4EMKA

Crystal structure of splsm5/6/7
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
b'LPLELIDKCIGSNLWVIMKSEREFAGTLVGFDDYVNIVLKDVTEYDTVTGVTEKHSEMLLNGNGMCMLIPGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm5
publication title Crystal Structures of Lsm3, Lsm4 and Lsm5/6/7 from Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
total genus 14
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4emkA00
2DTOA 3JCMe 4C92C 1HXDA 4F7UA 5GANd 5GAN2 4XTWA 3SWNC 4M78C 4M77E 1U1SA 2RD1A 4M78G 4NOYA 4M77B 1KQ2A 4XU3A 3L1AA 2K57A 2QTXA 4MMLA 3JCMf 4WF2A 5GAN7 4M7DC 1JBMA 2Y90A 4M7AF 3BDUA 4QVDA 1JRIA 5GAMh 3JB9D 3QUIA 4N0AA 3JB9I 4V2SA 4F7UE 5GAOl 4M7AA 5LJ3f 3V8KA 4M77F 4JRKA 5GAN4 2RB6A 2RM4A 2YLCA 4J5YA 5GMKm 5GMKj 3RERA 3BY7A 3JCMJ 3GIBA 3EFRA 2RA2A 4DQ2A 4M75C 4A53A 4C92A 5LJ5j 5GANf 1LJOA 3EFSA 3RKYA 5DY9A 5GAMg 3JB9H 1YCYA 3QO3A 4C8QD 4M75B 4F7UF 4XU0A 3JCMb 2EAYA 3JB9G 4EMKC 4M7AE 1LNXA 2DZ9A 5GANj 4M7DA 3BFMA 1D3BB 1HK9A 5LJ3h 4EMKB 1I5LA 1BIBA 4C92E 3M4GA 4C92B 4X9CA 3SWNB 4M78B 5GMKi 4M75F 5GAN3 1N9SA 4C8QC 1TH7A 1X01A 2VC8A 3PGGA 4C8QG 5GAMe 3HSBA 4A54A 4M75A 4M7DE 3V8LA 5LJ5f 2EWNA 5GAOm 2YHTA 2DJZA 4M7DB 3AHUA 4XTYA 2E64A 5LJ3g 4XTZA 1D3BA 4HA8A 4OP0A 4C92F 4HT8A 2E41A 4MMKA 4EMKA 4M78F 4PJOD 1LOJA 1I4K1 5GAOp 3JCMW 2CGHA 3SWNA 2DEQA 3FIFA 4M78A 3SB2A 3INZA 3JCMh 3JCMV 2HNIA 4M75E 3RESA 5GAN6 4XTUA 4M7DF 2DKGA 1H641 1M5Q1 2DXUA 2EJFA 4RCBA 5GMKe 5GMKh 5GAMd 3FB9A 3V8JA 4C8QA 5LJ5h 3HFNA 5LJ3e 3RKWA 3HFOA 4M7AD 3QSUA 4JLIA 4XU1A 4F7UG 2EJ9A 3RIRA 3JCMP 4PJOG 4PJOC 1M8VA 4M78E 3JCMg 4J6XA 2E10A 3V7CA 4M77D 5GANe 1MGQA 4NL2A 3QHSA 1Y96A 4XQ3A 4C92D 2E65A 5GANh 3VU3C 2DTHA 4XTXA 3RKXA 4Y91A 5LJ5g 4C8QE 3JCMQ 3JB9F 4RCCA 4C8QB 5I21A 1WNLA 3L2ZA 4JUVA 4JRIA 4M7AC 1WQ7A 4M7DD 1I8FA 4XTVA 4M7AG 1B34B 5LJ3d 3FJPA 1I81A 5GANg 2ZGWA 4M77C 3JCMc 1Y96B 4M77G 4HT9A 2DTIA 2DVEA 4X9DA 4C92G 4C8QF 5GAMj 4PJOA 4PNOA 2VXFA 5CAIA 5GAOr 4J6WA 5LJ5e 3JB9J 4M75D 1U1TA 4J6YA 4EMGA 5GAOn 3JCMX 4M7DG 2DZCA 3RUXA 4QVCA 1BIAA 1B34A 2VXEA 2DXTA 2YLBA 5GAN8 3BW1A 5GAOq 4PJOE 4F7UB 4NL3A 2E1HA 4PJOB 3JCMd 2EJGA 1N9RA 2FB7A 3V7SA 4M78D 2FYKA 1WPYA 5GMKl 1WQWA 1KQ1A 4M77A 3V7RA 4N0AC 4M75G 5LJ5d 5LJ3j 5GAMf 5GAN5 4EMHA 2JN0A 4PJOF 4M7AB 2I2LA 4XU2A
chains in the Genus database with same CATH superfamily
2D0NA 1ZHIA 2AZSA 2V26A 2JW4A 4IUQA 4PLIA 1YIJT 1WDXA 4F7UE 3EG9A 3GLXA 1QW1A 5GMKm 1SHFA 4DBQA 2LQ8A 4N4GA 5DY9A 4D8DA 3OYIA 1CSKA 1VQ9A 3EG9B 2VYTA 2F1LA 3OYCA 2C06A 2LNHB 1X01A 1U5SA 1VQ5A 5CIUA 1JQQA 4CC2A 1VQMA 3UA6A 4HCBA 4OGCA 2X4JA 2DD4A 1V76A 4UC4A 4PJOD 3EH1A 1I4K1 1Q95G 2NYSA 4A4HA 2L8DA 4E7KA 1LCKA 2QEXT 4RCBA 2QQSA 4YTLA 1RUWA 1M90U 3HFOA 1MMGA 4IUTA 4PJOC 3OBYA 1M8VA 3RIRA 2BE9B 2M1HA 4LNPA 3V7CA 1WXBA 4FT4A 4BUGA 3JCMQ 2ZZDA 4JRIA 4KH1B 1QVFA 1JO8A 5D7UA 3H0HA 1UDLA 1ZUUA 5IXBA 2X35A 2DTIA 4GLMA 1ZBXA 1PNJA 2LVMA 3BDLA 1WXUA 2WACA 4J6WA 2HKQB 5GAOn 3VUZA 2DX1A 4DEXA 5HKCA 1IHWA 2EJGA 3META 4EIKA 2D1XA 5GMKl 3C12A 1RACB 2RF0A 2XMFA 1VQ4Q 3A98A 2DEUA 4BI3A 2K3XA 4M78G 3CEYA 1RAHB 2ZPHB 2EQUA 4M7AF 4DBFA 3V8KA 2MWOA 1ZA1B 4J9BA 2GTOA 1OPKA 2E6ZA 5IAYA 4A53A 1TU0B 1G3SA 3MP8A 2E5QA 4OMNA 3VKIA 2DZ9A 3SEMA 1HK9A 2HL5C 1RL2A 2AT1B 1G8XA 3M0UA 4M75F 1YJ9Q 1NYGA 2DXCA 5GAOm 4E7ZA 3C4SA 2FPDA 4OMPA 5FWBA 4C92F 2HBPA 1W4SA 1VQ6Q 3CCMA 1GCQC 1JJ2P 5DLOA 5GAOp 3JCMW 3SB2A 2YRCA 2EVRA 5GAN6 1GRIA 3DLLA 1M5Q1 3MP6A 1H3ZA 1HD3A 4RKUE 1BYMA 2F5TX 1VQ8T 4OB3B 1VQ7Q 3OBWA 1FYNA 4BI8B 5GANh 4F16A 4XTXA 3A5ZB 2XU8A 5LJ5g 3JB9F 1NM7A 1IB8A 1QCFA 2ZPBB 2QDYB 1D1AA 5LJ3d 3MCAB 2ZGWA 1G5VA 4HT9A 2LCSA 1Q86U 4Z02A 3LGFA 1QQJA 1YIJQ 2RQUA 3SFMA 5KYYA 5FRMA 1BCMA 3CC2A 3HRSA 4JZ3A 2X4XA 1UHFA 1RAFB 1BK2A 2QQAA 5KYYB 4LN2A 3TSZA 4E7LA 2MMPA 4F7UA 2M9UA 2RI2A 4BE0A 2K3BA 3TREA 1QVFS 3L1AA 1HSQA 2RJCA 2E4HA 1U3OA 4VUBA 2G3RA 2COZA 3CCRT 3EGUA 1M1FA 5KYNA 5D6XA 5GAOl 3X25B 2EKOA 4LDXA 4QKUA 2FZCB 2ROTA 4IURA 2RA2A 3C95A 4DQ2A 2QEXQ 1M90C 2CSIA 2NUZA 2KI7A 1X6GA 3BFMA 4F14A 1UGQB 2LJ0A 3OS1A 1PKSA 2NWMA 4C92E 4J9IA 2K79A 2QXFA 1UFFA 3ASKA 5LJ5f 2YHTA 4J7FA 2JTMA 1WI7A 1JU5C 2A37A 1G3TA 3CCQA 3FIFA 2VVKA 3M54A 4B9WA 3FB9A 3OB9A 1IRXA 1VQPT 4HVWA 4PFOA 2IG0A 1SSHA 3CXCA 2C0TA 4C5EA 2SRCA 2EQMA 1NE8A 4Y91A 2F5KA 2NUPA 3L2ZA 3CCLA 1WA7A 4M7DD 2O2OA 2M02A 2YRDA 3I55A 3CCVT 3KXTA 4C8QF 1PG5B 2NUPB 4OB2B 2VV5A 4O6JA 4QVCA 1C1AA 2YLBA 1B34A 3HTRA 1ZSZA 2OTJA 4DBHA 1WZOA 4LDWA 4HXJA 2YUPA 3NGPA 3EG0A 4LUDA 2JMAA 4X34A 1ZSZB 1M4ZA 2HL3A 5GAN2 2EW3A 3I35A 2XD0A 2QTXA 4C0DB 3JCMf 2LTOA 2MPXC 2FEIA 6AT1B 2RJEA 1RAEB 5IT9E 1VQ4A 3VRZA 3QDRB 2D6FA 2LT4A 4HVVA 2RM4A 2LC4A 1ZQ1A 5AYFA 5GAMg 1VQ8Q 3CCJA 1M9SA 2YUNA 1YITT 2CREA 4QQDA 2RHYA 2KXCA 1MMAA 1NZ9A 1M1GA 1TG0A 5A0LA 1I1JA 1WHGA 2V8KA 4J9HA 3UF4A 2RK1A 1D3BA 4FT2A 1K73R 1Q86C 4EMKA 3M0RA 1XNIA 2ENMA 2COWA 3REBB 1QLYA 2FRYA 2X3XD 3GBQA 1KD1U 1H641 2JJ9A 5GMKh 2ESWA 2EQIA 3DKMA 1YJ9A 5LJ5h 1YHQT 1BI0A 2MYSA 4RMOA 1MGQA 2Y4YA 4OMOA 4A63B 4C8QE 5J26A 4N4HA 1ZSZC 3LWIA 3F70A 2AZVA 3FJPA 2R58A 2EGAA 3S3NA 1VQ7A 1MV3A 1UE9A 4L59A 4C0DC 1T3LA 5IHNA 1VA7A 3CCRQ 4PJJA 1D1BA 5LJ5e 1O75A 2EFIA 2YXYA 1K9AA 1KQ1A 2A0FB 1BU1A 5GAMf 2L3RA 3CXCS 4B9XA 1K1ZA 2JN0A 3OS5A 1GFDA 2LMJA 2I2LA 1UGVA 1WIEA 1D0XA 4M7AB 3SDZA 4CC7A 2DAQA 2KNBB 2FPEA 3L2QA 2FO0A 4J9DA 1N8RU 1KQ2A 3G1JA 4XU3A 2DK3A 3CMET 1T0HA 2ROLA 2FZKB 2LX7A 2QTVA 3CBPA 3VRYA 5FLXE 2G6FX 3UWNA 2FPFA 4J9EA 8ATCB 3NTKA 2RHIA 4C92A 3HHTB 1QVFP 1ARKA 3TQ7P 1VQPQ 3GOXA 4M75B 2XKOC 1X2QA 4EMKC 2KSSA 5GANj 4MZPA 1YP5A 2LCCA 1BIBA 4C92B 2CH4W 2PUKB 1N9SA 2QEXA 2DLPA 2J05A 3TU4K 2EWNA 2HMAA 2E64A 3CCVQ 4HA8A 2B8AA 3QYHB 1M3AA 4OB0B 1PC0A 3JCMe 1NJIU 3JCMV 4HCCA 3INZA 4M7DF 4XTUA 2DXUA 4FSSA 1X6BA 1FMKA 3BE3A 3G7ZA 4M7AD 2YDLA 3A8LB 4Z8AA 1SHGA 1NPRA 3I5SA 1PRLC 1QP3A 1ZA2B 2IIMA 2CZ0B 2JNGA 4M7AC 3QXEB 1G83A 4M77G 2DVEA 3CD6T 2EPDA 4M75D 1AZEA 4FW2A 2EQKA 2SEMA 2IPOB 3BW1A 4ZTFA 5FU6B 2R5MA 4BACA 1X6OA 5L23A 2D0QB 4J7IA 2EYYA 1YITQ 1WXTA 2A08A 3FLGA 4IUPA 4C92C 1WHHA 4C0GA 1X27A 2X51A 2KK4A 4IKFA 5A0GA 1MMDA 1RLPC 2GNCA 4WTOB 3GNFB 3M4YA 5GAMh 3JB9D 3QBYA 3QUIA 1KSWA 2RB6A 1G3YA 1RAGB 1KD1C 1B07A 2KE9A 3GF5A 3MO8A 4BB7A 3JB9H 1YHQQ 4Y92A 1GCPA 1ZUYA 3S6WA 1VQKT 1R8OB 2L3PA 3QZ9B 3M4GA 5GAMe 4Q5WA 3MKDA 4M7DE 3V8LA 1VQ8A 3PE0A 1SPKA 1UEBA 1WYXA 4XTZA 3QWYA 3PFSA 2QASA 1WJSA 2CS7A 4M78F 1QWFA 2GQIA 2DEQA 1U06A 3RESA 2W0ZA 3CC4Q 4A4FA 1YBYA 4C8QA 1UUEA 1M1KR 2O01E 5CCAA 4F7UG 3P8DA 1TOVA 2LP5A 4C8QB 5KYUA 5J3BA 2CH4A 4JUVA 2CP6A 4E2FB 2OTLT 3M0QA 5D6WA 1HYOA 3CMEQ 2L2PA 3FJ5A 4X1VA 5KYUB 3OW2P 1WHMA 1IGUA 1WJRA 2EYWA 3M57A 2CP3A 4OMQA 1AT1B 1GCQA 3CCST 1K8AU 2XDDA 2K9GA 3G4ST 2LNVA 4EMHA 4OF1A 2P4TA 1M1KC 1Y0MA 3M58A 3UDCA 1IGQA 4XTWA 3L2RA 4NOYA 2M0YA 2VASA 4ZGDB 4MMLA 2F2XA 2O4XB 2J06A 2DL4A 3CXCP 2O31A 1UGPB 1OQKA 2HEQA 4RTTA 1NJIC 2DFUA 3CCEA 1D09B 1SG5A 2L3SA 5GMKj 5LJ5j 2JUFA 1Y57A 2DERA 4R0KA 2ZAEA 4C8QD 1AOJA 4DOWA 2LRQA 5KCOA 1K9MU 2P4RA 1VQOT 1UJ0A 2CP7A 1U8RA 5AT1B 2HQHA 1UHCA 4C8QC 2VC8A 3PGGA 2GTJA 1AZGB 2PUOB 1VQPA 2I0NA 1UB4A 3EAEA 2P0PA 3G6ET 1KC8U 1OV3A 3CD6Q 2PU9B 1LOJA 2KDSA 3PVQA 1GBQA 2DKGA 2EJFA 4QVZA 2DL7A 1Q7YU 4JLIA 2QA4A 2KBTA 2GF7A 1FMVA 4XQ3A 1R77A 2MOXA 2EYXA 5I21A 3LGLA 4NS5A 1M3CA 2CSQA 3PIPA 1JXMA 1ZX6A 2PVDB 3URGA 2J6OA 3GNGA 2RJDA 2M0OA 4CC3A 5M9OA 5KE2A 1UGRB 1N9RA 2X9HA 2FYKA 1KG1A 1PRMC 1QKWA 5HY6A 3A8HB 1MV0B 4RG8A 1VQKQ 5CO7A 3R6OA 3VJPA 1YFNA 5GANd 1FXXA 1M90R 4JJBA 3CPWA 1BCOA 2QQRA 3M0SA 1YITA 3OYDA 2R5AA 4D8KA 2DL3A 1VQ9T 2D8HA 2ED0A 1VIFA 3MEVA 5I22A 3RKYA 1Q81U 4MZTA 4XAXB 4M7AE 2EAYA 4M7DA 2XHCA 2L3QA 4LDVA 1G2BA 2RHUA 4CRIA 1Q82U 4PJMA 1VQNT 3OY9A 2OTLQ 1D0YA 1PD1A 1AWJA 1YHQA 4M7DB 1PWTA 3VS3A 3NTHA 4GY5A 4ANJA 2RQWA 4PKCC 2CGHA 4O5VA 5IH2A 1KJWA 3WXMB 4M75E 5CKHA 3M5AA 1RAAB 3DLMA 2ZPIB 1K8AC 4JS4A 1G3WA 3CCSQ 2DO3A 4II1A 1B3QA 1TTHB 3JCMg 1E6GA 1YWPA 3I5RA 3VUBA 1OOTA 1VYUA 1N6AA 3G4SQ 1S72T 2YUOA 3FEOA 4RCCA 2M16A 5CK9A 1KQSA 4OMLA 4C5IA 1I8FA 3RMSA 1MNDA 4RG2A 3I9QA 4C92G 5GAMj 3E19A 2KT8A 5GAOr 1I5OB 2DBKA 2ATCB 4AG2C 2VWFA 3RUXA 1LPLA 3CMAQ 1NEGA 5LL6S 4AFZC 2LJ1A 1WFWA 3FRNA 2FHDA 4FCYA 2VGMA 3PMTA 3OYEA 3CMEA 1OU8A 4PFPA 1Y07A 2MIOA 5GAN5 2E6NA 4RUGA 4LDUA 1VQOQ 2KRNA 2EYZA 3A8GB 1GBRA 3RR6A 2CZ7B 4BI4A 2JM8A 3O5ZA 5KH6A 4MDXA 2K57A 4PJNA 3HRTA 1BB9A 3EHRA 4L6V5 1K0SA 4M7DC 2F69A 2LCLA 2Y90A 5CKDA 2BZXA 3G6EQ 1KC8C 1M3BA 1TS9A 2HSEB 4JJDA 2X4WA 3RERA 2PVOB 1AHJB 2DRKA 1MNEA 1ZUKA 2LQKA 1Q7YC 4F17A 1MHNA 4OMMA 1Q86R 2BUDA 5DM7R 4E6RA 1M8MA 2BIVA 3M53A 3VV0A 3SWNB 4M78B 3J7AF 2X3WD 3LLRA 1RABB 1AWXA 2O88A 3AHUA 4IIOA 3CPWS 1VQLT 1M2OA 3OYJA 3CBOA 1C0MA 3EH2A 2DF6A 1OYXA 4FSXA 1NLOC 2DILA 3CC7T 4ZGEB 4PJOG 2DXBA 2QI2A 4J6XA 2MF2A 3CD6A 3OYBA 2E12A 4KH0B 5GJWB 2EGEA 1QWEA 1XOVA 4BD3A 1X2KA 1W1FA 4MDWA 3M55A 3M0PA 2QK0A 4J6YA 4J8OA 4AMCA 1O9SA 3L2UA 1VQ9Q 2P0KA 2L89A 4JJNK 3EG2A 3OYNA 1ZBJA 2MCNA 1SRLA 1VQ6A 5C0MA 1X69A 3G71T 4M78D 1Q81C 1KIKA 3JRZA 2OAWA 3FC3A 4LDYA 1OZ3A 3DB3A 4L5GA 4AFUC 5LJ5d 1P92A 5J39A 3OS0A 4F04B 1D1CA 4QT7A 3SWNC 4M78C 1VQNQ 1KQSS 1AWOA 4DOVA 1NG2A 1TXQA 3PT9A 5FW9A 5FWCA 3CC4T 2DVJA 1VQKA 2DL5A 2DIQA 5A2QE 4M7AA 1V1CA 2W10A 4ZNXA 4M77F 2AKLA 2JOYA 2QQBA 3ZEHA 2AIRB 2PZ1A 3GIBA 1SEMA 1E7OA 2BZYA 1YIJA 2GCXA 3EGDA 1ZLMA 2V1QA 3OS2A 3HKSA 2WSCE 2ZCFB 2QGFB 4R56A 3EFOB 3QIIA 4KUIA 2HSPA 1UTIA 4AFQC 1S72Q 2BE7D 1Y71A 3RNJA 3N5BB 5ECAA 1WGSA 3EGDB 1SRMA 3CCQT 2A36A 3A8MB 4M75A 2DIGA 2COYA 3KUFA 4PLLA 3LYIA 2RK2A 3OMGA 3MJXA 1AD5A 1RADB 2FG0A 4HCZA 4RTZA 1QMCA 2XICA 3JCMh 1JB0E 4B6MA 1YJWT 4RTUA 5I2MA 2OTLA 3V8JA 2K2MA 3KBGA 3NPFA 1YI2T 4PK4A 2HZYA 5HK3A 3EG3A 1YN8A 1UG1A 2RO0A 3I55T 3JSCA 2CT4A 2V1RA 3ZL7C 1WHLA 3A8OB 3RBBB 1WNLA 1EIFA 1WQ7A 4KBMB 4FYVB 3J80E 2DYBA 2LQNA 3CCSA 3LW5E 1PCXA 1H92A 3VYGA 5EG2A 3QWXX 3G4SA 1SSFA 2K6DA 2HKNA 3JCMX 2GQVA 3SD4A 4IIMA 1HJDA 4QQ6A 1YJNT 1JEGA 3GPLA 1WPYA 2A28A 4JLGA 3PIOA 1H3HA 2OAUA 3NTIA 2ZPGB 2CP0A 1SF9A 4KUDK 4HCKA 9ATCB 4J9GA 1MMNA 4FU6A 1KD1R 2B86A 1IZ6A 2NLUA 1U1SA 4M77E 1FWZA 2MWPA 2AK5A 3ER0A 2D8JA 3HRUA 1VQLQ 1JRIA 2JXBA 3CCJT 1IHVA 1VQOA 4JRPA 4JZ4A 4M75C 5CVIA 4RTVA 2JT4A 3CC7Q 2CP2A 2VKNA 2D9TA 4BE2A 3G6EA 2PTKA 4ELZC 3HSBA 4RTXA 1YNZA 3Q1JA 2DPPB 5LJ3g 1LVKA 4FIBA 1CKBA 4N4IA 2XK0A 3MP1A 2Z0WA 1OX8A 5GAMd 2MAMA 3VS1A 1UJYA 5GJVB 1GFCA 1N8RR 2CUDA 3L42A 3G71Q 2GBQA 4P5NA 1OU9A 1C6VX 3X20B 5KYXA 4QQGA 2QAZA 4AG1C 4AFSC 5EC7A 1J3TA 2K5IA 4JJCA 3EG1A 1VYTA 3I56T 2HD0A 1K76A 1M27C 2DBMA 5KYXB 1F1BB 2OX7A 3E2UA 2VXFA 4DBRA 3OSVA 1U1TA 1WHJA 2RH2A 4EMGA 3C0CA 5FU6C 4M7DG 3OMCA 3L2VA 2K5LA 5GAN8 3QYGB 2V8IA 5D6YA 3V7SA 2PNIA 1XQHA 2DYIA 3V7RA 2C0IA 4C0ZA 1NEBA 3R6NA 1N8RC 1NJIR 2HBWA 2CYZB 2DETA 3M0TA 2KROA 2DTOA 1HXDA 2HQEA 2EQJA 4PJLA 2K4YA 1Y7XA 1Z9QA 3OYFA 3QJ6A 3CCQQ 4ZN1A 4Z89A 1SKUB 2ECZA 1JBMA 1E6HA 4HKEA 1H8KA 3KFVA 4BE1A 4N0AA 2P84A 1VOMA 5LJ3f 4J5YA 1YJWQ 1KQSP 1VQNA 5GANf 3CCRA 1XJWB 2BKDN 1QKXA 2YRVA 1D0ZA 1IXDA 2O4XA 1YI2Q 1OEBA 3CCLQ 2RNAA 1RAIB 4KRTA 2DE0X 1AWWA 1I5LA 2RMOA 3I55Q 1PD0A 4D6WA 1QVGA 2CT3A 2JTEA 1IREB 1B7TA 3S3OA 2XDPA 2P0QA 4JDSA 2KAFA 4FYYB 3CMAT 4EPCA 2O9VA 2OTJQ 2VB6A 4LD9K 2KXDA 1S72A 2KYBA 4PFZA 2VUBA 4HVUA 3HFNA 4XK8E 5IHIA 1YJNQ 4XU1A 2DM1A 3JCMP 4M78E 1N5ZA 3PNWC 2EGCA 4BDYA 3CCUT 3LH0A 1EFNA 5IXFA 1PSFA 3TVTA 1KK7A 4XTVA 4Z88A 2KVQG 5C6SA 1QVPA 2ZPEB 4M4ZA 1ZSGA 3L2WA 3X24B 3CCJQ 4FYXB 4FW1A 3CCVA 2RI3A 3PTAA 3MHXA 1VUBA 2LX9A 4FYWB 4M77A 4N0AC 1FMWA 3ME9A 5HCKA 4OMFB 2K3YA 1WHKA 4E7SA 3PMIA 3VS2A 3HL8A 1AVZC 5FRNA 4M77B 3QJYA 2DD5A 3NFCA 2LT1A 3BDUA 2RN8A 2JTFA 4RTWA 4ORZA 4WCIA 5GAN4 1BKBA 4LUEA 3JCMJ 3EFRA 2HDAA 2VGNA 1YCYA 3QO3A 2GGRA 8AT1B 1ACMB 2KGTA 3MPUB 2C0OA 1VQLA 1KHIA 1W2BA 5LJ3h 5KYWA 2KRSA 4X9CA 5GAN3 1TH7A 3CC7A 3X26B 1K8AR 3I56Q 2JS2A 4OP0A 5KYWB 4HT8A 1EZZB 4J83A 4Y28E 2KR3A 3THKA 1VIEA 3VS7A 2YWWA 1FX7A 3PVLA 4J9CA 3ULRB 5HK0A 1AEYA 1T0JA 2KY9A 4KGZB 4OGEA 1VQ5T 2H8HA 3SHWA 4DA4A 1VQMT 5LJ3e 3OYLA 3QSUA 1N27A 3LWHA 2QYZA 4M77D 2J6FA 3QPHA 5GANe 2JMCA 3LH5A 3TCJA 1QVGS 2JS0A 4M7AG 3REAB 2CDTA 4M77C 3G71A 3WVDB 3OYHA 2H3EB 4PNOA 4ZGJB 1K9MR 2CZ1B 2DL8A 1WX6A 4K11A 2HCKA 1RI0A 4F7UB 5A0DA 3S3MA 4QW2A 2RQVA 1K73U 1TUGB 4M75G 3VS0A 3CC4A 1KC8R 3TSWA 1QP2A 3TEEA 2DRMA 4PJOF 1W70A 4XU2A 2K2VA 1PHTA 2CUBA 4C0FA 3O8VA 2ABLA 2CZ6B 3OW2A 5FROA 2RD1A 3C94A 3OYMA 4KULA 1Q7YR 3CCET 2A7YA 4WF2A 4CC4B 1GXIE 4A4GA 3OYYA 5KE3A 3LX7A 3JB9I 4IUUA 2YLCA 2ZPFB 2KRMA 4OB1B 1K9MC 4JRQA 3JB9G 4JPBW 2KMTA 1OZ2A 3OQ5A 5IHKA 3CCUQ 1YJWA 5KCHA 5GMKi 1MUZA 4A54A 3UPUA 3EHQA 2DJZA 3OYGA 1I0CA 1YI2A 2DMOA 3E9FA 2E41A 2FRWA 2QG9B 2J7IA 4M78A 2QQ9A 3SWNA 4FM4B 2HNIA 1NYFA 2QA4T 2JM9A 4ZTJA 2EIFA 1OX9A 2RHXA 4A4KA 4E47A 3HP9A 3RKWA 2L5QA 5CQYA 3CCMT 3NMZC 3QHSA 1Y96A 4J9FA 4NL2A 2E65A 1KFZA 3VU3C 2DTHA 2JVVA 1W2BS 1M30A 2WSFE 2DA9A 2GFUA 4C5GA 3ZFJA 1B34B 1I81A 4GBQA 2EBPA 2EKHA 1Q81R 1YJNA 1Y96B 2ED1A 2L0AA 2RQRA 2YT6A 1WLPB 5CAIA 3JB9J 2X4YA 3UT1A 5CKBA 1BIAA 2A3LA 2VXEA 5CKEA 1Q82R 1X43A 3H8ZA 3DB4A 4PJOE 2E1HA 2FB7A 4LXCA 3WVEB 2RI5A 3H9NA 3M59A 1JJ2A 3VYHB 2FVUA 4TVRA 4BDZA 4LE9A 2F2VA 4E7HA 2OI3A 3JV3A 3M9QA 3CC2T 1XTDA 4R55A 4BY6B 5GAN7 1X75C 3X28B 2OJ2A 1EX4A 4E7IA 4JS5A 3UA7A 4CI0C 4RTYA 2DNUA 1VQ5Q 3EFSA 1QCNA 1IO6A 2H3JA 1VQMQ 4XU0A 3JCMb 1I07A 2K5FA 1PSEA 2MI6A 3E9GA 1D3BB 1Q82C 3MEWA 4EMKB 2E3IA 3QDFA 1BI2A 1S1NA 1TUDA 3H0FA 4ME7A 2E70A 3FDRA 5CKFA 4C8QG 1ABOA 3OW2S 1OI1A 5IN1A 4XTYA 1BBZA 3T9NA 2AHJB 3EFOA 2RQTA 4KGVB 2QGGA 1T3SA 2HQXA 4EDUA 1Z9ZA 2FL7A 3VS6A 5GMKe 2LJ3A 3RMQA 1RLQC 2LDMA 5DLQE 4OVAA 3OYKA 3I56A 3P8HA 2EJ9A 1A0NB 3OYAA 1K73C 1QCOA 1V29B 2PVGB 4MZMA 3H0IA 3RKXA 5FU7B 1R0CB 3QG1A 2FZGB 3VS5A 1BI1A 2XI9A 3QZ5B 5I2SA 3JCMc 3CCEQ 4BY6C 4X9DA 3M56A 2XDBA 2LQWA 4KGXB 2XIDA 3ZBDA 1YWOA 3E1SA 2BTTA 2J6KA 2DZCA 3CCLT 1QVGP 7AT1B 2MK5A 3JCMd 1NLPC 2EYQA 1GL5A 2KT1A 2RJFA 2CKKA 1UGSB 1ABQA 1PM3A 5LJ3j 2E5KA 3AT1B 3VS4A 2LZ6B 3CBMA 4FL6A 2NUTA 3U23A 4GLKA 1DJ7B 4ELYC 2KQWA 2OTJT 2CP5A 2BZ8A 1M1KU 4ESRA 4IUVA 3J81E 4C5HA 1NBEB 4QVDA 1RI9A 1OPLA 2O9SA 4V2SA 5CR2A 2NUTB 2V8JA 4JRKA 3H41A 2PQWA 1TWBA 2QA4Q 3BY7A 1K4US 3NHNA 3RDVA 1LJOA 3HPWA 4DEYA 1CKAA 4F7UF 1LNXA 4ATOA 3CMAA 1VQ4T 3OSSC 2DJQA 3CQTA 1JXOA 3CCMQ 3OA6A 1JJ2S 2IVWA 2F2WA 5FU7C 2R57A 3MEUA 3QKJA 1WJQA 3IQLA 1UECA 2E3HA 2Y4XA 4LD6A 2KYMA 4MMKA 3H6ZA 4A4EA 4AT1B 2GFAA 3CCUA 2RHZA 3CPFA 1R0BG 4KT0E 1KHCA 1M2VA 3EGXA 4E7JA 2HAXA 1K0XA 3A1PA 2QDLA 2E10A 2M51A 4C92D 2K7AA 2AKKA 1TSFA 1M2VB 3EGXB 3GP8A 1YJ9T 5CQXA 5L8RE 4PL6A 3CC2Q 3D7SB 3MEAA 5GANg 3UATA 1W6XA 2YSQA 2YUQA 1VQ6T 4PJOA 1PKTA 1BI3A 5I11A 1W2BP 2KEAA 1VYVA 2DXTA 3CPWP 5GAOq 3P8BB 4NL3A 1VQ7T 4PJOB 2JZ2A 2XG8D 1YCSB 3JAME 1NPPA 1WQWA 2WSEE 2RPNA 4ZN3A 1OULA 1TUCA
chains in the Genus database with same CATH topology
3HL8A 1ZHIA 2DAQA 2CZ7B 4BI4A 5KH6A 3L2QA 5FRNA 4M77B 4MDXA 3QJYA 1N8RU 1KQ2A 4XU3A 2K57A 2DK3A 3HRTA 3CMET 4L6V5 4IUQA 4M7DC 2DD5A 2F69A 2LCLA 2Y90A 3NFCA 5CKDA 2LT1A 4PLIA 3BDUA 1YIJT 1KC8C 3CBPA 2JTFA 4F7UE 5FLXE 3GLXA 3UWNA 5GAN4 1QW1A 1BKBA 2X4WA 5GMKm 3RERA 3NTKA 2PVOB 3JCMJ 3EFRA 1AHJB 2LQ8A 2RHIA 2VGNA 3HHTB 4N4GA 4C92A 5DY9A 1YCYA 3QO3A 2LQKA 3OYIA 3GOXA 1Q7YC 4M75B 2XKOC 1VQ9A 1MHNA 4EMKC 2KSSA 5GANj 4MZPA 1VQLA 1KHIA 1W2BA 2BUDA 2LCCA 5DM7R 5LJ3h 2VYTA 1BIBA 3M53A 2BIVA 4X9CA 3VV0A 4C92B 3OYCA 2C06A 3SWNB 4M78B 5GAN3 3J7AF 2PUKB 1N9SA 1TH7A 1X01A 3LLRA 2QEXA 1VQ5A 3CC7A 5CIUA 3TU4K 2EWNA 1VQMA 3X26B 3AHUA 2E64A 4HA8A 2B8AA 3QYHB 4OGCA 4OP0A 4HCBA 3CPWS 1VQLT 4J83A 2X4JA 4Y28E 2DD4A 4HT8A 4UC4A 4PJOD 1VIEA 3OYJA 3CBOA 4OB0B 1FX7A 1I4K1 4A4HA 3JCMe 1NJIU 3JCMV 4HCCA 3INZA 2L8DA 4E7KA 4M7DF 5HK0A 1OYXA 4XTUA 2KY9A 2QEXT 4FSXA 2DXUA 2QQSA 4OGEA 4RCBA 4YTLA 1VQ5T 3CC7T 4DA4A 3G7ZA 1VQMT 5LJ3e 1M90U 3HFOA 3OYLA 3QSUA 4ZGEB 1N27A 4IUTA 4M7AD 4PJOC 3OBYA 3LWHA 3RIRA 1M8VA 3A8LB 4PJOG 2DXBA 2M1HA 2QI2A 4J6XA 3V7CA 4M77D 5GANe 1NPRA 2MF2A 3QPHA 3CD6A 1QP3A 4FT4A 4BUGA 3JCMQ 2ZZDA 3OYBA 3TCJA 2CZ0B 2JNGA 4JRIA 1QVGS 4M7AC 4M7AG 2E12A 1QVFA 1XOVA 2X35A 4M77C 4BD3A 3QXEB 4M77G 3G71A 2DTIA 2DVEA 3WVDB 1ZBXA 2LVMA 4PNOA 3BDLA 3OYHA 3CD6T 4MDWA 2WACA 3M55A 4J6WA 4ZGJB 4M75D 4J6YA 4J8OA 3L2UA 1O9SA 5GAOn 2P0KA 2CZ1B 2L89A 4JJNK 2EQKA 3OYNA 3VUZA 3BW1A 4ZTFA 1RI0A 5HKCA 5FU6B 5C0MA 1VQ6A 4F7UB 2R5MA 5A0DA 4BACA 1X6OA 2EJGA 3G71T 4M78D 3META 3S3MA 4QW2A 1Q81C 3JRZA 2D0QB 5GMKl 3C12A 1K73U 3FC3A 4LDYA 4J7IA 1OZ3A 3DB3A 4L5GA 4M75G 5LJ5d 3CC4A 1P92A 1QP2A 3TEEA 3FLGA 5J39A 4PJOF 4BI3A 3OS0A 4XU2A 2K2VA 2K3XA 4IUPA 4C92C 4C0GA 4C0FA 3O8VA 3SWNC 2CZ6B 4M78C 3OW2A 5FROA 2RD1A 4M78G 1KQSS 3CEYA 4DOVA 2KK4A 3C94A 3OYMA 4KULA 4IKFA 3CCET 5A0GA 2A7YA 4WF2A 1GXIE 2ZPHB 3PT9A 3GNFB 2EQUA 4M7AF 3CC4T 3M4YA 1VQKA 5GAMh 3JB9D 3QBYA 3QUIA 4A4GA 3OYYA 2DIQA 3LX7A 5KE3A 3JB9I 5A2QE 4M7AA 4IUUA 3V8KA 4M77F 2QQBA 2JOYA 2MWOA 2RB6A 1G3YA 2YLCA 2ZPFB 3ZEHA 1KD1C 3GIBA 2E6ZA 5IAYA 4A53A 1G3SA 3GF5A 3MO8A 3MP8A 4BB7A 2E5QA 3JB9H 4OB1B 1YIJA 2GCXA 3VKIA 1K9MC 4JRQA 3JB9G 3OS2A 3S6WA 3HKSA 2DZ9A 2WSCE 2ZCFB 1R8OB 1HK9A 4R56A 1VQKT 2KMTA 1OZ2A 1RL2A 3QIIA 3OQ5A 4KUIA 3QZ9B 3M4GA 1Y71A 1YJWA 3N5BB 5KCHA 4M75F 5GMKi 1WGSA 5GAMe 3CCQT 4Q5WA 4A54A 3UPUA 3A8MB 4M75A 2DXCA 2DIGA 3V8LA 5GAOm 1VQ8A 4M7DE 2DJZA 3C4SA 3OYGA 1UEBA 1YI2A 3KUFA 4XTZA 3PFSA 4PLLA 4C92F 2HBPA 3E9FA 2E41A 2RK2A 1WJSA 1W4SA 2CS7A 3LYIA 3OMGA 4M78F 3CCMA 4HCZA 5DLOA 5GAOp 3JCMW 3SWNA 2DEQA 2QQ9A 2XICA 4M78A 3SB2A 4FM4B 1JB0E 2HNIA 3RESA 3JCMh 5GAN6 2QA4T 1YJWT 3DLLA 4ZTJA 1M5Q1 3MP6A 1H3ZA 2EIFA 4A4KA 2RHXA 5I2MA 4RKUE 1YBYA 3V8JA 4A4FA 4C8QA 2OTLA 2F5TX 1VQ8T 1BYMA 4E47A 3KBGA 3HP9A 4OB3B 3RKWA 1YI2T 2L5QA 2O01E 5CCAA 4F7UG 3P8DA 5HK3A 3OBWA 5CQYA 3CCMT 4BI8B 4NL2A 3QHSA 1Y96A 5GANh 2RO0A 2E65A 3I55T 3VU3C 2DTHA 4XTXA 3JSCA 2JVVA 2XU8A 3A5ZB 1W2BS 5LJ5g 3A8OB 3JB9F 4C8QB 5J3BA 1WNLA 2WSFE 1EIFA 2GFUA 4JUVA 4C5GA 1WQ7A 2ZPBB 4KBMB 2OTLT 3ZFJA 1B34B 2QDYB 5D6WA 5LJ3d 3J80E 1I81A 3MCAB 2ZGWA 1G5VA 1YJNA 4HT9A 1Y96B 3CCSA 3LW5E 1Q86U 3VYGA 4Z02A 5EG2A 3LGFA 5CAIA 3JB9J 3G4SA 2X4YA 1SSFA 3SFMA 3JCMX 1WJRA 3UT1A 3M57A 2GQVA 1BIAA 2A3LA 2VXEA 5CKBA 5CKEA 5FRMA 3SD4A 3H8ZA 3DB4A 4PJOE 4QQ6A 2E1HA 3CC2A 3HRSA 2FB7A 1YJNT 2X4XA 3GPLA 3CCST 1K8AU 3WVEB 1WPYA 2RI5A 2XDDA 3PIOA 4JLGA 2OAUA 3NTIA 2QQAA 3M59A 1JJ2A 2ZPGB 3VYHB 3G4ST 2LNVA 2FVUA 4EMHA 4TVRA 4OF1A 4KUDK 2P4TA 4BDZA 1M1KC 4E7LA 4FU6A 3M58A 2MMPA 4E7HA 3UDCA 4F7UA 4XTWA 3L2RA 1IZ6A 2NLUA 1U1SA 2M9UA 3M9QA 4M77E 2RI2A 4NOYA 4BE0A 3CC2T 3TREA 1XTDA 3L1AA 4ZGDB 4R55A 4MMLA 2RJCA 4BY6B 1QVFS 5GAN7 4VUBA 2G3RA 1X75C 1FWZA 2MWPA 2O4XB 3ER0A 3HRUA 3CCRT 3X28B 1JRIA 1M1FA 3CCJT 1UGPB 5D6XA 5GAOl 4E7IA 3X25B 2EKOA 4JS5A 1NJIC 1VQOA 4CI0C 4LDXA 4JRPA 3CCEA 5GMKj 4IURA 2RA2A 3C95A 4M75C 2JUFA 5CVIA 4DQ2A 5LJ5j 3EFSA 4C8QD 1M90C 2H3JA 2D9TA 4DOWA 4XU0A 3JCMb 2K5FA 1PSEA 2LRQA 2MI6A 3E9GA 4BE2A 3BFMA 1D3BB 1UGQB 1Q82C 5KCOA 3G6EA 3OS1A 3MEWA 1K9MU 4EMKB 4C92E 1BI2A 1VQOT 4ME7A 2E70A 1U8RA 3FDRA 4C8QC 2QXFA 5CKFA 4ELZC 2VC8A 3PGGA 4C8QG 3HSBA 3ASKA 2PUOB 5LJ5f 3OW2S 1OI1A 2YHTA 1VQPA 3Q1JA 5IN1A 2DPPB 4XTYA 1UB4A 3T9NA 5LJ3g 3EAEA 2AHJB 2P0PA 4J7FA 4FIBA 2JTMA 3G6ET 1KC8U 2PU9B 4N4IA 1LOJA 2KDSA 3CCQA 1G3TA 3FIFA 2XK0A 3MP1A 3M54A 4B9WA 2HQXA 4EDUA 2FL7A 2DKGA 5GAMd 2MAMA 2EJFA 5GMKe 3RMQA 3FB9A 3OB9A 4QVZA 2LDMA 5DLQE 1VQPT 4OVAA 1Q7YU 4JLIA 3OYKA 3I56A 3P8HA 3L42A 2EJ9A 2IG0A 4P5NA 3OYAA 1K73C 2QA4A 1V29B 3CXCA 4C5EA 2GF7A 2PVGB 4XQ3A 3X20B 4MZMA 2EQMA 1NE8A 4QQGA 4Y91A 3RKXA 5FU7B 2F5KA 3QG1A 5I21A 3L2ZA 3LGLA 3CCLA 4NS5A 4M7DD 2K5IA 1BI1A 2XI9A 3QZ5B 3PIPA 3I55A 3I56T 2HD0A 5I2SA 3CCVT 3JCMc 4BY6C 4X9DA 3KXTA 4C8QF 3M56A 2XDBA 2PVDB 3URGA 2XIDA 3GNGA 2RJDA 2VXFA 2M0OA 3ZBDA 3OSVA 4OB2B 1U1TA 2RH2A 2VV5A 4EMGA 3E1SA 4O6JA 5FU6C 4M7DG 2DZCA 3OMCA 4QVCA 2YLBA 1B34A 2K5LA 5GAN8 3L2VA 3CCLT 3QYGB 5M9OA 2V8IA 2OTJA 5KE2A 1UGRB 3JCMd 5D6YA 1N9RA 3V7SA 4LDWA 2EYQA 2FYKA 1KG1A 2RJFA 1XQHA 2CKKA 3V7RA 1UGSB 5HY6A 3A8HB 4RG8A 5CO7A 5LJ3j 4C0ZA 3R6OA 4X34A 1N8RC 2CYZB 1M4ZA 3VJPA 3CBMA 2DTOA 4FL6A 1HXDA 2HQEA 5GANd 5GAN2 2EQJA 1DJ7B 1FXXA 1Y7XA 2K4YA 2KQWA 4GLKA 4ELYC 3OYFA 3QJ6A 2XD0A 2OTJT 4ZN1A 2QTXA 4C0DB 3JCMf 1M1KU 2LTOA 4IUVA 3J81E 4C5HA 2QQRA 3CPWA 1JBMA 2RJEA 1YITA 4HKEA 5IT9E 3OYDA 2R5AA 4QVDA 1VQ4A 4BE1A 3QDRB 4N0AA 4V2SA 2D6FA 5CR2A 1VQ9T 5LJ3f 2V8JA 2LT4A 4JRKA 2PQWA 2RM4A 4J5YA 3BY7A 1VIFA 1VQNA 5GANf 3MEVA 2LC4A 3CCRA 1LJOA 1ZQ1A 2BKDN 3HPWA 2YRVA 5AYFA 3RKYA 5GAMg 1Q81U 3CCJA 2O4XA 4MZTA 4F7UF 1M9SA 4XAXB 2EAYA 4M7AE 1YITT 1LNXA 4ATOA 4QQDA 3CMAA 1VQ4T 4M7DA 3OSSC 2XHCA 2RHYA 4LDVA 3OA6A 1I5LA 1JJ2S 2RHUA 4CRIA 4D6WA 1QVGA 2IVWA 1NZ9A 1M1GA 5FU7C 2R57A 5A0LA 3MEUA 3QKJA 1Q82U 1IREB 1VQNT 3S3OA 2XDPA 2V8KA 2P0QA 1WJQA 4JDSA 3OY9A 2KAFA 1YHQA 4M7DB 2Y4XA 4LD6A 2RK1A 1D3BA 3NTHA 4FT2A 4GY5A 3CMAT 4EPCA 1Q86C 4MMKA 4EMKA 3H6ZA 4A4EA 1XNIA 2GFAA 4PKCC 2CGHA 4O5VA 3CCUA 4LD9K 3WXMB 2RHZA 3CPFA 1S72A 4M75E 2VUBA 5CKHA 1KD1U 3M5AA 1H641 4KT0E 3DLMA 1KHCA 5GMKh 2ZPIB 3DKMA 1YJ9A 5LJ5h 3HFNA 4XK8E 1YHQT 1BI0A 4E7JA 2HAXA 1K8AC 4XU1A 4JS4A 3JCMP 1G3WA 2DO3A 4II1A 4M78E 3JCMg 2E10A 4RMOA 1MGQA 2Y4YA 3PNWC 4C92D 3VUBA 4BDYA 1N6AA 3CCUT 3LH0A 1S72T 4C8QE 5J26A 4RCCA 3FEOA 1PSFA 2M16A 5CK9A 1KQSA 4N4HA 4C5IA 3LWIA 1I8FA 3F70A 4XTVA 3GP8A 5CQXA 5L8RE 4PL6A 3FJPA 1YJ9T 3RMSA 2R58A 2KVQG 3MEAA 5GANg 3S3NA 1VQ7A 5C6SA 4RG2A 1QVPA 2ZPEB 4L59A 4C0DC 4C92G 5GAMj 3E19A 1VQ6T 4PJOA 1BI3A 3L2WA 5GAOr 5LJ5e 3X24B 3RUXA 3CCVA 2DXTA 2RI3A 3PTAA 3MHXA 3P8BB 5GAOq 1O75A 5LL6S 2EFIA 4NL3A 1VUBA 2LX9A 1VQ7T 3FRNA 2FHDA 4PJOB 2JZ2A 2XG8D 2VGMA 3PMTA 3JAME 3OYEA 3CMEA 1NPPA 1WQWA 1KQ1A 2WSEE 4M77A 1Y07A 4N0AC 4ZN3A 5GAMf 2L3RA 5GAN5 3ME9A 2E6NA 3CXCS 4B9XA 2JN0A 4LDUA 2K3YA 3OS5A 4OMFB 4M7AB 2I2LA 3PMIA 3SDZA 3A8GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTO A;  3JCM e;  4C92 C;  1HXD A;  4F7U A;  5GAN d;  5GAN 2;  4XTW A;  3SWN C;  4M78 C;  4M77 E;  1U1S A;  2RD1 A;  4M78 G;  4NOY A;  4M77 B;  1KQ2 A;  4XU3 A;  3L1A A;  2K57 A;  2QTX A;  4MML A;  3JCM f;  4WF2 A;  5GAN 7;  4M7D C;  1JBM A;  2Y90 A;  4M7A F;  3BDU A;  4QVD A;  1JRI A;  5GAM h;  3JB9 D;  3QUI A;  4N0A A;  3JB9 I;  4V2S A;  4F7U E;  5GAO l;  4M7A A;  5LJ3 f;  3V8K A;  4M77 F;  4JRK A;  5GAN 4;  2RB6 A;  2RM4 A;  2YLC A;  4J5Y A;  5GMK m;  5GMK j;  3RER A;  3BY7 A;  3JCM J;  3GIB A;  3EFR A;  2RA2 A;  4DQ2 A;  4M75 C;  4A53 A;  4C92 A;  5LJ5 j;  5GAN f;  1LJO A;  3EFS A;  3RKY A;  5DY9 A;  5GAM g;  3JB9 H;  1YCY A;  3QO3 A;  4C8Q D;  4M75 B;  4F7U F;  4XU0 A;  3JCM b;  2EAY A;  3JB9 G;  4EMK C;  4M7A E;  1LNX A;  2DZ9 A;  5GAN j;  4M7D A;  3BFM A;  1D3B B;  1HK9 A;  5LJ3 h;  4EMK B;  1I5L A;  1BIB A;  4C92 E;  3M4G A;  4C92 B;  4X9C A;  3SWN B;  4M78 B;  5GMK i;  4M75 F;  5GAN 3;  1N9S A;  4C8Q C;  1TH7 A;  1X01 A;  2VC8 A;  3PGG A;  4C8Q G;  5GAM e;  3HSB A;  4A54 A;  4M75 A;  4M7D E;  3V8L A;  5LJ5 f;  2EWN A;  5GAO m;  2YHT A;  2DJZ A;  4M7D B;  3AHU A;  4XTY A;  2E64 A;  5LJ3 g;  4XTZ A;  1D3B A;  4HA8 A;  4OP0 A;  4C92 F;  4HT8 A;  2E41 A;  4MMK A;  4EMK A;  4M78 F;  4PJO D;  1LOJ A;  1I4K 1;  5GAO p;  3JCM W;  2CGH A;  3SWN A;  2DEQ A;  3FIF A;  4M78 A;  3SB2 A;  3INZ A;  3JCM h;  3JCM V;  2HNI A;  4M75 E;  3RES A;  5GAN 6;  4XTU A;  4M7D F;  2DKG A;  1H64 1;  1M5Q 1;  2DXU A;  2EJF A;  4RCB A;  5GMK e;  5GMK h;  5GAM d;  3FB9 A;  3V8J A;  4C8Q A;  5LJ5 h;  3HFN A;  5LJ3 e;  3RKW A;  3HFO A;  4M7A D;  3QSU A;  4JLI A;  4XU1 A;  4F7U G;  2EJ9 A;  3RIR A;  3JCM P;  4PJO G;  4PJO C;  1M8V A;  4M78 E;  3JCM g;  4J6X A;  2E10 A;  3V7C A;  4M77 D;  5GAN e;  1MGQ A;  4NL2 A;  3QHS A;  1Y96 A;  4XQ3 A;  4C92 D;  2E65 A;  5GAN h;  3VU3 C;  2DTH A;  4XTX A;  3RKX A;  4Y91 A;  5LJ5 g;  4C8Q E;  3JCM Q;  3JB9 F;  4RCC A;  4C8Q B;  5I21 A;  1WNL A;  3L2Z A;  4JUV A;  4JRI A;  4M7A C;  1WQ7 A;  4M7D D;  1I8F A;  4XTV A;  4M7A G;  1B34 B;  5LJ3 d;  3FJP A;  1I81 A;  5GAN g;  2ZGW A;  4M77 C;  3JCM c;  1Y96 B;  4M77 G;  4HT9 A;  2DTI A;  2DVE A;  4X9D A;  4C92 G;  4C8Q F;  5GAM j;  4PJO A;  4PNO A;  2VXF A;  5CAI A;  5GAO r;  4J6W A;  5LJ5 e;  3JB9 J;  4M75 D;  1U1T A;  4J6Y A;  4EMG A;  5GAO n;  3JCM X;  4M7D G;  2DZC A;  3RUX A;  4QVC A;  1BIA A;  1B34 A;  2VXE A;  2DXT A;  2YLB A;  5GAN 8;  3BW1 A;  5GAO q;  4PJO E;  4F7U B;  4NL3 A;  2E1H A;  4PJO B;  3JCM d;  2EJG A;  1N9R A;  2FB7 A;  3V7S A;  4M78 D;  2FYK A;  1WPY A;  5GMK l;  1WQW A;  1KQ1 A;  4M77 A;  3V7R A;  4N0A C;  4M75 G;  5LJ5 d;  5LJ3 j;  5GAM f;  5GAN 5;  4EMH A;  2JN0 A;  4PJO F;  4M7A B;  2I2L A;  4XU2 A; 
#chains in the Genus database with same CATH topology
 2D0N A;  1ZHI A;  2AZS A;  2V26 A;  2JW4 A;  4IUQ A;  4PLI A;  1YIJ T;  1WDX A;  4F7U E;  3EG9 A;  3GLX A;  1QW1 A;  5GMK m;  1SHF A;  4DBQ A;  2LQ8 A;  4N4G A;  5DY9 A;  4D8D A;  3OYI A;  1CSK A;  1VQ9 A;  3EG9 B;  2VYT A;  2F1L A;  3OYC A;  2C06 A;  2LNH B;  1X01 A;  1U5S A;  1VQ5 A;  5CIU A;  1JQQ A;  4CC2 A;  1VQM A;  3UA6 A;  4HCB A;  4OGC A;  2X4J A;  2DD4 A;  1V76 A;  4UC4 A;  4PJO D;  3EH1 A;  1I4K 1;  1Q95 G;  2NYS A;  4A4H A;  2L8D A;  4E7K A;  1LCK A;  2QEX T;  4RCB A;  2QQS A;  4YTL A;  1RUW A;  1M90 U;  3HFO A;  1MMG A;  4IUT A;  4PJO C;  3OBY A;  1M8V A;  3RIR A;  2BE9 B;  2M1H A;  4LNP A;  3V7C A;  1WXB A;  4FT4 A;  4BUG A;  3JCM Q;  2ZZD A;  4JRI A;  4KH1 B;  1QVF A;  1JO8 A;  5D7U A;  3H0H A;  1UDL A;  1ZUU A;  5IXB A;  2X35 A;  2DTI A;  4GLM A;  1ZBX A;  1PNJ A;  2LVM A;  3BDL A;  1WXU A;  2WAC A;  4J6W A;  2HKQ B;  5GAO n;  3VUZ A;  2DX1 A;  4DEX A;  5HKC A;  1IHW A;  2EJG A;  3MET A;  4EIK A;  2D1X A;  5GMK l;  3C12 A;  1RAC B;  2RF0 A;  2XMF A;  1VQ4 Q;  3A98 A;  2DEU A;  4BI3 A;  2K3X A;  4M78 G;  3CEY A;  1RAH B;  2ZPH B;  2EQU A;  4M7A F;  4DBF A;  3V8K A;  2MWO A;  1ZA1 B;  4J9B A;  2GTO A;  1OPK A;  2E6Z A;  5IAY A;  4A53 A;  1TU0 B;  1G3S A;  3MP8 A;  2E5Q A;  4OMN A;  3VKI A;  2DZ9 A;  3SEM A;  1HK9 A;  2HL5 C;  1RL2 A;  2AT1 B;  1G8X A;  3M0U A;  4M75 F;  1YJ9 Q;  1NYG A;  2DXC A;  5GAO m;  4E7Z A;  3C4S A;  2FPD A;  4OMP A;  5FWB A;  4C92 F;  2HBP A;  1W4S A;  1VQ6 Q;  3CCM A;  1GCQ C;  1JJ2 P;  5DLO A;  5GAO p;  3JCM W;  3SB2 A;  2YRC A;  2EVR A;  5GAN 6;  1GRI A;  3DLL A;  1M5Q 1;  3MP6 A;  1H3Z A;  1HD3 A;  4RKU E;  1BYM A;  2F5T X;  1VQ8 T;  4OB3 B;  1VQ7 Q;  3OBW A;  1FYN A;  4BI8 B;  5GAN h;  4F16 A;  4XTX A;  3A5Z B;  2XU8 A;  5LJ5 g;  3JB9 F;  1NM7 A;  1IB8 A;  1QCF A;  2ZPB B;  2QDY B;  1D1A A;  5LJ3 d;  3MCA B;  2ZGW A;  1G5V A;  4HT9 A;  2LCS A;  1Q86 U;  4Z02 A;  3LGF A;  1QQJ A;  1YIJ Q;  2RQU A;  3SFM A;  5KYY A;  5FRM A;  1BCM A;  3CC2 A;  3HRS A;  4JZ3 A;  2X4X A;  1UHF A;  1RAF B;  1BK2 A;  2QQA A;  5KYY B;  4LN2 A;  3TSZ A;  4E7L A;  2MMP A;  4F7U A;  2M9U A;  2RI2 A;  4BE0 A;  2K3B A;  3TRE A;  1QVF S;  3L1A A;  1HSQ A;  2RJC A;  2E4H A;  1U3O A;  4VUB A;  2G3R A;  2COZ A;  3CCR T;  3EGU A;  1M1F A;  5KYN A;  5D6X A;  5GAO l;  3X25 B;  2EKO A;  4LDX A;  4QKU A;  2FZC B;  2ROT A;  4IUR A;  2RA2 A;  3C95 A;  4DQ2 A;  2QEX Q;  1M90 C;  2CSI A;  2NUZ A;  2KI7 A;  1X6G A;  3BFM A;  4F14 A;  1UGQ B;  2LJ0 A;  3OS1 A;  1PKS A;  2NWM A;  4C92 E;  4J9I A;  2K79 A;  2QXF A;  1UFF A;  3ASK A;  5LJ5 f;  2YHT A;  4J7F A;  2JTM A;  1WI7 A;  1JU5 C;  2A37 A;  1G3T A;  3CCQ A;  3FIF A;  2VVK A;  3M54 A;  4B9W A;  3FB9 A;  3OB9 A;  1IRX A;  1VQP T;  4HVW A;  4PFO A;  2IG0 A;  1SSH A;  3CXC A;  2C0T A;  4C5E A;  2SRC A;  2EQM A;  1NE8 A;  4Y91 A;  2F5K A;  2NUP A;  3L2Z A;  3CCL A;  1WA7 A;  4M7D D;  2O2O A;  2M02 A;  2YRD A;  3I55 A;  3CCV T;  3KXT A;  4C8Q F;  1PG5 B;  2NUP B;  4OB2 B;  2VV5 A;  4O6J A;  4QVC A;  1C1A A;  2YLB A;  1B34 A;  3HTR A;  1ZSZ A;  2OTJ A;  4DBH A;  1WZO A;  4LDW A;  4HXJ A;  2YUP A;  3NGP A;  3EG0 A;  4LUD A;  2JMA A;  4X34 A;  1ZSZ B;  1M4Z A;  2HL3 A;  5GAN 2;  2EW3 A;  3I35 A;  2XD0 A;  2QTX A;  4C0D B;  3JCM f;  2LTO A;  2MPX C;  2FEI A;  6AT1 B;  2RJE A;  1RAE B;  5IT9 E;  1VQ4 A;  3VRZ A;  3QDR B;  2D6F A;  2LT4 A;  4HVV A;  2RM4 A;  2LC4 A;  1ZQ1 A;  5AYF A;  5GAM g;  1VQ8 Q;  3CCJ A;  1M9S A;  2YUN A;  1YIT T;  2CRE A;  4QQD A;  2RHY A;  2KXC A;  1MMA A;  1NZ9 A;  1M1G A;  1TG0 A;  5A0L A;  1I1J A;  1WHG A;  2V8K A;  4J9H A;  3UF4 A;  2RK1 A;  1D3B A;  4FT2 A;  1K73 R;  1Q86 C;  4EMK A;  3M0R A;  1XNI A;  2ENM A;  2COW A;  3REB B;  1QLY A;  2FRY A;  2X3X D;  3GBQ A;  1KD1 U;  1H64 1;  2JJ9 A;  5GMK h;  2ESW A;  2EQI A;  3DKM A;  1YJ9 A;  5LJ5 h;  1YHQ T;  1BI0 A;  2MYS A;  4RMO A;  1MGQ A;  2Y4Y A;  4OMO A;  4A63 B;  4C8Q E;  5J26 A;  4N4H A;  1ZSZ C;  3LWI A;  3F70 A;  2AZV A;  3FJP A;  2R58 A;  2EGA A;  3S3N A;  1VQ7 A;  1MV3 A;  1UE9 A;  4L59 A;  4C0D C;  1T3L A;  5IHN A;  1VA7 A;  3CCR Q;  4PJJ A;  1D1B A;  5LJ5 e;  1O75 A;  2EFI A;  2YXY A;  1K9A A;  1KQ1 A;  2A0F B;  1BU1 A;  5GAM f;  2L3R A;  3CXC S;  4B9X A;  1K1Z A;  2JN0 A;  3OS5 A;  1GFD A;  2LMJ A;  2I2L A;  1UGV A;  1WIE A;  1D0X A;  4M7A B;  3SDZ A;  4CC7 A;  2DAQ A;  2KNB B;  2FPE A;  3L2Q A;  2FO0 A;  4J9D A;  1N8R U;  1KQ2 A;  3G1J A;  4XU3 A;  2DK3 A;  3CME T;  1T0H A;  2ROL A;  2FZK B;  2LX7 A;  2QTV A;  3CBP A;  3VRY A;  5FLX E;  2G6F X;  3UWN A;  2FPF A;  4J9E A;  8ATC B;  3NTK A;  2RHI A;  4C92 A;  3HHT B;  1QVF P;  1ARK A;  3TQ7 P;  1VQP Q;  3GOX A;  4M75 B;  2XKO C;  1X2Q A;  4EMK C;  2KSS A;  5GAN j;  4MZP A;  1YP5 A;  2LCC A;  1BIB A;  4C92 B;  2CH4 W;  2PUK B;  1N9S A;  2QEX A;  2DLP A;  2J05 A;  3TU4 K;  2EWN A;  2HMA A;  2E64 A;  3CCV Q;  4HA8 A;  2B8A A;  3QYH B;  1M3A A;  4OB0 B;  1PC0 A;  3JCM e;  1NJI U;  3JCM V;  4HCC A;  3INZ A;  4M7D F;  4XTU A;  2DXU A;  4FSS A;  1X6B A;  1FMK A;  3BE3 A;  3G7Z A;  4M7A D;  2YDL A;  3A8L B;  4Z8A A;  1SHG A;  1NPR A;  3I5S A;  1PRL C;  1QP3 A;  1ZA2 B;  2IIM A;  2CZ0 B;  2JNG A;  4M7A C;  3QXE B;  1G83 A;  4M77 G;  2DVE A;  3CD6 T;  2EPD A;  4M75 D;  1AZE A;  4FW2 A;  2EQK A;  2SEM A;  2IPO B;  3BW1 A;  4ZTF A;  5FU6 B;  2R5M A;  4BAC A;  1X6O A;  5L23 A;  2D0Q B;  4J7I A;  2EYY A;  1YIT Q;  1WXT A;  2A08 A;  3FLG A;  4IUP A;  4C92 C;  1WHH A;  4C0G A;  1X27 A;  2X51 A;  2KK4 A;  4IKF A;  5A0G A;  1MMD A;  1RLP C;  2GNC A;  4WTO B;  3GNF B;  3M4Y A;  5GAM h;  3JB9 D;  3QBY A;  3QUI A;  1KSW A;  2RB6 A;  1G3Y A;  1RAG B;  1KD1 C;  1B07 A;  2KE9 A;  3GF5 A;  3MO8 A;  4BB7 A;  3JB9 H;  1YHQ Q;  4Y92 A;  1GCP A;  1ZUY A;  3S6W A;  1VQK T;  1R8O B;  2L3P A;  3QZ9 B;  3M4G A;  5GAM e;  4Q5W A;  3MKD A;  4M7D E;  3V8L A;  1VQ8 A;  3PE0 A;  1SPK A;  1UEB A;  1WYX A;  4XTZ A;  3QWY A;  3PFS A;  2QAS A;  1WJS A;  2CS7 A;  4M78 F;  1QWF A;  2GQI A;  2DEQ A;  1U06 A;  3RES A;  2W0Z A;  3CC4 Q;  4A4F A;  1YBY A;  4C8Q A;  1UUE A;  1M1K R;  2O01 E;  5CCA A;  4F7U G;  3P8D A;  1TOV A;  2LP5 A;  4C8Q B;  5KYU A;  5J3B A;  2CH4 A;  4JUV A;  2CP6 A;  4E2F B;  2OTL T;  3M0Q A;  5D6W A;  1HYO A;  3CME Q;  2L2P A;  3FJ5 A;  4X1V A;  5KYU B;  3OW2 P;  1WHM A;  1IGU A;  1WJR A;  2EYW A;  3M57 A;  2CP3 A;  4OMQ A;  1AT1 B;  1GCQ A;  3CCS T;  1K8A U;  2XDD A;  2K9G A;  3G4S T;  2LNV A;  4EMH A;  4OF1 A;  2P4T A;  1M1K C;  1Y0M A;  3M58 A;  3UDC A;  1IGQ A;  4XTW A;  3L2R A;  4NOY A;  2M0Y A;  2VAS A;  4ZGD B;  4MML A;  2F2X A;  2O4X B;  2J06 A;  2DL4 A;  3CXC P;  2O31 A;  1UGP B;  1OQK A;  2HEQ A;  4RTT A;  1NJI C;  2DFU A;  3CCE A;  1D09 B;  1SG5 A;  2L3S A;  5GMK j;  5LJ5 j;  2JUF A;  1Y57 A;  2DER A;  4R0K A;  2ZAE A;  4C8Q D;  1AOJ A;  4DOW A;  2LRQ A;  5KCO A;  1K9M U;  2P4R A;  1VQO T;  1UJ0 A;  2CP7 A;  1U8R A;  5AT1 B;  2HQH A;  1UHC A;  4C8Q C;  2VC8 A;  3PGG A;  2GTJ A;  1AZG B;  2PUO B;  1VQP A;  2I0N A;  1UB4 A;  3EAE A;  2P0P A;  3G6E T;  1KC8 U;  1OV3 A;  3CD6 Q;  2PU9 B;  1LOJ A;  2KDS A;  3PVQ A;  1GBQ A;  2DKG A;  2EJF A;  4QVZ A;  2DL7 A;  1Q7Y U;  4JLI A;  2QA4 A;  2KBT A;  2GF7 A;  1FMV A;  4XQ3 A;  1R77 A;  2MOX A;  2EYX A;  5I21 A;  3LGL A;  4NS5 A;  1M3C A;  2CSQ A;  3PIP A;  1JXM A;  1ZX6 A;  2PVD B;  3URG A;  2J6O A;  3GNG A;  2RJD A;  2M0O A;  4CC3 A;  5M9O A;  5KE2 A;  1UGR B;  1N9R A;  2X9H A;  2FYK A;  1KG1 A;  1PRM C;  1QKW A;  5HY6 A;  3A8H B;  1MV0 B;  4RG8 A;  1VQK Q;  5CO7 A;  3R6O A;  3VJP A;  1YFN A;  5GAN d;  1FXX A;  1M90 R;  4JJB A;  3CPW A;  1BCO A;  2QQR A;  3M0S A;  1YIT A;  3OYD A;  2R5A A;  4D8K A;  2DL3 A;  1VQ9 T;  2D8H A;  2ED0 A;  1VIF A;  3MEV A;  5I22 A;  3RKY A;  1Q81 U;  4MZT A;  4XAX B;  4M7A E;  2EAY A;  4M7D A;  2XHC A;  2L3Q A;  4LDV A;  1G2B A;  2RHU A;  4CRI A;  1Q82 U;  4PJM A;  1VQN T;  3OY9 A;  2OTL Q;  1D0Y A;  1PD1 A;  1AWJ A;  1YHQ A;  4M7D B;  1PWT A;  3VS3 A;  3NTH A;  4GY5 A;  4ANJ A;  2RQW A;  4PKC C;  2CGH A;  4O5V A;  5IH2 A;  1KJW A;  3WXM B;  4M75 E;  5CKH A;  3M5A A;  1RAA B;  3DLM A;  2ZPI B;  1K8A C;  4JS4 A;  1G3W A;  3CCS Q;  2DO3 A;  4II1 A;  1B3Q A;  1TTH B;  3JCM g;  1E6G A;  1YWP A;  3I5R A;  3VUB A;  1OOT A;  1VYU A;  1N6A A;  3G4S Q;  1S72 T;  2YUO A;  3FEO A;  4RCC A;  2M16 A;  5CK9 A;  1KQS A;  4OML A;  4C5I A;  1I8F A;  3RMS A;  1MND A;  4RG2 A;  3I9Q A;  4C92 G;  5GAM j;  3E19 A;  2KT8 A;  5GAO r;  1I5O B;  2DBK A;  2ATC B;  4AG2 C;  2VWF A;  3RUX A;  1LPL A;  3CMA Q;  1NEG A;  5LL6 S;  4AFZ C;  2LJ1 A;  1WFW A;  3FRN A;  2FHD A;  4FCY A;  2VGM A;  3PMT A;  3OYE A;  3CME A;  1OU8 A;  4PFP A;  1Y07 A;  2MIO A;  5GAN 5;  2E6N A;  4RUG A;  4LDU A;  1VQO Q;  2KRN A;  2EYZ A;  3A8G B;  1GBR A;  3RR6 A;  2CZ7 B;  4BI4 A;  2JM8 A;  3O5Z A;  5KH6 A;  4MDX A;  2K57 A;  4PJN A;  3HRT A;  1BB9 A;  3EHR A;  4L6V 5;  1K0S A;  4M7D C;  2F69 A;  2LCL A;  2Y90 A;  5CKD A;  2BZX A;  3G6E Q;  1KC8 C;  1M3B A;  1TS9 A;  2HSE B;  4JJD A;  2X4W A;  3RER A;  2PVO B;  1AHJ B;  2DRK A;  1MNE A;  1ZUK A;  2LQK A;  1Q7Y C;  4F17 A;  1MHN A;  4OMM A;  1Q86 R;  2BUD A;  5DM7 R;  4E6R A;  1M8M A;  2BIV A;  3M53 A;  3VV0 A;  3SWN B;  4M78 B;  3J7A F;  2X3W D;  3LLR A;  1RAB B;  1AWX A;  2O88 A;  3AHU A;  4IIO A;  3CPW S;  1VQL T;  1M2O A;  3OYJ A;  3CBO A;  1C0M A;  3EH2 A;  2DF6 A;  1OYX A;  4FSX A;  1NLO C;  2DIL A;  3CC7 T;  4ZGE B;  4PJO G;  2DXB A;  2QI2 A;  4J6X A;  2MF2 A;  3CD6 A;  3OYB A;  2E12 A;  4KH0 B;  5GJW B;  2EGE A;  1QWE A;  1XOV A;  4BD3 A;  1X2K A;  1W1F A;  4MDW A;  3M55 A;  3M0P A;  2QK0 A;  4J6Y A;  4J8O A;  4AMC A;  1O9S A;  3L2U A;  1VQ9 Q;  2P0K A;  2L89 A;  4JJN K;  3EG2 A;  3OYN A;  1ZBJ A;  2MCN A;  1SRL A;  1VQ6 A;  5C0M A;  1X69 A;  3G71 T;  4M78 D;  1Q81 C;  1KIK A;  3JRZ A;  2OAW A;  3FC3 A;  4LDY A;  1OZ3 A;  3DB3 A;  4L5G A;  4AFU C;  5LJ5 d;  1P92 A;  5J39 A;  3OS0 A;  4F04 B;  1D1C A;  4QT7 A;  3SWN C;  4M78 C;  1VQN Q;  1KQS S;  1AWO A;  4DOV A;  1NG2 A;  1TXQ A;  3PT9 A;  5FW9 A;  5FWC A;  3CC4 T;  2DVJ A;  1VQK A;  2DL5 A;  2DIQ A;  5A2Q E;  4M7A A;  1V1C A;  2W10 A;  4ZNX A;  4M77 F;  2AKL A;  2JOY A;  2QQB A;  3ZEH A;  2AIR B;  2PZ1 A;  3GIB A;  1SEM A;  1E7O A;  2BZY A;  1YIJ A;  2GCX A;  3EGD A;  1ZLM A;  2V1Q A;  3OS2 A;  3HKS A;  2WSC E;  2ZCF B;  2QGF B;  4R56 A;  3EFO B;  3QII A;  4KUI A;  2HSP A;  1UTI A;  4AFQ C;  1S72 Q;  2BE7 D;  1Y71 A;  3RNJ A;  3N5B B;  5ECA A;  1WGS A;  3EGD B;  1SRM A;  3CCQ T;  2A36 A;  3A8M B;  4M75 A;  2DIG A;  2COY A;  3KUF A;  4PLL A;  3LYI A;  2RK2 A;  3OMG A;  3MJX A;  1AD5 A;  1RAD B;  2FG0 A;  4HCZ A;  4RTZ A;  1QMC A;  2XIC A;  3JCM h;  1JB0 E;  4B6M A;  1YJW T;  4RTU A;  5I2M A;  2OTL A;  3V8J A;  2K2M A;  3KBG A;  3NPF A;  1YI2 T;  4PK4 A;  2HZY A;  5HK3 A;  3EG3 A;  1YN8 A;  1UG1 A;  2RO0 A;  3I55 T;  3JSC A;  2CT4 A;  2V1R A;  3ZL7 C;  1WHL A;  3A8O B;  3RBB B;  1WNL A;  1EIF A;  1WQ7 A;  4KBM B;  4FYV B;  3J80 E;  2DYB A;  2LQN A;  3CCS A;  3LW5 E;  1PCX A;  1H92 A;  3VYG A;  5EG2 A;  3QWX X;  3G4S A;  1SSF A;  2K6D A;  2HKN A;  3JCM X;  2GQV A;  3SD4 A;  4IIM A;  1HJD A;  4QQ6 A;  1YJN T;  1JEG A;  3GPL A;  1WPY A;  2A28 A;  4JLG A;  3PIO A;  1H3H A;  2OAU A;  3NTI A;  2ZPG B;  2CP0 A;  1SF9 A;  4KUD K;  4HCK A;  9ATC B;  4J9G A;  1MMN A;  4FU6 A;  1KD1 R;  2B86 A;  1IZ6 A;  2NLU A;  1U1S A;  4M77 E;  1FWZ A;  2MWP A;  2AK5 A;  3ER0 A;  2D8J A;  3HRU A;  1VQL Q;  1JRI A;  2JXB A;  3CCJ T;  1IHV A;  1VQO A;  4JRP A;  4JZ4 A;  4M75 C;  5CVI A;  4RTV A;  2JT4 A;  3CC7 Q;  2CP2 A;  2VKN A;  2D9T A;  4BE2 A;  3G6E A;  2PTK A;  4ELZ C;  3HSB A;  4RTX A;  1YNZ A;  3Q1J A;  2DPP B;  5LJ3 g;  1LVK A;  4FIB A;  1CKB A;  4N4I A;  2XK0 A;  3MP1 A;  2Z0W A;  1OX8 A;  5GAM d;  2MAM A;  3VS1 A;  1UJY A;  5GJV B;  1GFC A;  1N8R R;  2CUD A;  3L42 A;  3G71 Q;  2GBQ A;  4P5N A;  1OU9 A;  1C6V X;  3X20 B;  5KYX A;  4QQG A;  2QAZ A;  4AG1 C;  4AFS C;  5EC7 A;  1J3T A;  2K5I A;  4JJC A;  3EG1 A;  1VYT A;  3I56 T;  2HD0 A;  1K76 A;  1M27 C;  2DBM A;  5KYX B;  1F1B B;  2OX7 A;  3E2U A;  2VXF A;  4DBR A;  3OSV A;  1U1T A;  1WHJ A;  2RH2 A;  4EMG A;  3C0C A;  5FU6 C;  4M7D G;  3OMC A;  3L2V A;  2K5L A;  5GAN 8;  3QYG B;  2V8I A;  5D6Y A;  3V7S A;  2PNI A;  1XQH A;  2DYI A;  3V7R A;  2C0I A;  4C0Z A;  1NEB A;  3R6N A;  1N8R C;  1NJI R;  2HBW A;  2CYZ B;  2DET A;  3M0T A;  2KRO A;  2DTO A;  1HXD A;  2HQE A;  2EQJ A;  4PJL A;  2K4Y A;  1Y7X A;  1Z9Q A;  3OYF A;  3QJ6 A;  3CCQ Q;  4ZN1 A;  4Z89 A;  1SKU B;  2ECZ A;  1JBM A;  1E6H A;  4HKE A;  1H8K A;  3KFV A;  4BE1 A;  4N0A A;  2P84 A;  1VOM A;  5LJ3 f;  4J5Y A;  1YJW Q;  1KQS P;  1VQN A;  5GAN f;  3CCR A;  1XJW B;  2BKD N;  1QKX A;  2YRV A;  1D0Z A;  1IXD A;  2O4X A;  1YI2 Q;  1OEB A;  3CCL Q;  2RNA A;  1RAI B;  4KRT A;  2DE0 X;  1AWW A;  1I5L A;  2RMO A;  3I55 Q;  1PD0 A;  4D6W A;  1QVG A;  2CT3 A;  2JTE A;  1IRE B;  1B7T A;  3S3O A;  2XDP A;  2P0Q A;  4JDS A;  2KAF A;  4FYY B;  3CMA T;  4EPC A;  2O9V A;  2OTJ Q;  2VB6 A;  4LD9 K;  2KXD A;  1S72 A;  2KYB A;  4PFZ A;  2VUB A;  4HVU A;  3HFN A;  4XK8 E;  5IHI A;  1YJN Q;  4XU1 A;  2DM1 A;  3JCM P;  4M78 E;  1N5Z A;  3PNW C;  2EGC A;  4BDY A;  3CCU T;  3LH0 A;  1EFN A;  5IXF A;  1PSF A;  3TVT A;  1KK7 A;  4XTV A;  4Z88 A;  2KVQ G;  5C6S A;  1QVP A;  2ZPE B;  4M4Z A;  1ZSG A;  3L2W A;  3X24 B;  3CCJ Q;  4FYX B;  4FW1 A;  3CCV A;  2RI3 A;  3PTA A;  3MHX A;  1VUB A;  2LX9 A;  4FYW B;  4M77 A;  4N0A C;  1FMW A;  3ME9 A;  5HCK A;  4OMF B;  2K3Y A;  1WHK A;  4E7S A;  3PMI A;  3VS2 A;  3HL8 A;  1AVZ C;  5FRN A;  4M77 B;  3QJY A;  2DD5 A;  3NFC A;  2LT1 A;  3BDU A;  2RN8 A;  2JTF A;  4RTW A;  4ORZ A;  4WCI A;  5GAN 4;  1BKB A;  4LUE A;  3JCM J;  3EFR A;  2HDA A;  2VGN A;  1YCY A;  3QO3 A;  2GGR A;  8AT1 B;  1ACM B;  2KGT A;  3MPU B;  2C0O A;  1VQL A;  1KHI A;  1W2B A;  5LJ3 h;  5KYW A;  2KRS A;  4X9C A;  5GAN 3;  1TH7 A;  3CC7 A;  3X26 B;  1K8A R;  3I56 Q;  2JS2 A;  4OP0 A;  5KYW B;  4HT8 A;  1EZZ B;  4J83 A;  4Y28 E;  2KR3 A;  3THK A;  1VIE A;  3VS7 A;  2YWW A;  1FX7 A;  3PVL A;  4J9C A;  3ULR B;  5HK0 A;  1AEY A;  1T0J A;  2KY9 A;  4KGZ B;  4OGE A;  1VQ5 T;  2H8H A;  3SHW A;  4DA4 A;  1VQM T;  5LJ3 e;  3OYL A;  3QSU A;  1N27 A;  3LWH A;  2QYZ A;  4M77 D;  2J6F A;  3QPH A;  5GAN e;  2JMC A;  3LH5 A;  3TCJ A;  1QVG S;  2JS0 A;  4M7A G;  3REA B;  2CDT A;  4M77 C;  3G71 A;  3WVD B;  3OYH A;  2H3E B;  4PNO A;  4ZGJ B;  1K9M R;  2CZ1 B;  2DL8 A;  1WX6 A;  4K11 A;  2HCK A;  1RI0 A;  4F7U B;  5A0D A;  3S3M A;  4QW2 A;  2RQV A;  1K73 U;  1TUG B;  4M75 G;  3VS0 A;  3CC4 A;  1KC8 R;  3TSW A;  1QP2 A;  3TEE A;  2DRM A;  4PJO F;  1W70 A;  4XU2 A;  2K2V A;  1PHT A;  2CUB A;  4C0F A;  3O8V A;  2ABL A;  2CZ6 B;  3OW2 A;  5FRO A;  2RD1 A;  3C94 A;  3OYM A;  4KUL A;  1Q7Y R;  3CCE T;  2A7Y A;  4WF2 A;  4CC4 B;  1GXI E;  4A4G A;  3OYY A;  5KE3 A;  3LX7 A;  3JB9 I;  4IUU A;  2YLC A;  2ZPF B;  2KRM A;  4OB1 B;  1K9M C;  4JRQ A;  3JB9 G;  4JPB W;  2KMT A;  1OZ2 A;  3OQ5 A;  5IHK A;  3CCU Q;  1YJW A;  5KCH A;  5GMK i;  1MUZ A;  4A54 A;  3UPU A;  3EHQ A;  2DJZ A;  3OYG A;  1I0C A;  1YI2 A;  2DMO A;  3E9F A;  2E41 A;  2FRW A;  2QG9 B;  2J7I A;  4M78 A;  2QQ9 A;  3SWN A;  4FM4 B;  2HNI A;  1NYF A;  2QA4 T;  2JM9 A;  4ZTJ A;  2EIF A;  1OX9 A;  2RHX A;  4A4K A;  4E47 A;  3HP9 A;  3RKW A;  2L5Q A;  5CQY A;  3CCM T;  3NMZ C;  3QHS A;  1Y96 A;  4J9F A;  4NL2 A;  2E65 A;  1KFZ A;  3VU3 C;  2DTH A;  2JVV A;  1W2B S;  1M30 A;  2WSF E;  2DA9 A;  2GFU A;  4C5G A;  3ZFJ A;  1B34 B;  1I81 A;  4GBQ A;  2EBP A;  2EKH A;  1Q81 R;  1YJN A;  1Y96 B;  2ED1 A;  2L0A A;  2RQR A;  2YT6 A;  1WLP B;  5CAI A;  3JB9 J;  2X4Y A;  3UT1 A;  5CKB A;  1BIA A;  2A3L A;  2VXE A;  5CKE A;  1Q82 R;  1X43 A;  3H8Z A;  3DB4 A;  4PJO E;  2E1H A;  2FB7 A;  4LXC A;  3WVE B;  2RI5 A;  3H9N A;  3M59 A;  1JJ2 A;  3VYH B;  2FVU A;  4TVR A;  4BDZ A;  4LE9 A;  2F2V A;  4E7H A;  2OI3 A;  3JV3 A;  3M9Q A;  3CC2 T;  1XTD A;  4R55 A;  4BY6 B;  5GAN 7;  1X75 C;  3X28 B;  2OJ2 A;  1EX4 A;  4E7I A;  4JS5 A;  3UA7 A;  4CI0 C;  4RTY A;  2DNU A;  1VQ5 Q;  3EFS A;  1QCN A;  1IO6 A;  2H3J A;  1VQM Q;  4XU0 A;  3JCM b;  1I07 A;  2K5F A;  1PSE A;  2MI6 A;  3E9G A;  1D3B B;  1Q82 C;  3MEW A;  4EMK B;  2E3I A;  3QDF A;  1BI2 A;  1S1N A;  1TUD A;  3H0F A;  4ME7 A;  2E70 A;  3FDR A;  5CKF A;  4C8Q G;  1ABO A;  3OW2 S;  1OI1 A;  5IN1 A;  4XTY A;  1BBZ A;  3T9N A;  2AHJ B;  3EFO A;  2RQT A;  4KGV B;  2QGG A;  1T3S A;  2HQX A;  4EDU A;  1Z9Z A;  2FL7 A;  3VS6 A;  5GMK e;  2LJ3 A;  3RMQ A;  1RLQ C;  2LDM A;  5DLQ E;  4OVA A;  3OYK A;  3I56 A;  3P8H A;  2EJ9 A;  1A0N B;  3OYA A;  1K73 C;  1QCO A;  1V29 B;  2PVG B;  4MZM A;  3H0I A;  3RKX A;  5FU7 B;  1R0C B;  3QG1 A;  2FZG B;  3VS5 A;  1BI1 A;  2XI9 A;  3QZ5 B;  5I2S A;  3JCM c;  3CCE Q;  4BY6 C;  4X9D A;  3M56 A;  2XDB A;  2LQW A;  4KGX B;  2XID A;  3ZBD A;  1YWO A;  3E1S A;  2BTT A;  2J6K A;  2DZC A;  3CCL T;  1QVG P;  7AT1 B;  2MK5 A;  3JCM d;  1NLP C;  2EYQ A;  1GL5 A;  2KT1 A;  2RJF A;  2CKK A;  1UGS B;  1ABQ A;  1PM3 A;  5LJ3 j;  2E5K A;  3AT1 B;  3VS4 A;  2LZ6 B;  3CBM A;  4FL6 A;  2NUT A;  3U23 A;  4GLK A;  1DJ7 B;  4ELY C;  2KQW A;  2OTJ T;  2CP5 A;  2BZ8 A;  1M1K U;  4ESR A;  4IUV A;  3J81 E;  4C5H A;  1NBE B;  4QVD A;  1RI9 A;  1OPL A;  2O9S A;  4V2S A;  5CR2 A;  2NUT B;  2V8J A;  4JRK A;  3H41 A;  2PQW A;  1TWB A;  2QA4 Q;  3BY7 A;  1K4U S;  3NHN A;  3RDV A;  1LJO A;  3HPW A;  4DEY A;  1CKA A;  4F7U F;  1LNX A;  4ATO A;  3CMA A;  1VQ4 T;  3OSS C;  2DJQ A;  3CQT A;  1JXO A;  3CCM Q;  3OA6 A;  1JJ2 S;  2IVW A;  2F2W A;  5FU7 C;  2R57 A;  3MEU A;  3QKJ A;  1WJQ A;  3IQL A;  1UEC A;  2E3H A;  2Y4X A;  4LD6 A;  2KYM A;  4MMK A;  3H6Z A;  4A4E A;  4AT1 B;  2GFA A;  3CCU A;  2RHZ A;  3CPF A;  1R0B G;  4KT0 E;  1KHC A;  1M2V A;  3EGX A;  4E7J A;  2HAX A;  1K0X A;  3A1P A;  2QDL A;  2E10 A;  2M51 A;  4C92 D;  2K7A A;  2AKK A;  1TSF A;  1M2V B;  3EGX B;  3GP8 A;  1YJ9 T;  5CQX A;  5L8R E;  4PL6 A;  3CC2 Q;  3D7S B;  3MEA A;  5GAN g;  3UAT A;  1W6X A;  2YSQ A;  2YUQ A;  1VQ6 T;  4PJO A;  1PKT A;  1BI3 A;  5I11 A;  1W2B P;  2KEA A;  1VYV A;  2DXT A;  3CPW P;  5GAO q;  3P8B B;  4NL3 A;  1VQ7 T;  4PJO B;  2JZ2 A;  2XG8 D;  1YCS B;  3JAM E;  1NPP A;  1WQW A;  2WSE E;  2RPN A;  4ZN3 A;  1OUL A;  1TUC A; 
#chains in the Genus database with same CATH homology
 3HL8 A;  1ZHI A;  2DAQ A;  2CZ7 B;  4BI4 A;  5KH6 A;  3L2Q A;  5FRN A;  4M77 B;  4MDX A;  3QJY A;  1N8R U;  1KQ2 A;  4XU3 A;  2K57 A;  2DK3 A;  3HRT A;  3CME T;  4L6V 5;  4IUQ A;  4M7D C;  2DD5 A;  2F69 A;  2LCL A;  2Y90 A;  3NFC A;  5CKD A;  2LT1 A;  4PLI A;  3BDU A;  1YIJ T;  1KC8 C;  3CBP A;  2JTF A;  4F7U E;  5FLX E;  3GLX A;  3UWN A;  5GAN 4;  1QW1 A;  1BKB A;  2X4W A;  5GMK m;  3RER A;  3NTK A;  2PVO B;  3JCM J;  3EFR A;  1AHJ B;  2LQ8 A;  2RHI A;  2VGN A;  3HHT B;  4N4G A;  4C92 A;  5DY9 A;  1YCY A;  3QO3 A;  2LQK A;  3OYI A;  3GOX A;  1Q7Y C;  4M75 B;  2XKO C;  1VQ9 A;  1MHN A;  4EMK C;  2KSS A;  5GAN j;  4MZP A;  1VQL A;  1KHI A;  1W2B A;  2BUD A;  2LCC A;  5DM7 R;  5LJ3 h;  2VYT A;  1BIB A;  3M53 A;  2BIV A;  4X9C A;  3VV0 A;  4C92 B;  3OYC A;  2C06 A;  3SWN B;  4M78 B;  5GAN 3;  3J7A F;  2PUK B;  1N9S A;  1TH7 A;  1X01 A;  3LLR A;  2QEX A;  1VQ5 A;  3CC7 A;  5CIU A;  3TU4 K;  2EWN A;  1VQM A;  3X26 B;  3AHU A;  2E64 A;  4HA8 A;  2B8A A;  3QYH B;  4OGC A;  4OP0 A;  4HCB A;  3CPW S;  1VQL T;  4J83 A;  2X4J A;  4Y28 E;  2DD4 A;  4HT8 A;  4UC4 A;  4PJO D;  1VIE A;  3OYJ A;  3CBO A;  4OB0 B;  1FX7 A;  1I4K 1;  4A4H A;  3JCM e;  1NJI U;  3JCM V;  4HCC A;  3INZ A;  2L8D A;  4E7K A;  4M7D F;  5HK0 A;  1OYX A;  4XTU A;  2KY9 A;  2QEX T;  4FSX A;  2DXU A;  2QQS A;  4OGE A;  4RCB A;  4YTL A;  1VQ5 T;  3CC7 T;  4DA4 A;  3G7Z A;  1VQM T;  5LJ3 e;  1M90 U;  3HFO A;  3OYL A;  3QSU A;  4ZGE B;  1N27 A;  4IUT A;  4M7A D;  4PJO C;  3OBY A;  3LWH A;  3RIR A;  1M8V A;  3A8L B;  4PJO G;  2DXB A;  2M1H A;  2QI2 A;  4J6X A;  3V7C A;  4M77 D;  5GAN e;  1NPR A;  2MF2 A;  3QPH A;  3CD6 A;  1QP3 A;  4FT4 A;  4BUG A;  3JCM Q;  2ZZD A;  3OYB A;  3TCJ A;  2CZ0 B;  2JNG A;  4JRI A;  1QVG S;  4M7A C;  4M7A G;  2E12 A;  1QVF A;  1XOV A;  2X35 A;  4M77 C;  4BD3 A;  3QXE B;  4M77 G;  3G71 A;  2DTI A;  2DVE A;  3WVD B;  1ZBX A;  2LVM A;  4PNO A;  3BDL A;  3OYH A;  3CD6 T;  4MDW A;  2WAC A;  3M55 A;  4J6W A;  4ZGJ B;  4M75 D;  4J6Y A;  4J8O A;  3L2U A;  1O9S A;  5GAO n;  2P0K A;  2CZ1 B;  2L89 A;  4JJN K;  2EQK A;  3OYN A;  3VUZ A;  3BW1 A;  4ZTF A;  1RI0 A;  5HKC A;  5FU6 B;  5C0M A;  1VQ6 A;  4F7U B;  2R5M A;  5A0D A;  4BAC A;  1X6O A;  2EJG A;  3G71 T;  4M78 D;  3MET A;  3S3M A;  4QW2 A;  1Q81 C;  3JRZ A;  2D0Q B;  5GMK l;  3C12 A;  1K73 U;  3FC3 A;  4LDY A;  4J7I A;  1OZ3 A;  3DB3 A;  4L5G A;  4M75 G;  5LJ5 d;  3CC4 A;  1P92 A;  1QP2 A;  3TEE A;  3FLG A;  5J39 A;  4PJO F;  4BI3 A;  3OS0 A;  4XU2 A;  2K2V A;  2K3X A;  4IUP A;  4C92 C;  4C0G A;  4C0F A;  3O8V A;  3SWN C;  2CZ6 B;  4M78 C;  3OW2 A;  5FRO A;  2RD1 A;  4M78 G;  1KQS S;  3CEY A;  4DOV A;  2KK4 A;  3C94 A;  3OYM A;  4KUL A;  4IKF A;  3CCE T;  5A0G A;  2A7Y A;  4WF2 A;  1GXI E;  2ZPH B;  3PT9 A;  3GNF B;  2EQU A;  4M7A F;  3CC4 T;  3M4Y A;  1VQK A;  5GAM h;  3JB9 D;  3QBY A;  3QUI A;  4A4G A;  3OYY A;  2DIQ A;  3LX7 A;  5KE3 A;  3JB9 I;  5A2Q E;  4M7A A;  4IUU A;  3V8K A;  4M77 F;  2QQB A;  2JOY A;  2MWO A;  2RB6 A;  1G3Y A;  2YLC A;  2ZPF B;  3ZEH A;  1KD1 C;  3GIB A;  2E6Z A;  5IAY A;  4A53 A;  1G3S A;  3GF5 A;  3MO8 A;  3MP8 A;  4BB7 A;  2E5Q A;  3JB9 H;  4OB1 B;  1YIJ A;  2GCX A;  3VKI A;  1K9M C;  4JRQ A;  3JB9 G;  3OS2 A;  3S6W A;  3HKS A;  2DZ9 A;  2WSC E;  2ZCF B;  1R8O B;  1HK9 A;  4R56 A;  1VQK T;  2KMT A;  1OZ2 A;  1RL2 A;  3QII A;  3OQ5 A;  4KUI A;  3QZ9 B;  3M4G A;  1Y71 A;  1YJW A;  3N5B B;  5KCH A;  4M75 F;  5GMK i;  1WGS A;  5GAM e;  3CCQ T;  4Q5W A;  4A54 A;  3UPU A;  3A8M B;  4M75 A;  2DXC A;  2DIG A;  3V8L A;  5GAO m;  1VQ8 A;  4M7D E;  2DJZ A;  3C4S A;  3OYG A;  1UEB A;  1YI2 A;  3KUF A;  4XTZ A;  3PFS A;  4PLL A;  4C92 F;  2HBP A;  3E9F A;  2E41 A;  2RK2 A;  1WJS A;  1W4S A;  2CS7 A;  3LYI A;  3OMG A;  4M78 F;  3CCM A;  4HCZ A;  5DLO A;  5GAO p;  3JCM W;  3SWN A;  2DEQ A;  2QQ9 A;  2XIC A;  4M78 A;  3SB2 A;  4FM4 B;  1JB0 E;  2HNI A;  3RES A;  3JCM h;  5GAN 6;  2QA4 T;  1YJW T;  3DLL A;  4ZTJ A;  1M5Q 1;  3MP6 A;  1H3Z A;  2EIF A;  4A4K A;  2RHX A;  5I2M A;  4RKU E;  1YBY A;  3V8J A;  4A4F A;  4C8Q A;  2OTL A;  2F5T X;  1VQ8 T;  1BYM A;  4E47 A;  3KBG A;  3HP9 A;  4OB3 B;  3RKW A;  1YI2 T;  2L5Q A;  2O01 E;  5CCA A;  4F7U G;  3P8D A;  5HK3 A;  3OBW A;  5CQY A;  3CCM T;  4BI8 B;  4NL2 A;  3QHS A;  1Y96 A;  5GAN h;  2RO0 A;  2E65 A;  3I55 T;  3VU3 C;  2DTH A;  4XTX A;  3JSC A;  2JVV A;  2XU8 A;  3A5Z B;  1W2B S;  5LJ5 g;  3A8O B;  3JB9 F;  4C8Q B;  5J3B A;  1WNL A;  2WSF E;  1EIF A;  2GFU A;  4JUV A;  4C5G A;  1WQ7 A;  2ZPB B;  4KBM B;  2OTL T;  3ZFJ A;  1B34 B;  2QDY B;  5D6W A;  5LJ3 d;  3J80 E;  1I81 A;  3MCA B;  2ZGW A;  1G5V A;  1YJN A;  4HT9 A;  1Y96 B;  3CCS A;  3LW5 E;  1Q86 U;  3VYG A;  4Z02 A;  5EG2 A;  3LGF A;  5CAI A;  3JB9 J;  3G4S A;  2X4Y A;  1SSF A;  3SFM A;  3JCM X;  1WJR A;  3UT1 A;  3M57 A;  2GQV A;  1BIA A;  2A3L A;  2VXE A;  5CKB A;  5CKE A;  5FRM A;  3SD4 A;  3H8Z A;  3DB4 A;  4PJO E;  4QQ6 A;  2E1H A;  3CC2 A;  3HRS A;  2FB7 A;  1YJN T;  2X4X A;  3GPL A;  3CCS T;  1K8A U;  3WVE B;  1WPY A;  2RI5 A;  2XDD A;  3PIO A;  4JLG A;  2OAU A;  3NTI A;  2QQA A;  3M59 A;  1JJ2 A;  2ZPG B;  3VYH B;  3G4S T;  2LNV A;  2FVU A;  4EMH A;  4TVR A;  4OF1 A;  4KUD K;  2P4T A;  4BDZ A;  1M1K C;  4E7L A;  4FU6 A;  3M58 A;  2MMP A;  4E7H A;  3UDC A;  4F7U A;  4XTW A;  3L2R A;  1IZ6 A;  2NLU A;  1U1S A;  2M9U A;  3M9Q A;  4M77 E;  2RI2 A;  4NOY A;  4BE0 A;  3CC2 T;  3TRE A;  1XTD A;  3L1A A;  4ZGD B;  4R55 A;  4MML A;  2RJC A;  4BY6 B;  1QVF S;  5GAN 7;  4VUB A;  2G3R A;  1X75 C;  1FWZ A;  2MWP A;  2O4X B;  3ER0 A;  3HRU A;  3CCR T;  3X28 B;  1JRI A;  1M1F A;  3CCJ T;  1UGP B;  5D6X A;  5GAO l;  4E7I A;  3X25 B;  2EKO A;  4JS5 A;  1NJI C;  1VQO A;  4CI0 C;  4LDX A;  4JRP A;  3CCE A;  5GMK j;  4IUR A;  2RA2 A;  3C95 A;  4M75 C;  2JUF A;  5CVI A;  4DQ2 A;  5LJ5 j;  3EFS A;  4C8Q D;  1M90 C;  2H3J A;  2D9T A;  4DOW A;  4XU0 A;  3JCM b;  2K5F A;  1PSE A;  2LRQ A;  2MI6 A;  3E9G A;  4BE2 A;  3BFM A;  1D3B B;  1UGQ B;  1Q82 C;  5KCO A;  3G6E A;  3OS1 A;  3MEW A;  1K9M U;  4EMK B;  4C92 E;  1BI2 A;  1VQO T;  4ME7 A;  2E70 A;  1U8R A;  3FDR A;  4C8Q C;  2QXF A;  5CKF A;  4ELZ C;  2VC8 A;  3PGG A;  4C8Q G;  3HSB A;  3ASK A;  2PUO B;  5LJ5 f;  3OW2 S;  1OI1 A;  2YHT A;  1VQP A;  3Q1J A;  5IN1 A;  2DPP B;  4XTY A;  1UB4 A;  3T9N A;  5LJ3 g;  3EAE A;  2AHJ B;  2P0P A;  4J7F A;  4FIB A;  2JTM A;  3G6E T;  1KC8 U;  2PU9 B;  4N4I A;  1LOJ A;  2KDS A;  3CCQ A;  1G3T A;  3FIF A;  2XK0 A;  3MP1 A;  3M54 A;  4B9W A;  2HQX A;  4EDU A;  2FL7 A;  2DKG A;  5GAM d;  2MAM A;  2EJF A;  5GMK e;  3RMQ A;  3FB9 A;  3OB9 A;  4QVZ A;  2LDM A;  5DLQ E;  1VQP T;  4OVA A;  1Q7Y U;  4JLI A;  3OYK A;  3I56 A;  3P8H A;  3L42 A;  2EJ9 A;  2IG0 A;  4P5N A;  3OYA A;  1K73 C;  2QA4 A;  1V29 B;  3CXC A;  4C5E A;  2GF7 A;  2PVG B;  4XQ3 A;  3X20 B;  4MZM A;  2EQM A;  1NE8 A;  4QQG A;  4Y91 A;  3RKX A;  5FU7 B;  2F5K A;  3QG1 A;  5I21 A;  3L2Z A;  3LGL A;  3CCL A;  4NS5 A;  4M7D D;  2K5I A;  1BI1 A;  2XI9 A;  3QZ5 B;  3PIP A;  3I55 A;  3I56 T;  2HD0 A;  5I2S A;  3CCV T;  3JCM c;  4BY6 C;  4X9D A;  3KXT A;  4C8Q F;  3M56 A;  2XDB A;  2PVD B;  3URG A;  2XID A;  3GNG A;  2RJD A;  2VXF A;  2M0O A;  3ZBD A;  3OSV A;  4OB2 B;  1U1T A;  2RH2 A;  2VV5 A;  4EMG A;  3E1S A;  4O6J A;  5FU6 C;  4M7D G;  2DZC A;  3OMC A;  4QVC A;  2YLB A;  1B34 A;  2K5L A;  5GAN 8;  3L2V A;  3CCL T;  3QYG B;  5M9O A;  2V8I A;  2OTJ A;  5KE2 A;  1UGR B;  3JCM d;  5D6Y A;  1N9R A;  3V7S A;  4LDW A;  2EYQ A;  2FYK A;  1KG1 A;  2RJF A;  1XQH A;  2CKK A;  3V7R A;  1UGS B;  5HY6 A;  3A8H B;  4RG8 A;  5CO7 A;  5LJ3 j;  4C0Z A;  3R6O A;  4X34 A;  1N8R C;  2CYZ B;  1M4Z A;  3VJP A;  3CBM A;  2DTO A;  4FL6 A;  1HXD A;  2HQE A;  5GAN d;  5GAN 2;  2EQJ A;  1DJ7 B;  1FXX A;  1Y7X A;  2K4Y A;  2KQW A;  4GLK A;  4ELY C;  3OYF A;  3QJ6 A;  2XD0 A;  2OTJ T;  4ZN1 A;  2QTX A;  4C0D B;  3JCM f;  1M1K U;  2LTO A;  4IUV A;  3J81 E;  4C5H A;  2QQR A;  3CPW A;  1JBM A;  2RJE A;  1YIT A;  4HKE A;  5IT9 E;  3OYD A;  2R5A A;  4QVD A;  1VQ4 A;  4BE1 A;  3QDR B;  4N0A A;  4V2S A;  2D6F A;  5CR2 A;  1VQ9 T;  5LJ3 f;  2V8J A;  2LT4 A;  4JRK A;  2PQW A;  2RM4 A;  4J5Y A;  3BY7 A;  1VIF A;  1VQN A;  5GAN f;  3MEV A;  2LC4 A;  3CCR A;  1LJO A;  1ZQ1 A;  2BKD N;  3HPW A;  2YRV A;  5AYF A;  3RKY A;  5GAM g;  1Q81 U;  3CCJ A;  2O4X A;  4MZT A;  4F7U F;  1M9S A;  4XAX B;  2EAY A;  4M7A E;  1YIT T;  1LNX A;  4ATO A;  4QQD A;  3CMA A;  1VQ4 T;  4M7D A;  3OSS C;  2XHC A;  2RHY A;  4LDV A;  3OA6 A;  1I5L A;  1JJ2 S;  2RHU A;  4CRI A;  4D6W A;  1QVG A;  2IVW A;  1NZ9 A;  1M1G A;  5FU7 C;  2R57 A;  5A0L A;  3MEU A;  3QKJ A;  1Q82 U;  1IRE B;  1VQN T;  3S3O A;  2XDP A;  2V8K A;  2P0Q A;  1WJQ A;  4JDS A;  3OY9 A;  2KAF A;  1YHQ A;  4M7D B;  2Y4X A;  4LD6 A;  2RK1 A;  1D3B A;  3NTH A;  4FT2 A;  4GY5 A;  3CMA T;  4EPC A;  1Q86 C;  4MMK A;  4EMK A;  3H6Z A;  4A4E A;  1XNI A;  2GFA A;  4PKC C;  2CGH A;  4O5V A;  3CCU A;  4LD9 K;  3WXM B;  2RHZ A;  3CPF A;  1S72 A;  4M75 E;  2VUB A;  5CKH A;  1KD1 U;  3M5A A;  1H64 1;  4KT0 E;  3DLM A;  1KHC A;  5GMK h;  2ZPI B;  3DKM A;  1YJ9 A;  5LJ5 h;  3HFN A;  4XK8 E;  1YHQ T;  1BI0 A;  4E7J A;  2HAX A;  1K8A C;  4XU1 A;  4JS4 A;  3JCM P;  1G3W A;  2DO3 A;  4II1 A;  4M78 E;  3JCM g;  2E10 A;  4RMO A;  1MGQ A;  2Y4Y A;  3PNW C;  4C92 D;  3VUB A;  4BDY A;  1N6A A;  3CCU T;  3LH0 A;  1S72 T;  4C8Q E;  5J26 A;  4RCC A;  3FEO A;  1PSF A;  2M16 A;  5CK9 A;  1KQS A;  4N4H A;  4C5I A;  3LWI A;  1I8F A;  3F70 A;  4XTV A;  3GP8 A;  5CQX A;  5L8R E;  4PL6 A;  3FJP A;  1YJ9 T;  3RMS A;  2R58 A;  2KVQ G;  3MEA A;  5GAN g;  3S3N A;  1VQ7 A;  5C6S A;  4RG2 A;  1QVP A;  2ZPE B;  4L59 A;  4C0D C;  4C92 G;  5GAM j;  3E19 A;  1VQ6 T;  4PJO A;  1BI3 A;  3L2W A;  5GAO r;  5LJ5 e;  3X24 B;  3RUX A;  3CCV A;  2DXT A;  2RI3 A;  3PTA A;  3MHX A;  3P8B B;  5GAO q;  1O75 A;  5LL6 S;  2EFI A;  4NL3 A;  1VUB A;  2LX9 A;  1VQ7 T;  3FRN A;  2FHD A;  4PJO B;  2JZ2 A;  2XG8 D;  2VGM A;  3PMT A;  3JAM E;  3OYE A;  3CME A;  1NPP A;  1WQW A;  1KQ1 A;  2WSE E;  4M77 A;  1Y07 A;  4N0A C;  4ZN3 A;  5GAM f;  2L3R A;  5GAN 5;  3ME9 A;  2E6N A;  3CXC S;  4B9X A;  2JN0 A;  4LDU A;  2K3Y A;  3OS5 A;  4OMF B;  4M7A B;  2I2L A;  3PMI A;  3SDZ A;  3A8G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...