9A 3X26B 2O01E 1I81A 1X01A 3HL8A 1YBYA 5D6YA 3A8MB 2WSCE 3JCMh 1JJ2S 4GLKA 2K5FA 4Z02A 1VQOA 3GPLA 4CI0C 4M7AB 1YI2A 3Q1JA 4RCCA 2P0QA 3CEYA 4JLIA 1VQPT 2V8KA 3GNFB 3RKYA 3KUFA 3UWNA 3MP6A 3DB4A 1WGSA 3OYFA 3SB2A 3CCRA 3OW2S 3CCUT 5GAN3 2M9UA 3JCMg 4LDVA 4M78C 5M9OA 3CCSA 3FRNA 4M7DG 1YI2T 3WVEB 2K3XA 5GAMj 3MEVA 1M8VA 4PJOF 5LJ5h 3RESA 1K8AU 1UB4A 2E12A 3QZ9B 4C8QE 2PU9B 3L2ZA 4M75B 5GAN2 3GP8A 2BIVA 3JCMb 5CR2A 1BIBA 4XTWA 3CC4T 1YJNT 3T9NA 1XQHA 2DKGA 5CKBA 4BUGA 5AYFA 3DKMA 4F7UA 1KC8U 2DJZA 4C0FA 3VYGA 4LDWA 4EMGA 2QEXA 3M58A 1VIEA 2IG0A 2PVDB 2ZPFB 2VGNA 3JRZA 4ZGEB 5LJ5g 3VUBA 2KK4A 5C0MA 2BKDN 3GNGA 2OAUA 3OBYA 4C8QB 1FWZA 3PMIA 2RI3A 1Q86C 3P8DA 1QVFA 2VUBA 4C5GA 5A2QE 3V7CA 4E47A 5A0DA 4M78A 4OF1A 5GANj 5CKDA 1M1KC 1VQ6A 1VQ9A 2RD1A 4M75F 3JCMf 2DPPB 2QQAA 1I5LA 4KUIA 4ZN3A 2DD5A 3KBGA 4M77F 2AHJB 2DD4A 2QQSA 4PL6A 4RCBA 1RL2A 4A53A 2RHIA 5CK9A 3M5AA 1ZQ1A 4DOWA 1NJIC 3JCMW 4PNOA 3CBMA 5DLOA 4C5EA 4F7UE 3FDRA 3LW5E 3QHSA 3S3MA 3A5ZB 4PLIA 2ZGWA 4ZN1A 2P4TA 1B34A 3CCVA 2CS7A 3G7ZA 2VXFA 2JVVA 4FT2A 2LVMA 4L6V5 4B9XA 3JB9F 4HCBA 3I55T 1HK9A 2EJFA 1N9RA 2RH2A 1Y7XA 2RA2A 5LJ5j 3OA6A 3VUZA 2E70A 4IKFA 4R55A 3WVDB 2DXCA 3LH0A 3M56A 3PNWC 3MCAB 4IUUA 3CCET 3CMAT 4MDWA 5GANf 3CC7T 2X4JA 3M57A 4C5IA 2DTOA 4ATOA 3OYGA 4XU2A 4F7UB 5GAN7 1AHJB 2E10A 2CZ0B 2XU8A 1K73U 3HPWA 3CXCS 3MHXA 4F7UG 4C8QG 1NPPA 1VQ8T 2DVEA 3JCMc 4M75A 3RMQA 4M7AD 1UGPB 1VQ5T 3PIPA 5CKHA 2QI2A 2LX9A 4OGEA 1YIJT 2QQ9A 4LDXA 1N8RU 3JCMe 1U1SA 3H8ZA 1Q7YU 1BYMA 1G5VA 1UEBA 5CKEA 4B9WA 3BFMA 3JAME 3OY9A 3OYLA 1O9SA 2RK1A 3DB3A 1YITT 2OTLT 1QVGA 4J7IA 3EFRA 1PSFA 3NTHA 1ZBXA 2JTFA 5FROA 1JB0E 3RKXA 3E9GA 5CAIA 2PQWA 2LTOA 2RHUA 1YITA 4M7AA 4FL6A 2YLBA 2VV5A 5GANg 1QVPA 2HD0A 4M75D 3TREA 1B34B 5FLXE 4PKCC 5GAMf 2K57A 3HSBA 5GMKe 3J7AF 4QVZA 1Q82U 1KQSA 5GMKl 3MO8A 5LJ5e 2O4XB 3CPFA 2EQMA 5GAOp 1KD1C 2DZCA 1WNLA 3EFSA 4BE1A 4A4FA 4JRIA 2JNGA 3V8LA 4BD3A 4DOVA 2QA4A 2BUDA 2FVUA 2LT4A 3P8BB 4M77E 1M90U 1VQ8A 2DZ9A 5CCAA 1M1FA 3JCMP 3DLLA 3M53A 1IREB 2DEQA 2GQVA 4JS4A 4M7DE 2C06A 1ZHIA 3L2VA 4BE0A 1WQWA 3X25B 3OS1A 3P8HA 3PTAA 5I21A 2MI6A 3CCQT 1N27A 2ZPGB 5CIUA 4MMKA 2HAXA 3OMCA 3X20B 4A4HA 3OYBA 1VQMT 3CD6T 4BY6C 3G6ET 1QW1A 3OYMA 5D6XA 4LDUA 1LNXA 4ELZC 3HP9A 4E7LA 3OYHA 4MDXA 4V2SA 3HRUA 3SWNC 4C0DC 1M1GA 4OB2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8J A;  5LJ5 g;  4A54 A;  4M7A E;  3VU3 C;  1JBM A;  2CGH A;  2EJ9 A;  4C92 C;  5GAN h;  3HFO A;  2VC8 A;  5GAM d;  2QTX A;  5GAN 5;  3QUI A;  4C8Q B;  1WPY A;  3JB9 G;  4WF2 A;  1HXD A;  4OP0 A;  4XQ3 A;  1N9S A;  2DXU A;  3V7C A;  2VXE A;  4M78 A;  4C8Q D;  5GAN j;  5LJ5 d;  3JCM Q;  4J6W A;  4M7A G;  2RD1 A;  4HT9 A;  3BY7 A;  4M75 F;  3JCM f;  4XTV A;  4NL3 A;  3FIF A;  1I5L A;  4M7A C;  1Y96 A;  4RCB A;  4M77 F;  4A53 A;  5GAM g;  4XTZ A;  2HNI A;  3JCM X;  4N0A A;  5DY9 A;  3JCM J;  4J5Y A;  3JCM W;  4PNO A;  1U1T A;  1BIA A;  2YHT A;  3L1A A;  4F7U E;  3QHS A;  4HT8 A;  2E41 A;  2ZGW A;  4C92 F;  1B34 A;  3GIB A;  3RUX A;  2VXF A;  4J6X A;  5GAO l;  4C92 E;  4M78 E;  3RER A;  5GMK m;  3JB9 F;  5GAO r;  4M78 D;  4C8Q A;  5GAN 6;  1HK9 A;  2EJF A;  2EJG A;  1N9R A;  3SWN A;  1WQ7 A;  4F7U F;  4NL2 A;  2E1H A;  2RM4 A;  1LOJ A;  4M78 G;  2RA2 A;  4XTU A;  4EMK C;  4QVD A;  5LJ3 g;  5LJ5 j;  5GAO m;  4M7A F;  2E65 A;  4M77 B;  3V7S A;  5LJ3 h;  1YCY A;  5LJ3 f;  4MML A;  4C92 A;  4M7D B;  1H64 1;  4M77 G;  1D3B A;  4EMK B;  4C92 G;  5GAN f;  5LJ3 d;  3JCM d;  2Y90 A;  3M4G A;  4M75 E;  5GAM e;  2DTO A;  4PJO A;  4C92 D;  5GMK j;  4XU2 A;  3INZ A;  4F7U B;  4XU1 A;  2E10 A;  5GAN 7;  3JB9 I;  4JRK A;  5LJ3 e;  5LJ5 f;  4F7U G;  4Y91 A;  3V7R A;  4C8Q G;  1JRI A;  3V8K A;  4C8Q C;  2DVE A;  3JCM c;  2FB7 A;  5GAN 8;  4M75 A;  2DXT A;  5GAN d;  4M7A D;  3FB9 A;  1KQ2 A;  4M77 D;  3SWN B;  4DQ2 A;  4HA8 A;  1D3B B;  4EMK A;  4XU0 A;  4M78 F;  4M7D A;  3JCM e;  1U1S A;  3JB9 D;  4M77 A;  3RKW A;  3BDU A;  4PJO C;  3BFM A;  2I2L A;  4PJO D;  5GMK h;  3JCM V;  3EFR A;  4XTX A;  5GMK i;  1I4K 1;  1LJO A;  4J6Y A;  2EWN A;  2DTH A;  3RKX A;  1I81 A;  1X01 A;  4XTY A;  5CAI A;  4M7A A;  3JCM h;  5GAM h;  4NOY A;  2YLB A;  5GAN g;  5LJ3 j;  5GAO n;  4M75 D;  5GAN 4;  1B34 B;  5GAM f;  4M7A B;  2K57 A;  1MGQ A;  2YLC A;  4RCC A;  4C8Q F;  1I8F A;  4QVC A;  5GMK e;  1TH7 A;  4JLI A;  3HSB A;  3RKY A;  4M7D C;  4PJO E;  5GMK l;  3BW1 A;  5LJ5 e;  2DTI A;  3PGG A;  5GAO p;  4EMH A;  4M78 B;  2DZC A;  1WNL A;  3EFS A;  3JB9 J;  3SB2 A;  2RB6 A;  4JRI A;  3HFN A;  3V8L A;  5GAN 3;  3JCM g;  4M78 C;  4M77 E;  1KQ1 A;  1Y96 B;  4M7D G;  2DZ9 A;  5GAM j;  3JCM P;  1M5Q 1;  4M7D E;  4PJO F;  2DEQ A;  5LJ5 h;  1M8V A;  3RES A;  4N0A C;  4C8Q E;  2EAY A;  1WQW A;  3L2Z A;  4M75 B;  5GAN 2;  5I21 A;  4X9C A;  2E64 A;  3JCM b;  1BIB A;  4MMK A;  4XTW A;  4M75 G;  3AHU A;  4M75 C;  3JB9 H;  2DKG A;  4XU3 A;  4F7U A;  4M77 C;  4M7D D;  2DJZ A;  4PJO B;  5GAN e;  2JN0 A;  1LNX A;  4EMG A;  3FJP A;  5GAO q;  3QSU A;  3RIR A;  4X9D A;  4JUV A;  4M7D F;  2FYK A;  4V2S A;  4PJO G;  3SWN C;  3QO3 A;  4C92 B; 
#chains in the Genus database with same CATH topology
 3A8G B;  1M1K R;  3VRZ A;  1JBM A;  4E7H A;  1VQ9 Q;  3H9N A;  4D8K A;  4QQ6 A;  1SPK A;  4OP0 A;  1N9S A;  5IHI A;  2R58 A;  1WJR A;  1Q86 U;  1YCS B;  3CCR T;  2GTJ A;  3RDV A;  3CCQ Q;  4XTZ A;  3EGD B;  2DIG A;  4KGX B;  5DY9 A;  4BI8 B;  2DL3 A;  3URG A;  1JJ2 P;  2MWO A;  2K5L A;  2A28 A;  2PUK B;  4C92 F;  5GJV B;  4AMC A;  3CPW A;  1D0Z A;  3PE0 A;  2X4W A;  2K79 A;  4C92 E;  3RER A;  5GMK m;  4J9I A;  1OYX A;  3RR6 A;  4JDS A;  4NL2 A;  2QEX T;  1ZX6 A;  2KAF A;  2CKK A;  4M7A F;  2DIQ A;  3H6Z A;  3M54 A;  1YFN A;  1H64 1;  1D3B A;  1RUW A;  2RJF A;  5GAM e;  2BTT A;  2WSE E;  5FU7 C;  4CC7 A;  1WI7 A;  2COW A;  1ZLM A;  2XDD A;  3CCJ T;  1X69 A;  1FMV A;  1FXX A;  1VYV A;  4F14 A;  3CME T;  2JZ2 A;  1AOJ A;  3I35 A;  2RQU A;  3CPW P;  1W6X A;  3OS0 A;  3G71 T;  1VQN Q;  1K4U S;  2XG8 D;  3M0T A;  5GMK h;  1QKX A;  4BDZ A;  1VQK A;  3C4S A;  5KE3 A;  1AWO A;  5GAO n;  1VQ7 A;  3CBO A;  4EMH A;  1YIT Q;  4PJM A;  3G4S A;  2FPE A;  3CC2 A;  2XD0 A;  2GFU A;  2LNV A;  3CCE A;  2YWW A;  1M5Q 1;  2KRN A;  3CCM Q;  5KE2 A;  1T3L A;  2YRD A;  4IUP A;  7AT1 B;  1OZ2 A;  2DL7 A;  4NS5 A;  2PZ1 A;  2COZ A;  3O8V A;  2MOX A;  4M75 C;  2J06 A;  4M77 C;  3CCJ A;  5KCH A;  3QBY A;  4PJO B;  3ZEH A;  2JN0 A;  2EIF A;  4FM4 B;  1I1J A;  1GXI E;  1R0B G;  1YJN Q;  3OSS C;  1IGQ A;  5HCK A;  4FYV B;  2QQB A;  3JB9 G;  5L23 A;  3QZ5 B;  3LX7 A;  2FZC B;  1EX4 A;  3S3O A;  4GY5 A;  4XTV A;  4QT7 A;  4J5Y A;  2F2V A;  2AKK A;  1U1T A;  1WYX A;  2YHT A;  4ORZ A;  1YWP A;  3AT1 B;  4RTV A;  2VVK A;  2IVW A;  3PT9 A;  3S6W A;  3EH1 A;  3M0Q A;  1YNZ A;  2CH4 W;  2E3H A;  4XK8 E;  3TU4 K;  2EQI A;  2RHZ A;  2KY9 A;  1WQ7 A;  4ZTF A;  4M78 G;  1ARK A;  5GAO m;  1Y57 A;  2O9S A;  3L2W A;  2QXF A;  4C92 A;  2KQW A;  5I11 A;  1YHQ Q;  4FT4 A;  3JB9 I;  5DLQ E;  3UT1 A;  2K9G A;  2L8D A;  4E6R A;  1QQJ A;  2FPD A;  3OYA A;  2CP2 A;  2C0O A;  1KC8 C;  5KYU A;  2OX7 A;  3EG9 A;  2CSI A;  3MEU A;  3WXM B;  2GCX A;  1Z9Z A;  1C6V X;  4HKE A;  1Q7Y C;  4KH1 B;  3VS3 A;  1QCF A;  2QK0 A;  1LPL A;  1KD1 U;  1IRX A;  1UHF A;  3BW1 A;  2DTI A;  5CQX A;  1BKB A;  5KYX B;  4LD9 K;  1QVF P;  2RB6 A;  3HFN A;  2YDL A;  1CKB A;  1KQ1 A;  1Y96 B;  2JS2 A;  2M0O A;  2EAY A;  2DF6 A;  1D0Y A;  1PCX A;  3A8O B;  2HL5 C;  2LX7 A;  1VQL T;  4L59 A;  3CCV Q;  4XU3 A;  1Q82 C;  4M7D D;  1HYO A;  4J8O A;  3FJP A;  3RIR A;  1RAE B;  1RAF B;  2CP6 A;  2L2P A;  4PJO G;  3OYN A;  3VS7 A;  3HTR A;  1VQL A;  1K76 A;  5FWB A;  2CGH A;  2HEQ A;  4VUB A;  3CCU A;  4C92 C;  4C5H A;  3QUI A;  4QQG A;  4XQ3 A;  1ZSZ A;  4A4K A;  1PKS A;  3CCU Q;  4M7A G;  4J6W A;  2ROT A;  2XIC A;  3CC4 A;  2XMF A;  5HK3 A;  3E19 A;  1VQ6 Q;  2A36 A;  1X6G A;  3CCS T;  3EHR A;  5EG2 A;  1MND A;  2CUB A;  1ZUU A;  1YP5 A;  2KYB A;  2V8I A;  4MZP A;  4QQD A;  1CKA A;  3I56 T;  1ZA2 B;  1KJW A;  3H0I A;  4M77 B;  4DBH A;  5DM7 R;  1A0N B;  1ABO A;  1M90 C;  3M59 A;  2Y4X A;  3RMS A;  4M7D B;  3JCM d;  2O9V A;  1GCQ C;  1QKW A;  3M4G A;  1VA7 A;  1R8O B;  5I2S A;  2KEA A;  2EKO A;  4Z89 A;  1UGQ B;  2BZ8 A;  5GAN d;  3OMG A;  3QDR B;  4OMF B;  2X51 A;  4JJC A;  3E1S A;  4IUV A;  4M78 F;  4DBR A;  3VRY A;  4PJO D;  4FW2 A;  5D6W A;  2EQJ A;  1YJW Q;  1G83 A;  1VQK T;  2EWN A;  3HL8 A;  3A8M B;  1JJ2 S;  4Z8A A;  3PVL A;  1VQO A;  1NJI R;  1NM7 A;  4KGZ B;  3CEY A;  2KRM A;  2V8K A;  3UWN A;  3EG0 A;  4LDV A;  4M78 C;  3CCS A;  1YI2 T;  2K3X A;  2VB6 A;  2VKN A;  1M8V A;  3REA B;  5LJ5 h;  2RPN A;  5CR2 A;  1MMA A;  3CC4 T;  5CKB A;  3QDF A;  4F7U A;  3REB B;  4EMG A;  2QEX A;  1WHJ A;  4K11 A;  1RI9 A;  4F16 A;  3SEM A;  2KK4 A;  3GNG A;  2QAZ A;  3PMI A;  2RI3 A;  1Q86 C;  5KYW B;  8ATC B;  4E47 A;  1M1K C;  3NHN A;  2RD1 A;  1OOT A;  2DPP B;  4ZN3 A;  4M77 F;  2AHJ B;  3M5A A;  3A98 A;  2DER A;  2GBQ A;  1I5O B;  2SEM A;  3LW5 E;  3QHS A;  3S3M A;  4JPB W;  3G7Z A;  2VXF A;  2JVV A;  3TSZ A;  4E2F B;  2JM9 A;  1N5Z A;  2EJF A;  1D0X A;  3LH5 A;  4JJB A;  5IXF A;  1UE9 A;  4IKF A;  3G4S Q;  3WVD B;  4CC2 A;  4IUU A;  3CMA T;  2LNH B;  4MDW A;  2KGT A;  2YUP A;  3M57 A;  1MV0 B;  2DTO A;  4XU2 A;  5GAN 7;  1AHJ B;  1FMW A;  2A0F B;  2KXD A;  3CXC S;  1WLP B;  1MMD A;  2HBW A;  2RNA A;  4M7A D;  1UGP B;  2LX9 A;  1YIJ T;  2QQ9 A;  1N8R U;  1W70 A;  1AZG B;  1Q7Y U;  2DFU A;  1UEB A;  3BFM A;  3OY9 A;  2OTL T;  2JTF A;  3RKX A;  1Q86 R;  4FL6 A;  1QVP A;  3QWX X;  3KFV A;  1KQS A;  3UA6 A;  5GMK l;  4J9G A;  2O4X B;  3CPF A;  2DZC A;  4A4F A;  2JNG A;  4RTT A;  1QLY A;  4PFP A;  2BUD A;  2C0T A;  2CDT A;  1CSK A;  3JCM P;  3M53 A;  1ZHI A;  3X25 B;  2HKN A;  3M0P A;  2MI6 A;  3G1J A;  2HAX A;  3OMC A;  3OYB A;  4ELZ C;  3HP9 A;  4E7L A;  3EGX B;  1ACM B;  1WXT A;  1X43 A;  4FSX A;  1U8R A;  3V8J A;  2J05 A;  3CCV T;  3UPU A;  1X75 C;  2V1R A;  3M0R A;  2DX1 A;  2DYI A;  2YT6 A;  1SKU B;  4JS5 A;  2EGC A;  4TVR A;  2DM1 A;  1WIE A;  4RTZ A;  4EDU A;  3JCM X;  4OB3 B;  4FYY B;  1V1C A;  1Q95 G;  4J9C A;  5L8R E;  1M2V B;  1XNI A;  2WAC A;  1JJ2 A;  3GIB A;  4J6X A;  5KH6 A;  3HRT A;  2GTO A;  3NGP A;  2FHD A;  2R5M A;  4WTO B;  4M78 D;  4WCI A;  3CPW S;  1HD3 A;  5I2M A;  4KGV B;  2NUZ A;  1OV3 A;  2QA4 T;  4UC4 A;  2XDP A;  2ZPB B;  1TG0 A;  4XU1 A;  1KHC A;  1VQO Q;  4MZT A;  4AFZ C;  1QP2 A;  4HCC A;  4PJJ A;  4IUT A;  2FZG B;  4O5V A;  3OS5 A;  1UGR B;  4HA8 A;  2OTL A;  5J3B A;  5FRN A;  4M7D A;  1RAI B;  3JB9 D;  4RKU E;  3CCM A;  2ZCF B;  2K2V A;  3G71 A;  4M77 A;  3HHT B;  3D7S B;  1H3H A;  4OMM A;  2ROL A;  1I4K 1;  1X2Q A;  3SDZ A;  4ME7 A;  2PVO B;  2RJD A;  2AZS A;  1VQN T;  2CP3 A;  5GAN 4;  1RLP C;  2OTJ A;  1QWE A;  1Y71 A;  3LWH A;  4QW2 A;  1IZ6 A;  2V8J A;  1IO6 A;  1OUL A;  2E5K A;  1Q82 R;  3LGF A;  2XID A;  4AG1 C;  2RHY A;  1FX7 A;  3TEE A;  2B8A A;  2E64 A;  1K1Z A;  1X27 A;  4M75 G;  3MP8 A;  1IGU A;  1S72 Q;  1UEC A;  2LCS A;  3QSU A;  4JUV A;  4BI4 A;  1GCQ A;  2DJQ A;  3CC4 Q;  4A54 A;  4IUR A;  5GAN h;  2LDM A;  2VC8 A;  3LLR A;  5CQY A;  3FC3 A;  2LZ6 B;  2EQU A;  2D8H A;  4C8Q D;  1NBE B;  1Q7Y R;  2EW3 A;  2IPO B;  1PNJ A;  4J9D A;  3M4Y A;  2SRC A;  2DK3 A;  3LWI A;  2HNI A;  1MNE A;  5FU6 B;  1QVG P;  5IT9 E;  3CCQ A;  1AVZ C;  2LCC A;  3EFO B;  2GFA A;  5HY6 A;  2KNB B;  3QYH B;  1KG1 A;  5GAN 6;  4X1V A;  2K7A A;  2QDL A;  5GAM h;  4F7U F;  1U5S A;  2RM4 A;  4FSS A;  2XHC A;  1NLO C;  1BI3 A;  3N5B B;  4CC4 B;  1OX8 A;  2E6Z A;  5FW9 A;  3VS1 A;  1JRI A;  1VQO T;  1KHI A;  2E6N A;  2DXT A;  2RMO A;  1NEG A;  5HK0 A;  1EIF A;  4X34 A;  1PRL C;  2RK2 A;  4II1 A;  1I07 A;  2YUQ A;  2LQK A;  1QP3 A;  4XTY A;  1KSW A;  2RHX A;  3PMT A;  2X3W D;  1MGQ A;  2FRY A;  1XTD A;  3OB9 A;  1YHQ A;  2DBM A;  3ZBD A;  5IHK A;  1BU1 A;  1BI0 A;  4JJN K;  3I56 A;  4BY6 B;  3I55 A;  4BAC A;  1WXU A;  3JSC A;  3QII A;  1ZSZ C;  2RJE A;  1RAC B;  1VQL Q;  2EVR A;  3I5R A;  4HXJ A;  3OSV A;  1GBQ A;  2PNI A;  1WHM A;  2QTX A;  1YHQ T;  2D6F A;  1M4Z A;  4FCY A;  1S72 A;  2DBK A;  1BB9 A;  2A08 A;  1SHF A;  2DXU A;  2VXE A;  3QYG B;  3ULR B;  1YJN A;  1Y96 A;  4OB0 B;  5GAM g;  2F2W A;  1W2B P;  4OGC A;  5CKF A;  4J9H A;  2CT3 A;  5GAO r;  1D1A A;  4KT0 E;  1H92 A;  1P92 A;  5LJ3 g;  2JOY A;  5CVI A;  1UGS B;  4BDY A;  2JUF A;  3EGX A;  4JRP A;  5LJ3 d;  2CZ6 B;  1NLP C;  2XKO C;  3VS2 A;  1VQ8 Q;  2KT1 A;  3R6N A;  1M30 A;  4F17 A;  2ZZD A;  4LDY A;  2KE9 A;  2K3Y A;  3U23 A;  1M3C A;  3J81 E;  4HCZ A;  3SWN B;  2I0N A;  3MEA A;  2VWF A;  5AT1 B;  2LC4 A;  1D3B B;  3RKW A;  2I2L A;  1G3Y A;  5FU6 C;  4DA4 A;  1MHN A;  3ME9 A;  3X26 B;  2O01 E;  1I81 A;  1X01 A;  2WSC E;  3JCM h;  4GLK A;  1W1F A;  2K5F A;  3CQT A;  2RQT A;  4M7A B;  4CI0 C;  3Q1J A;  1YI2 A;  3CCR A;  1TUG B;  3OW2 S;  3CCU T;  3EGD A;  3JCM g;  3WVE B;  3MEV A;  4HVW A;  4IIM A;  2W0Z A;  1K8A U;  4RTX A;  2PU9 B;  5GAN 2;  3GP8 A;  2CUD A;  2LP5 A;  4XTW A;  3UAT A;  1UG1 A;  5AYF A;  2DJZ A;  4C0F A;  2NYS A;  3VYG A;  2QGF B;  1MUZ A;  2VGN A;  2HCK A;  5LJ5 g;  1ABQ A;  3VUB A;  3I55 Q;  1RLQ C;  2BKD N;  1SRM A;  4C8Q B;  1FWZ A;  2L3S A;  3P8D A;  1YN8 A;  1ZA1 B;  2VUB A;  3V7C A;  5A0D A;  4Z88 A;  2ENM A;  4GLM A;  1VQ9 A;  1I5L A;  4KUI A;  4RCB A;  2QQS A;  2DD4 A;  2QTV A;  5FWC A;  1RL2 A;  1ZQ1 A;  4DOW A;  1NJI C;  3CC2 Q;  3JCM W;  1R0C B;  4C5E A;  3FDR A;  1VQ7 Q;  3EG3 A;  2CS7 A;  1UGV A;  4FT2 A;  4L6V 5;  4B9X A;  2BE9 B;  1N9R A;  1BK2 A;  2HZY A;  1Y7X A;  2RH2 A;  2HSE B;  3EG9 B;  2EGA A;  4Y92 A;  3VUZ A;  1AWW A;  2E70 A;  2RN8 A;  4B6M A;  2YXY A;  3LH0 A;  3M56 A;  3PNW C;  3CCE T;  1GFC A;  2X9H A;  4C5I A;  4DEX A;  4E7Z A;  3OYG A;  4F7U B;  2E10 A;  1K73 U;  1OQK A;  3CMA Q;  3HPW A;  3I56 Q;  1VQ8 T;  4FYX B;  1JU5 C;  1SG5 A;  1M8M A;  3VS4 A;  2QI2 A;  2ECZ A;  3RNJ A;  4JZ3 A;  1U1S A;  3H8Z A;  1G5V A;  3OYL A;  1M2V A;  2RK1 A;  3DB3 A;  1KK7 A;  4J7I A;  1GBR A;  1PSF A;  1JB0 E;  2RHU A;  2LTO A;  1YIT A;  4M7A A;  4AFS C;  2VV5 A;  1B34 B;  2FZK B;  3HSB A;  2FPF A;  2QG9 B;  3CXC P;  1Q82 U;  2AZV A;  5LJ5 e;  1WNL A;  4BE1 A;  1UHC A;  3V8L A;  4DOV A;  1VQK Q;  5IHN A;  2FVU A;  3P8B B;  4M77 E;  5CCA A;  4M7D E;  4JS4 A;  2C06 A;  4BE0 A;  1UTI A;  1WQW A;  2CP0 A;  3CCQ T;  1N27 A;  2ZPG B;  3FJ5 A;  1VQM T;  4A4H A;  3CD6 T;  3G6E T;  1WA7 A;  3TQ7 P;  2JMC A;  3MJX A;  2DVJ A;  4LDU A;  1LNX A;  2K2M A;  2KYM A;  3SWN C;  4C0D C;  1M1G A;  4OB2 B;  4ZGJ B;  3QXE B;  3OYI A;  1WHH A;  2EJ9 A;  2KR3 A;  2R5A A;  3G4S T;  5ECA A;  2QEX Q;  5A0G A;  4RUG A;  1WX6 A;  2MK5 A;  1AZE A;  2P0P A;  2QDY B;  2HDA A;  4M7A C;  1M9S A;  2F1L A;  2LQW A;  2EPD A;  2CZ1 B;  2GNC A;  2HQH A;  1MMN A;  2PVG B;  3G6E A;  2L3R A;  3L1A A;  3CD6 A;  3VV0 A;  3KXT A;  3CME A;  1WJS A;  4FW1 A;  1QMC A;  4BE2 A;  3G71 Q;  1FYN A;  2DA9 A;  2MPX C;  4RG8 A;  3LGL A;  1KC8 R;  3FLG A;  3SFM A;  5GMK j;  3INZ A;  3CMA A;  4JRK A;  4HVV A;  2MWP A;  3V8K A;  4C8Q C;  2E5Q A;  2M51 A;  1K8A C;  3QKJ A;  4D6W A;  1T0J A;  3FB9 A;  3CCM T;  2RI5 A;  1B7T A;  2XDB A;  2DIL A;  4OMP A;  1JXM A;  2OI3 A;  4N4H A;  1SRL A;  1F1B B;  2RQV A;  3UA7 A;  1JO8 A;  2OTJ Q;  4A4E A;  3NPF A;  1OU8 A;  1V29 B;  1N6A A;  1W2B S;  5IH2 A;  4LUE A;  3GLX A;  2RF0 A;  1SHG A;  4C8Q F;  2HKQ B;  4M7D C;  1RAH B;  4PJO E;  3OW2 A;  2OTL Q;  1VQ7 T;  2K6D A;  4C0Z A;  1NG2 A;  4YTL A;  4MZM A;  4CRI A;  1K0S A;  2YUO A;  1Z9Q A;  1DJ7 B;  3OYC A;  1OEB A;  2QQR A;  3G6E Q;  2AT1 B;  2FYK A;  3HKS A;  3QG1 A;  5J39 A;  2RI2 A;  5GAN 5;  1PKT A;  2JM8 A;  2QAS A;  4WF2 A;  3EG1 A;  2AKL A;  3EFO A;  1M27 C;  5LJ5 d;  3CXC A;  3OYD A;  1U06 A;  4J83 A;  2QYZ A;  5KYX A;  3FEO A;  2NUP A;  2EYY A;  2O88 A;  3OBW A;  3M0S A;  2KVQ G;  2XI9 A;  4A4G A;  4DBQ A;  2EJG A;  3SWN A;  2E1H A;  1LOJ A;  3VJP A;  4EMK C;  3OYJ A;  2P4R A;  1K9M C;  2KBT A;  4KUD K;  2JTM A;  4LE9 A;  5KYY B;  2KMT A;  3IQL A;  4M77 G;  1OI1 A;  4M75 E;  2QGG A;  3VKI A;  2W10 A;  5LJ3 e;  1KFZ A;  4F04 B;  1QVG S;  2X3X D;  5GAN 8;  5J26 A;  2D8J A;  3GF5 A;  2D1X A;  2MMP A;  3VS0 A;  2G6F X;  2X35 A;  1G3S A;  5A0L A;  4E7I A;  3JCM V;  3CCL T;  2F5T X;  5GMK i;  2KSS A;  1QCO A;  4J6Y A;  4JLG A;  4N4G A;  2DTH A;  3EHQ A;  1X6B A;  2NWM A;  1TH7 A;  2R57 A;  3PGG A;  1Q81 U;  3JB9 J;  2EYX A;  1WHL A;  2EGE A;  1IXD A;  2LJ3 A;  1AWX A;  2ZAE A;  4P5N A;  1VYU A;  2CP7 A;  4N4I A;  1E7O A;  2L0A A;  2VGM A;  5GAN e;  4BI3 A;  3L42 A;  3MET A;  4X9D A;  2ZPH B;  2KXC A;  1D1C A;  2M1H A;  4OVA A;  1VQ5 A;  1MMG A;  5C6S A;  2CZ7 B;  4M7A E;  4PK4 A;  4HVU A;  3CD6 Q;  4E7K A;  1K9M U;  2M0Y A;  3SD4 A;  1VOM A;  1S72 T;  3L2Q A;  1UUE A;  1HXD A;  2H3J A;  2CSQ A;  2LRQ A;  3I5S A;  5FU7 B;  1E6H A;  3JCM Q;  3GOX A;  4IUQ A;  1X2K A;  1VQ4 T;  1PG5 B;  1X6O A;  3JCM J;  2D0Q B;  2ED1 A;  2B86 A;  1BIA A;  4OMN A;  2EQK A;  3RUX A;  5KYW A;  3VS5 A;  2X4X A;  5KCO A;  4C8Q A;  2RJC A;  3L2U A;  2X4Y A;  4JRQ A;  4EPC A;  1NYG A;  2A3L A;  1OZ3 A;  3CC7 Q;  4MML A;  2L5Q A;  2DO3 A;  3CCR Q;  4LN2 A;  2A7Y A;  2Y90 A;  4PLL A;  1UJY A;  2EYZ A;  2H8H A;  2VYT A;  1Q81 C;  3C95 A;  2E4H A;  1YJ9 A;  1Y0M A;  4RTY A;  2EBP A;  5IAY A;  1LCK A;  2Z0W A;  4J7F A;  1G8X A;  3MPU B;  1C0M A;  2DL4 A;  3EAE A;  4FYW B;  2RQW A;  9ATC B;  5KYY A;  2MAM A;  4PJO C;  3OQ5 A;  2H3E B;  2O31 A;  2O4X A;  1W2B A;  4LD6 A;  1OPL A;  4AFQ C;  1YBY A;  4OMO A;  1JEG A;  1PC0 A;  4GBQ A;  2C0I A;  5KYN A;  3RKY A;  3KUF A;  1TWB A;  1WGS A;  3SB2 A;  5GAN 3;  2M9U A;  4JZ4 A;  2FEI A;  3TVT A;  1UB4 A;  4C8Q E;  1TXQ A;  3L2Z A;  4M75 B;  2BIV A;  5GJW B;  1BIB A;  3T9N A;  5D7U A;  2DKG A;  3VS6 A;  1KC8 U;  4LDW A;  5KYU B;  1BCO A;  1D1B A;  2J7I A;  1R77 A;  1TUC A;  1GRI A;  2ESW A;  1N8R R;  2FG0 A;  4PJL A;  5A2Q E;  1JXO A;  2CP5 A;  3ZL7 C;  1VQ6 A;  4M75 F;  2CRE A;  1PM3 A;  3JCM f;  2DD5 A;  3KBG A;  4A53 A;  5CK9 A;  5IXB A;  4AFU C;  1V76 A;  2DLP A;  5DLO A;  4ZNX A;  1BCM A;  4PLI A;  2P84 A;  2ZGW A;  2LVM A;  4HCB A;  3E2U A;  1IHV A;  5LJ5 j;  4R55 A;  4RTU A;  2JT4 A;  2COY A;  1BBZ A;  3CC7 T;  4DBF A;  2NUT A;  4F7U G;  1FMK A;  4ANJ A;  2DVE A;  4M4Z A;  3JCM c;  1PD1 A;  3PIP A;  5CKH A;  4OGE A;  4LDX A;  3JCM e;  1BYM A;  5CKE A;  2J6F A;  4B9W A;  1YIT T;  4IIO A;  1QVG A;  4QKU A;  1ZBX A;  2E3I A;  2YLB A;  3TRE A;  2HD0 A;  5FLX E;  2K57 A;  5GMK e;  3J7A F;  3OW2 P;  4KH0 B;  5GAO p;  2FRW A;  1OPK A;  4JRI A;  2QA4 A;  2D0N A;  4BD3 A;  2LT4 A;  1M90 U;  1VQ8 A;  2DZ9 A;  1IRE B;  2DEQ A;  2GQV A;  1YIJ Q;  3L2V A;  8AT1 B;  1UJ0 A;  1WDX A;  4PJN A;  5I21 A;  3CME Q;  4MMK A;  2F2X A;  4BY6 C;  4R0K A;  3OYM A;  1KIK A;  1QWF A;  5D6X A;  3OYH A;  1TS9 A;  3HRU A;  1VQM Q;  2GQI A;  2O2O A;  1VQM A;  1BI2 A;  3HFO A;  5GAM d;  1UFF A;  2ZPE B;  3ER0 A;  1PHT A;  2GGR A;  2D9T A;  4C0G A;  1PSE A;  1C1A A;  2F5K A;  4R56 A;  1G3T A;  1HSQ A;  2WSF E;  2KDS A;  2V26 A;  1RAA B;  2IIM A;  2E41 A;  2L3P A;  3UF4 A;  1TTH B;  2LQ8 A;  2FO0 A;  2DL8 A;  1KD1 R;  1ZSZ B;  3I9Q A;  5IN1 A;  1Q81 R;  2AK5 A;  1YWO A;  3CC2 T;  1SF9 A;  3OYK A;  2E65 A;  2JTE A;  2CYZ B;  4DEY A;  3MKD A;  5HKC A;  4OB1 B;  2PUO B;  2HBP A;  2LMJ A;  4Y28 E;  4J9E A;  4L5G A;  4OML A;  4PJO A;  1YJ9 T;  5CO7 A;  1EFN A;  2EFI A;  1WJQ A;  2JXB A;  1G2B A;  3M55 A;  4ELY C;  3ZFJ A;  4LXC A;  1PD0 A;  1WHG A;  2HSP A;  3CCE Q;  2G3R A;  3OYE A;  1M1K U;  2JJ9 A;  2EYQ A;  3NMZ C;  4EMK A;  4XU0 A;  1SEM A;  1YJW A;  2MYS A;  4RG2 A;  4LUD A;  2GF7 A;  1LJO A;  2HQE A;  2QA4 Q;  1D09 B;  3M0U A;  1UDL A;  3EGU A;  2OTJ T;  3J80 E;  1I8F A;  3TCJ A;  1VQN A;  1VQ4 A;  4BB7 A;  3CBP A;  3QJY A;  4KUL A;  4M78 B;  3NTK A;  3PFS A;  3PIO A;  3CC7 A;  1TU0 B;  2KRO A;  2XK0 A;  1NJI U;  3C94 A;  2V1Q A;  4X9C A;  1YJW T;  3JB9 H;  5I22 A;  1RAB B;  4M7D F;  5GAO q;  3PVQ A;  1SSF A;  3QO3 A;  3L2R A;  4C92 B;  3E9F A;  3DLM A;  2L3Q A;  1H8K A;  1K73 C;  2BZX A;  1VUB A;  2ABL A;  1GCP A;  2JMA A;  1OU9 A;  6AT1 B;  1VQ6 T;  1K0X A;  3BE3 A;  3CCS Q;  3M9Q A;  3X28 B;  2L89 A;  2AIR B;  1KQS P;  3MEW A;  3BY7 A;  4NL3 A;  3FIF A;  2OAW A;  2DXB A;  2A37 A;  3OYY A;  4N0A A;  3C12 A;  1VYT A;  1VQP Q;  1RI0 A;  1AD5 A;  3R6O A;  1AT1 B;  1S1N A;  3RBB B;  4M78 E;  1W4S A;  2J6K A;  4FIB A;  5FRM A;  1H3Z A;  1LVK A;  3V7S A;  2J6O A;  2MIO A;  2YRC A;  1YCY A;  1HJD A;  4E7J A;  3OS2 A;  3VYH B;  4C92 D;  1EZZ B;  5LJ5 f;  2CT4 A;  1G3W A;  2FB7 A;  2LJ0 A;  1T3S A;  1T0H A;  3LYI A;  3QPH A;  1KQ2 A;  4M77 D;  1B07 A;  1TSF A;  4DQ2 A;  1NYF A;  1E6G A;  2DYB A;  3NFC A;  1NE8 A;  2DAQ A;  4XTX A;  2BE7 D;  1MV3 A;  4RMO A;  4NOY A;  4CC3 A;  5LJ3 j;  1ZBJ A;  4J9F A;  2YLC A;  4QVC A;  1M90 R;  3ASK A;  2NUP B;  2P0K A;  3GBQ A;  3UDC A;  1M3B A;  2ZPI B;  1VQP A;  4KRT A;  2JW4 A;  3A8H B;  3NTI A;  4N0A C;  1WZO A;  2JS0 A;  4LNP A;  2YRV A;  2LQN A;  1WHK A;  4FU6 A;  3AHU A;  1NZ9 A;  1VQ9 T;  3C0C A;  2NLU A;  1RAG B;  1YJ9 Q;  3H0H A;  1BI1 A;  2VAS A;  2LT1 A;  3S3N A;  4O6J A;  1VQ5 Q;  3VU3 C;  2NUT B;  2K5I A;  1QVF S;  2RO0 A;  3HRS A;  1WPY A;  4ZGD B;  2FL7 A;  1KQS S;  4Q5W A;  2MF2 A;  2LCL A;  3QWY A;  1TUD A;  4HT9 A;  3O5Z A;  3QJ6 A;  4EIK A;  4HCK A;  1K9A A;  4KBM B;  3F70 A;  4E7S A;  2DL5 A;  2K4Y A;  4RTW A;  1TOV A;  1B3Q A;  4HT8 A;  2M16 A;  1VQ4 Q;  1N8R C;  2F69 A;  5GAO l;  2Y4Y A;  4ZTJ A;  1Y07 A;  4C0D B;  1PWT A;  4JJD A;  4XTU A;  1AEY A;  4QVD A;  5LJ3 h;  3A8L B;  5LJ3 f;  4J9B A;  4EMK B;  2DRM A;  4C92 G;  1I0C A;  5LL6 S;  2DNU A;  4A63 B;  2HQX A;  1VIF A;  1U3O A;  1XOV A;  4Y91 A;  3V7R A;  1YIJ A;  2ED0 A;  3MP1 A;  1NEB A;  1NPR A;  1O75 A;  3CCL A;  4XAX B;  2KRS A;  3X24 B;  3BDL A;  2BZY A;  2KI7 A;  3BDU A;  2ATC B;  1IHW A;  2OJ2 A;  5D6Y A;  4AG2 C;  4Z02 A;  2RQR A;  3GPL A;  4RCC A;  2DMO A;  2P0Q A;  4JLI A;  1VQP T;  3GNF B;  1YI2 Q;  2KT8 A;  3EH2 A;  3MP6 A;  3DB4 A;  1OX9 A;  3OYF A;  3CCL Q;  2EKH A;  5M9O A;  4M7D G;  3FRN A;  5GAM j;  4PJO F;  4PFZ A;  3RES A;  1ZSG A;  3QZ9 B;  2E12 A;  3JV3 A;  3JCM b;  1ZUK A;  1YJN T;  1XQH A;  4BUG A;  3DKM A;  2YSQ A;  1SSH A;  1M3A A;  4OMQ A;  3M58 A;  1VIE A;  2IG0 A;  2PVD B;  2ZPF B;  3TSW A;  4D8D A;  3CCJ Q;  1K73 R;  3JRZ A;  4ZGE B;  3SHW A;  1J3T A;  5C0M A;  2OAU A;  3OBY A;  1QVF A;  2EYW A;  4C5G A;  4M78 A;  4OF1 A;  2DRK A;  5CKD A;  5GAN j;  2LJ1 A;  2QQA A;  3H41 A;  4PL6 A;  2RHI A;  2M02 A;  2HL3 A;  2CH4 A;  4PFO A;  4PNO A;  3CBM A;  4F7U E;  2K3B A;  3A5Z B;  4ZN1 A;  2P4T A;  1B34 A;  1QCN A;  3CCV A;  3JB9 F;  1K8A R;  2DE0 X;  4ESR A;  3I55 T;  1HK9 A;  2RA2 A;  3EG2 A;  3OA6 A;  3THK A;  2DXC A;  3MCA B;  2HMA A;  5GAN f;  1WXB A;  2X4J A;  4ATO A;  1ZUY A;  1AWJ A;  2XU8 A;  2CZ0 B;  1PRM C;  3MHX A;  4C8Q G;  1NPP A;  4M75 A;  3RMQ A;  1IB8 A;  4AT1 B;  1VQ5 T;  2DEU A;  3JAM E;  1O9S A;  3EFR A;  3NTH A;  5FRO A;  1XJW B;  3E9G A;  5CAI A;  2PQW A;  5GAN g;  1GFD A;  4M75 D;  5GAM f;  4PKC C;  4QVZ A;  3MO8 A;  1M2O A;  2EQM A;  1KD1 C;  3EFS A;  2MCN A;  1M1F A;  3DLL A;  5EC7 A;  2YUN A;  2PTK A;  3P8H A;  3OS1 A;  3PTA A;  5CIU A;  3A1P A;  3X20 B;  2DET A;  1QW1 A;  1RAD B;  1WFW A;  1K9M R;  4MDX A;  4V2S A;  1JQQ A;  1GL5 A;  3H0F A; 
#chains in the Genus database with same CATH homology
 3A8G B;  4FSX A;  4ZGJ B;  1U8R A;  3V8J A;  3QXE B;  1VQM A;  1JBM A;  3CCV T;  3UPU A;  4E7H A;  3OYI A;  2EJ9 A;  2R5A A;  3G4S T;  1BI2 A;  3HFO A;  5GAM d;  2ZPE B;  1X75 C;  5A0G A;  4QQ6 A;  4OP0 A;  3ER0 A;  1N9S A;  2D9T A;  2R58 A;  4C0G A;  1PSE A;  2P0P A;  2QDY B;  1WJR A;  1Q86 U;  4M7A C;  1M9S A;  3CCR T;  2F5K A;  4JS5 A;  4R56 A;  1G3T A;  4TVR A;  4XTZ A;  2CZ1 B;  2DIG A;  4EDU A;  2WSF E;  3JCM X;  5DY9 A;  2KDS A;  4BI8 B;  3URG A;  4OB3 B;  2MWO A;  2PVG B;  2K5L A;  2L3R A;  3L1A A;  3G6E A;  3CD6 A;  2PUK B;  2E41 A;  5L8R E;  3VV0 A;  3KXT A;  3CME A;  1XNI A;  2LQ8 A;  2WAC A;  4C92 F;  3CPW A;  1JJ2 A;  3GIB A;  4J6X A;  1WJS A;  2X4W A;  3HRT A;  5KH6 A;  4C92 E;  3RER A;  5GMK m;  4BE2 A;  2FHD A;  2R5M A;  5IN1 A;  1OYX A;  4M78 D;  3CPW S;  4M7A F;  4JDS A;  4NL2 A;  5I2M A;  2QEX T;  3CC2 T;  2KAF A;  2CKK A;  2QA4 T;  4UC4 A;  4RG8 A;  2DIQ A;  2E65 A;  2CYZ B;  2XDP A;  3H6Z A;  3LGL A;  3M54 A;  4OB1 B;  5HKC A;  2PUO B;  2HBP A;  2ZPB B;  1H64 1;  3FLG A;  1D3B A;  4Y28 E;  3SFM A;  2RJF A;  4L5G A;  5GAM e;  4PJO A;  1YJ9 T;  5GMK j;  3INZ A;  5CO7 A;  4XU1 A;  1KHC A;  2EFI A;  2WSE E;  5FU7 C;  4JRK A;  1WJQ A;  4MZT A;  3CMA A;  1QP2 A;  2MWP A;  2XDD A;  4HCC A;  3M55 A;  3V8K A;  4ELY C;  4C8Q C;  2E5Q A;  3ZFJ A;  4IUT A;  3CCJ T;  4O5V A;  1K8A C;  3QKJ A;  4D6W A;  3OS5 A;  1UGR B;  3FB9 A;  2G3R A;  3OYE A;  1FXX A;  3CCM T;  1M1K U;  2EYQ A;  2RI5 A;  4HA8 A;  3CME T;  4EMK A;  2JZ2 A;  4XU0 A;  2OTL A;  2XDB A;  5J3B A;  5FRN A;  4M7D A;  3JB9 D;  4N4H A;  4RKU E;  3OS0 A;  2ZCF B;  2K2V A;  3G71 T;  4M77 A;  3G71 A;  3HHT B;  3CCM A;  1YJW A;  2XG8 D;  4RG2 A;  5GMK h;  2GF7 A;  4A4E A;  1I4K 1;  1LJO A;  2HQE A;  4BDZ A;  1VQK A;  1V29 B;  3C4S A;  1N6A A;  4ME7 A;  2PVO B;  3SDZ A;  5KE3 A;  5GAO n;  2RJD A;  1W2B S;  1VQN T;  5GAN 4;  3GLX A;  2OTJ T;  3J80 E;  4C8Q F;  1Y71 A;  1I8F A;  2OTJ A;  4M7D C;  3TCJ A;  4PJO E;  1VQ7 A;  3LWH A;  4QW2 A;  3OW2 A;  1VQ4 A;  1VQN A;  4BB7 A;  3CBP A;  3CBO A;  4EMH A;  3QJY A;  4KUL A;  4M78 B;  3NTK A;  3PFS A;  3PIO A;  3CC7 A;  1VQ7 T;  1IZ6 A;  3G4S A;  2XK0 A;  1NJI U;  3CC2 A;  2V8J A;  4C0Z A;  2XD0 A;  2GFU A;  2LNV A;  3CCE A;  4YTL A;  3LGF A;  1M5Q 1;  4MZM A;  2XID A;  5KE2 A;  4CRI A;  3C94 A;  2RHY A;  1FX7 A;  4IUP A;  3TEE A;  2B8A A;  1OZ2 A;  2E64 A;  4NS5 A;  4X9C A;  3O8V A;  4M75 G;  4M75 C;  1YJW T;  3JB9 H;  3MP8 A;  1DJ7 B;  4M77 C;  5KCH A;  3QBY A;  3OYC A;  3ZEH A;  2JN0 A;  3CCJ A;  3QSU A;  4M7D F;  5GAO q;  4PJO B;  2QQR A;  4JUV A;  2FYK A;  1SSF A;  2EIF A;  4FM4 B;  3QO3 A;  3L2R A;  4BI4 A;  3HKS A;  4C92 B;  1GXI E;  3E9F A;  3QG1 A;  3DLM A;  4A54 A;  5J39 A;  4IUR A;  3OSS C;  1K73 C;  5GAN h;  2LDM A;  2RI2 A;  2VC8 A;  3LLR A;  5GAN 5;  1VUB A;  2QQB A;  3JB9 G;  4WF2 A;  1VQ6 T;  5CQY A;  3FC3 A;  2EQU A;  3M9Q A;  3QZ5 B;  3LX7 A;  2L89 A;  3X28 B;  4C8Q D;  5LJ5 d;  3CXC A;  3MEW A;  3OYD A;  3S3O A;  3BY7 A;  4GY5 A;  4NL3 A;  4XTV A;  3FIF A;  3M4Y A;  3LWI A;  2DK3 A;  4J83 A;  2DXB A;  2HNI A;  3OYY A;  4N0A A;  3OYK A;  3C12 A;  4J5Y A;  3FEO A;  1U1T A;  5FU6 B;  2YHT A;  1RI0 A;  5IT9 E;  2IVW A;  3PT9 A;  3S6W A;  3OBW A;  3CCQ A;  2LCC A;  2GFA A;  3R6O A;  2KVQ G;  5HY6 A;  3QYH B;  4M78 E;  4XK8 E;  1W4S A;  3TU4 K;  2RHZ A;  1KG1 A;  2XI9 A;  4A4G A;  5GAN 6;  2KY9 A;  2EJG A;  4FIB A;  3SWN A;  5FRM A;  1WQ7 A;  4F7U F;  5GAM h;  2E1H A;  2RM4 A;  1LOJ A;  4M78 G;  3VJP A;  4ZTF A;  4EMK C;  1H3Z A;  2XHC A;  5GAO m;  3OYJ A;  1K9M C;  3V7S A;  4KUD K;  3L2W A;  2JTM A;  1YCY A;  2QXF A;  1BI3 A;  4C92 A;  2KMT A;  2KQW A;  4M77 G;  3N5B B;  4E7J A;  3OS2 A;  1OI1 A;  4FT4 A;  4M75 E;  3VKI A;  2E6Z A;  3VYH B;  4C92 D;  5DLQ E;  3UT1 A;  3JB9 I;  2L8D A;  5LJ3 e;  5LJ5 f;  1JRI A;  1G3W A;  1QVG S;  1VQO T;  3OYA A;  2FB7 A;  5GAN 8;  1KC8 C;  1KHI A;  2E6N A;  3LYI A;  3QPH A;  2DXT A;  5J26 A;  3MEU A;  4M77 D;  1KQ2 A;  5HK0 A;  4DQ2 A;  3GF5 A;  2MMP A;  1EIF A;  4X34 A;  3WXM B;  2GCX A;  2X35 A;  1G3S A;  5A0L A;  4E7I A;  4HKE A;  3NFC A;  1NE8 A;  2RK2 A;  2DAQ A;  2F5T X;  4II1 A;  3JCM V;  3CCL T;  4XTX A;  2LQK A;  2KSS A;  4J6Y A;  4JLG A;  5GMK i;  4N4G A;  1QP3 A;  2DTH A;  4XTY A;  2RHX A;  3PMT A;  4NOY A;  4RMO A;  5LJ3 j;  1MGQ A;  2YLC A;  4QVC A;  1KD1 U;  1TH7 A;  1XTD A;  3ASK A;  2P0K A;  3BW1 A;  3UDC A;  2DTI A;  2R57 A;  3OB9 A;  3PGG A;  5CQX A;  1BKB A;  1YHQ A;  1Q81 U;  4LD9 K;  3JB9 J;  2RB6 A;  2ZPI B;  3ZBD A;  3HFN A;  1VQP A;  1KQ1 A;  1Y96 B;  1BI0 A;  2M0O A;  3A8H B;  4JJN K;  4P5N A;  3NTI A;  4N0A C;  2EAY A;  3A8O B;  2YRV A;  3I56 A;  4BY6 B;  3I55 A;  4BAC A;  4FU6 A;  4N4I A;  3AHU A;  1VQL T;  1NZ9 A;  4L59 A;  1VQ9 T;  3JSC A;  4XU3 A;  2NLU A;  1Q82 C;  2VGM A;  4M7D D;  3QII A;  4J8O A;  4BI3 A;  2RJE A;  3FJP A;  3L42 A;  5GAN e;  3MET A;  4X9D A;  3RIR A;  2ZPH B;  4PJO G;  1BI1 A;  2M1H A;  4OVA A;  1VQ5 A;  3OYN A;  2LT1 A;  3S3N A;  5C6S A;  2CZ7 B;  3OSV A;  4O6J A;  3VU3 C;  1VQL A;  4M7A E;  4E7K A;  2CGH A;  4VUB A;  3CCU A;  2K5I A;  4C92 C;  1K9M U;  2RO0 A;  1QVF S;  2QTX A;  3HRS A;  3SD4 A;  4C5H A;  3QUI A;  1YHQ T;  1WPY A;  2D6F A;  1M4Z A;  4QQG A;  4ZGD B;  2FL7 A;  3L2Q A;  1HXD A;  1S72 T;  4XQ3 A;  1S72 A;  4Q5W A;  1KQS S;  2DXU A;  2H3J A;  4A4K A;  2MF2 A;  2LCL A;  2LRQ A;  2VXE A;  3QYG B;  5FU7 B;  3GOX A;  3JCM Q;  4J6W A;  4M7A G;  4HT9 A;  4IUQ A;  2XIC A;  1YJN A;  3QJ6 A;  3CC4 A;  1Y96 A;  4OB0 B;  5GAM g;  4KBM B;  1VQ4 T;  3F70 A;  1X6O A;  3JCM J;  2D0Q B;  5HK3 A;  1Q7Y C;  2K4Y A;  3E19 A;  1BIA A;  4OGC A;  5CKF A;  3CCS T;  5EG2 A;  4HT8 A;  2EQK A;  2M16 A;  2V8I A;  4MZP A;  3RUX A;  1N8R C;  2F69 A;  2X4X A;  5GAO l;  2Y4Y A;  4QQD A;  1Y07 A;  4ZTJ A;  5KCO A;  4C0D B;  4C8Q A;  5GAO r;  2RJC A;  3L2U A;  2X4Y A;  3I56 T;  4JRQ A;  4KT0 E;  4XTU A;  4EPC A;  1P92 A;  4QVD A;  5LJ3 g;  2JOY A;  2A3L A;  5CVI A;  1UGS B;  1OZ3 A;  4M77 B;  5DM7 R;  1M90 C;  5LJ3 h;  3A8L B;  2Y4X A;  3M59 A;  5LJ3 f;  4MML A;  3RMS A;  2L5Q A;  4BDY A;  2JUF A;  4M7D B;  4EMK B;  4JRP A;  2DO3 A;  4C92 G;  5LJ3 d;  2CZ6 B;  3JCM d;  2A7Y A;  5LL6 S;  2Y90 A;  2XKO C;  3M4G A;  4PLL A;  2VYT A;  1Q81 C;  2HQX A;  1R8O B;  1VIF A;  3C95 A;  5I2S A;  1XOV A;  2ZZD A;  4LDY A;  4Y91 A;  3V7R A;  1YJ9 A;  2EKO A;  2K3Y A;  1YIJ A;  5IAY A;  3J81 E;  3MP1 A;  1UGQ B;  4HCZ A;  3OMG A;  5GAN d;  3QDR B;  4OMF B;  3E1S A;  3SWN B;  1NPR A;  3MEA A;  1O75 A;  2LC4 A;  1D3B B;  4IUV A;  3CCL A;  4J7F A;  4XAX B;  4M78 F;  3EAE A;  3X24 B;  3BDL A;  2MAM A;  3RKW A;  3BDU A;  4PJO C;  3OQ5 A;  2I2L A;  4PJO D;  2O4X A;  5D6W A;  2EQJ A;  1W2B A;  4LD6 A;  1G3Y A;  5FU6 C;  4DA4 A;  1VQK T;  2EWN A;  1MHN A;  3ME9 A;  3X26 B;  2O01 E;  1I81 A;  1X01 A;  3HL8 A;  1YBY A;  5D6Y A;  3A8M B;  2WSC E;  3JCM h;  1JJ2 S;  4GLK A;  2K5F A;  4Z02 A;  1VQO A;  3GPL A;  4CI0 C;  4M7A B;  1YI2 A;  3Q1J A;  4RCC A;  2P0Q A;  3CEY A;  4JLI A;  1VQP T;  2V8K A;  3GNF B;  3RKY A;  3KUF A;  3UWN A;  3MP6 A;  3DB4 A;  1WGS A;  3OYF A;  3SB2 A;  3CCR A;  3OW2 S;  3CCU T;  5GAN 3;  2M9U A;  3JCM g;  4LDV A;  4M78 C;  5M9O A;  3CCS A;  3FRN A;  4M7D G;  1YI2 T;  3WVE B;  2K3X A;  5GAM j;  3MEV A;  1M8V A;  4PJO F;  5LJ5 h;  3RES A;  1K8A U;  1UB4 A;  2E12 A;  3QZ9 B;  4C8Q E;  2PU9 B;  3L2Z A;  4M75 B;  5GAN 2;  3GP8 A;  2BIV A;  3JCM b;  5CR2 A;  1BIB A;  4XTW A;  3CC4 T;  1YJN T;  3T9N A;  1XQH A;  2DKG A;  5CKB A;  4BUG A;  5AYF A;  3DKM A;  4F7U A;  1KC8 U;  2DJZ A;  4C0F A;  3VYG A;  4LDW A;  4EMG A;  2QEX A;  3M58 A;  1VIE A;  2IG0 A;  2PVD B;  2ZPF B;  2VGN A;  3JRZ A;  4ZGE B;  5LJ5 g;  3VUB A;  2KK4 A;  5C0M A;  2BKD N;  3GNG A;  2OAU A;  3OBY A;  4C8Q B;  1FWZ A;  3PMI A;  2RI3 A;  1Q86 C;  3P8D A;  1QVF A;  2VUB A;  4C5G A;  5A2Q E;  3V7C A;  4E47 A;  5A0D A;  4M78 A;  4OF1 A;  5GAN j;  5CKD A;  1M1K C;  1VQ6 A;  1VQ9 A;  2RD1 A;  4M75 F;  3JCM f;  2DPP B;  2QQA A;  1I5L A;  4KUI A;  4ZN3 A;  2DD5 A;  3KBG A;  4M77 F;  2AHJ B;  2DD4 A;  2QQS A;  4PL6 A;  4RCB A;  1RL2 A;  4A53 A;  2RHI A;  5CK9 A;  3M5A A;  1ZQ1 A;  4DOW A;  1NJI C;  3JCM W;  4PNO A;  3CBM A;  5DLO A;  4C5E A;  4F7U E;  3FDR A;  3LW5 E;  3QHS A;  3S3M A;  3A5Z B;  4PLI A;  2ZGW A;  4ZN1 A;  2P4T A;  1B34 A;  3CCV A;  2CS7 A;  3G7Z A;  2VXF A;  2JVV A;  4FT2 A;  2LVM A;  4L6V 5;  4B9X A;  3JB9 F;  4HCB A;  3I55 T;  1HK9 A;  2EJF A;  1N9R A;  2RH2 A;  1Y7X A;  2RA2 A;  5LJ5 j;  3OA6 A;  3VUZ A;  2E70 A;  4IKF A;  4R55 A;  3WVD B;  2DXC A;  3LH0 A;  3M56 A;  3PNW C;  3MCA B;  4IUU A;  3CCE T;  3CMA T;  4MDW A;  5GAN f;  3CC7 T;  2X4J A;  3M57 A;  4C5I A;  2DTO A;  4ATO A;  3OYG A;  4XU2 A;  4F7U B;  5GAN 7;  1AHJ B;  2E10 A;  2CZ0 B;  2XU8 A;  1K73 U;  3HPW A;  3CXC S;  3MHX A;  4F7U G;  4C8Q G;  1NPP A;  1VQ8 T;  2DVE A;  3JCM c;  4M75 A;  3RMQ A;  4M7A D;  1UGP B;  1VQ5 T;  3PIP A;  5CKH A;  2QI2 A;  2LX9 A;  4OGE A;  1YIJ T;  2QQ9 A;  4LDX A;  1N8R U;  3JCM e;  1U1S A;  3H8Z A;  1Q7Y U;  1BYM A;  1G5V A;  1UEB A;  5CKE A;  4B9W A;  3BFM A;  3JAM E;  3OY9 A;  3OYL A;  1O9S A;  2RK1 A;  3DB3 A;  1YIT T;  2OTL T;  1QVG A;  4J7I A;  3EFR A;  1PSF A;  3NTH A;  1ZBX A;  2JTF A;  5FRO A;  1JB0 E;  3RKX A;  3E9G A;  5CAI A;  2PQW A;  2LTO A;  2RHU A;  1YIT A;  4M7A A;  4FL6 A;  2YLB A;  2VV5 A;  5GAN g;  1QVP A;  2HD0 A;  4M75 D;  3TRE A;  1B34 B;  5FLX E;  4PKC C;  5GAM f;  2K57 A;  3HSB A;  5GMK e;  3J7A F;  4QVZ A;  1Q82 U;  1KQS A;  5GMK l;  3MO8 A;  5LJ5 e;  2O4X B;  3CPF A;  2EQM A;  5GAO p;  1KD1 C;  2DZC A;  1WNL A;  3EFS A;  4BE1 A;  4A4F A;  4JRI A;  2JNG A;  3V8L A;  4BD3 A;  4DOV A;  2QA4 A;  2BUD A;  2FVU A;  2LT4 A;  3P8B B;  4M77 E;  1M90 U;  1VQ8 A;  2DZ9 A;  5CCA A;  1M1F A;  3JCM P;  3DLL A;  3M53 A;  1IRE B;  2DEQ A;  2GQV A;  4JS4 A;  4M7D E;  2C06 A;  1ZHI A;  3L2V A;  4BE0 A;  1WQW A;  3X25 B;  3OS1 A;  3P8H A;  3PTA A;  5I21 A;  2MI6 A;  3CCQ T;  1N27 A;  2ZPG B;  5CIU A;  4MMK A;  2HAX A;  3OMC A;  3X20 B;  4A4H A;  3OYB A;  1VQM T;  3CD6 T;  4BY6 C;  3G6E T;  1QW1 A;  3OYM A;  5D6X A;  4LDU A;  1LNX A;  4ELZ C;  3HP9 A;  4E7L A;  3OYH A;  4MDX A;  4V2S A;  3HRU A;  3SWN C;  4C0D C;  1M1G A;  4OB2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...