4EMKA

Crystal structure of splsm5/6/7
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
LPLELIDKCIGSNLWVIMKSEREFAGTLVGFDDYVNIVLKDVTEYDTVTGVTEKHSEMLLNGNGMCMLIPGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm5
publication title Crystal Structures of Lsm3, Lsm4 and Lsm5/6/7 from Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
total genus 14
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4emkA00
4C92D 4M75C 4XU3A 2K57A 3AHUA 3JB9H 3INZA 2DTIA 2DZCA 3JCMV 2QTXA 4F7UE 4J5YA 3EFSA 1LOJA 2CGHA 1JRIA 3M4GA 5GMKi 4RCCA 3JB9J 3RKWA 3V8LA 4OP0A 5GAMg 3QUIA 4X9DA 4PJOF 4M75A 3JB9D 4M7DF 4PNOA 5GMKl 1Y96A 1HXDA 5LJ3g 3JCMQ 4RCBA 2VXFA 3JCMJ 4XTVA 2E64A 4M75G 4XU1A 3RKXA 5GAN6 2DJZA 4EMHA 2EWNA 3BY7A 4A54A 5GMKm 4J6XA 4XTZA 4F7UF 1D3BB 2YLBA 3FJPA 1U1SA 4V2SA 4M78B 4JRIA 1WQ7A 5GAN2 2VXEA 3PGGA 4M75B 4XTUA 5LJ5g 4M78C 4M7AC 2DVEA 3EFRA 4PJOD 2Y90A 4M7DD 2RA2A 2ZGWA 5GAMe 3JCMe 4M75E 5GAN5 3JCMW 5LJ3e 5GAOr 3JB9I 1D3BA 5GANd 5GAN3 3QHSA 1I8FA 2FYKA 4M78A 2EJFA 5GAN7 1WNLA 2RD1A 4XU2A 4M7AA 5DY9A 5GAOn 3JCMg 3JCMP 4Y91A 4M7AG 4M78G 2EJGA 1WQWA 4M77C 1LJOA 4NL2A 4WF2A 1I4K1 4M78F 4NL3A 3BW1A 1BIAA 1YCYA 2EAYA 4MMLA 2DXUA 2VC8A 4C8QD 4C92C 4DQ2A 5LJ5e 4M75F 4XTYA 3V7RA 3HFOA 5GAOl 1TH7A 4M7AB 5GMKe 5GAOp 3JCMc 4M77A 1H641 4EMGA 2I2LA 5GAN8 5GAOm 5I21A 4M77G 3JCMf 5GAMf 4C92A 1I81A 1I5LA 4M7AE 4M78E 4XU0A 5GAMj 4N0AC 1M8VA 5LJ3f 2E65A 2YHTA 3V7CA 3HFNA 5LJ3j 4JRKA 2DZ9A 4C92G 4XQ3A 4C8QC 4EMKC 4HT9A 2EJ9A 1N9RA 4M75D 4M77B 3VU3C 5GAMh 5CAIA 3RIRA 3SB2A 2RM4A 4N0AA 5LJ3h 4J6YA 3V7SA 4J6WA 2HNIA 3JB9G 5GANe 4C92B 1U1TA 1WPYA 3L1AA 5LJ5f 4HT8A 4M7AF 4C8QA 4M77E 1BIBA 3SWNB 3RESA 4EMKA 5LJ5j 3JB9F 4PJOC 2FB7A 4M7DC 3HSBA 5GAOq 2JN0A 2RB6A 3V8KA 4C8QG 3SWNC 4NOYA 5GMKj 4A53A 4C92E 5GANg 3GIBA 3JCMX 3RUXA 1MGQA 5LJ5h 1X01A 3RKYA 2DEQA 3JCMb 1B34B 2E10A 4PJOA 4M7DA 5GMKh 3V8JA 4JUVA 4HA8A 4C8QB 3SWNA 2YLCA 1HK9A 4M77F 4EMKB 4MMKA 2E1HA 4PJOG 3L2ZA 3RERA 4M7DG 4M78D 4M7AD 3QSUA 1KQ1A 2E41A 4F7UA 5LJ5d 3QO3A 4C92F 3BFMA 3FB9A 4C8QE 5GAN4 3JCMh 2DTHA 2DKGA 4XTXA 5GANf 1LNXA 3BDUA 4XTWA 1B34A 4F7UG 5GANj 1KQ2A 4PJOB 4QVCA 4M7DB 4X9CA 1M5Q1 1N9SA 4JLIA 1JBMA 4QVDA 5GANh 2DTOA 4M77D 3JCMd 5GAMd 4PJOE 3FIFA 4M7DE 4F7UB 2DXTA 1Y96B 5LJ3d 4C8QF
chains in the Genus database with same CATH superfamily
2K4YA 1OZ2A 1GRIA 4C5HA 3JAME 2FRWA 4Q5WA 1M1FA 2MCNA 3LLRA 2EQIA 4R0KA 1S72T 3CMEA 5I11A 2EQMA 4J9DA 5IN1A 4Y28E 3CCEA 4RCBA 1W6XA 4OMFB 1Q82C 1VQPA 2RQVA 2EWNA 1JO8A 3UA7A 4F7UF 1KJWA 2FG0A 1VYTA 1PG5B 3L2QA 1RACB 1I5OB 3PGGA 4HVWA 4GLMA 2CZ1B 3LH0A 2VVKA 1WXUA 4N4IA 1YIJQ 1YITT 3JCMg 3OSVA 1X6OA 3P8HA 1AD5A 3AT1B 3EGDA 4NL2A 3G71Q 1G3WA 1VQNT 2COYA 5DLOA 1RUWA 5A0GA 4E47A 4J9CA 3I9QA 4DA4A 1ZBJA 1FMKA 3OW2S 2L3QA 4JLGA 5GAMf 4OMPA 1I81A 2MWOA 4RKUE 3OBYA 4JRKA 4C8QC 3G1JA 3SDZA 2EYWA 3ZBDA 2MK5A 4C92B 1QVFA 2RMOA 4LD6A 2XDDA 2AKKA 1NJIC 2MOXA 2YSQA 5GAOq 5GANg 2A3LA 1AWJA 2L3RA 4ZTFA 4Z89A 3C4SA 2PQWA 1UGQB 5KYUA 2K3BA 2J05A 1KHIA 3VYGA 2QA4Q 1M1KC 3FDRA 2VKNA 1B34A 2X51A 3L2VA 4PJNA 4QVCA 1K1ZA 1Y57A 3LX7A 1IGUA 3C94A 1KD1R 4C5GA 2AK5A 3J80E 1C6VX 2JVVA 4OB1B 5CKHA 4X1VA 2DRMA 5GMKi 1JRIA 2AIRB 1TU0B 4J9BA 4FM4B 4ZGEB 5GAMg 3QUIA 1NEGA 3CCMA 3EHQA 2PNIA 3G4SQ 1WYXA 3I55Q 2XDBA 4J9EA 2E64A 4M75G 3BY7A 1MMDA 2JNGA 3VKIA 2CH4W 1YJWT 1SSHA 1VQ4T 3KXTA 1LPLA 2PVGB 2HKNA 1IZ6A 1Q82U 2FYKA 4M78A 3J81E 3NFCA 2GQVA 2RQRA 3S3NA 3EHRA 2EJGA 1WQWA 1VQMA 1YI2A 3BW1A 3REAB 4ORZA 1VQ5Q 2VC8A 1YHQA 4RG8A 1JJ2P 3OYFA 2O31A 4A4GA 1YJNQ 4EMGA 1W4SA 3CCLQ 4RMOA 4XU0A 2P84A 2DM1A 3PT9A 2P0QA 5LJ3j 3CPWA 2IVWA 2CYZB 2E6NA 4QT7A 1PWTA 1YIJT 1W2BS 5L8RE 3CMAA 1VYVA 1VA7A 1ZUKA 1W70A 2K2MA 3OSSC 2A36A 4KGZB 1B34B 7AT1B 1T3SA 3A8OB 4NS5A 4HA8A 1RAEB 4IIOA 4M7DG 2KT8A 1M3BA 2E41A 3PNWC 5GAN4 1NJIU 2L89A 2KNBB 2W0ZA 1LNXA 5IHKA 2QQSA 3CC2T 1G3SA 1EFNA 1JEGA 3CCRA 1N9SA 3OYMA 3CBMA 2HMAA 2WSEE 5GANh 2DETA 3VS6A 4OMLA 3QYHB 4HXJA 3QJ6A 4C92D 4IUUA 3G6EQ 1M1KU 4PFOA 2QTXA 1Q81R 3EFSA 2K2VA 2XI9A 5CKBA 2ATCB 1RI0A 2QEXA 2DJZA 1WLPB 2QA4T 1OQKA 4A4FA 5LL6S 4M78B 1O9SA 2VXEA 3CC7A 2Y90A 4E7IA 4II1A 1QCFA 1KC8C 1XOVA 5GAN5 5DM7R 2NUPA 2V1RA 2QASA 4MZTA 1YJ9T 1I8FA 2DEUA 3QWXX 1YCSB 1K9MC 3M53A 1K9AA 2LJ3A 4BY6B 2RN8A 2X4WA 1YCYA 2VWFA 4C92C 4XTYA 2GQIA 3V7RA 2CP3A 2DL7A 5GAOl 3HRUA 1UHCA 4JRQA 2V8JA 5GAOm 4CRIA 4M77G 4IURA 2EBPA 4M7AE 2DXBA 1J3TA 1QLYA 5FU7B 3VU3C 4OB2B 2RPNA 2L8DA 4BI4A 1WPYA 2BTTA 2KYBA 3THKA 4BB7A 2HSPA 2HQEA 2LT1A 1VQKA 2YRCA 2COWA 1N5ZA 2DD5A 4C0DC 4CC2A 1MHNA 1QP3A 2M0YA 2DVJA 4FIBA 1KQSA 2JJ9A 1YJNT 3PMIA 1W1FA 3RERA 3TSZA 2DE0X 2EGAA 4C0FA 3PTAA 3SFMA 4F7UG 1Q86C 1ZBXA 2HZYA 5D7UA 4C5IA 3EGXA 3JSCA 2XD0A 1TS9A 2EYXA 2D9TA 1GL5A 3CCSQ 2DXTA 2DTIA 2DZCA 3OMGA 3JCMV 1QVGP 1N6AA 4FL6A 5KCOA 2OTJQ 1G83A 3UATA 4M75A 2D8HA 3KBGA 1X2KA 3MEUA 1NYFA 3MJXA 2CT3A 2NUPB 3QJYA 4E7LA 1X75C 2DNUA 3NTIA 2E6ZA 2COZA 3X26B 2CS7A 1VQOQ 4KUDK 1D3BA 3G6ET 5FWBA 1WNLA 1NYGA 4PJLA 5KYYB 2WSFE 1YNZA 4L59A 1BKBA 2RQWA 2KYMA 2DXUA 2KQWA 3NTHA 4M7AB 5AT1B 2DLPA 1KC8U 1PD0A 3GPLA 4RUGA 2DBKA 2LJ1A 4LDYA 3QWYA 2DYIA 4IIMA 1K9MU 2F69A 2DK3A 2MMPA 2ESWA 2L0AA 3R6NA 1MV3A 1EZZB 2D1XA 4BE2A 1RABB 3MEAA 2ZPFB 2O9VA 1UGPB 2JS0A 3A5ZB 1QCNA 1SHFA 3HPWA 3OYYA 2AHJB 5LJ5h 3RKYA 4M7DA 3BDLA 5GMKh 3EGXB 1IO6A 2CSQA 2ZZDA 2CUBA 5C6SA 1UEBA 2M9UA 3TQ7P 5GANj 2WACA 3NGPA 2O4XB 2X35A 3EG3A 2BE9B 2YUPA 4Z02A 1WDXA 2Z0WA 3OB9A 4J83A 2CREA 2PVDB 3FIFA 2HD0A 2OX7A 4C8QF 2PTKA 4QVZA 3MO8A 2FVUA 2GNCA 4KGVB 2RJCA 1Q86U 1X69A 2JS2A 4IKFA 5FWCA 3PFSA 2DIQA 2CZ0B 3U23A 1VQ8A 2P0KA 4XTZA 4BY6C 1D3BB 1ZHIA 1D1BA 5GAN2 4O6JA 1ZSZA 3M0TA 2C0OA 5HK3A 8AT1B 2A7YA 3EFRA 1BBZA 2RJEA 3CCST 4EPCA 2OI3A 1WHJA 3OYDA 1S72A 5GAOr 1YITQ 1M3AA 2J6FA 3EG9A 3M0RA 3PIOA 1Q7YU 5FU7C 2BZ8A 3VS3A 4F17A 9ATCB 2DX1A 2K3YA 3UA6A 4M77A 2GCXA 1FX7A 1H641 3CCJA 2GTOA 2HQHA 2YHTA 2CH4A 4HVUA 1VQOT 4ATOA 2KEAA 3SB2A 1TUGB 2C0TA 2DL3A 1VQNA 1C0MA 2QK0A 2LRQA 4EMKA 4C5EA 2RB6A 2PUOB 2NUZA 1HYOA 1K8AR 1VQ6A 2DEQA 3H0HA 3NHNA 2E1HA 4M7AD 5IAYA 4F7UA 3CQTA 2EKHA 2RNAA 4E7SA 5I2MA 5KYXA 2A28A 2DL8A 3A8LB 1CKAA 4BACA 2I0NA 1HJDA 4PJOE 1X43A 3EG1A 4YTLA 3HRSA 1F1BB 3INZA 4BDYA 4IUTA 2W10A 3S3OA 2NYSA 2EVRA 2EW3A 1OULA 3H6ZA 1B7TA 1MMAA 4X9DA 2DJQA 2RHYA 3QZ9B 3RKXA 2FEIA 2JTMA 2HL5C 2OAWA 1YJWQ 2RQUA 3EG9B 1WQ7A 2H3EB 2K5LA 1UG1A 1IHWA 4M7AC 1FXXA 2JXBA 4BUGA 4N4HA 1QCOA 3I5RA 3OW2A 3X25B 4FW2A 5GJVB 2RQTA 2FRYA 3PE0A 3I56Q 1UE9A 4C8QD 4LXCA 3P8DA 1TH7A 1EIFA 3DLMA 3CC4T 1YWPA 1D1CA 2WSCE 2E3IA 4XAXB 3CCQT 1OX9A 3TU4K 3PVQA 1H92A 1Z9QA 1OZ3A 1D0XA 5CAIA 3OYBA 2OAUA 2VGNA 5CKDA 3EH2A 1LVKA 2FPEA 1Y0MA 3OYEA 2JOYA 3JB9F 5LJ5j 3HSBA 1KD1U 5GMKj 3GIBA 1FMVA 1WJRA 2E10A 1PRMC 4OMNA 1HK9A 1TSFA 1VIFA 4JJDA 2LX7A 5LJ5d 4C92F 1IRXA 2ZPBB 4A63B 2DMOA 2DL4A 3FJ5A 3CC2Q 4XTWA 1YIJA 4PJOB 3G71A 5FW9A 3S3MA 4OVAA 4JLIA 4QVDA 3M9QA 1NLOC 3A98A 1N8RR 2QXFA 5CIUA 1RAGB 3VV0A 2L3PA 2FPFA 2ZPGB 1YBYA 4GLKA 1LOJA 1MNDA 1KFZA 5CKFA 3EFOA 2R5AA 1GXIE 4PLIA 3MPUB 3OYJA 3I5SA 1Y96A 1AT1B 5GAN6 5D6YA 3CCVT 2OTLA 4PLLA 4DBRA 4RTXA 3C12A 2KI7A 4RTYA 5M9OA 3A1PA 1YJ9Q 1H3ZA 1ZSGA 1RAHB 1QVFP 2V8KA 2HL3A 1MMGA 3DB4A 2LQWA 2PVOB 2E12A 2JMAA 3GP8A 3HFOA 1X6GA 3JCMc 2JTFA 1W2BA 1GBRA 1XJWB 5I21A 1ABQA 3EGDB 4M78E 2A0FB 2LMJA 2B86A 4R56A 3V7CA 3VS2A 1BI1A 2NLUA 2DZ9A 3CMET 1VQMQ 2ENMA 2LJ0A 1YI2Q 4AMCA 2NUTA 4A4KA 2BZXA 3V7SA 3CCET 4J6YA 1D0YA 3VRYA 4AFQC 2K9GA 1VQPT 2RK1A 2LQKA 3G4SA 3I56T 3I55A 2D6FA 2CUDA 3KUFA 4C8QG 1SSFA 1M3CA 2BE7D 3TVTA 3M0SA 3KFVA 4P5NA 1DJ7B 4FYXB 4BE0A 3JCMh 4B6MA 1WHMA 4XTXA 3E2UA 1RLQC 1K73C 4X9CA 2BKDN 1JJ2S 4JJCA 1MMNA 5KYUB 2DTOA 4E7KA 1VQ5A 4KH1B 3MKDA 1Y96B 1M1GA 5LJ3d 1SHGA 1TUDA 2EYZA 1Z9ZA 2L5QA 3I35A 3H8ZA 4CC4B 3CCLA 1OX8A 3MEVA 3MP6A 2PU9B 4Y92A 1R77A 1JXMA 3RKWA 3JB9D 4OP0A 1ZUUA 5FLXE 4BD3A 1AZEA 3OS2A 1KG1A 4ME7A 4DEYA 1GBQA 1KHCA 1PSFA 3MP1A 3GNFB 3FJPA 2QTVA 4JRIA 3E1SA 4XTUA 2MWPA 3CPWP 2ZPEB 4PJOD 2KRSA 2VASA 3PMTA 4EIKA 3CCUA 2KAFA 5LJ3e 1M30A 2XKOC 5GAN3 2A08A 3DKMA 3A8GB 3UWNA 3ZFJA 2QEXQ 4CI0C 2KR3A 4BI3A 1VQ9Q 2QAZA 2DF6A 1M2VA 4M78F 5GAN7 1ARKA 3M58A 2AT1B 2FL7A 2YRDA 1PNJA 5EC7A 3O8VA 3VYHB 4EDUA 2DILA 3EG0A 3HFNA 5HY6A 5CO7A 1NM7A 1VOMA 5GAMh 4KULA 3RIRA 2X4YA 4N0AA 2HNIA 2HQXA 4TVRA 4LDVA 4ZTJA 3MCAB 2BZYA 4FT2A 4PJOC 3V8KA 3RNJA 3JCMX 1TG0A 1KK7A 2E4HA 2H8HA 3X20B 5CK9A 2ZCFB 4KRTA 3SWNA 1GCQA 4GBQA 1FWZA 1QWEA 3OA6A 3DB3A 3BFMA 3X28B 1NJIR 1VQMT 4JZ4A 1YI2T 2KT1A 3A8MB 2CT4A 2ECZA 1X27A 3UPUA 4OF1A 1H8KA 3WVEB 3OYAA 2EIFA 1NE8A 2YRVA 4RCCA 1QWFA 1K73U 1XTDA 6AT1B 5GMKl 3QPHA 3CD6A 1HXDA 3H9NA 2XMFA 2PZ1A 1OI1A 2LCCA 3CMAT 4WCIA 2ZPHB 5GMKm 3O5ZA 3M4YA 4J6XA 4J9IA 2FZCB 2YLBA 1U1SA 3JV3A 2EPDA 3H0IA 2KK4A 3META 2FZKB 1BB9A 2Y4XA 2KMTA 5KYNA 3CXCP 3TCJA 4M75E 4DBFA 2EYYA 2ZPIB 2FPDA 3QHSA 2RJFA 3QG1A 4AG1C 1M90C 2KDSA 3JCMP 2GF7A 4F04B 4FU6A 1BIAA 2EAYA 2R57A 3CCRT 3VRZA 5CCAA 1Q7YC 4HCCA 5GAOp 4PJJA 3CXCS 1KQSP 3E19A 2DL5A 2GBQA 1QVGS 4ZGDB 1M8VA 2F2XA 2VV5A 5LJ3f 2E65A 4C92G 2JM8A 4XQ3A 3E9FA 2JMCA 1BCMA 1UGSB 2OTJA 4J6WA 2XDPA 3GLXA 2QEXT 1VQ9T 4M7AF 4C8QA 3SWNB 1XQHA 1LCKA 2YUOA 8ATCB 1C1AA 2F2VA 1QMCA 2J6OA 1SF9A 1JQQA 1QQJA 3TREA 3C0CA 3FRNA 4FSXA 1X01A 2KBTA 1O75A 3OYCA 2SEMA 4PJMA 4JUVA 2XG8D 2YLCA 1M9SA 4M78D 2KVQG 1VQOA 1K0XA 1KQ1A 2M16A 3QO3A 1ZA1B 3FB9A 3MEWA 2J7IA 2DKGA 3BDUA 5IHNA 3OS0A 4FCYA 2QGGA 3JCMd 5FU6B 3QDFA 2LZ6B 1G3TA 4M7DE 4NOYA 4MZMA 2RH2A 4XU3A 1G3YA 2O9SA 2M51A 5D6XA 1AVZC 3JB9J 4C0ZA 3V8LA 4E6RA 5LJ3g 3CBPA 2KXCA 2YUNA 2GFUA 4EMHA 3EGUA 4JDSA 1T0JA 4JZ3A 1D0ZA 3NPFA 4M75B 4M78C 3NTKA 4OGEA 2H3JA 1WHKA 1OYXA 1BCOA 3JCMe 2V8IA 2DFUA 3JB9I 3DLLA 5GANd 2RD1A 3VS4A 1I4K1 1UGRB 5IHIA 4NL3A 1IXDA 2QGFB 3CC4Q 1FMWA 1I07A 2ED1A 4ESRA 3T9NA 3CCQQ 3OS1A 4FYVB 2I2LA 3LWIA 2YDLA 1I0CA 2DXCA 1TXQA 1M90U 5GAMj 4OB0B 4OMOA 1YN8A 1N8RC 2JW4A 2DIGA 4FSSA 2XICA 4AG2C 1K9MR 5IT9E 1U3OA 2QYZA 3QKJA 3QYGB 1QW1A 1UB4A 3F70A 5GANe 3L1AA 3L2RA 2P0PA 4M77E 1BIBA 3HP9A 1GFCA 3GNGA 4AT1B 2CZ6B 1IB8A 1RADB 3LH5A 3QXEB 4A53A 2KRNA 3ER0A 4JS4A 2DD4A 4F14A 1HSQA 3V8JA 1KD1C 3FC3A 4MMKA 4IUQA 2RK2A 1M8MA 2BIVA 1YITA 1UJYA 3RMSA 2K5FA 4OMMA 4ZNXA 4M7DB 1K0SA 3HL8A 3M0PA 1JBMA 1VQ6Q 3TSWA 4F16A 1CKBA 3WXMB 5FRMA 3MHXA 1B3QA 3HTRA 2EYQA 2MYSA 4RTVA 1QP2A 4F7UE 2DYBA 2LNVA 1Q86R 1NEBA 1U8RA 2MF2A 1T3LA 4L5GA 4J9GA 3CCVQ 1VQLQ 4PFZA 4XU1A 3WVDB 4D8KA 4QQ6A 1D09B 1U06A 1V29B 3RR6A 3OYNA 1VQ7Q 1X2QA 2DAQA 4LUDA 3URGA 2XK0A 1WHHA 1ZSZB 3FEOA 4Y91A 1IGQA 1E6HA 1LJOA 1YFNA 4MDXA 2DRKA 5A0LA 2QDYB 3HHTB 2C0IA 2JUFA 2RHUA 4M4ZA 5KH6A 3JCMf 4C92A 3CMEQ 3M57A 1PC0A 3CCEQ 2DBMA 4M75D 4M77B 1VQPQ 1U1TA 4HT8A 2V1QA 1PD1A 1VQ8T 4OGCA 5AYFA 2CP0A 2FB7A 2AKLA 1VYUA 2CP5A 1N8RU 5L23A 2HSEB 1SRMA 3NMZC 3RUXA 1MGQA 1YJWA 5FU6C 1VQ4A 2A37A 2E5QA 2RI2A 3ZL7C 4EMKB 5I2SA 3RBBB 4E7JA 1YP5A 2EFIA 4AFSC 1M4ZA 4D6WA 1Q81C 1OU8A 5GANf 4R55A 4JPBW 2K5IA 3I56A 3SEMA 1IREB 4F7UB 4J8OA 3CCJT 2XHCA 3OW2P 4M75C 1GFDA 5IXBA 5KYXB 3VS7A 2KGTA 1K76A 1E6GA 1RAAB 3QBYA 2LC4A 1OPLA 4PJOF 2X3XD 4LDWA 2O88A 4XTVA 2L3SA 1BK2A 3PIPA 2ROLA 1TWBA 4OMQA 1E7OA 2IPOB 2CSIA 1VQ6T 2DVEA 4M7DD 2ZGWA 2EGEA 2B8AA 1Y07A 1R8OB 1GCPA 2EJFA 2QDLA 4XU2A 2YXYA 2LX9A 1MV0B 2OTLQ 2XU8A 4M7AG 2LCLA 1AWWA 2K7AA 2LT4A 2HBWA 3CC2A 3ULRB 5C0MA 1VQLT 5LJ5e 3QDRB 3VUBA 1WFWA 1V1CA 5GMKe 4L6V5 4PK4A 1M2OA 2CDTA 2VB6A 2DO3A 4HCKA 1BI2A 1B07A 5EG2A 3M0QA 3CCMQ 4HT9A 4RTZA 5CQYA 1VQ7T 1Y71A 1UGVA 3OYHA 2QA4A 3M59A 3RESA 3VS0A 5J39A 4M7DC 1TUCA 1CSKA 4C0DB 3EH1A 3VS1A 2NWMA 4KGXB 5CQXA 1JJ2A 1ZLMA 2HCKA 2FHDA 4UC4A 2YUQA 1N27A 2LTOA 3L2ZA 1YJ9A 1HD3A 3HKSA 1QVFS 1OOTA 2D0QB 1WXBA 5IH2A 4CC7A 1PCXA 1YHQQ 1KSWA 2HEQA 2E70A 3GOXA 4A4EA 3L2WA 5I22A 5KE3A 4M77D 2BUDA 1G2BA 3GBQA 2CP2A 3BE3A 4DBQA 2K57A 1AOJA 3EG2A 1Q81U 1UDLA 5CR2A 1RAIB 1V76A 5J3BA 1H3HA 1JU5C 1NG2A 1PKTA 2YWWA 4PNOA 2J06A 3CMAQ 1ZSZC 4KBMB 2Y4YA 3JCMJ 5CKEA 1W2BP 4E7HA 2CZ7B 4GY5A 3N5BB 3EFOB 2ED0A 1SRLA 2M02A 2E5KA 1AEYA 3C95A 2EQUA 1YJNA 5ECAA 3Q1JA 2KXDA 1R0BG 3OBWA 4M77C 3CCRQ 4J7IA 2LQ8A 1I1JA 3G71T 2QQ9A 4ZN1A 2O2OA 2F1LA 2P4RA 2LDMA 3CCUQ 1WX6A 2LVMA 1WIEA 4XK8E 3UT1A 4EMKC 2EJ9A 2R5MA 1Q82R 2E3HA 2AZVA 4FYWB 2MIOA 5LJ5f 2OTLT 2VUBA 1NBEB 2J6KA 3SD4A 3CC7Q 3A8HB 2JN0A 3CPWS 2NUTB 1NPPA 1P92A 3JCMb 3VUZA 1AWXA 1U5SA 3G6EA 3QSUA 5KCHA 2DPPB 4DOWA 1UECA 1JXOA 3CCMT 2PUKB 4QQGA 1VQ9A 2M1HA 1EX4A 1XNIA 1UFFA 1TTHB 1BYMA 2YT6A 5A0DA 4KT0E 2EQJA 3OQ5A 3L2UA 3JB9H 2QQRA 4CC3A 1UJ0A 1WHGA 2M0OA 3LW5E 1ACMB 3JCMQ 1WHLA 2KRMA 2ROTA 4J9FA 3M56A 3VJPA 3GF5A 4Z8AA 3G4ST 3I55T 1VQKQ 1YHQT 4V2SA 4N4GA 1AZGB 4DEXA 5KYYA 1SPKA 5LJ5g 5FROA 1Q95G 3CXCA 3CD6Q 1M1KR 4HCBA 3LGFA 1JB0E 4M7AA 1QVGA 1ABOA 1K4US 5DY9A 1D1AA 1PSEA 1RI9A 4WF2A 2GFAA 2HKQB 4QKUA 3M5AA 1NLPC 3IQLA 2F5TX 1VQ5T 1BI0A 5GAN8 4B9WA 4AFUC 2QG9B 2K3XA 1M2VB 1IHVA 4PKCC 3CCLT 1K8AC 3E9GA 2KSSA 4E7ZA 2V26A 2RM4A 1S1NA 3JB9G 1ZA2B 1ZX6A 2KE9A 2MAMA 3X24B 2MPXC 4FYYB 3OYKA 1UHFA 5IXFA 4K11A 2EKOA 2O4XA 3CCSA 1MNEA 3CCUT 1X6BA 4HCZA 1WXTA 1YWOA 4PJOG 1M27C 3EAEA 4C8QE 1WGSA 2DTHA 4BI8B 3H41A 2RO0A 1KQSS 3JRZA 4DBHA 1A0NB 1MUZA 3CC7T 2D8JA 4LN2A 2G6FX 1VIEA 1WZOA 2L2PA 4PL6A 4J5YA 2IG0A 2CGHA 2LCSA 1UTIA 5HKCA 1K73R 4E2FB 4ELZC 2QQAA 1RAFB 1VUBA 2C06A 1PRLC 1OU9A 2QQBA 3QIIA 2F5KA 4WTOB 1PM3A 2RHIA 1PHTA 4JJNK 1ZUYA 3OMCA 4X34A 5GJWB 2RA2A 3L42A 3OYIA 3M54A 2JT4A 2X3WD 3P8BB 4VUBA 3RMQA 1FYNA 3ME9A 2DA9A 4ZGJB 5DLQE 1WJQA 4JRPA 4M75F 4ZN3A 3UF4A 2CP7A 2LP5A 1VQKT 2CKKA 2RHZA 3D7SB 5KYWA 2G3RA 2DERA 3VS5A 4RG2A 5CVIA 3CD6T 3LGLA 3UDCA 1VQ8Q 4AFZC 2SRCA 3TEEA 4PFPA 5D6WA 3PVLA 1R0CB 3H0FA 1K8AU 4LD9K 3J7AF 2JZ2A 2JTEA 1KC8R 1TOVA 2HAXA 1S72Q 3OYLA 3MP8A 4C8QB 3FLGA 4BE1A 4RTWA 4HVVA 1OPKA 4MZPA 1AHJB 1Y7XA 1OV3A 3QZ5B 2LQNA 4MDWA 2FZGB 2HBPA 3LYIA 3M55A 2O01E 3CCJQ 1BI3A 3CC4A 2KY9A 5GAMd 1G5VA 4IUPA 4J9HA 4LDXA 4C0GA 3AHUA 2VGMA 1BU1A 4LUEA 4KH0B 4Z88A 3CCQA 3R6OA 2AZSA 3M4GA 3OS5A 3REBB 3HRTA 2QI2A 2RJDA 2KROA 1VQNQ 4QW2A 4M7DF 3ASKA 3ZEHA 2OTJT 2VXFA 2LNHB 1QKXA 4LNPA 4A54A 4JS5A 1WI7A 1SG5A 3CEYA 2X4JA 4D8DA 2EQKA 4JJBA 2HDAA 4BDZA 3LWHA 1SEMA 5GAMe 3JCMW 1AWOA 2OJ2A 2X9HA 3M0UA 4KUIA 5GAOn 4O5VA 4M78G 4ANJA 2EGCA 5KYWB 3S6WA 2JM9A 2K6DA 4LE9A 4MMLA 3SHWA 2K79A 4DQ2A 4IUVA 4LDUA 4OB3B 1T0HA 4DOVA 1I5LA 3OY9A 2GTJA 2RI3A 4N0AC 3RDVA 3OYGA 1M90R 1QVPA 2ABLA 1SKUB 1G8XA 2RF0A 1N9RA 2CP6A 1QKWA 1WA7A 4A4HA 3CPFA 1Q7YR 5LJ3h 1PKSA 4HKEA 2GGRA 1ZQ1A 4B9XA 3CCVA 4RTUA 1VQLA 4ELYC 1UUEA 3SWNC 5A2QE 4C92E 1GCQC 3G7ZA 2XIDA 1NZ9A 4PJOA 1KIKA 2X4XA 4M77F 4FT4A 4RTTA 2VYTA 5J26A 1VQ7A 5HK0A 1NPRA 2RHXA 3CBOA 2RI5A 1RLPC 5KE2A 2D0NA 5FRNA 1KQ2A 2ZAEA 2IIMA 2MI6A 1M5Q1 4FW1A 2F2WA 1WJSA 2R58A 2FO0A 1VQ4Q 2P4TA 4J7FA 1OEBA 1RL2A 5HCKA 4QQDA
chains in the Genus database with same CATH topology
2K4YA 1OZ2A 4QVZA 3MO8A 2FVUA 4C5HA 2K57A 4Q5WA 3JAME 1M1FA 1Q81U 3WVEB 3OYAA 3LLRA 2EIFA 2RJCA 5CR2A 1Q86U 1S72T 1NE8A 2YRVA 3CMEA 4RCCA 2EQMA 1K73U 4IKFA 5J3BA 1XTDA 5IN1A 4PNOA 5GMKl 3QPHA 4Y28E 1HXDA 3CD6A 3CCEA 4KBMB 4RCBA 2Y4YA 3JCMJ 4OMFB 3PFSA 5CKEA 1Q82C 2DIQA 1VQPA 1OI1A 2CZ0B 2EWNA 2LCCA 2ZPHB 5GMKm 3CMAT 1VQ8A 3M4YA 2P0KA 4J6XA 4XTZA 1D3BB 2YLBA 1ZHIA 4BY6C 2CZ7B 1U1SA 4F7UF 4E7HA 4GY5A 3L2QA 5GAN2 3N5BB 4O6JA 2KK4A 3META 3PGGA 5HK3A 2A7YA 2Y4XA 3EFRA 2CZ1B 2KMTA 2RJEA 3CCST 3C95A 2EQUA 3LH0A 4EPCA 1YJNA 3Q1JA 3TCJA 4M75E 3OYDA 1S72A 2ZPIB 5GAOr 3QHSA 2RJFA 3QG1A 3PIOA 1Q7YU 5FU7C 4N4IA 1YITT 1M90C 2KDSA 3JCMg 3OSVA 3JCMP 1X6OA 2GF7A 3OBWA 3P8HA 4M77C 4NL2A 1G3WA 2LQ8A 4J7IA 4FU6A 1VQNT 1BIAA 5DLOA 2EAYA 2R57A 3CCRT 5A0GA 5CCAA 3G71T 2K3YA 2QQ9A 4E47A 4ZN1A 1Q7YC 4HCCA 2LDMA 5GAOp 4DA4A 4M77A 2GCXA 3CXCS 3OW2S 1H641 1FX7A 3CCJA 3E19A 1QVGS 4JLGA 5GAMf 4ZGDB 1I81A 1M8VA 2LVMA 2VV5A 2MWOA 4RKUE 3OBYA 5LJ3f 2E65A 2YHTA 4XK8E 3UT1A 4JRKA 4C92G 4XQ3A 3E9FA 4C8QC 4EMKC 2EJ9A 2R5MA 1VQOT 4ATOA 1UGSB 2OTJA 3SB2A 4J6WA 3SDZA 2XDPA 3GLXA 3ZBDA 4C92B 2QEXT 1VQNA 5LJ5f 1VQ9T 2OTLT 2VUBA 2LRQA 3SWNB 1XQHA 4C8QA 4LD6A 4EMKA 2XDDA 4C5EA 1QVFA 3SD4A 1NJIC 3A8HB 5GAOq 2JN0A 2RB6A 2PUOB 5GANg 2A3LA 3CPWS 3TREA 3FRNA 1NPPA 4FSXA 1X01A 1P92A 2L3RA 1VQ6A 2DEQA 3JCMb 1O75A 4ZTFA 3OYCA 3C4SA 2PQWA 1UGQB 4JUVA 3VUZA 2XG8D 2YLCA 1M9SA 1KHIA 2E1HA 4M7AD 4M78D 2KVQG 3G6EA 1VQOA 3QSUA 5IAYA 1KQ1A 2DPPB 3VYGA 2M16A 3QO3A 4F7UA 5KCHA 3FB9A 4DOWA 3MEWA 1M1KC 3CCMT 2DKGA 3FDRA 3BDUA 2PUKB 5I2MA 1B34A 4QQGA 3OS0A 2M1HA 3A8LB 1VQ9A 3L2VA 4QVCA 4BACA 3LX7A 1XNIA 1BYMA 3C94A 3JCMd 5FU6B 4PJOE 4M7DE 1G3TA 4NOYA 5A0DA 4C5GA 4MZMA 4KT0E 2EQJA 3J80E 3OQ5A 2RH2A 3HRSA 4YTLA 4XU3A 3L2UA 3JB9H 1G3YA 3INZA 2JVVA 4OB1B 5CKHA 4BDYA 4IUTA 2QQRA 5D6XA 1JRIA 5GMKi 3S3OA 3JB9J 4C0ZA 3H6ZA 2M0OA 4FM4B 3V8LA 3QUIA 4X9DA 4ZGEB 5GAMg 3CCMA 2RHYA 3LW5E 3QZ9B 5LJ3g 3JCMQ 3CBPA 2XDBA 2E64A 4M75G 3M56A 3RKXA 2GFUA 2JTMA 3BY7A 3GF5A 3VJPA 4EMHA 3G4ST 3I55T 4JDSA 1YHQT 4V2SA 4N4GA 2JNGA 3VKIA 1WQ7A 2K5LA 4M75B 1YJWT 5LJ5g 4M78C 3NTKA 4OGEA 2H3JA 1VQ4T 4M7AC 3KXTA 1FXXA 2PVGB 1OYXA 1IZ6A 4BUGA 5FROA 3JCMe 4N4HA 2V8IA 3CXCA 3OW2A 3X25B 3JB9I 3DLLA 1Q82U 5GANd 3LGFA 4HCBA 1JB0E 2FYKA 4M78A 1QVGA 4M7AA 2RD1A 3J81E 3NFCA 5DY9A 2GQVA 3S3NA 1PSEA 2EJGA 1WQWA 1VQMA 1YI2A 4WF2A 2GFAA 1I4K1 1UGRB 4NL3A 3BW1A 3M5AA 4C8QD 2VC8A 1YHQA 4RG8A 2F5TX 3OYFA 3P8DA 3T9NA 1TH7A 1EIFA 3DLMA 4A4GA 3CC4T 1VQ5T 2WSCE 3OS1A 1BI0A 4EMGA 1W4SA 2I2LA 4XAXB 4B9WA 5GAN8 3LWIA 4RMOA 3CCQT 2DXCA 2K3XA 1M90U 4PKCC 4XU0A 4OB0B 5GAMj 3CCLT 3TU4K 1N8RC 3PT9A 2DIGA 2P0QA 2XICA 5LJ3j 3CPWA 1K8AC 2IVWA 5IT9E 1OZ3A 3QKJA 2CYZB 2E6NA 3E9GA 3QYGB 1QW1A 2KSSA 1UB4A 5CAIA 2RM4A 3OYBA 3F70A 2OAUA 2VGNA 5CKDA 3JB9G 5GANe 1YIJT 1W2BS 3L1AA 3L2RA 2P0PA 5L8RE 3OYEA 4M77E 1BIBA 2JOYA 3CMAA 5LJ5j 3JB9F 3HP9A 3GNGA 2CZ6B 3HSBA 2MAMA 3X24B 5GMKj 1KD1U 3QXEB 4A53A 3OYKA 3GIBA 3ER0A 4JS4A 2DD4A 3OSSC 1WJRA 1B34B 2E10A 2EKOA 2O4XA 3CCSA 3V8JA 3A8OB 4NS5A 4HA8A 3CCUT 1KD1C 1HK9A 4HCZA 3FC3A 4MMKA 4PJOG 1VIFA 4M7DG 4IUQA 2RK2A 3EAEA 2E41A 5LJ5d 3PNWC 2BIVA 4C92F 5GAN4 1YITA 2L89A 4C8QE 2ZPBB 1WGSA 2DTHA 2K5FA 3RMSA 4BI8B 1NJIU 1LNXA 4XTWA 1YIJA 2QQSA 4PJOB 3CC2T 4M7DB 1G3SA 3HL8A 3CCRA 1N9SA 3OYMA 3G71A 3S3MA 2RO0A 3CBMA 4JLIA 1JBMA 4OVAA 1KQSS 3JRZA 2WSEE 4QVDA 3M9QA 5GANh 3WXMB 3CC7T 5FRMA 2QXFA 3MHXA 5CIUA 3QYHB 2EYQA 3QJ6A 4C92D 1VIEA 4IUUA 3VV0A 1QP2A 1M1KU 2QTXA 4F7UE 2ZPGB 1YBYA 2IG0A 4J5YA 4PL6A 3EFSA 4GLKA 1LOJA 2CGHA 2K2VA 5CKFA 2LNVA 1U8RA 2XI9A 2MF2A 5HKCA 2R5AA 1GXIE 4PLIA 3OYJA 4L5GA 4ELZC 1Y96A 5CKBA 2QQAA 1VUBA 1RI0A 4XU1A 2C06A 5GAN6 2QEXA 2DJZA 5D6YA 3CCVT 2QA4T 2OTLA 4PLLA 2QQBA 4A4FA 5LL6S 3QIIA 2F5KA 4M78B 3WVDB 1O9SA 3C12A 2RHIA 4JJNK 4QQ6A 2VXEA 3CC7A 5M9OA 3OMCA 4X34A 2Y90A 2RA2A 4E7IA 3L42A 1V29B 4II1A 3OYNA 1KC8C 1XOVA 5GAN5 5DM7R 1H3ZA 4MZTA 3OYIA 1YJ9T 1I8FA 3M54A 2DAQA 3P8BB 3URGA 4VUBA 2XK0A 3FEOA 4Y91A 3RMQA 1K9MC 2V8KA 3M53A 1LJOA 3ME9A 4ZGJB 4BY6B 5DLQE 4MDXA 2X4WA 3DB4A 1WJQA 1YCYA 4JRPA 4C92C 5A0LA 2PVOB 2E12A 4M75F 4XTYA 3V7RA 4ZN3A 3HFOA 5GAOl 3GP8A 3JCMc 2JTFA 3HRUA 2QDYB 1W2BA 4JRQA 1VQKT 2V8JA 3HHTB 2CKKA 2RHZA 5GAOm 2JUFA 2RHUA 4CRIA 4M77G 4IURA 3JCMf 5I21A 4C92A 5KH6A 2G3RA 4M7AE 4M78E 4R56A 3V7CA 1BI1A 2NLUA 3M57A 2DXBA 2DZ9A 4RG2A 5FU7B 3CMET 4M75D 4OB2B 4M77B 5CVIA 3VU3C 4A4KA 3CD6T 3V7SA 3CCET 4J6YA 3LGLA 3UDCA 2L8DA 4BI4A 1U1TA 1WPYA 2RK1A 2LQKA 1VQPT 3G4SA 4HT8A 3I56T 3I55A 1VQ8T 4OGCA 5AYFA 2FB7A 3TEEA 4BB7A 5D6WA 2D6FA 3KUFA 4C8QG 2HQEA 2LT1A 1N8RU 1VQKA 1K8AU 1SSFA 4LD9K 3RUXA 1MGQA 1YJWA 2JZ2A 2DD5A 5FU6C 4C0DC 1VQ4A 3J7AF 1MHNA 2HAXA 2E5QA 1QP3A 2RI2A 4FIBA 1KQSA 3OYLA 4P5NA 3MP8A 1YJNT 1DJ7B 3FLGA 3PMIA 4C8QB 4EMKB 5I2SA 4BE1A 3RERA 4BE0A 1G5VA 4E7JA 4MZPA 2EFIA 1M4ZA 4D6WA 1Q81C 3JCMh 1AHJB 4C0FA 1Y7XA 4XTXA 3SFMA 5GANf 4R55A 3PTAA 3QZ5B 4F7UG 1Q86C 1ZBXA 2K5IA 4MDWA 4C5IA 3I56A 1K73C 2HBPA 3LYIA 2BKDN 3M55A 4X9CA 1JJ2S 2O01E 3JSCA 2XD0A 1BI3A 2DTOA 2D9TA 2KY9A 5GAMd 4E7KA 4IUPA 1VQ5A 3CC4A 1IREB 4F7UB 2DXTA 1Y96B 1M1GA 5LJ3d 4J8OA 3CCJT 4LDXA 2XHCA 2L5QA 4C0GA 4M75C 3AHUA 2VGMA 3CCQA 3H8ZA 2DTIA 2DZCA 3OMGA 3JCMV 3CCLA 3MEVA 1N6AA 3MP6A 3R6OA 2PU9B 4FL6A 3M4GA 5KCOA 3QBYA 3OS5A 3RKWA 2LC4A 3HRTA 4M7AF 2QI2A 2RJDA 4OP0A 3JB9D 4PJOF 4M75A 3KBGA 4QW2A 3ASKA 3ZEHA 4M7DF 2OTJT 5FLXE 4BD3A 3MEUA 4LDWA 3OS2A 2VXFA 1KG1A 4ME7A 4XTVA 3PIPA 4A54A 4JS5A 1KHCA 1PSFA 3MP1A 3GNFB 3FJPA 3QJYA 4E7LA 4JRIA 3E1SA 3CEYA 2X4JA 1X75C 3NTIA 2EQKA 4XTUA 2E6ZA 2MWPA 1VQ6T 2DVEA 2ZPEB 4PJOD 4M7DD 4BDZA 3X26B 3LWHA 2ZGWA 5GAMe 2B8AA 2CS7A 1Y07A 3PMTA 3CCUA 4KUDK 2KAFA 3JCMW 5LJ3e 1D3BA 1R8OB 2XKOC 5GAN3 3DKMA 3A8GB 2EJFA 3G6ET 1WNLA 4XU2A 4KUIA 3UWNA 2LX9A 3ZFJA 4CI0C 5GAOn 4BI3A 2XU8A 4M78G 4O5VA 2WSFE 4M7AG 2LCLA 2LT4A 3S6WA 4L59A 4M78F 1BKBA 3CC2A 5C0MA 5GAN7 4MMLA 2DXUA 3M58A 5LJ5e 1VQLT 2FL7A 2KQWA 4DQ2A 3NTHA 3QDRB 3VUBA 4IUVA 4M7AB 5GMKe 1KC8U 4LDUA 4L6V5 3GPLA 3O8VA 3VYHB 4LDYA 4OB3B 2DO3A 4DOVA 1I5LA 3OY9A 2RI3A 4EDUA 4N0AC 3OYGA 1BI2A 1K9MU 1QVPA 2DK3A 2F69A 2MMPA 3HFNA 5CO7A 5HY6A 5EG2A 4HT9A 1N9RA 5CQYA 5GAMh 4A4HA 1VQ7T 3CPFA 4KULA 3RIRA 1Y71A 4BE2A 2X4YA 4N0AA 5LJ3h 3MEAA 2HNIA 4HKEA 2HQXA 4TVRA 4LDVA 3OYHA 4ZTJA 3MCAB 1ZQ1A 2ZPFB 4B9XA 3CCVA 2QA4A 1VQLA 4ELYC 3M59A 3RESA 1UGPB 5J39A 4FT2A 4PJOC 3A5ZB 4M7DC 3HPWA 3OYYA 3V8KA 3SWNC 4C0DB 5A2QE 4C92E 2AHJB 3JCMX 3G7ZA 5CQXA 2XIDA 1JJ2A 5LJ5h 3RKYA 1NZ9A 3X20B 4PJOA 5CK9A 4M7DA 2ZCFB 3BDLA 5GMKh 2FHDA 4UC4A 2X4XA 3SWNA 4M77F 3L2ZA 1N27A 2LTOA 1FWZA 4FT4A 2ZZDA 5J26A 2VYTA 3HKSA 5C6SA 1YJ9A 3OA6A 1UEBA 2M9UA 3DB3A 1VQ7A 1QVFS 3BFMA 5HK0A 1NPRA 2RHXA 3CBOA 2RI5A 3X28B 2D0QB 1VQMT 5KE2A 5GANj 1YI2T 5FRNA 2WACA 1KQ2A 2O4XB 2X35A 2MI6A 2E70A 3A8MB 1M5Q1 4Z02A 3GOXA 4A4EA 3L2WA 1WJSA 2R58A 3OB9A 2P4TA 5KE3A 4J7FA 4J83A 4M77D 1RL2A 2PVDB 2BUDA 3FIFA 4QQDA 3UPUA 2HD0A 4OF1A 4C8QF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C92 D;  4M75 C;  4XU3 A;  2K57 A;  3AHU A;  3JB9 H;  3INZ A;  2DTI A;  2DZC A;  3JCM V;  2QTX A;  4F7U E;  4J5Y A;  3EFS A;  1LOJ A;  2CGH A;  1JRI A;  3M4G A;  5GMK i;  4RCC A;  3JB9 J;  3RKW A;  3V8L A;  4OP0 A;  5GAM g;  3QUI A;  4X9D A;  4PJO F;  4M75 A;  3JB9 D;  4M7D F;  4PNO A;  5GMK l;  1Y96 A;  1HXD A;  5LJ3 g;  3JCM Q;  4RCB A;  2VXF A;  3JCM J;  4XTV A;  2E64 A;  4M75 G;  4XU1 A;  3RKX A;  5GAN 6;  2DJZ A;  4EMH A;  2EWN A;  3BY7 A;  4A54 A;  5GMK m;  4J6X A;  4XTZ A;  4F7U F;  1D3B B;  2YLB A;  3FJP A;  1U1S A;  4V2S A;  4M78 B;  4JRI A;  1WQ7 A;  5GAN 2;  2VXE A;  3PGG A;  4M75 B;  4XTU A;  5LJ5 g;  4M78 C;  4M7A C;  2DVE A;  3EFR A;  4PJO D;  2Y90 A;  4M7D D;  2RA2 A;  2ZGW A;  5GAM e;  3JCM e;  4M75 E;  5GAN 5;  3JCM W;  5LJ3 e;  5GAO r;  3JB9 I;  1D3B A;  5GAN d;  5GAN 3;  3QHS A;  1I8F A;  2FYK A;  4M78 A;  2EJF A;  5GAN 7;  1WNL A;  2RD1 A;  4XU2 A;  4M7A A;  5DY9 A;  5GAO n;  3JCM g;  3JCM P;  4Y91 A;  4M7A G;  4M78 G;  2EJG A;  1WQW A;  4M77 C;  1LJO A;  4NL2 A;  4WF2 A;  1I4K 1;  4M78 F;  4NL3 A;  3BW1 A;  1BIA A;  1YCY A;  2EAY A;  4MML A;  2DXU A;  2VC8 A;  4C8Q D;  4C92 C;  4DQ2 A;  5LJ5 e;  4M75 F;  4XTY A;  3V7R A;  3HFO A;  5GAO l;  1TH7 A;  4M7A B;  5GMK e;  5GAO p;  3JCM c;  4M77 A;  1H64 1;  4EMG A;  2I2L A;  5GAN 8;  5GAO m;  5I21 A;  4M77 G;  3JCM f;  5GAM f;  4C92 A;  1I81 A;  1I5L A;  4M7A E;  4M78 E;  4XU0 A;  5GAM j;  4N0A C;  1M8V A;  5LJ3 f;  2E65 A;  2YHT A;  3V7C A;  3HFN A;  5LJ3 j;  4JRK A;  2DZ9 A;  4C92 G;  4XQ3 A;  4C8Q C;  4EMK C;  4HT9 A;  2EJ9 A;  1N9R A;  4M75 D;  4M77 B;  3VU3 C;  5GAM h;  5CAI A;  3RIR A;  3SB2 A;  2RM4 A;  4N0A A;  5LJ3 h;  4J6Y A;  3V7S A;  4J6W A;  2HNI A;  3JB9 G;  5GAN e;  4C92 B;  1U1T A;  1WPY A;  3L1A A;  5LJ5 f;  4HT8 A;  4M7A F;  4C8Q A;  4M77 E;  1BIB A;  3SWN B;  3RES A;  4EMK A;  5LJ5 j;  3JB9 F;  4PJO C;  2FB7 A;  4M7D C;  3HSB A;  5GAO q;  2JN0 A;  2RB6 A;  3V8K A;  4C8Q G;  3SWN C;  4NOY A;  5GMK j;  4A53 A;  4C92 E;  5GAN g;  3GIB A;  3JCM X;  3RUX A;  1MGQ A;  5LJ5 h;  1X01 A;  3RKY A;  2DEQ A;  3JCM b;  1B34 B;  2E10 A;  4PJO A;  4M7D A;  5GMK h;  3V8J A;  4JUV A;  4HA8 A;  4C8Q B;  3SWN A;  2YLC A;  1HK9 A;  4M77 F;  4EMK B;  4MMK A;  2E1H A;  4PJO G;  3L2Z A;  3RER A;  4M7D G;  4M78 D;  4M7A D;  3QSU A;  1KQ1 A;  2E41 A;  4F7U A;  5LJ5 d;  3QO3 A;  4C92 F;  3BFM A;  3FB9 A;  4C8Q E;  5GAN 4;  3JCM h;  2DTH A;  2DKG A;  4XTX A;  5GAN f;  1LNX A;  3BDU A;  4XTW A;  1B34 A;  4F7U G;  5GAN j;  1KQ2 A;  4PJO B;  4QVC A;  4M7D B;  4X9C A;  1M5Q 1;  1N9S A;  4JLI A;  1JBM A;  4QVD A;  5GAN h;  2DTO A;  4M77 D;  3JCM d;  5GAM d;  4PJO E;  3FIF A;  4M7D E;  4F7U B;  2DXT A;  1Y96 B;  5LJ3 d;  4C8Q F; 
#chains in the Genus database with same CATH topology
 2K4Y A;  1OZ2 A;  1GRI A;  4C5H A;  3JAM E;  2FRW A;  4Q5W A;  1M1F A;  2MCN A;  3LLR A;  2EQI A;  4R0K A;  1S72 T;  3CME A;  5I11 A;  2EQM A;  4J9D A;  5IN1 A;  4Y28 E;  3CCE A;  4RCB A;  1W6X A;  4OMF B;  1Q82 C;  1VQP A;  2RQV A;  2EWN A;  1JO8 A;  3UA7 A;  4F7U F;  1KJW A;  2FG0 A;  1VYT A;  1PG5 B;  3L2Q A;  1RAC B;  1I5O B;  3PGG A;  4HVW A;  4GLM A;  2CZ1 B;  3LH0 A;  2VVK A;  1WXU A;  4N4I A;  1YIJ Q;  1YIT T;  3JCM g;  3OSV A;  1X6O A;  3P8H A;  1AD5 A;  3AT1 B;  3EGD A;  4NL2 A;  3G71 Q;  1G3W A;  1VQN T;  2COY A;  5DLO A;  1RUW A;  5A0G A;  4E47 A;  4J9C A;  3I9Q A;  4DA4 A;  1ZBJ A;  1FMK A;  3OW2 S;  2L3Q A;  4JLG A;  5GAM f;  4OMP A;  1I81 A;  2MWO A;  4RKU E;  3OBY A;  4JRK A;  4C8Q C;  3G1J A;  3SDZ A;  2EYW A;  3ZBD A;  2MK5 A;  4C92 B;  1QVF A;  2RMO A;  4LD6 A;  2XDD A;  2AKK A;  1NJI C;  2MOX A;  2YSQ A;  5GAO q;  5GAN g;  2A3L A;  1AWJ A;  2L3R A;  4ZTF A;  4Z89 A;  3C4S A;  2PQW A;  1UGQ B;  5KYU A;  2K3B A;  2J05 A;  1KHI A;  3VYG A;  2QA4 Q;  1M1K C;  3FDR A;  2VKN A;  1B34 A;  2X51 A;  3L2V A;  4PJN A;  4QVC A;  1K1Z A;  1Y57 A;  3LX7 A;  1IGU A;  3C94 A;  1KD1 R;  4C5G A;  2AK5 A;  3J80 E;  1C6V X;  2JVV A;  4OB1 B;  5CKH A;  4X1V A;  2DRM A;  5GMK i;  1JRI A;  2AIR B;  1TU0 B;  4J9B A;  4FM4 B;  4ZGE B;  5GAM g;  3QUI A;  1NEG A;  3CCM A;  3EHQ A;  2PNI A;  3G4S Q;  1WYX A;  3I55 Q;  2XDB A;  4J9E A;  2E64 A;  4M75 G;  3BY7 A;  1MMD A;  2JNG A;  3VKI A;  2CH4 W;  1YJW T;  1SSH A;  1VQ4 T;  3KXT A;  1LPL A;  2PVG B;  2HKN A;  1IZ6 A;  1Q82 U;  2FYK A;  4M78 A;  3J81 E;  3NFC A;  2GQV A;  2RQR A;  3S3N A;  3EHR A;  2EJG A;  1WQW A;  1VQM A;  1YI2 A;  3BW1 A;  3REA B;  4ORZ A;  1VQ5 Q;  2VC8 A;  1YHQ A;  4RG8 A;  1JJ2 P;  3OYF A;  2O31 A;  4A4G A;  1YJN Q;  4EMG A;  1W4S A;  3CCL Q;  4RMO A;  4XU0 A;  2P84 A;  2DM1 A;  3PT9 A;  2P0Q A;  5LJ3 j;  3CPW A;  2IVW A;  2CYZ B;  2E6N A;  4QT7 A;  1PWT A;  1YIJ T;  1W2B S;  5L8R E;  3CMA A;  1VYV A;  1VA7 A;  1ZUK A;  1W70 A;  2K2M A;  3OSS C;  2A36 A;  4KGZ B;  1B34 B;  7AT1 B;  1T3S A;  3A8O B;  4NS5 A;  4HA8 A;  1RAE B;  4IIO A;  4M7D G;  2KT8 A;  1M3B A;  2E41 A;  3PNW C;  5GAN 4;  1NJI U;  2L89 A;  2KNB B;  2W0Z A;  1LNX A;  5IHK A;  2QQS A;  3CC2 T;  1G3S A;  1EFN A;  1JEG A;  3CCR A;  1N9S A;  3OYM A;  3CBM A;  2HMA A;  2WSE E;  5GAN h;  2DET A;  3VS6 A;  4OML A;  3QYH B;  4HXJ A;  3QJ6 A;  4C92 D;  4IUU A;  3G6E Q;  1M1K U;  4PFO A;  2QTX A;  1Q81 R;  3EFS A;  2K2V A;  2XI9 A;  5CKB A;  2ATC B;  1RI0 A;  2QEX A;  2DJZ A;  1WLP B;  2QA4 T;  1OQK A;  4A4F A;  5LL6 S;  4M78 B;  1O9S A;  2VXE A;  3CC7 A;  2Y90 A;  4E7I A;  4II1 A;  1QCF A;  1KC8 C;  1XOV A;  5GAN 5;  5DM7 R;  2NUP A;  2V1R A;  2QAS A;  4MZT A;  1YJ9 T;  1I8F A;  2DEU A;  3QWX X;  1YCS B;  1K9M C;  3M53 A;  1K9A A;  2LJ3 A;  4BY6 B;  2RN8 A;  2X4W A;  1YCY A;  2VWF A;  4C92 C;  4XTY A;  2GQI A;  3V7R A;  2CP3 A;  2DL7 A;  5GAO l;  3HRU A;  1UHC A;  4JRQ A;  2V8J A;  5GAO m;  4CRI A;  4M77 G;  4IUR A;  2EBP A;  4M7A E;  2DXB A;  1J3T A;  1QLY A;  5FU7 B;  3VU3 C;  4OB2 B;  2RPN A;  2L8D A;  4BI4 A;  1WPY A;  2BTT A;  2KYB A;  3THK A;  4BB7 A;  2HSP A;  2HQE A;  2LT1 A;  1VQK A;  2YRC A;  2COW A;  1N5Z A;  2DD5 A;  4C0D C;  4CC2 A;  1MHN A;  1QP3 A;  2M0Y A;  2DVJ A;  4FIB A;  1KQS A;  2JJ9 A;  1YJN T;  3PMI A;  1W1F A;  3RER A;  3TSZ A;  2DE0 X;  2EGA A;  4C0F A;  3PTA A;  3SFM A;  4F7U G;  1Q86 C;  1ZBX A;  2HZY A;  5D7U A;  4C5I A;  3EGX A;  3JSC A;  2XD0 A;  1TS9 A;  2EYX A;  2D9T A;  1GL5 A;  3CCS Q;  2DXT A;  2DTI A;  2DZC A;  3OMG A;  3JCM V;  1QVG P;  1N6A A;  4FL6 A;  5KCO A;  2OTJ Q;  1G83 A;  3UAT A;  4M75 A;  2D8H A;  3KBG A;  1X2K A;  3MEU A;  1NYF A;  3MJX A;  2CT3 A;  2NUP B;  3QJY A;  4E7L A;  1X75 C;  2DNU A;  3NTI A;  2E6Z A;  2COZ A;  3X26 B;  2CS7 A;  1VQO Q;  4KUD K;  1D3B A;  3G6E T;  5FWB A;  1WNL A;  1NYG A;  4PJL A;  5KYY B;  2WSF E;  1YNZ A;  4L59 A;  1BKB A;  2RQW A;  2KYM A;  2DXU A;  2KQW A;  3NTH A;  4M7A B;  5AT1 B;  2DLP A;  1KC8 U;  1PD0 A;  3GPL A;  4RUG A;  2DBK A;  2LJ1 A;  4LDY A;  3QWY A;  2DYI A;  4IIM A;  1K9M U;  2F69 A;  2DK3 A;  2MMP A;  2ESW A;  2L0A A;  3R6N A;  1MV3 A;  1EZZ B;  2D1X A;  4BE2 A;  1RAB B;  3MEA A;  2ZPF B;  2O9V A;  1UGP B;  2JS0 A;  3A5Z B;  1QCN A;  1SHF A;  3HPW A;  3OYY A;  2AHJ B;  5LJ5 h;  3RKY A;  4M7D A;  3BDL A;  5GMK h;  3EGX B;  1IO6 A;  2CSQ A;  2ZZD A;  2CUB A;  5C6S A;  1UEB A;  2M9U A;  3TQ7 P;  5GAN j;  2WAC A;  3NGP A;  2O4X B;  2X35 A;  3EG3 A;  2BE9 B;  2YUP A;  4Z02 A;  1WDX A;  2Z0W A;  3OB9 A;  4J83 A;  2CRE A;  2PVD B;  3FIF A;  2HD0 A;  2OX7 A;  4C8Q F;  2PTK A;  4QVZ A;  3MO8 A;  2FVU A;  2GNC A;  4KGV B;  2RJC A;  1Q86 U;  1X69 A;  2JS2 A;  4IKF A;  5FWC A;  3PFS A;  2DIQ A;  2CZ0 B;  3U23 A;  1VQ8 A;  2P0K A;  4XTZ A;  4BY6 C;  1D3B B;  1ZHI A;  1D1B A;  5GAN 2;  4O6J A;  1ZSZ A;  3M0T A;  2C0O A;  5HK3 A;  8AT1 B;  2A7Y A;  3EFR A;  1BBZ A;  2RJE A;  3CCS T;  4EPC A;  2OI3 A;  1WHJ A;  3OYD A;  1S72 A;  5GAO r;  1YIT Q;  1M3A A;  2J6F A;  3EG9 A;  3M0R A;  3PIO A;  1Q7Y U;  5FU7 C;  2BZ8 A;  3VS3 A;  4F17 A;  9ATC B;  2DX1 A;  2K3Y A;  3UA6 A;  4M77 A;  2GCX A;  1FX7 A;  1H64 1;  3CCJ A;  2GTO A;  2HQH A;  2YHT A;  2CH4 A;  4HVU A;  1VQO T;  4ATO A;  2KEA A;  3SB2 A;  1TUG B;  2C0T A;  2DL3 A;  1VQN A;  1C0M A;  2QK0 A;  2LRQ A;  4EMK A;  4C5E A;  2RB6 A;  2PUO B;  2NUZ A;  1HYO A;  1K8A R;  1VQ6 A;  2DEQ A;  3H0H A;  3NHN A;  2E1H A;  4M7A D;  5IAY A;  4F7U A;  3CQT A;  2EKH A;  2RNA A;  4E7S A;  5I2M A;  5KYX A;  2A28 A;  2DL8 A;  3A8L B;  1CKA A;  4BAC A;  2I0N A;  1HJD A;  4PJO E;  1X43 A;  3EG1 A;  4YTL A;  3HRS A;  1F1B B;  3INZ A;  4BDY A;  4IUT A;  2W10 A;  3S3O A;  2NYS A;  2EVR A;  2EW3 A;  1OUL A;  3H6Z A;  1B7T A;  1MMA A;  4X9D A;  2DJQ A;  2RHY A;  3QZ9 B;  3RKX A;  2FEI A;  2JTM A;  2HL5 C;  2OAW A;  1YJW Q;  2RQU A;  3EG9 B;  1WQ7 A;  2H3E B;  2K5L A;  1UG1 A;  1IHW A;  4M7A C;  1FXX A;  2JXB A;  4BUG A;  4N4H A;  1QCO A;  3I5R A;  3OW2 A;  3X25 B;  4FW2 A;  5GJV B;  2RQT A;  2FRY A;  3PE0 A;  3I56 Q;  1UE9 A;  4C8Q D;  4LXC A;  3P8D A;  1TH7 A;  1EIF A;  3DLM A;  3CC4 T;  1YWP A;  1D1C A;  2WSC E;  2E3I A;  4XAX B;  3CCQ T;  1OX9 A;  3TU4 K;  3PVQ A;  1H92 A;  1Z9Q A;  1OZ3 A;  1D0X A;  5CAI A;  3OYB A;  2OAU A;  2VGN A;  5CKD A;  3EH2 A;  1LVK A;  2FPE A;  1Y0M A;  3OYE A;  2JOY A;  3JB9 F;  5LJ5 j;  3HSB A;  1KD1 U;  5GMK j;  3GIB A;  1FMV A;  1WJR A;  2E10 A;  1PRM C;  4OMN A;  1HK9 A;  1TSF A;  1VIF A;  4JJD A;  2LX7 A;  5LJ5 d;  4C92 F;  1IRX A;  2ZPB B;  4A63 B;  2DMO A;  2DL4 A;  3FJ5 A;  3CC2 Q;  4XTW A;  1YIJ A;  4PJO B;  3G71 A;  5FW9 A;  3S3M A;  4OVA A;  4JLI A;  4QVD A;  3M9Q A;  1NLO C;  3A98 A;  1N8R R;  2QXF A;  5CIU A;  1RAG B;  3VV0 A;  2L3P A;  2FPF A;  2ZPG B;  1YBY A;  4GLK A;  1LOJ A;  1MND A;  1KFZ A;  5CKF A;  3EFO A;  2R5A A;  1GXI E;  4PLI A;  3MPU B;  3OYJ A;  3I5S A;  1Y96 A;  1AT1 B;  5GAN 6;  5D6Y A;  3CCV T;  2OTL A;  4PLL A;  4DBR A;  4RTX A;  3C12 A;  2KI7 A;  4RTY A;  5M9O A;  3A1P A;  1YJ9 Q;  1H3Z A;  1ZSG A;  1RAH B;  1QVF P;  2V8K A;  2HL3 A;  1MMG A;  3DB4 A;  2LQW A;  2PVO B;  2E12 A;  2JMA A;  3GP8 A;  3HFO A;  1X6G A;  3JCM c;  2JTF A;  1W2B A;  1GBR A;  1XJW B;  5I21 A;  1ABQ A;  3EGD B;  4M78 E;  2A0F B;  2LMJ A;  2B86 A;  4R56 A;  3V7C A;  3VS2 A;  1BI1 A;  2NLU A;  2DZ9 A;  3CME T;  1VQM Q;  2ENM A;  2LJ0 A;  1YI2 Q;  4AMC A;  2NUT A;  4A4K A;  2BZX A;  3V7S A;  3CCE T;  4J6Y A;  1D0Y A;  3VRY A;  4AFQ C;  2K9G A;  1VQP T;  2RK1 A;  2LQK A;  3G4S A;  3I56 T;  3I55 A;  2D6F A;  2CUD A;  3KUF A;  4C8Q G;  1SSF A;  1M3C A;  2BE7 D;  3TVT A;  3M0S A;  3KFV A;  4P5N A;  1DJ7 B;  4FYX B;  4BE0 A;  3JCM h;  4B6M A;  1WHM A;  4XTX A;  3E2U A;  1RLQ C;  1K73 C;  4X9C A;  2BKD N;  1JJ2 S;  4JJC A;  1MMN A;  5KYU B;  2DTO A;  4E7K A;  1VQ5 A;  4KH1 B;  3MKD A;  1Y96 B;  1M1G A;  5LJ3 d;  1SHG A;  1TUD A;  2EYZ A;  1Z9Z A;  2L5Q A;  3I35 A;  3H8Z A;  4CC4 B;  3CCL A;  1OX8 A;  3MEV A;  3MP6 A;  2PU9 B;  4Y92 A;  1R77 A;  1JXM A;  3RKW A;  3JB9 D;  4OP0 A;  1ZUU A;  5FLX E;  4BD3 A;  1AZE A;  3OS2 A;  1KG1 A;  4ME7 A;  4DEY A;  1GBQ A;  1KHC A;  1PSF A;  3MP1 A;  3GNF B;  3FJP A;  2QTV A;  4JRI A;  3E1S A;  4XTU A;  2MWP A;  3CPW P;  2ZPE B;  4PJO D;  2KRS A;  2VAS A;  3PMT A;  4EIK A;  3CCU A;  2KAF A;  5LJ3 e;  1M30 A;  2XKO C;  5GAN 3;  2A08 A;  3DKM A;  3A8G B;  3UWN A;  3ZFJ A;  2QEX Q;  4CI0 C;  2KR3 A;  4BI3 A;  1VQ9 Q;  2QAZ A;  2DF6 A;  1M2V A;  4M78 F;  5GAN 7;  1ARK A;  3M58 A;  2AT1 B;  2FL7 A;  2YRD A;  1PNJ A;  5EC7 A;  3O8V A;  3VYH B;  4EDU A;  2DIL A;  3EG0 A;  3HFN A;  5HY6 A;  5CO7 A;  1NM7 A;  1VOM A;  5GAM h;  4KUL A;  3RIR A;  2X4Y A;  4N0A A;  2HNI A;  2HQX A;  4TVR A;  4LDV A;  4ZTJ A;  3MCA B;  2BZY A;  4FT2 A;  4PJO C;  3V8K A;  3RNJ A;  3JCM X;  1TG0 A;  1KK7 A;  2E4H A;  2H8H A;  3X20 B;  5CK9 A;  2ZCF B;  4KRT A;  3SWN A;  1GCQ A;  4GBQ A;  1FWZ A;  1QWE A;  3OA6 A;  3DB3 A;  3BFM A;  3X28 B;  1NJI R;  1VQM T;  4JZ4 A;  1YI2 T;  2KT1 A;  3A8M B;  2CT4 A;  2ECZ A;  1X27 A;  3UPU A;  4OF1 A;  1H8K A;  3WVE B;  3OYA A;  2EIF A;  1NE8 A;  2YRV A;  4RCC A;  1QWF A;  1K73 U;  1XTD A;  6AT1 B;  5GMK l;  3QPH A;  3CD6 A;  1HXD A;  3H9N A;  2XMF A;  2PZ1 A;  1OI1 A;  2LCC A;  3CMA T;  4WCI A;  2ZPH B;  5GMK m;  3O5Z A;  3M4Y A;  4J6X A;  4J9I A;  2FZC B;  2YLB A;  1U1S A;  3JV3 A;  2EPD A;  3H0I A;  2KK4 A;  3MET A;  2FZK B;  1BB9 A;  2Y4X A;  2KMT A;  5KYN A;  3CXC P;  3TCJ A;  4M75 E;  4DBF A;  2EYY A;  2ZPI B;  2FPD A;  3QHS A;  2RJF A;  3QG1 A;  4AG1 C;  1M90 C;  2KDS A;  3JCM P;  2GF7 A;  4F04 B;  4FU6 A;  1BIA A;  2EAY A;  2R57 A;  3CCR T;  3VRZ A;  5CCA A;  1Q7Y C;  4HCC A;  5GAO p;  4PJJ A;  3CXC S;  1KQS P;  3E19 A;  2DL5 A;  2GBQ A;  1QVG S;  4ZGD B;  1M8V A;  2F2X A;  2VV5 A;  5LJ3 f;  2E65 A;  4C92 G;  2JM8 A;  4XQ3 A;  3E9F A;  2JMC A;  1BCM A;  1UGS B;  2OTJ A;  4J6W A;  2XDP A;  3GLX A;  2QEX T;  1VQ9 T;  4M7A F;  4C8Q A;  3SWN B;  1XQH A;  1LCK A;  2YUO A;  8ATC B;  1C1A A;  2F2V A;  1QMC A;  2J6O A;  1SF9 A;  1JQQ A;  1QQJ A;  3TRE A;  3C0C A;  3FRN A;  4FSX A;  1X01 A;  2KBT A;  1O75 A;  3OYC A;  2SEM A;  4PJM A;  4JUV A;  2XG8 D;  2YLC A;  1M9S A;  4M78 D;  2KVQ G;  1VQO A;  1K0X A;  1KQ1 A;  2M16 A;  3QO3 A;  1ZA1 B;  3FB9 A;  3MEW A;  2J7I A;  2DKG A;  3BDU A;  5IHN A;  3OS0 A;  4FCY A;  2QGG A;  3JCM d;  5FU6 B;  3QDF A;  2LZ6 B;  1G3T A;  4M7D E;  4NOY A;  4MZM A;  2RH2 A;  4XU3 A;  1G3Y A;  2O9S A;  2M51 A;  5D6X A;  1AVZ C;  3JB9 J;  4C0Z A;  3V8L A;  4E6R A;  5LJ3 g;  3CBP A;  2KXC A;  2YUN A;  2GFU A;  4EMH A;  3EGU A;  4JDS A;  1T0J A;  4JZ3 A;  1D0Z A;  3NPF A;  4M75 B;  4M78 C;  3NTK A;  4OGE A;  2H3J A;  1WHK A;  1OYX A;  1BCO A;  3JCM e;  2V8I A;  2DFU A;  3JB9 I;  3DLL A;  5GAN d;  2RD1 A;  3VS4 A;  1I4K 1;  1UGR B;  5IHI A;  4NL3 A;  1IXD A;  2QGF B;  3CC4 Q;  1FMW A;  1I07 A;  2ED1 A;  4ESR A;  3T9N A;  3CCQ Q;  3OS1 A;  4FYV B;  2I2L A;  3LWI A;  2YDL A;  1I0C A;  2DXC A;  1TXQ A;  1M90 U;  5GAM j;  4OB0 B;  4OMO A;  1YN8 A;  1N8R C;  2JW4 A;  2DIG A;  4FSS A;  2XIC A;  4AG2 C;  1K9M R;  5IT9 E;  1U3O A;  2QYZ A;  3QKJ A;  3QYG B;  1QW1 A;  1UB4 A;  3F70 A;  5GAN e;  3L1A A;  3L2R A;  2P0P A;  4M77 E;  1BIB A;  3HP9 A;  1GFC A;  3GNG A;  4AT1 B;  2CZ6 B;  1IB8 A;  1RAD B;  3LH5 A;  3QXE B;  4A53 A;  2KRN A;  3ER0 A;  4JS4 A;  2DD4 A;  4F14 A;  1HSQ A;  3V8J A;  1KD1 C;  3FC3 A;  4MMK A;  4IUQ A;  2RK2 A;  1M8M A;  2BIV A;  1YIT A;  1UJY A;  3RMS A;  2K5F A;  4OMM A;  4ZNX A;  4M7D B;  1K0S A;  3HL8 A;  3M0P A;  1JBM A;  1VQ6 Q;  3TSW A;  4F16 A;  1CKB A;  3WXM B;  5FRM A;  3MHX A;  1B3Q A;  3HTR A;  2EYQ A;  2MYS A;  4RTV A;  1QP2 A;  4F7U E;  2DYB A;  2LNV A;  1Q86 R;  1NEB A;  1U8R A;  2MF2 A;  1T3L A;  4L5G A;  4J9G A;  3CCV Q;  1VQL Q;  4PFZ A;  4XU1 A;  3WVD B;  4D8K A;  4QQ6 A;  1D09 B;  1U06 A;  1V29 B;  3RR6 A;  3OYN A;  1VQ7 Q;  1X2Q A;  2DAQ A;  4LUD A;  3URG A;  2XK0 A;  1WHH A;  1ZSZ B;  3FEO A;  4Y91 A;  1IGQ A;  1E6H A;  1LJO A;  1YFN A;  4MDX A;  2DRK A;  5A0L A;  2QDY B;  3HHT B;  2C0I A;  2JUF A;  2RHU A;  4M4Z A;  5KH6 A;  3JCM f;  4C92 A;  3CME Q;  3M57 A;  1PC0 A;  3CCE Q;  2DBM A;  4M75 D;  4M77 B;  1VQP Q;  1U1T A;  4HT8 A;  2V1Q A;  1PD1 A;  1VQ8 T;  4OGC A;  5AYF A;  2CP0 A;  2FB7 A;  2AKL A;  1VYU A;  2CP5 A;  1N8R U;  5L23 A;  2HSE B;  1SRM A;  3NMZ C;  3RUX A;  1MGQ A;  1YJW A;  5FU6 C;  1VQ4 A;  2A37 A;  2E5Q A;  2RI2 A;  3ZL7 C;  4EMK B;  5I2S A;  3RBB B;  4E7J A;  1YP5 A;  2EFI A;  4AFS C;  1M4Z A;  4D6W A;  1Q81 C;  1OU8 A;  5GAN f;  4R55 A;  4JPB W;  2K5I A;  3I56 A;  3SEM A;  1IRE B;  4F7U B;  4J8O A;  3CCJ T;  2XHC A;  3OW2 P;  4M75 C;  1GFD A;  5IXB A;  5KYX B;  3VS7 A;  2KGT A;  1K76 A;  1E6G A;  1RAA B;  3QBY A;  2LC4 A;  1OPL A;  4PJO F;  2X3X D;  4LDW A;  2O88 A;  4XTV A;  2L3S A;  1BK2 A;  3PIP A;  2ROL A;  1TWB A;  4OMQ A;  1E7O A;  2IPO B;  2CSI A;  1VQ6 T;  2DVE A;  4M7D D;  2ZGW A;  2EGE A;  2B8A A;  1Y07 A;  1R8O B;  1GCP A;  2EJF A;  2QDL A;  4XU2 A;  2YXY A;  2LX9 A;  1MV0 B;  2OTL Q;  2XU8 A;  4M7A G;  2LCL A;  1AWW A;  2K7A A;  2LT4 A;  2HBW A;  3CC2 A;  3ULR B;  5C0M A;  1VQL T;  5LJ5 e;  3QDR B;  3VUB A;  1WFW A;  1V1C A;  5GMK e;  4L6V 5;  4PK4 A;  1M2O A;  2CDT A;  2VB6 A;  2DO3 A;  4HCK A;  1BI2 A;  1B07 A;  5EG2 A;  3M0Q A;  3CCM Q;  4HT9 A;  4RTZ A;  5CQY A;  1VQ7 T;  1Y71 A;  1UGV A;  3OYH A;  2QA4 A;  3M59 A;  3RES A;  3VS0 A;  5J39 A;  4M7D C;  1TUC A;  1CSK A;  4C0D B;  3EH1 A;  3VS1 A;  2NWM A;  4KGX B;  5CQX A;  1JJ2 A;  1ZLM A;  2HCK A;  2FHD A;  4UC4 A;  2YUQ A;  1N27 A;  2LTO A;  3L2Z A;  1YJ9 A;  1HD3 A;  3HKS A;  1QVF S;  1OOT A;  2D0Q B;  1WXB A;  5IH2 A;  4CC7 A;  1PCX A;  1YHQ Q;  1KSW A;  2HEQ A;  2E70 A;  3GOX A;  4A4E A;  3L2W A;  5I22 A;  5KE3 A;  4M77 D;  2BUD A;  1G2B A;  3GBQ A;  2CP2 A;  3BE3 A;  4DBQ A;  2K57 A;  1AOJ A;  3EG2 A;  1Q81 U;  1UDL A;  5CR2 A;  1RAI B;  1V76 A;  5J3B A;  1H3H A;  1JU5 C;  1NG2 A;  1PKT A;  2YWW A;  4PNO A;  2J06 A;  3CMA Q;  1ZSZ C;  4KBM B;  2Y4Y A;  3JCM J;  5CKE A;  1W2B P;  4E7H A;  2CZ7 B;  4GY5 A;  3N5B B;  3EFO B;  2ED0 A;  1SRL A;  2M02 A;  2E5K A;  1AEY A;  3C95 A;  2EQU A;  1YJN A;  5ECA A;  3Q1J A;  2KXD A;  1R0B G;  3OBW A;  4M77 C;  3CCR Q;  4J7I A;  2LQ8 A;  1I1J A;  3G71 T;  2QQ9 A;  4ZN1 A;  2O2O A;  2F1L A;  2P4R A;  2LDM A;  3CCU Q;  1WX6 A;  2LVM A;  1WIE A;  4XK8 E;  3UT1 A;  4EMK C;  2EJ9 A;  2R5M A;  1Q82 R;  2E3H A;  2AZV A;  4FYW B;  2MIO A;  5LJ5 f;  2OTL T;  2VUB A;  1NBE B;  2J6K A;  3SD4 A;  3CC7 Q;  3A8H B;  2JN0 A;  3CPW S;  2NUT B;  1NPP A;  1P92 A;  3JCM b;  3VUZ A;  1AWX A;  1U5S A;  3G6E A;  3QSU A;  5KCH A;  2DPP B;  4DOW A;  1UEC A;  1JXO A;  3CCM T;  2PUK B;  4QQG A;  1VQ9 A;  2M1H A;  1EX4 A;  1XNI A;  1UFF A;  1TTH B;  1BYM A;  2YT6 A;  5A0D A;  4KT0 E;  2EQJ A;  3OQ5 A;  3L2U A;  3JB9 H;  2QQR A;  4CC3 A;  1UJ0 A;  1WHG A;  2M0O A;  3LW5 E;  1ACM B;  3JCM Q;  1WHL A;  2KRM A;  2ROT A;  4J9F A;  3M56 A;  3VJP A;  3GF5 A;  4Z8A A;  3G4S T;  3I55 T;  1VQK Q;  1YHQ T;  4V2S A;  4N4G A;  1AZG B;  4DEX A;  5KYY A;  1SPK A;  5LJ5 g;  5FRO A;  1Q95 G;  3CXC A;  3CD6 Q;  1M1K R;  4HCB A;  3LGF A;  1JB0 E;  4M7A A;  1QVG A;  1ABO A;  1K4U S;  5DY9 A;  1D1A A;  1PSE A;  1RI9 A;  4WF2 A;  2GFA A;  2HKQ B;  4QKU A;  3M5A A;  1NLP C;  3IQL A;  2F5T X;  1VQ5 T;  1BI0 A;  5GAN 8;  4B9W A;  4AFU C;  2QG9 B;  2K3X A;  1M2V B;  1IHV A;  4PKC C;  3CCL T;  1K8A C;  3E9G A;  2KSS A;  4E7Z A;  2V26 A;  2RM4 A;  1S1N A;  3JB9 G;  1ZA2 B;  1ZX6 A;  2KE9 A;  2MAM A;  3X24 B;  2MPX C;  4FYY B;  3OYK A;  1UHF A;  5IXF A;  4K11 A;  2EKO A;  2O4X A;  3CCS A;  1MNE A;  3CCU T;  1X6B A;  4HCZ A;  1WXT A;  1YWO A;  4PJO G;  1M27 C;  3EAE A;  4C8Q E;  1WGS A;  2DTH A;  4BI8 B;  3H41 A;  2RO0 A;  1KQS S;  3JRZ A;  4DBH A;  1A0N B;  1MUZ A;  3CC7 T;  2D8J A;  4LN2 A;  2G6F X;  1VIE A;  1WZO A;  2L2P A;  4PL6 A;  4J5Y A;  2IG0 A;  2CGH A;  2LCS A;  1UTI A;  5HKC A;  1K73 R;  4E2F B;  4ELZ C;  2QQA A;  1RAF B;  1VUB A;  2C06 A;  1PRL C;  1OU9 A;  2QQB A;  3QII A;  2F5K A;  4WTO B;  1PM3 A;  2RHI A;  1PHT A;  4JJN K;  1ZUY A;  3OMC A;  4X34 A;  5GJW B;  2RA2 A;  3L42 A;  3OYI A;  3M54 A;  2JT4 A;  2X3W D;  3P8B B;  4VUB A;  3RMQ A;  1FYN A;  3ME9 A;  2DA9 A;  4ZGJ B;  5DLQ E;  1WJQ A;  4JRP A;  4M75 F;  4ZN3 A;  3UF4 A;  2CP7 A;  2LP5 A;  1VQK T;  2CKK A;  2RHZ A;  3D7S B;  5KYW A;  2G3R A;  2DER A;  3VS5 A;  4RG2 A;  5CVI A;  3CD6 T;  3LGL A;  3UDC A;  1VQ8 Q;  4AFZ C;  2SRC A;  3TEE A;  4PFP A;  5D6W A;  3PVL A;  1R0C B;  3H0F A;  1K8A U;  4LD9 K;  3J7A F;  2JZ2 A;  2JTE A;  1KC8 R;  1TOV A;  2HAX A;  1S72 Q;  3OYL A;  3MP8 A;  4C8Q B;  3FLG A;  4BE1 A;  4RTW A;  4HVV A;  1OPK A;  4MZP A;  1AHJ B;  1Y7X A;  1OV3 A;  3QZ5 B;  2LQN A;  4MDW A;  2FZG B;  2HBP A;  3LYI A;  3M55 A;  2O01 E;  3CCJ Q;  1BI3 A;  3CC4 A;  2KY9 A;  5GAM d;  1G5V A;  4IUP A;  4J9H A;  4LDX A;  4C0G A;  3AHU A;  2VGM A;  1BU1 A;  4LUE A;  4KH0 B;  4Z88 A;  3CCQ A;  3R6O A;  2AZS A;  3M4G A;  3OS5 A;  3REB B;  3HRT A;  2QI2 A;  2RJD A;  2KRO A;  1VQN Q;  4QW2 A;  4M7D F;  3ASK A;  3ZEH A;  2OTJ T;  2VXF A;  2LNH B;  1QKX A;  4LNP A;  4A54 A;  4JS5 A;  1WI7 A;  1SG5 A;  3CEY A;  2X4J A;  4D8D A;  2EQK A;  4JJB A;  2HDA A;  4BDZ A;  3LWH A;  1SEM A;  5GAM e;  3JCM W;  1AWO A;  2OJ2 A;  2X9H A;  3M0U A;  4KUI A;  5GAO n;  4O5V A;  4M78 G;  4ANJ A;  2EGC A;  5KYW B;  3S6W A;  2JM9 A;  2K6D A;  4LE9 A;  4MML A;  3SHW A;  2K79 A;  4DQ2 A;  4IUV A;  4LDU A;  4OB3 B;  1T0H A;  4DOV A;  1I5L A;  3OY9 A;  2GTJ A;  2RI3 A;  4N0A C;  3RDV A;  3OYG A;  1M90 R;  1QVP A;  2ABL A;  1SKU B;  1G8X A;  2RF0 A;  1N9R A;  2CP6 A;  1QKW A;  1WA7 A;  4A4H A;  3CPF A;  1Q7Y R;  5LJ3 h;  1PKS A;  4HKE A;  2GGR A;  1ZQ1 A;  4B9X A;  3CCV A;  4RTU A;  1VQL A;  4ELY C;  1UUE A;  3SWN C;  5A2Q E;  4C92 E;  1GCQ C;  3G7Z A;  2XID A;  1NZ9 A;  4PJO A;  1KIK A;  2X4X A;  4M77 F;  4FT4 A;  4RTT A;  2VYT A;  5J26 A;  1VQ7 A;  5HK0 A;  1NPR A;  2RHX A;  3CBO A;  2RI5 A;  1RLP C;  5KE2 A;  2D0N A;  5FRN A;  1KQ2 A;  2ZAE A;  2IIM A;  2MI6 A;  1M5Q 1;  4FW1 A;  2F2W A;  1WJS A;  2R58 A;  2FO0 A;  1VQ4 Q;  2P4T A;  4J7F A;  1OEB A;  1RL2 A;  5HCK A;  4QQD A; 
#chains in the Genus database with same CATH homology
 2K4Y A;  1OZ2 A;  4QVZ A;  3MO8 A;  2FVU A;  4C5H A;  2K57 A;  4Q5W A;  3JAM E;  1M1F A;  1Q81 U;  3WVE B;  3OYA A;  3LLR A;  2EIF A;  2RJC A;  5CR2 A;  1Q86 U;  1S72 T;  1NE8 A;  2YRV A;  3CME A;  4RCC A;  2EQM A;  1K73 U;  4IKF A;  5J3B A;  1XTD A;  5IN1 A;  4PNO A;  5GMK l;  3QPH A;  4Y28 E;  1HXD A;  3CD6 A;  3CCE A;  4KBM B;  4RCB A;  2Y4Y A;  3JCM J;  4OMF B;  3PFS A;  5CKE A;  1Q82 C;  2DIQ A;  1VQP A;  1OI1 A;  2CZ0 B;  2EWN A;  2LCC A;  2ZPH B;  5GMK m;  3CMA T;  1VQ8 A;  3M4Y A;  2P0K A;  4J6X A;  4XTZ A;  1D3B B;  2YLB A;  1ZHI A;  4BY6 C;  2CZ7 B;  1U1S A;  4F7U F;  4E7H A;  4GY5 A;  3L2Q A;  5GAN 2;  3N5B B;  4O6J A;  2KK4 A;  3MET A;  3PGG A;  5HK3 A;  2A7Y A;  2Y4X A;  3EFR A;  2CZ1 B;  2KMT A;  2RJE A;  3CCS T;  3C95 A;  2EQU A;  3LH0 A;  4EPC A;  1YJN A;  3Q1J A;  3TCJ A;  4M75 E;  3OYD A;  1S72 A;  2ZPI B;  5GAO r;  3QHS A;  2RJF A;  3QG1 A;  3PIO A;  1Q7Y U;  5FU7 C;  4N4I A;  1YIT T;  1M90 C;  2KDS A;  3JCM g;  3OSV A;  3JCM P;  1X6O A;  2GF7 A;  3OBW A;  3P8H A;  4M77 C;  4NL2 A;  1G3W A;  2LQ8 A;  4J7I A;  4FU6 A;  1VQN T;  1BIA A;  5DLO A;  2EAY A;  2R57 A;  3CCR T;  5A0G A;  5CCA A;  3G71 T;  2K3Y A;  2QQ9 A;  4E47 A;  4ZN1 A;  1Q7Y C;  4HCC A;  2LDM A;  5GAO p;  4DA4 A;  4M77 A;  2GCX A;  3CXC S;  3OW2 S;  1H64 1;  1FX7 A;  3CCJ A;  3E19 A;  1QVG S;  4JLG A;  5GAM f;  4ZGD B;  1I81 A;  1M8V A;  2LVM A;  2VV5 A;  2MWO A;  4RKU E;  3OBY A;  5LJ3 f;  2E65 A;  2YHT A;  4XK8 E;  3UT1 A;  4JRK A;  4C92 G;  4XQ3 A;  3E9F A;  4C8Q C;  4EMK C;  2EJ9 A;  2R5M A;  1VQO T;  4ATO A;  1UGS B;  2OTJ A;  3SB2 A;  4J6W A;  3SDZ A;  2XDP A;  3GLX A;  3ZBD A;  4C92 B;  2QEX T;  1VQN A;  5LJ5 f;  1VQ9 T;  2OTL T;  2VUB A;  2LRQ A;  3SWN B;  1XQH A;  4C8Q A;  4LD6 A;  4EMK A;  2XDD A;  4C5E A;  1QVF A;  3SD4 A;  1NJI C;  3A8H B;  5GAO q;  2JN0 A;  2RB6 A;  2PUO B;  5GAN g;  2A3L A;  3CPW S;  3TRE A;  3FRN A;  1NPP A;  4FSX A;  1X01 A;  1P92 A;  2L3R A;  1VQ6 A;  2DEQ A;  3JCM b;  1O75 A;  4ZTF A;  3OYC A;  3C4S A;  2PQW A;  1UGQ B;  4JUV A;  3VUZ A;  2XG8 D;  2YLC A;  1M9S A;  1KHI A;  2E1H A;  4M7A D;  4M78 D;  2KVQ G;  3G6E A;  1VQO A;  3QSU A;  5IAY A;  1KQ1 A;  2DPP B;  3VYG A;  2M16 A;  3QO3 A;  4F7U A;  5KCH A;  3FB9 A;  4DOW A;  3MEW A;  1M1K C;  3CCM T;  2DKG A;  3FDR A;  3BDU A;  2PUK B;  5I2M A;  1B34 A;  4QQG A;  3OS0 A;  2M1H A;  3A8L B;  1VQ9 A;  3L2V A;  4QVC A;  4BAC A;  3LX7 A;  1XNI A;  1BYM A;  3C94 A;  3JCM d;  5FU6 B;  4PJO E;  4M7D E;  1G3T A;  4NOY A;  5A0D A;  4C5G A;  4MZM A;  4KT0 E;  2EQJ A;  3J80 E;  3OQ5 A;  2RH2 A;  3HRS A;  4YTL A;  4XU3 A;  3L2U A;  3JB9 H;  1G3Y A;  3INZ A;  2JVV A;  4OB1 B;  5CKH A;  4BDY A;  4IUT A;  2QQR A;  5D6X A;  1JRI A;  5GMK i;  3S3O A;  3JB9 J;  4C0Z A;  3H6Z A;  2M0O A;  4FM4 B;  3V8L A;  3QUI A;  4X9D A;  4ZGE B;  5GAM g;  3CCM A;  2RHY A;  3LW5 E;  3QZ9 B;  5LJ3 g;  3JCM Q;  3CBP A;  2XDB A;  2E64 A;  4M75 G;  3M56 A;  3RKX A;  2GFU A;  2JTM A;  3BY7 A;  3GF5 A;  3VJP A;  4EMH A;  3G4S T;  3I55 T;  4JDS A;  1YHQ T;  4V2S A;  4N4G A;  2JNG A;  3VKI A;  1WQ7 A;  2K5L A;  4M75 B;  1YJW T;  5LJ5 g;  4M78 C;  3NTK A;  4OGE A;  2H3J A;  1VQ4 T;  4M7A C;  3KXT A;  1FXX A;  2PVG B;  1OYX A;  1IZ6 A;  4BUG A;  5FRO A;  3JCM e;  4N4H A;  2V8I A;  3CXC A;  3OW2 A;  3X25 B;  3JB9 I;  3DLL A;  1Q82 U;  5GAN d;  3LGF A;  4HCB A;  1JB0 E;  2FYK A;  4M78 A;  1QVG A;  4M7A A;  2RD1 A;  3J81 E;  3NFC A;  5DY9 A;  2GQV A;  3S3N A;  1PSE A;  2EJG A;  1WQW A;  1VQM A;  1YI2 A;  4WF2 A;  2GFA A;  1I4K 1;  1UGR B;  4NL3 A;  3BW1 A;  3M5A A;  4C8Q D;  2VC8 A;  1YHQ A;  4RG8 A;  2F5T X;  3OYF A;  3P8D A;  3T9N A;  1TH7 A;  1EIF A;  3DLM A;  4A4G A;  3CC4 T;  1VQ5 T;  2WSC E;  3OS1 A;  1BI0 A;  4EMG A;  1W4S A;  2I2L A;  4XAX B;  4B9W A;  5GAN 8;  3LWI A;  4RMO A;  3CCQ T;  2DXC A;  2K3X A;  1M90 U;  4PKC C;  4XU0 A;  4OB0 B;  5GAM j;  3CCL T;  3TU4 K;  1N8R C;  3PT9 A;  2DIG A;  2P0Q A;  2XIC A;  5LJ3 j;  3CPW A;  1K8A C;  2IVW A;  5IT9 E;  1OZ3 A;  3QKJ A;  2CYZ B;  2E6N A;  3E9G A;  3QYG B;  1QW1 A;  2KSS A;  1UB4 A;  5CAI A;  2RM4 A;  3OYB A;  3F70 A;  2OAU A;  2VGN A;  5CKD A;  3JB9 G;  5GAN e;  1YIJ T;  1W2B S;  3L1A A;  3L2R A;  2P0P A;  5L8R E;  3OYE A;  4M77 E;  1BIB A;  2JOY A;  3CMA A;  5LJ5 j;  3JB9 F;  3HP9 A;  3GNG A;  2CZ6 B;  3HSB A;  2MAM A;  3X24 B;  5GMK j;  1KD1 U;  3QXE B;  4A53 A;  3OYK A;  3GIB A;  3ER0 A;  4JS4 A;  2DD4 A;  3OSS C;  1WJR A;  1B34 B;  2E10 A;  2EKO A;  2O4X A;  3CCS A;  3V8J A;  3A8O B;  4NS5 A;  4HA8 A;  3CCU T;  1KD1 C;  1HK9 A;  4HCZ A;  3FC3 A;  4MMK A;  4PJO G;  1VIF A;  4M7D G;  4IUQ A;  2RK2 A;  3EAE A;  2E41 A;  5LJ5 d;  3PNW C;  2BIV A;  4C92 F;  5GAN 4;  1YIT A;  2L89 A;  4C8Q E;  2ZPB B;  1WGS A;  2DTH A;  2K5F A;  3RMS A;  4BI8 B;  1NJI U;  1LNX A;  4XTW A;  1YIJ A;  2QQS A;  4PJO B;  3CC2 T;  4M7D B;  1G3S A;  3HL8 A;  3CCR A;  1N9S A;  3OYM A;  3G71 A;  3S3M A;  2RO0 A;  3CBM A;  4JLI A;  1JBM A;  4OVA A;  1KQS S;  3JRZ A;  2WSE E;  4QVD A;  3M9Q A;  5GAN h;  3WXM B;  3CC7 T;  5FRM A;  2QXF A;  3MHX A;  5CIU A;  3QYH B;  2EYQ A;  3QJ6 A;  4C92 D;  1VIE A;  4IUU A;  3VV0 A;  1QP2 A;  1M1K U;  2QTX A;  4F7U E;  2ZPG B;  1YBY A;  2IG0 A;  4J5Y A;  4PL6 A;  3EFS A;  4GLK A;  1LOJ A;  2CGH A;  2K2V A;  5CKF A;  2LNV A;  1U8R A;  2XI9 A;  2MF2 A;  5HKC A;  2R5A A;  1GXI E;  4PLI A;  3OYJ A;  4L5G A;  4ELZ C;  1Y96 A;  5CKB A;  2QQA A;  1VUB A;  1RI0 A;  4XU1 A;  2C06 A;  5GAN 6;  2QEX A;  2DJZ A;  5D6Y A;  3CCV T;  2QA4 T;  2OTL A;  4PLL A;  2QQB A;  4A4F A;  5LL6 S;  3QII A;  2F5K A;  4M78 B;  3WVD B;  1O9S A;  3C12 A;  2RHI A;  4JJN K;  4QQ6 A;  2VXE A;  3CC7 A;  5M9O A;  3OMC A;  4X34 A;  2Y90 A;  2RA2 A;  4E7I A;  3L42 A;  1V29 B;  4II1 A;  3OYN A;  1KC8 C;  1XOV A;  5GAN 5;  5DM7 R;  1H3Z A;  4MZT A;  3OYI A;  1YJ9 T;  1I8F A;  3M54 A;  2DAQ A;  3P8B B;  3URG A;  4VUB A;  2XK0 A;  3FEO A;  4Y91 A;  3RMQ A;  1K9M C;  2V8K A;  3M53 A;  1LJO A;  3ME9 A;  4ZGJ B;  4BY6 B;  5DLQ E;  4MDX A;  2X4W A;  3DB4 A;  1WJQ A;  1YCY A;  4JRP A;  4C92 C;  5A0L A;  2PVO B;  2E12 A;  4M75 F;  4XTY A;  3V7R A;  4ZN3 A;  3HFO A;  5GAO l;  3GP8 A;  3JCM c;  2JTF A;  3HRU A;  2QDY B;  1W2B A;  4JRQ A;  1VQK T;  2V8J A;  3HHT B;  2CKK A;  2RHZ A;  5GAO m;  2JUF A;  2RHU A;  4CRI A;  4M77 G;  4IUR A;  3JCM f;  5I21 A;  4C92 A;  5KH6 A;  2G3R A;  4M7A E;  4M78 E;  4R56 A;  3V7C A;  1BI1 A;  2NLU A;  3M57 A;  2DXB A;  2DZ9 A;  4RG2 A;  5FU7 B;  3CME T;  4M75 D;  4OB2 B;  4M77 B;  5CVI A;  3VU3 C;  4A4K A;  3CD6 T;  3V7S A;  3CCE T;  4J6Y A;  3LGL A;  3UDC A;  2L8D A;  4BI4 A;  1U1T A;  1WPY A;  2RK1 A;  2LQK A;  1VQP T;  3G4S A;  4HT8 A;  3I56 T;  3I55 A;  1VQ8 T;  4OGC A;  5AYF A;  2FB7 A;  3TEE A;  4BB7 A;  5D6W A;  2D6F A;  3KUF A;  4C8Q G;  2HQE A;  2LT1 A;  1N8R U;  1VQK A;  1K8A U;  1SSF A;  4LD9 K;  3RUX A;  1MGQ A;  1YJW A;  2JZ2 A;  2DD5 A;  5FU6 C;  4C0D C;  1VQ4 A;  3J7A F;  1MHN A;  2HAX A;  2E5Q A;  1QP3 A;  2RI2 A;  4FIB A;  1KQS A;  3OYL A;  4P5N A;  3MP8 A;  1YJN T;  1DJ7 B;  3FLG A;  3PMI A;  4C8Q B;  4EMK B;  5I2S A;  4BE1 A;  3RER A;  4BE0 A;  1G5V A;  4E7J A;  4MZP A;  2EFI A;  1M4Z A;  4D6W A;  1Q81 C;  3JCM h;  1AHJ B;  4C0F A;  1Y7X A;  4XTX A;  3SFM A;  5GAN f;  4R55 A;  3PTA A;  3QZ5 B;  4F7U G;  1Q86 C;  1ZBX A;  2K5I A;  4MDW A;  4C5I A;  3I56 A;  1K73 C;  2HBP A;  3LYI A;  2BKD N;  3M55 A;  4X9C A;  1JJ2 S;  2O01 E;  3JSC A;  2XD0 A;  1BI3 A;  2DTO A;  2D9T A;  2KY9 A;  5GAM d;  4E7K A;  4IUP A;  1VQ5 A;  3CC4 A;  1IRE B;  4F7U B;  2DXT A;  1Y96 B;  1M1G A;  5LJ3 d;  4J8O A;  3CCJ T;  4LDX A;  2XHC A;  2L5Q A;  4C0G A;  4M75 C;  3AHU A;  2VGM A;  3CCQ A;  3H8Z A;  2DTI A;  2DZC A;  3OMG A;  3JCM V;  3CCL A;  3MEV A;  1N6A A;  3MP6 A;  3R6O A;  2PU9 B;  4FL6 A;  3M4G A;  5KCO A;  3QBY A;  3OS5 A;  3RKW A;  2LC4 A;  3HRT A;  4M7A F;  2QI2 A;  2RJD A;  4OP0 A;  3JB9 D;  4PJO F;  4M75 A;  3KBG A;  4QW2 A;  3ASK A;  3ZEH A;  4M7D F;  2OTJ T;  5FLX E;  4BD3 A;  3MEU A;  4LDW A;  3OS2 A;  2VXF A;  1KG1 A;  4ME7 A;  4XTV A;  3PIP A;  4A54 A;  4JS5 A;  1KHC A;  1PSF A;  3MP1 A;  3GNF B;  3FJP A;  3QJY A;  4E7L A;  4JRI A;  3E1S A;  3CEY A;  2X4J A;  1X75 C;  3NTI A;  2EQK A;  4XTU A;  2E6Z A;  2MWP A;  1VQ6 T;  2DVE A;  2ZPE B;  4PJO D;  4M7D D;  4BDZ A;  3X26 B;  3LWH A;  2ZGW A;  5GAM e;  2B8A A;  2CS7 A;  1Y07 A;  3PMT A;  3CCU A;  4KUD K;  2KAF A;  3JCM W;  5LJ3 e;  1D3B A;  1R8O B;  2XKO C;  5GAN 3;  3DKM A;  3A8G B;  2EJF A;  3G6E T;  1WNL A;  4XU2 A;  4KUI A;  3UWN A;  2LX9 A;  3ZFJ A;  4CI0 C;  5GAO n;  4BI3 A;  2XU8 A;  4M78 G;  4O5V A;  2WSF E;  4M7A G;  2LCL A;  2LT4 A;  3S6W A;  4L59 A;  4M78 F;  1BKB A;  3CC2 A;  5C0M A;  5GAN 7;  4MML A;  2DXU A;  3M58 A;  5LJ5 e;  1VQL T;  2FL7 A;  2KQW A;  4DQ2 A;  3NTH A;  3QDR B;  3VUB A;  4IUV A;  4M7A B;  5GMK e;  1KC8 U;  4LDU A;  4L6V 5;  3GPL A;  3O8V A;  3VYH B;  4LDY A;  4OB3 B;  2DO3 A;  4DOV A;  1I5L A;  3OY9 A;  2RI3 A;  4EDU A;  4N0A C;  3OYG A;  1BI2 A;  1K9M U;  1QVP A;  2DK3 A;  2F69 A;  2MMP A;  3HFN A;  5CO7 A;  5HY6 A;  5EG2 A;  4HT9 A;  1N9R A;  5CQY A;  5GAM h;  4A4H A;  1VQ7 T;  3CPF A;  4KUL A;  3RIR A;  1Y71 A;  4BE2 A;  2X4Y A;  4N0A A;  5LJ3 h;  3MEA A;  2HNI A;  4HKE A;  2HQX A;  4TVR A;  4LDV A;  3OYH A;  4ZTJ A;  3MCA B;  1ZQ1 A;  2ZPF B;  4B9X A;  3CCV A;  2QA4 A;  1VQL A;  4ELY C;  3M59 A;  3RES A;  1UGP B;  5J39 A;  4FT2 A;  4PJO C;  3A5Z B;  4M7D C;  3HPW A;  3OYY A;  3V8K A;  3SWN C;  4C0D B;  5A2Q E;  4C92 E;  2AHJ B;  3JCM X;  3G7Z A;  5CQX A;  2XID A;  1JJ2 A;  5LJ5 h;  3RKY A;  1NZ9 A;  3X20 B;  4PJO A;  5CK9 A;  4M7D A;  2ZCF B;  3BDL A;  5GMK h;  2FHD A;  4UC4 A;  2X4X A;  3SWN A;  4M77 F;  3L2Z A;  1N27 A;  2LTO A;  1FWZ A;  4FT4 A;  2ZZD A;  5J26 A;  2VYT A;  3HKS A;  5C6S A;  1YJ9 A;  3OA6 A;  1UEB A;  2M9U A;  3DB3 A;  1VQ7 A;  1QVF S;  3BFM A;  5HK0 A;  1NPR A;  2RHX A;  3CBO A;  2RI5 A;  3X28 B;  2D0Q B;  1VQM T;  5KE2 A;  5GAN j;  1YI2 T;  5FRN A;  2WAC A;  1KQ2 A;  2O4X B;  2X35 A;  2MI6 A;  2E70 A;  3A8M B;  1M5Q 1;  4Z02 A;  3GOX A;  4A4E A;  3L2W A;  1WJS A;  2R58 A;  3OB9 A;  2P4T A;  5KE3 A;  4J7F A;  4J83 A;  4M77 D;  1RL2 A;  2PVD B;  2BUD A;  3FIF A;  4QQD A;  3UPU A;  2HD0 A;  4OF1 A;  4C8Q F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...