4EMKC

Crystal structure of splsm5/6/7
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
69
structure length
60
Chain Sequence
QDQRIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLGAIRKLGLVVVRGTTLVLIAPMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm5
publication title Crystal Structures of Lsm3, Lsm4 and Lsm5/6/7 from Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
total genus 9
structure length 60
sequence length 69
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4emkC00
3QSUA 4C92G 1Y96A 3RESA 4C92C 1I4K1 2YLBA 5GANg 4M75F 1TH7A 4M7AG 1WPYA 4C8QE 5GMKh 5GAN5 3JCMg 4M7AC 4M78F 2DTOA 5LJ3f 4A54A 4C92A 3L2ZA 5GAOr 1WNLA 5LJ3h 4HT8A 4JLIA 2QTXA 2DTHA 4F7UF 4M7AA 4DQ2A 3RKYA 5GAOq 5CAIA 4C92E 4XTWA 3L1AA 5GAMe 1JBMA 3GIBA 4M7AE 2DZ9A 4JRIA 3JB9G 5LJ3g 5GAMj 4PNOA 4J6WA 5GMKm 5GANe 1U1SA 5GAN8 1I5LA 2EJFA 3QO3A 1LJOA 5GAN3 3JCMe 5GANj 4M75D 3JCMh 4M77B 3RUXA 5GAOp 4M7DG 1JRIA 4M78D 3M4GA 2EJ9A 1U1TA 4C8QF 4M77G 4RCCA 4M77C 2DEQA 2DVEA 4X9DA 4M7DA 1YCYA 4XU0A 5GMKe 2DKGA 3SB2A 4M77A 5DY9A 5GMKj 5LJ3e 4M7AD 4C92F 2FYKA 4M7DE 3INZA 5LJ3j 1WQWA 2VXEA 2DXUA 3JB9J 1M5Q1 2ZGWA 4M7AF 1I8FA 2E65A 4M75B 2DJZA 4HA8A 4PJOD 4M78B 5GAOl 4J5YA 4PJOB 3BW1A 4C8QD 1KQ2A 2CGHA 4M75C 5GMKi 3JCMV 1M8VA 3HSBA 5LJ5f 2RM4A 4F7UB 4PJOG 3EFRA 5LJ5h 4M78C 3V8JA 3SWNB 2DZCA 4PJOC 1X01A 3FB9A 3JB9F 4F7UG 1N9RA 2EJGA 3HFNA 4MMLA 1HXDA 4QVCA 4M78A 4C92D 4PJOA 3SWNC 4XQ3A 1BIBA 3V7RA 3V8KA 4EMGA 5GAOn 3JB9I 3JCMJ 1HK9A 4MMKA 4M7DF 3BFMA 4F7UA 2E10A 3QUIA 3V7SA 5LJ5g 3VU3C 4J6YA 3RERA 3BY7A 4QVDA 5GAN7 1B34B 2Y90A 3FJPA 4NOYA 4C8QB 3PGGA 2K57A 4NL2A 4EMHA 1Y96B 4M77E 3JCMP 5GAMd 2I2LA 4Y91A 4EMKB 4JUVA 4C8QC 2EAYA 4XU1A 5GAN2 1WQ7A 3AHUA 3JB9D 5GAOm 5GANd 4M75G 2YHTA 1B34A 3JCMd 4EMKC 4C8QA 1LOJA 1H641 4M78G 5LJ5e 5GAN4 4M7DD 5LJ5j 1I81A 4JRKA 4M75A 1BIAA 4XTZA 4EMKA 4NL3A 1D3BB 4M77D 3RIRA 4WF2A 4XTUA 3FIFA 3RKXA 1MGQA 4J6XA 2VC8A 4XU2A 4PJOF 4XTVA 3EFSA 2DTIA 4N0AC 4M75E 4V2SA 3JCMX 5LJ3d 4XTXA 2FB7A 2JN0A 2RD1A 4M78E 4X9CA 3SWNA 3V8LA 4A53A 4PJOE 3JCMb 1KQ1A 4M77F 4N0AA 3RKWA 1D3BA 2EWNA 2HNIA 3V7CA 5GAMf 4F7UE 4RCBA 3JB9H 5GAMh 3QHSA 3HFOA 3JCMQ 2E41A 5I21A 1LNXA 4C8QG 5GMKl 5GANf 4M7DB 4XTYA 2RB6A 4XU3A 5GANh 2E1HA 2VXFA 3JCMf 1N9SA 2E64A 2YLCA 2DXTA 5LJ5d 4C92B 3JCMc 5GAN6 4M7DC 2RA2A 3BDUA 4HT9A 4OP0A 5GAMg 3JCMW 4M7AB
chains in the Genus database with same CATH superfamily
1MV0B 1VQMQ 1NE8A 2DAQA 3QYGB 4KUDK 1C6VX 3CCJQ 1YITA 1GCQA 1V1CA 3PIPA 2F1LA 1WZOA 4EIKA 1PC0A 2QQ9A 3EG3A 4JRIA 1U1SA 2FRWA 3L2RA 3OYKA 4A4GA 2JW4A 1QVGP 2JS0A 4HVUA 1VQ5A 1D0XA 3EH2A 2QEXT 5FROA 2JUFA 4M7DE 2GQIA 1I0CA 3S3OA 4M75B 2DE0X 3MEWA 5I2SA 3CPWP 3EH1A 2CKKA 1JJ2P 1IHVA 2X4WA 4X1VA 3NHNA 1UJ0A 2O01E 6AT1B 5A0DA 4XQ3A 1BIBA 5D6WA 2CP7A 4ZNXA 3V7RA 4MMKA 2DL4A 1YHQT 3SHWA 3CXCS 1B3QA 3OYCA 1VYTA 1RAHB 3TVTA 2HQHA 2DVJA 1JXOA 4R0KA 1MMDA 2LVMA 2RHIA 3CCQT 5KYYB 3X25B 3I5RA 1D3BB 2PZ1A 1AHJB 1PKTA 1YWPA 4J6XA 2HZYA 2L3SA 2O9VA 3EG9A 2CS7A 2K9GA 2JN0A 3SWNA 3JCMb 4FL6A 5KYXA 1MMGA 1IZ6A 5IXBA 2DD5A 1BU1A 2X4JA 1T3LA 1QP3A 2E1HA 4DBRA 1JU5C 1OYXA 4C92B 3GBQA 4PJNA 2CUBA 3BDLA 5CQYA 5I22A 1B07A 1YJ9A 1RACB 4BACA 1UUEA 2QK0A 3CCUT 5J26A 1YCSB 4DOVA 3I56Q 3LGLA 1K9AA 5GMKh 3JCMg 4J7IA 2H8HA 3G4ST 2GQVA 4GLKA 1AVZC 5J39A 1VQLA 2M02A 1KSWA 1IREB 1RLPC 5CK9A 1XQHA 4HCCA 2ENMA 4J6WA 1OQKA 3RUXA 3HL8A 1CKAA 3M4GA 3OS2A 3KBGA 1YJNT 2EJ9A 1KFZA 1YN8A 2LDMA 2V1QA 4RCCA 4M77C 4JDSA 1YCYA 4XU0A 3G4SQ 1ZA2B 4M77A 4FW1A 3INZA 4AFSC 4E6RA 4M7AF 3M9QA 4BI8B 2JT4A 2KT8A 3FC3A 4KH0B 4F7UB 5LJ5h 4BDZA 1KHIA 1MV3A 2DETA 4GBQA 2KXDA 4ELZC 4QVCA 3NTIA 2JJ9A 2LNVA 4DBHA 4M7AD 5LJ5g 2V8KA 3UPUA 2R58A 4LUDA 1RI0A 2K57A 2X4YA 2G3RA 2DFUA 2ZPBB 2DRKA 1H641 4FM4B 1OPKA 1SRMA 3MEAA 5D6YA 4HCKA 3OB9A 1K0SA 1SHGA 2VC8A 3O8VA 3TCJA 5HCKA 5LJ3d 3NTHA 5IXFA 3LLRA 4AFUC 1QWEA 3I9QA 1WHGA 3CCRQ 4C5GA 1VQNA 1KJWA 3CMET 3QG1A 1Y71A 4C92G 1BYMA 1XJWB 3WXMB 3HKSA 4PJMA 1RLQC 4K11A 1K73U 2E6NA 2VGMA 4RKUE 5CAIA 1EZZB 3L1AA 5FU6B 3OYHA 2NUPA 1KC8U 4JJNK 4M7AE 2LCSA 1OULA 3VUBA 2LZ6B 3CCET 2K79A 1VIFA 3M0PA 1G5VA 2RI5A 1ZSZA 2DL3A 2MOXA 2DXCA 5D7UA 2KI7A 1K8AC 3SB2A 3HTRA 4J83A 4ELYC 4F14A 2QTVA 1WJSA 2E65A 2DJQA 3VS7A 3G71A 3CC7A 3A8OB 3P8HA 1OI1A 3BW1A 3EGXB 1QCFA 2JTFA 5KYNA 1OZ2A 4ZTFA 2AZVA 1I1JA 2KRMA 2EBPA 2MPXC 2DD4A 4F7UG 3MJXA 3CC4A 1M4ZA 2K2VA 2YRVA 2VGNA 3VU3C 4BI3A 5FW9A 5GAN7 4RTYA 3VS0A 1G8XA 1H3HA 1W2BA 3VYGA 1YI2Q 3JCMP 2RJDA 2KYMA 1E6GA 2RHXA 2EAYA 4BY6C 1VQKA 2OTJT 1Q81U 1GCPA 3M58A 1Y7XA 4AG1C 2YHTA 1QCNA 3PVQA 1D0ZA 1BB9A 1PRMC 1SSHA 3CBPA 3R6NA 4M75A 1ABQA 4LXCA 2R5MA 2RJEA 3WVEB 4CC2A 1ZUUA 3H6ZA 4JZ4A 4IKFA 3QBYA 2EWNA 4PLLA 1QVFP 3V7CA 2EGEA 1MUZA 1VIEA 3JCMQ 1QMCA 2E41A 2KQWA 4C5HA 2VXFA 3TEEA 2DXTA 1NJIU 2VVKA 5ECAA 1VQOQ 4M7DC 4ZN1A 4OP0A 3JCMW 4E47A 5A2QE 3OW2A 1ZBJA 2R57A 5AT1B 5FLXE 1I4K1 5DM7R 1WGSA 3DLLA 4R56A 1YNZA 3EAEA 4O6JA 5FWBA 3FDRA 4FCYA 4J9HA 3GIBA 5EG2A 1NLOC 1MHNA 3CCMT 1JXMA 5GAOp 4FYWB 3C95A 1UTIA 2BE7D 1WXBA 3QDFA 1Q95G 1X2QA 2PTKA 1E6HA 4IUTA 2PUKB 1RAFB 5DY9A 3OYNA 1K1ZA 2KR3A 2FYKA 3A8MB 1J3TA 2EQUA 3VS1A 4P5NA 1VQ8T 3VKIA 1EX4A 2HMAA 2DJZA 8AT1B 1SPKA 1P92A 3CCMQ 2RM4A 3EFRA 4QQDA 2M51A 2PVDB 2RK2A 4DEXA 2LRQA 4FYVB 4MMLA 1Q81R 1TXQA 4OVAA 4RTVA 2L2PA 4JS4A 2E70A 3LX7A 2DEUA 4J6YA 3LYIA 5HK0A 3RERA 4J9FA 2QA4A 1VQ8Q 4A4KA 3KXTA 1O9SA 2RHUA 1Q82C 4Y91A 4F17A 4JUVA 4FYYB 3EG2A 1WQ7A 5GANd 3EG9B 1OOTA 1VYVA 3GF5A 1NJIR 3CEYA 1M30A 3REAB 2OI3A 4DEYA 1WJRA 1M8MA 4XTXA 1VQ4A 1W1FA 1EIFA 2WSCE 1OV3A 4IUPA 4MZTA 2K5FA 3VS3A 1LNXA 4C8QG 3I55T 2OAUA 1KQSA 1SHFA 2YLCA 2XD0A 2DL5A 2RK1A 3OYGA 2OAWA 1VQ9T 4OMLA 2ZCFB 2MCNA 5A0LA 1IGUA 2FZKB 1RUWA 1WXUA 4IUUA 3CXCP 1Q86U 2VASA 1LCKA 2CZ7B 1GBRA 1YJWQ 3I5SA 2HCKA 4ORZA 3VS2A 3ZFJA 1M90U 2XG8D 2CP0A 5GAOq 2RQRA 3CCVT 3I55Q 2DXBA 3JB9G 5HKCA 1OX8A 2L3QA 1YWOA 3QO3A 1WDXA 3CC2A 4L6V5 4M77B 2OJ2A 1VYUA 2MYSA 2COYA 1Q7YU 2HKQB 4LDVA 2GBQA 2DERA 3ASKA 2DXUA 4KRTA 3CCVQ 1FX7A 4OMQA 1YIJA 1M1KR 4J8OA 2K6DA 2ED0A 1G3SA 2DZCA 2GF7A 3RBBB 1PHTA 1M2VA 2J6KA 3E1SA 2JNGA 5KYWA 2P4RA 2EQKA 2Z0WA 2LCCA 1W70A 3BE3A 1N8RC 1WJQA 4HCZA 2CH4W 5GAMd 2CREA 2LX7A 5M9OA 2PVOB 2JM8A 2QQSA 3PMIA 1LOJA 4A4FA 2QQBA 7AT1B 3CCST 1QVPA 3ZL7C 2QEXA 3M0UA 3CBOA 3L2UA 1ZLMA 1MGQA 4BE2A 3Q1JA 1Q86R 2ESWA 3RDVA 2BIVA 2NUTA 2EIFA 4II1A 4AT1B 3JB9H 2RQUA 1OPLA 2LQNA 3HFOA 5FWCA 3FEOA 1M90R 2EYZA 1GFDA 2JM9A 1JJ2A 5GAN6 1EFNA 2B8AA 2RHYA 1VQ6T 4KT0E 4D8KA 3OA6A 1YHQA 4OMFB 2NUPB 4AFQC 1KD1R 2V26A 4J9EA 3OSSC 5LJ3h 3OBYA 1RAEB 3S3NA 1AEYA 5DLOA 4E2FB 4E7KA 3CCJT 4CRIA 4PKCC 2CT3A 3RKYA 1IO6A 3PTAA 1ZSZB 2E3HA 3VS5A 4KGZB 5LJ3g 2L3PA 2DO3A 3CCQA 5GAN3 3JCMe 4IIOA 1FYNA 2MWOA 4PK4A 4J9GA 4M77G 2DEQA 2HBWA 5GMKe 1NYFA 5FRMA 4MDWA 4C92F 2DIGA 4N4GA 3EHRA 1AD5A 1S72Q 1M1GA 1IXDA 1W2BS 2ZPHB 1U06A 2VUBA 4C0GA 2JZ2A 2PU9B 2LQKA 3TSZA 2A28A 3CCUA 2KNBB 4BE1A 1HJDA 5IHNA 4LN2A 2EJGA 3HFNA 1VQ7A 3VYHB 1RI9A 1D1AA 4FSXA 4C92D 4IIMA 5GAOn 2BZXA 3LWIA 2E10A 3QUIA 4KUIA 1NEGA 4BY6B 1HYOA 2JTMA 3H9NA 1Y96B 3MO8A 2W10A 2E6ZA 1BCOA 4HCBA 5IN1A 4HKEA 3OYMA 1C0MA 3JSCA 1YJNA 1IRXA 2L0AA 4M78G 4C0DC 5LJ5e 1I81A 1TS9A 2P4TA 2CYZB 1BIAA 5IHIA 4RTWA 1AWXA 4AG2C 3OW2S 2HQXA 3GPLA 4JJBA 4X9CA 2KAFA 4PJOE 2RJCA 3WVDB 3F70A 2RPNA 3JRZA 4M7DB 1PCXA 1SG5A 1OZ3A 1AOJA 1WHKA 1SKUB 2SRCA 4ZGDB 2AHJB 2YLBA 2R5AA 3H8ZA 2DYIA 4FW2A 3FJ5A 2X35A 3I56T 4ESRA 5C0MA 3GP8A 3OMCA 3M59A 4OMOA 4IUVA 3H0FA 4C92E 1X6BA 1WI7A 2QQAA 3JCMh 3O5ZA 1M3CA 1UHFA 3A8LB 1AZGB 2CZ1B 1UG1A 1K73C 2P0PA 2DVEA 1NPPA 1KC8C 5C6SA 1YITT 1H92A 1VQPQ 1I8FA 1OU9A 4UC4A 5CKFA 2ED1A 2P84A 2AKLA 4JZ3A 3CMEA 1ZUYA 3V8JA 2E4HA 3NTKA 2NYSA 1N9RA 2EYWA 1HXDA 2HL3A 3FLGA 3TU4K 5I11A 4GY5A 2P0QA 2K5IA 3LW5E 1YITQ 2C0IA 2Y90A 4QVZA 5KE3A 3G7ZA 3CCEA 2O4XA 4M75G 2YUOA 4OB0B 1B34A 4EMKC 1BCMA 1KQSS 1HSQA 3QZ9B 1U3OA 4EMKA 3DLMA 2LJ1A 4CC4B 3RKXA 5KE2A 4LD6A 1QW1A 1NEBA 2ZAEA 2HL5C 3CD6T 3MEUA 4Q5WA 3C4SA 3QJ6A 3M0SA 5CKDA 3MPUB 3IQLA 3J80E 5GANh 1MNEA 3JCMf 1N9SA 3AT1B 4XK8E 1DJ7B 1ZQ1A 2CP5A 3CCRT 3GLXA 4HT9A 3BDUA 1GRIA 4WCIA 4KULA 5GANg 2O2OA 4O5VA 2CP6A 1SEMA 1JQQA 5CO7A 4MDXA 1LPLA 3CD6Q 2DTHA 1XTDA 2LQ8A 2RHZA 1XOVA 2OTJA 5KYUB 3E19A 2EJFA 3QXEB 5KH6A 2OTLT 2AZSA 3DB4A 4C8QF 2LQWA 4GLMA 2BE9B 4KBMB 3OYIA 2EFIA 4L5GA 4PL6A 5GMKj 1YBYA 4J7FA 3L2VA 2JXBA 4Z02A 1AWWA 1M2VB 2J7IA 4LD9K 1BI0A 5KYWB 4C8QD 2AIRB 3E9FA 2F5KA 2KT1A 2C06A 1M8VA 1UGRB 3REBB 5LJ5f 2BTTA 2KYBA 2OTLQ 5IAYA 3QIIA 1YJ9Q 2RN8A 3JB9F 2K3XA 5KCOA 1ZHIA 4PFOA 3EGUA 3OYEA 2DL8A 3PFSA 1VQLQ 2COZA 3LH0A 1YFNA 5L8RE 3CCMA 1YI2T 3MCAB 3JB9D 1GXIE 1TG0A 4BD3A 5LJ5j 3OYAA 2LJ0A 1JJ2S 2NUTB 4ME7A 2J6OA 2GGRA 2K4YA 4X34A 4C0FA 1MNDA 1JB0E 3MHXA 2ZPIB 4RG8A 3NMZC 3SDZA 1HD3A 1PSFA 2XKOC 1R0CB 1T0HA 1G3TA 4WTOB 3X20B 5GAMh 1SRLA 4XU3A 2DBKA 3S3MA 2D0QB 2ABLA 3M0QA 2FG0A 5GAMg 3ZEHA 1VQOT 1Y96A 3UATA 4C8QE 4J9BA 3M53A 2HKNA 4JLGA 2EGAA 2X3WD 1KHCA 2DL7A 3CCLT 2JOYA 2M0OA 1QP2A 2D9TA 5HY6A 4M7DA 2CT4A 4R55A 1M3BA 2CSIA 1AWJA 3JV3A 1WQWA 1Y07A 1IB8A 2E3IA 4HA8A 5LL6S 1UECA 3L2WA 2FL7A 1K9MC 1M3AA 1VQ9A 3CCLQ 1GFCA 3QDRB 1Q7YC 3MP1A 3RR6A 1VQNQ 4PJOC 3FB9A 2YRCA 2YWWA 4PJOA 4EMGA 3V8KA 3JB9I 4BB7A 5D6XA 3CCVA 2WSEE 3CMAT 4FSSA 3OBWA 2KXCA 3G71T 5CVIA 4C0DB 2DILA 1O75A 1WIEA 2KGTA 2M0YA 4OB1B 4M77D 3A8HB 2V1RA 2CH4A 2MK5A 2QGFB 2JS2A 3CMAQ 1M1KU 1OEBA 1KQ1A 5I2MA 2YUQA 1K8AU 3UA7A 3G71Q 3SD4A 2EYQA 3GOXA 2GTOA 2VYTA 2YDLA 4BUGA 2HSEB 5LJ5d 2J6FA 2RA2A 1AZEA 1FWZA 1TUCA 3CC4Q 3PNWC 4MZMA 4JRQA 4M78F 4HT8A 2DF6A 1QWFA 1YJWT 3E2UA 2FVUA 3GNGA 2EQMA 2EYXA 4J9DA 4KGXB 2DZ9A 1VQKQ 3A8GB 1TUDA 3SEMA 1NG2A 4BE0A 3CCSA 5DLQE 2QASA 1PD1A 4OGEA 2A37A 4M78D 1UEBA 4CC3A 1PM3A 1T0JA 1FMWA 1WA7A 1X69A 2JVVA 5LJ3e 2LT4A 2BKDN 1K0XA 1F1BB 2E12A 3M56A 5EC7A 1VUBA 1VQ6A 1M27C 3QKJA 1U5SA 1VQMA 2X9HA 5KYUA 2KY9A 1KD1U 2XU8A 4CC7A 2YUPA 4E7SA 3CCJA 2DRMA 3N5BB 2KVQG 3L42A 2O4XB 3BY7A 3MEVA 1B34B 3R6OA 4F04B 4LE9A 4NS5A 4EMKB 3E9GA 4Z88A 4E7LA 1K8AR 1H3ZA 1ABOA 1CSKA 4E7HA 2I0NA 2AKKA 1BI3A 4N0AC 3OY9A 4M78E 1W6XA 3LWHA 4N0AA 2M9UA 3CBMA 4HVWA 2QA4T 1K76A 2RI2A 5I21A 5GMKl 1M9SA 4XTYA 1S1NA 3TSWA 1QVGA 2NUZA 1OX9A 3RESA 4M75F 4RTTA 2A08A 3VS4A 3PE0A 4M7AC 2E5KA 2LX9A 2AT1B 8ATCB 1RADB 5FU7C 2QA4Q 4M7AA 2M16A 4RMOA 4JRPA 2ROLA 1KG1A 2SEMA 1NM7A 4KH1B 1RAAB 2LCLA 4C0ZA 4RG2A 1KQSP 4LNPA 4D6WA 3M0RA 5KCHA 3RNJA 3DKMA 1G3YA 3CPWA 4M75D 1Q82U 1JRIA 1ZBXA 5GJWB 4DBFA 2D0NA 4E7ZA 2QAZA 3EG1A 1UGQB 3L2QA 1AT1B 4EDUA 2O88A 4OF1A 2EKHA 2VXEA 2HBPA 2HD0A 4B6MA 1TOVA 1S72T 3OS1A 3PVLA 1YP5A 1X01A 3CC2T 1UB4A 3OS0A 1D1CA 3I56A 2CUDA 3ZBDA 4QVDA 3EFOA 4DOWA 4OMNA 2EQJA 2RQTA 2NWMA 1TUGB 5AYFA 2CP2A 1TSFA 2A7YA 1M2OA 4C8QC 1K4US 3AHUA 2WSFE 4C8QA 3CC2Q 2A0FB 4OB3B 1WX6A 2QDYB 4A4HA 4NL3A 1GCQC 3G4SA 3HHTB 4M75E 2LC4A 2VWFA 3UDCA 1IHWA 2HNIA 2FPEA 1YIJQ 3M57A 3QWYA 3G1JA 1MMAA 2DA9A 2QG9B 1RAGB 2PQWA 4ZN3A 4RTUA 2DYBA 3J81E 1E7OA 2KBTA 1SF9A 2JMCA 4A4EA 2DNUA 1Q82R 1SSFA 5GAOr 2ATCB 2M1HA 5LJ3f 3X24B 1PG5B 4JLIA 2F69A 2EPDA 4F7UF 3OYBA 1ZUKA 4N4IA 1PKSA 1UJYA 3G6ET 4N4HA 2VB6A 2DX1A 4RUGA 2YRDA 1D09B 2B86A 3NGPA 5GANe 3THKA 2X51A 1N8RU 2FO0A 2GFUA 2LNHB 3I35A 2QEXQ 1UFFA 3UF4A 1T3SA 4C5IA 1VA7A 2MMPA 1W4SA 2O9SA 2PNIA 3CD6A 2C0OA 2BZ8A 5LJ3j 2RO0A 3G6EQ 1VQPT 2H3JA 5GAOl 1FXXA 4J5YA 3C94A 4PJOB 1V29B 3CCRA 1KQ2A 3JCMV 4VUBA 4FIBA 1UGPB 2ZZDA 3SWNC 2RNAA 1YHQQ 3JCMJ 1Y57A 4YTLA 1HK9A 3BFMA 2KRSA 3FJPA 4DBQA 2F2WA 1ZA1B 2A36A 3PGGA 4B9XA 3KUFA 5GAN2 2QGGA 1U8RA 2RI3A 2XMFA 2XIDA 3OS5A 2OTLA 3CCQQ 4PJLA 1PRLC 3NPFA 3RIRA 2H3EB 1VQ7T 2A3LA 5J3BA 4XU2A 1OU8A 3PIOA 3JCMX 1QKWA 1VQ5T 1BI2A 3V8LA 4F7UE 2MWPA 2FHDA 1FMVA 2V8IA 2E5QA 3URGA 2D8HA 1PWTA 2XDBA 1RABB 3CCUQ 3X28B 1MMNA 4JJCA 3QSUA 1VQ7Q 2EYYA 1N8RR 3M4YA 2FRYA 5GAN5 2EKOA 1VQ5Q 4A54A 1WNLA 1X27A 3QJYA 1R77A 2ZPFB 2CSQA 1N5ZA 1Q81C 1KIKA 1WHLA 4E7JA 4ZTJA 1YI2A 3P8BB 5GAMe 4B9WA 9ATCB 2Y4XA 1X43A 5GMKm 1YJNQ 1JEGA 4M7DG 2DIQA 4JPBW 1R0BG 3SFMA 1NPRA 2D8JA 4TVRA 4ZGJB 3TREA 1BI1A 2YSQA 4PFPA 4CI0C 1NJIC 1QCOA 2QYZA 2MAMA 1PNJA 3QZ5B 3OYDA 2CGHA 3OSVA 1QLYA 2V8JA 4L59A 2FEIA 4M78C 2XK0A 4PJOG 1VQOA 3M54A 3EGDA 2DLPA 4IUQA 3UT1A 4M78A 1YJ9T 3ULRB 2IIMA 1RAIB 3H41A 1BKBA 3V7SA 2FPFA 4ATOA 4OB2B 2KE9A 4OMPA 1QVFA 3VJPA 2XHCA 4LDYA 3X26B 2I2LA 1VQLT 4XU1A 3CCLA 2XI9A 2LP5A 2L3RA 5FRNA 4PJJA 2KMTA 2LT1A 1QVGS 4IURA 2AK5A 3ER0A 2DTIA 3J7AF 4A53A 4J9CA 1AWOA 1KK7A 4RCBA 1GBQA 1ZX6A 1ZSZC 5GANf 1Z9QA 2RB6A 1WXTA 3S6WA 2JTEA 2E64A 3CMEQ 2BZYA 2QQRA 4Y92A 4M7AB 1M1KC 3CPWS 3QYHB 1TH7A 5FU7B 2DTOA 2RH2A 4AMCA 1CKBA 3CMAA 2K3YA 2PVGB 2L5QA 2QTXA 1VQ8A 1H8KA 2RQWA 1G83A 2FPDA 3CCEQ 1M1FA 2L8DA 2XICA 3OYJA 5GANj 2W0ZA 2XDDA 2QDLA 2X4XA 2K2MA 2Y4YA 3DB3A 2DKGA 4F16A 2EVRA 3H0IA 1G3WA 1M5Q1 4ANJA 4LDXA 2IVWA 3META 1X2KA 3UA6A 1TU0B 4M75C 1Q86C 2XDPA 3PT9A 3EFOB 2OX7A 4PFZA 2FZGB 4J9IA 1VQNT 1M90C 1I07A 2J05A 4C5EA 5HK3A 1YJWA 2EGCA 4NOYA 4C8QB 3VV0A 3UWNA 2DMOA 2OTJQ 4NL2A 4EMHA 2EW3A 5CR2A 3I55A 1K73R 3HRSA 2MF2A 1KD1C 1BK2A 5GAOm 1UHCA 2PUOB 1KC8R 3JCMd 2O31A 2MI6A 4XTZA 1D0YA 4BDYA 2DM1A 2DK3A 3CXCA 2HSPA 3T9NA 4OMMA 1UE9A 2FB7A 1R8OB 1ACMB 5KYYA 4M77F 1D3BA 2YUNA 5GAMf 1V76A 3QHSA 4DA4A 1UGSB 3HRTA 2X3XD 2D6FA 3CC7T 1Z9ZA 2VV5A 4Z89A 4RTXA 2GFAA 5CIUA 1LVKA 1I5OB 1NLPC 4A63B 4C92C 4PLIA 2K3BA 4M7AG 1WPYA 2F5TX 1QKXA 2HDAA 4QQGA 3C12A 4C92A 3CC4T 1UDLA 2CDTA 1NZ9A 1VOMA 1NYGA 1WHJA 4KGVB 1W2BP 2QXFA 1JBMA 2YT6A 3CC7Q 5GAMj 2YXYA 4PNOA 3VS6A 1I5LA 1VQKT 2G6FX 4LDUA 3A1PA 2QI2A 2J06A 4M4ZA 5GJVB 4X9DA 4BI4A 4E7IA 3ME9A 2VKNA 3KFVA 1Y0MA 2KK4A 4LUEA 2CZ6B 2K5LA 2ZGWA 3EHQA 3MKDA 1BBZA 3EG0A 3VRYA 2RF0A 1WYXA 5GMKi 1PD0A 4FT2A 2ZPGB 3M0TA 3VRZA 4FYXB 3SWNB 1XNIA 5KYXB 3OW2P 2KRNA 1WHHA 3OYLA 3RMQA 1ARKA 1X6OA 4F7UA 4RTZA 1X75C 4Y28E 4XAXB 3D7SB 2DBMA 4M77E 1WHMA 3CPFA 2DPPB 3HP9A 4MZPA 4QT7A 2COWA 2KEAA 4JRKA 1D1BA 2KROA 4WF2A 4XTUA 2WACA 3TQ7P 5A0GA 2RMOA 4XTVA 3NFCA 2GTJA 3C0CA 2RD1A 4QKUA 1JO8A 2LTOA 3FRNA 3RKWA 2K7AA 3OYFA 5L23A 2ZPEB 1S72A 3HPWA 5CKEA 2MIOA 2IG0A 3OQ5A 4LDWA 1VQ9Q 2RJFA 1B7TA 3MP6A 3M55A 3QWXX 1GL5A 5IT9E 1K9MU 1WLPB 2IPOB 3QPHA 1TTHB 3RMSA 1UGVA 3L2ZA 2BUDA 4HXJA 4DQ2A 2RQVA 4XTWA 5CKBA 1NBEB 5FU6C 5GAN8 1LJOA 1N6AA 3M5AA 2LMJA 4QQ6A 1U1TA 3MP8A 3GNFB 1RL2A 5CCAA 1FMKA 3PMTA 1TWBA 2C0TA 3U23A 2HEQA 3JB9J 1C1AA 4FU6A 1VQ4T 3HRUA 4JS5A 3EGDB 4M78B 1QVFS 5IHKA 3HSBA 2FZCB 2F2VA 3OYYA 3H0HA 1N27A 3A5ZB 4ZGEB 3EGXA 1QQJA 2ECZA 2ROTA 4M7DF 3G6EA 1VQ4Q 3VUZA 2L89A 5CKHA 3CQTA 4AFZC 2GCXA 4OGCA 4Z8AA 4HVVA 3CCSQ 1WFWA 1X6GA 1G2BA 2KSSA 3LH5A 1PSEA 2GNCA 2P0KA 4JJDA 5IH2A 2CZ0B 5GAN4 4M7DD 2EQIA 2D1XA 2KDSA 1VQMT 3FIFA 2NLUA 4PJOF 3EFSA 1IGQA 2JMAA 4V2SA 1K9MR 1Q7YR 2HAXA 4D8DA 1VQPA 4FT4A 1ZSGA 2LJ3A 5CQXA 1YIJT 3P8DA 2HQEA 3JAME 3A98A 4EPCA 2F2XA 1VQ6Q 2CP3A 3JCMc 3OMGA 4PJOD 3LGFA 4QW2A 1A0NB
chains in the Genus database with same CATH topology
3QSUA 1NE8A 1VQOT 1Y96A 4IUUA 1Q86U 2DAQA 3M4YA 3QYGB 4C8QE 2CZ7B 5GAN5 4KUDK 2EKOA 4A54A 1YITA 1WNLA 3QJYA 3M53A 3ZFJA 2ZPFB 1M90U 2XG8D 1Q81C 3PIPA 5GAOq 4E7JA 4ZTJA 1YI2A 3CCVT 4JLGA 3P8BB 2QQ9A 4B9WA 5GAMe 2DXBA 4JRIA 3JB9G 5HKCA 2Y4XA 5GMKm 1U1SA 1KHCA 3QO3A 3L2RA 3OYKA 3CC2A 4L6V5 4A4GA 3CCLT 4M77B 4M7DG 2DIQA 2JOYA 2M0OA 3SFMA 1QP2A 1NPRA 4TVRA 4ZGJB 2D9TA 5HY6A 4M7DA 1VQ5A 3TREA 2QEXT 1Q7YU 4R55A 1BI1A 5FROA 4LDVA 2JUFA 3ASKA 4M7DE 1WQWA 4CI0C 2DXUA 3S3OA 1FX7A 1YIJA 1NJIC 1Y07A 4M75B 4HA8A 4J8OA 3MEWA 5LL6S 2MAMA 5I2SA 3L2WA 2FL7A 1K9MC 3QZ5B 3OYDA 2CGHA 1VQ9A 1G3SA 3OSVA 2CKKA 3QDRB 1Q7YC 3MP1A 4L59A 2V8JA 4PJOG 4M78C 1VQOA 2XK0A 2DZCA 2GF7A 3M54A 4PJOC 3FB9A 2X4WA 3E1SA 4IUQA 2JNGA 3UT1A 4M78A 2O01E 5A0DA 4PJOA 4XQ3A 1BIBA 5D6WA 3V7RA 3V8KA 4EMGA 3JB9I 1YJ9T 4BB7A 4MMKA 3V7SA 1BKBA 5D6XA 1YHQT 3CXCS 4ATOA 2EQKA 3OYCA 4OB2B 3CCVA 2WSEE 2LCCA 3CMAT 1QVFA 3VJPA 1N8RC 2XHCA 1WJQA 4HCZA 4LDYA 5GAMd 3OBWA 2I2LA 3X26B 1VQLT 4XU1A 5CVIA 4C0DB 5M9OA 3G71T 3CCLA 2XI9A 2PVOB 2L3RA 1O75A 2QQSA 3PMIA 5FRNA 1LOJA 4A4FA 2QQBA 3CCST 2LVMA 2RHIA 3CCQT 1QVPA 2QEXA 2KMTA 3X25B 2LT1A 1D3BB 4OB1B 3CBOA 3L2UA 4M77D 1AHJB 3A8HB 1MGQA 4J6XA 4IURA 1QVGS 3ER0A 2DTIA 2CS7A 3J7AF 2JN0A 3Q1JA 3SWNA 4A53A 4BE2A 1M1KU 3JCMb 2BIVA 1KQ1A 4FL6A 2EIFA 4II1A 5I2MA 1K8AU 3JB9H 4RCBA 1IZ6A 2DD5A 3HFOA 3SD4A 2EYQA 3GOXA 3FEOA 5GANf 2X4JA 2RB6A 2E1HA 1QP3A 2VYTA 3S6WA 4BUGA 2E64A 5LJ5d 1OYXA 4QW2A 4C92B 5GAN6 1JJ2A 2B8AA 2RHYA 2RA2A 3BDLA 5CQYA 1VQ6T 2QQRA 4KT0E 1YJ9A 1FWZA 4M7AB 4BACA 1M1KC 3CPWS 3CCUT 5J26A 3OA6A 3QYHB 1YHQA 4DOVA 1TH7A 3LGLA 3PNWC 4MZMA 4OMFB 5FU7B 5GMKh 3JCMg 4JRQA 4J7IA 4M78F 2DTOA 2RH2A 4HT8A 3G4ST 3OSSC 5LJ3h 3OBYA 2K3YA 3CMAA 2PVGB 3S3NA 2GQVA 1YIJT 4GLKA 5DLOA 1YJWT 2L5QA 2QTXA 3CCJT 2FVUA 4CRIA 4E7KA 1VQ8A 4PKCC 5J39A 3GNGA 2EQMA 3RKYA 1VQLA 3PTAA 1IREB 5CK9A 1XQHA 2DZ9A 4HCCA 5LJ3g 1M1FA 3A8GB 2L8DA 2XICA 4J6WA 3OYJA 2DO3A 4BE0A 3CCSA 5DLQE 3CCQA 5GAN3 3JCMe 5GANj 4OGEA 3RUXA 3HL8A 2XDDA 2MWOA 4M78D 3M4GA 3OS2A 2X4XA 3KBGA 2EJ9A 1UEBA 1YJNT 2LDMA 4M77G 2Y4YA 4RCCA 4M77C 2DEQA 4JDSA 3DB3A 1YCYA 4XU0A 5GMKe 2DKGA 2JVVA 5FRMA 4M77A 4MDWA 5LJ3e 2LT4A 4C92F 3INZA 2BKDN 2DIGA 1G3WA 2E12A 4N4GA 1M5Q1 3M56A 4M7AF 3M9QA 4BI8B 4LDXA 2IVWA 3META 1M1GA 1W2BS 3FC3A 1VUBA 1VQ6A 2ZPHB 4M75C 1Q86C 2VUBA 4C0GA 2JZ2A 2PU9B 4F7UB 2LQKA 5LJ5h 3CCUA 4BDZA 4BE1A 3QKJA 2XDPA 3PT9A 1KHIA 1VQMA 2EJGA 3HFNA 1KD1U 2KY9A 3VYHB 2XU8A 4ELZC 4QVCA 3NTIA 4FSXA 4C92D 1M90C 1VQ7A 1VQNT 5GAOn 2LNVA 4C5EA 5HK3A 1YJWA 3LWIA 3CCJA 5LJ5g 4M7AD 2E10A 2V8KA 3QUIA 2R58A 3N5BB 4KUIA 3UPUA 2KVQG 3L42A 2O4XB 3BY7A 3MEVA 1B34B 4NOYA 3R6OA 4BY6B 4C8QB 2JTMA 3VV0A 3UWNA 1RI0A 2K57A 2X4YA 4NL2A 4EMHA 1Y96B 5CR2A 3I55A 3HRSA 3MO8A 4NS5A 4EMKB 2MF2A 1KD1C 2G3RA 3E9GA 5GAOm 2E6ZA 4E7LA 2PUOB 5IN1A 4HCBA 4HKEA 3OYMA 2ZPBB 3JSCA 1YJNA 1H3ZA 3JCMd 1H641 4FM4B 2MI6A 4M78G 4C0DC 5LJ5e 3MEAA 5D6YA 4E7HA 1I81A 2P4TA 2CYZB 1BIAA 4XTZA 4BDYA 2DK3A 3OB9A 3CXCA 1BI3A 3OW2S 2VC8A 3O8VA 4N0AC 3TCJA 3OY9A 2HQXA 3T9NA 5LJ3d 3GPLA 3NTHA 2FB7A 4X9CA 1R8OB 2KAFA 4M78E 4PJOE 3LWHA 3LLRA 4M77F 2M9UA 3CBMA 4N0AA 2QA4T 1D3BA 2RJCA 3WVDB 5GAMf 3F70A 3QHSA 2RI2A 3JRZA 5I21A 5GMKl 4DA4A 1UGSB 4M7DB 1M9SA 3HRTA 4XTYA 3CC7T 1OZ3A 2D6FA 2VV5A 4C5GA 1VQNA 2GFAA 3CMET 3QG1A 1Y71A 1QVGA 5CIUA 4C92G 4ZGDB 3RESA 4C92C 2AHJB 2YLBA 4PLIA 1BYMA 4M75F 2R5AA 4M7AG 1WPYA 3H8ZA 2F5TX 4M7AC 4QQGA 3WXMB 2LX9A 3C12A 4C92A 3CC4T 2X35A 3HKSA 3I56T 5C0MA 3GP8A 1K73U 5FU7C 2E6NA 1NZ9A 3OMCA 2VGMA 2M16A 3M59A 4RMOA 4RKUE 4M7AA 4IUVA 5CAIA 4C92E 4JRPA 3L1AA 5FU6B 3OYHA 1KG1A 1KC8U 2QXFA 2LCLA 1JBMA 4C0ZA 4RG2A 4JJNK 4M7AE 5GAMj 4PNOA 4D6WA 3VUBA 5KCHA 1I5LA 3CCET 2QQAA 3DKMA 1G3YA 1VIFA 3CPWA 4LDUA 4M75D 3JCMh 1VQKT 1G5VA 2QI2A 1Q82U 2RI5A 1JRIA 1ZBXA 3A8LB 2CZ1B 2DXCA 1K73C 2P0PA 2DVEA 4X9DA 4BI4A 4E7IA 1NPPA 1UGQB 3ME9A 1K8AC 3L2QA 3SB2A 1KC8C 4EDUA 4J83A 2KK4A 4ELYC 4OF1A 2CZ6B 5C6SA 1YITT 2VXEA 2HBPA 2K5LA 2ZGWA 1I8FA 1WJSA 2E65A 3G71A 3CC7A 2HD0A 3A8OB 3P8HA 4UC4A 5CKFA 1OI1A 3BW1A 1S72T 3OS1A 5GMKi 3CMEA 4FT2A 2ZPGB 2JTFA 3V8JA 1OZ2A 3SWNB 1XNIA 1X01A 3NTKA 4ZTFA 3CC2T 1UB4A 2DD4A 3OS0A 4F7UG 1N9RA 1HXDA 3FLGA 3TU4K 3CC4A 3I56A 3OYLA 1M4ZA 2K2VA 4GY5A 3RMQA 1X6OA 2YRVA 2P0QA 2VGNA 4F7UA 3VU3C 3ZBDA 2K5IA 3LW5E 4BI3A 4QVDA 4DOWA 1X75C 5GAN7 2EQJA 2Y90A 4Y28E 4QVZA 5KE3A 5AYFA 4XAXB 1W2BA 3VYGA 3G7ZA 2A7YA 4M77E 3JCMP 3CCEA 2RJDA 2RHXA 4BY6C 4C8QC 2EAYA 1VQKA 3AHUA 2OTJT 2WSFE 1Q81U 2O4XA 3M58A 1Y7XA 3CPFA 2YHTA 2DPPB 4M75G 1B34A 3HP9A 4OB0B 4EMKC 4MZPA 4C8QA 1KQSS 3QZ9B 4OB3B 3CBPA 4JRKA 2QDYB 4M75A 4A4HA 4EMKA 3DLMA 4NL3A 2R5MA 4WF2A 4XTUA 2WACA 3G4SA 3HHTB 2RJEA 3RKXA 5A0GA 5KE2A 4XTVA 3NFCA 3WVEB 4M75E 2LC4A 4LD6A 3H6ZA 3UDCA 2RD1A 2LTOA 3FRNA 1QW1A 4IKFA 3CD6T 3RKWA 3MEUA 3QBYA 2EWNA 4PLLA 2HNIA 4Q5WA 3V7CA 3M57A 3C4SA 3OYFA 3QJ6A 2ZPEB 1S72A 1VIEA 3JCMQ 3HPWA 5CKDA 2E41A 5CKEA 2IG0A 3OQ5A 2KQWA 4C5HA 4LDWA 5GANh 3J80E 2VXFA 3JCMf 1N9SA 2RJFA 3TEEA 2DXTA 3MP6A 1DJ7B 1ZQ1A 2PQWA 3M55A 4XK8E 3CCRT 1NJIU 4M7DC 3GLXA 4ZN1A 3BDUA 4ZN3A 4HT9A 4OP0A 5IT9E 3JCMW 4E47A 5A2QE 3OW2A 3J81E 1K9MU 2R57A 4KULA 5FLXE 1I4K1 3QPHA 5GANg 4A4EA 5DM7R 1WGSA 4O5VA 1SSFA 3RMSA 3DLLA 5GAOr 2M1HA 5LJ3f 3L2ZA 5CO7A 3X24B 4R56A 4MDXA 4JLIA 2F69A 3EAEA 2BUDA 2DTHA 4F7UF 4O6JA 3OYBA 1XTDA 2LQ8A 2RHZA 3FDRA 4N4IA 4DQ2A 3G6ET 1XOVA 4XTWA 2OTJA 4N4HA 3GIBA 3E19A 5CKBA 5EG2A 5FU6C 5GANe 5GAN8 2EJFA 1MHNA 1LJOA 3CCMT 1N8RU 1N6AA 3M5AA 5GAOp 3C95A 3QXEB 5KH6A 2GFUA 4QQ6A 2OTLT 1U1TA 3DB4A 4C8QF 3MP8A 3GNFB 1RL2A 5CCAA 4C5IA 4KBMB 3OYIA 2MMPA 4IUTA 2EFIA 3PMTA 1W4SA 4L5GA 4PL6A 2PUKB 1YBYA 5DY9A 4J7FA 5GMKj 3OYNA 3CD6A 2FYKA 3A8MB 3L2VA 2EQUA 5LJ3j 2RO0A 3JB9J 4FU6A 4P5NA 1VQ4T 3HRUA 4JS5A 4Z02A 3VKIA 1VQ8T 2DJZA 2H3JA 1VQPT 4LD9K 1BI0A 1FXXA 4J5YA 3C94A 4M78B 1V29B 1P92A 5GAOl 3CCRA 1QVFS 4C8QD 4PJOB 3E9FA 2F5KA 1KQ2A 2C06A 3JCMV 4VUBA 3HSBA 1UGRB 4FIBA 2RM4A 5LJ5f 1M8VA 3EFRA 1UGPB 4QQDA 2PVDB 2RK2A 5IAYA 2ZZDA 2LRQA 3OYYA 3QIIA 3JB9F 1N27A 4MMLA 3A5ZB 2K3XA 5KCOA 3SWNC 4OVAA 1ZHIA 4ZGEB 4JS4A 3JCMJ 2E70A 4YTLA 1HK9A 3LX7A 4M7DF 3BFMA 4J6YA 3LYIA 5HK0A 3G6EA 3RERA 3OYEA 2QA4A 3FJPA 4A4KA 3VUZA 2L89A 5CKHA 3PFSA 3KXTA 3PGGA 2GCXA 4B9XA 1O9SA 2RHUA 3LH0A 1Q82C 4Y91A 4JUVA 3KUFA 4OGCA 5L8RE 3CCMA 5GAN2 1WQ7A 3MCAB 1YI2T 3JB9D 5GANd 2RI3A 1U8RA 1GXIE 2XIDA 3OS5A 2KSSA 2OTLA 1PSEA 2P0KA 2CZ0B 5GAN4 4M7DD 4BD3A 5LJ5j 3OYAA 3GF5A 4ME7A 1JJ2S 2KDSA 1VQMT 3CEYA 3RIRA 2K4YA 3FIFA 4X34A 2A3LA 2NLUA 5J3BA 4C0FA 4XU2A 1WJRA 4PJOF 1VQ7T 1JB0E 3EFSA 3MHXA 3PIOA 4V2SA 3JCMX 1VQ5T 4XTXA 2ZPIB 1BI2A 4RG8A 1VQ4A 3V8LA 3SDZA 1PSFA 2XKOC 2HAXA 1VQPA 4FT4A 1EIFA 1G3TA 2MWPA 2WSCE 2FHDA 3X20B 4F7UE 5CQXA 5GAMh 4IUPA 4MZTA 2K5FA 2V8IA 1LNXA 4C8QG 2E5QA 3P8DA 3I55T 2HQEA 2OAUA 4XU3A 3URGA 3JAME 1KQSA 4EPCA 2YLCA 2D0QB 3S3MA 2XDBA 2XD0A 2RK1A 3JCMc 3OMGA 3OYGA 3X28B 4PJOD 1VQ9T 3LGFA 5GAMg 2ZCFB 5A0LA 3ZEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QSU A;  4C92 G;  1Y96 A;  3RES A;  4C92 C;  1I4K 1;  2YLB A;  5GAN g;  4M75 F;  1TH7 A;  4M7A G;  1WPY A;  4C8Q E;  5GMK h;  5GAN 5;  3JCM g;  4M7A C;  4M78 F;  2DTO A;  5LJ3 f;  4A54 A;  4C92 A;  3L2Z A;  5GAO r;  1WNL A;  5LJ3 h;  4HT8 A;  4JLI A;  2QTX A;  2DTH A;  4F7U F;  4M7A A;  4DQ2 A;  3RKY A;  5GAO q;  5CAI A;  4C92 E;  4XTW A;  3L1A A;  5GAM e;  1JBM A;  3GIB A;  4M7A E;  2DZ9 A;  4JRI A;  3JB9 G;  5LJ3 g;  5GAM j;  4PNO A;  4J6W A;  5GMK m;  5GAN e;  1U1S A;  5GAN 8;  1I5L A;  2EJF A;  3QO3 A;  1LJO A;  5GAN 3;  3JCM e;  5GAN j;  4M75 D;  3JCM h;  4M77 B;  3RUX A;  5GAO p;  4M7D G;  1JRI A;  4M78 D;  3M4G A;  2EJ9 A;  1U1T A;  4C8Q F;  4M77 G;  4RCC A;  4M77 C;  2DEQ A;  2DVE A;  4X9D A;  4M7D A;  1YCY A;  4XU0 A;  5GMK e;  2DKG A;  3SB2 A;  4M77 A;  5DY9 A;  5GMK j;  5LJ3 e;  4M7A D;  4C92 F;  2FYK A;  4M7D E;  3INZ A;  5LJ3 j;  1WQW A;  2VXE A;  2DXU A;  3JB9 J;  1M5Q 1;  2ZGW A;  4M7A F;  1I8F A;  2E65 A;  4M75 B;  2DJZ A;  4HA8 A;  4PJO D;  4M78 B;  5GAO l;  4J5Y A;  4PJO B;  3BW1 A;  4C8Q D;  1KQ2 A;  2CGH A;  4M75 C;  5GMK i;  3JCM V;  1M8V A;  3HSB A;  5LJ5 f;  2RM4 A;  4F7U B;  4PJO G;  3EFR A;  5LJ5 h;  4M78 C;  3V8J A;  3SWN B;  2DZC A;  4PJO C;  1X01 A;  3FB9 A;  3JB9 F;  4F7U G;  1N9R A;  2EJG A;  3HFN A;  4MML A;  1HXD A;  4QVC A;  4M78 A;  4C92 D;  4PJO A;  3SWN C;  4XQ3 A;  1BIB A;  3V7R A;  3V8K A;  4EMG A;  5GAO n;  3JB9 I;  3JCM J;  1HK9 A;  4MMK A;  4M7D F;  3BFM A;  4F7U A;  2E10 A;  3QUI A;  3V7S A;  5LJ5 g;  3VU3 C;  4J6Y A;  3RER A;  3BY7 A;  4QVD A;  5GAN 7;  1B34 B;  2Y90 A;  3FJP A;  4NOY A;  4C8Q B;  3PGG A;  2K57 A;  4NL2 A;  4EMH A;  1Y96 B;  4M77 E;  3JCM P;  5GAM d;  2I2L A;  4Y91 A;  4EMK B;  4JUV A;  4C8Q C;  2EAY A;  4XU1 A;  5GAN 2;  1WQ7 A;  3AHU A;  3JB9 D;  5GAO m;  5GAN d;  4M75 G;  2YHT A;  1B34 A;  3JCM d;  4EMK C;  4C8Q A;  1LOJ A;  1H64 1;  4M78 G;  5LJ5 e;  5GAN 4;  4M7D D;  5LJ5 j;  1I81 A;  4JRK A;  4M75 A;  1BIA A;  4XTZ A;  4EMK A;  4NL3 A;  1D3B B;  4M77 D;  3RIR A;  4WF2 A;  4XTU A;  3FIF A;  3RKX A;  1MGQ A;  4J6X A;  2VC8 A;  4XU2 A;  4PJO F;  4XTV A;  3EFS A;  2DTI A;  4N0A C;  4M75 E;  4V2S A;  3JCM X;  5LJ3 d;  4XTX A;  2FB7 A;  2JN0 A;  2RD1 A;  4M78 E;  4X9C A;  3SWN A;  3V8L A;  4A53 A;  4PJO E;  3JCM b;  1KQ1 A;  4M77 F;  4N0A A;  3RKW A;  1D3B A;  2EWN A;  2HNI A;  3V7C A;  5GAM f;  4F7U E;  4RCB A;  3JB9 H;  5GAM h;  3QHS A;  3HFO A;  3JCM Q;  2E41 A;  5I21 A;  1LNX A;  4C8Q G;  5GMK l;  5GAN f;  4M7D B;  4XTY A;  2RB6 A;  4XU3 A;  5GAN h;  2E1H A;  2VXF A;  3JCM f;  1N9S A;  2E64 A;  2YLC A;  2DXT A;  5LJ5 d;  4C92 B;  3JCM c;  5GAN 6;  4M7D C;  2RA2 A;  3BDU A;  4HT9 A;  4OP0 A;  5GAM g;  3JCM W;  4M7A B; 
#chains in the Genus database with same CATH topology
 1MV0 B;  1VQM Q;  1NE8 A;  2DAQ A;  3QYG B;  4KUD K;  1C6V X;  3CCJ Q;  1YIT A;  1GCQ A;  1V1C A;  3PIP A;  2F1L A;  1WZO A;  4EIK A;  1PC0 A;  2QQ9 A;  3EG3 A;  4JRI A;  1U1S A;  2FRW A;  3L2R A;  3OYK A;  4A4G A;  2JW4 A;  1QVG P;  2JS0 A;  4HVU A;  1VQ5 A;  1D0X A;  3EH2 A;  2QEX T;  5FRO A;  2JUF A;  4M7D E;  2GQI A;  1I0C A;  3S3O A;  4M75 B;  2DE0 X;  3MEW A;  5I2S A;  3CPW P;  3EH1 A;  2CKK A;  1JJ2 P;  1IHV A;  2X4W A;  4X1V A;  3NHN A;  1UJ0 A;  2O01 E;  6AT1 B;  5A0D A;  4XQ3 A;  1BIB A;  5D6W A;  2CP7 A;  4ZNX A;  3V7R A;  4MMK A;  2DL4 A;  1YHQ T;  3SHW A;  3CXC S;  1B3Q A;  3OYC A;  1VYT A;  1RAH B;  3TVT A;  2HQH A;  2DVJ A;  1JXO A;  4R0K A;  1MMD A;  2LVM A;  2RHI A;  3CCQ T;  5KYY B;  3X25 B;  3I5R A;  1D3B B;  2PZ1 A;  1AHJ B;  1PKT A;  1YWP A;  4J6X A;  2HZY A;  2L3S A;  2O9V A;  3EG9 A;  2CS7 A;  2K9G A;  2JN0 A;  3SWN A;  3JCM b;  4FL6 A;  5KYX A;  1MMG A;  1IZ6 A;  5IXB A;  2DD5 A;  1BU1 A;  2X4J A;  1T3L A;  1QP3 A;  2E1H A;  4DBR A;  1JU5 C;  1OYX A;  4C92 B;  3GBQ A;  4PJN A;  2CUB A;  3BDL A;  5CQY A;  5I22 A;  1B07 A;  1YJ9 A;  1RAC B;  4BAC A;  1UUE A;  2QK0 A;  3CCU T;  5J26 A;  1YCS B;  4DOV A;  3I56 Q;  3LGL A;  1K9A A;  5GMK h;  3JCM g;  4J7I A;  2H8H A;  3G4S T;  2GQV A;  4GLK A;  1AVZ C;  5J39 A;  1VQL A;  2M02 A;  1KSW A;  1IRE B;  1RLP C;  5CK9 A;  1XQH A;  4HCC A;  2ENM A;  4J6W A;  1OQK A;  3RUX A;  3HL8 A;  1CKA A;  3M4G A;  3OS2 A;  3KBG A;  1YJN T;  2EJ9 A;  1KFZ A;  1YN8 A;  2LDM A;  2V1Q A;  4RCC A;  4M77 C;  4JDS A;  1YCY A;  4XU0 A;  3G4S Q;  1ZA2 B;  4M77 A;  4FW1 A;  3INZ A;  4AFS C;  4E6R A;  4M7A F;  3M9Q A;  4BI8 B;  2JT4 A;  2KT8 A;  3FC3 A;  4KH0 B;  4F7U B;  5LJ5 h;  4BDZ A;  1KHI A;  1MV3 A;  2DET A;  4GBQ A;  2KXD A;  4ELZ C;  4QVC A;  3NTI A;  2JJ9 A;  2LNV A;  4DBH A;  4M7A D;  5LJ5 g;  2V8K A;  3UPU A;  2R58 A;  4LUD A;  1RI0 A;  2K57 A;  2X4Y A;  2G3R A;  2DFU A;  2ZPB B;  2DRK A;  1H64 1;  4FM4 B;  1OPK A;  1SRM A;  3MEA A;  5D6Y A;  4HCK A;  3OB9 A;  1K0S A;  1SHG A;  2VC8 A;  3O8V A;  3TCJ A;  5HCK A;  5LJ3 d;  3NTH A;  5IXF A;  3LLR A;  4AFU C;  1QWE A;  3I9Q A;  1WHG A;  3CCR Q;  4C5G A;  1VQN A;  1KJW A;  3CME T;  3QG1 A;  1Y71 A;  4C92 G;  1BYM A;  1XJW B;  3WXM B;  3HKS A;  4PJM A;  1RLQ C;  4K11 A;  1K73 U;  2E6N A;  2VGM A;  4RKU E;  5CAI A;  1EZZ B;  3L1A A;  5FU6 B;  3OYH A;  2NUP A;  1KC8 U;  4JJN K;  4M7A E;  2LCS A;  1OUL A;  3VUB A;  2LZ6 B;  3CCE T;  2K79 A;  1VIF A;  3M0P A;  1G5V A;  2RI5 A;  1ZSZ A;  2DL3 A;  2MOX A;  2DXC A;  5D7U A;  2KI7 A;  1K8A C;  3SB2 A;  3HTR A;  4J83 A;  4ELY C;  4F14 A;  2QTV A;  1WJS A;  2E65 A;  2DJQ A;  3VS7 A;  3G71 A;  3CC7 A;  3A8O B;  3P8H A;  1OI1 A;  3BW1 A;  3EGX B;  1QCF A;  2JTF A;  5KYN A;  1OZ2 A;  4ZTF A;  2AZV A;  1I1J A;  2KRM A;  2EBP A;  2MPX C;  2DD4 A;  4F7U G;  3MJX A;  3CC4 A;  1M4Z A;  2K2V A;  2YRV A;  2VGN A;  3VU3 C;  4BI3 A;  5FW9 A;  5GAN 7;  4RTY A;  3VS0 A;  1G8X A;  1H3H A;  1W2B A;  3VYG A;  1YI2 Q;  3JCM P;  2RJD A;  2KYM A;  1E6G A;  2RHX A;  2EAY A;  4BY6 C;  1VQK A;  2OTJ T;  1Q81 U;  1GCP A;  3M58 A;  1Y7X A;  4AG1 C;  2YHT A;  1QCN A;  3PVQ A;  1D0Z A;  1BB9 A;  1PRM C;  1SSH A;  3CBP A;  3R6N A;  4M75 A;  1ABQ A;  4LXC A;  2R5M A;  2RJE A;  3WVE B;  4CC2 A;  1ZUU A;  3H6Z A;  4JZ4 A;  4IKF A;  3QBY A;  2EWN A;  4PLL A;  1QVF P;  3V7C A;  2EGE A;  1MUZ A;  1VIE A;  3JCM Q;  1QMC A;  2E41 A;  2KQW A;  4C5H A;  2VXF A;  3TEE A;  2DXT A;  1NJI U;  2VVK A;  5ECA A;  1VQO Q;  4M7D C;  4ZN1 A;  4OP0 A;  3JCM W;  4E47 A;  5A2Q E;  3OW2 A;  1ZBJ A;  2R57 A;  5AT1 B;  5FLX E;  1I4K 1;  5DM7 R;  1WGS A;  3DLL A;  4R56 A;  1YNZ A;  3EAE A;  4O6J A;  5FWB A;  3FDR A;  4FCY A;  4J9H A;  3GIB A;  5EG2 A;  1NLO C;  1MHN A;  3CCM T;  1JXM A;  5GAO p;  4FYW B;  3C95 A;  1UTI A;  2BE7 D;  1WXB A;  3QDF A;  1Q95 G;  1X2Q A;  2PTK A;  1E6H A;  4IUT A;  2PUK B;  1RAF B;  5DY9 A;  3OYN A;  1K1Z A;  2KR3 A;  2FYK A;  3A8M B;  1J3T A;  2EQU A;  3VS1 A;  4P5N A;  1VQ8 T;  3VKI A;  1EX4 A;  2HMA A;  2DJZ A;  8AT1 B;  1SPK A;  1P92 A;  3CCM Q;  2RM4 A;  3EFR A;  4QQD A;  2M51 A;  2PVD B;  2RK2 A;  4DEX A;  2LRQ A;  4FYV B;  4MML A;  1Q81 R;  1TXQ A;  4OVA A;  4RTV A;  2L2P A;  4JS4 A;  2E70 A;  3LX7 A;  2DEU A;  4J6Y A;  3LYI A;  5HK0 A;  3RER A;  4J9F A;  2QA4 A;  1VQ8 Q;  4A4K A;  3KXT A;  1O9S A;  2RHU A;  1Q82 C;  4Y91 A;  4F17 A;  4JUV A;  4FYY B;  3EG2 A;  1WQ7 A;  5GAN d;  3EG9 B;  1OOT A;  1VYV A;  3GF5 A;  1NJI R;  3CEY A;  1M30 A;  3REA B;  2OI3 A;  4DEY A;  1WJR A;  1M8M A;  4XTX A;  1VQ4 A;  1W1F A;  1EIF A;  2WSC E;  1OV3 A;  4IUP A;  4MZT A;  2K5F A;  3VS3 A;  1LNX A;  4C8Q G;  3I55 T;  2OAU A;  1KQS A;  1SHF A;  2YLC A;  2XD0 A;  2DL5 A;  2RK1 A;  3OYG A;  2OAW A;  1VQ9 T;  4OML A;  2ZCF B;  2MCN A;  5A0L A;  1IGU A;  2FZK B;  1RUW A;  1WXU A;  4IUU A;  3CXC P;  1Q86 U;  2VAS A;  1LCK A;  2CZ7 B;  1GBR A;  1YJW Q;  3I5S A;  2HCK A;  4ORZ A;  3VS2 A;  3ZFJ A;  1M90 U;  2XG8 D;  2CP0 A;  5GAO q;  2RQR A;  3CCV T;  3I55 Q;  2DXB A;  3JB9 G;  5HKC A;  1OX8 A;  2L3Q A;  1YWO A;  3QO3 A;  1WDX A;  3CC2 A;  4L6V 5;  4M77 B;  2OJ2 A;  1VYU A;  2MYS A;  2COY A;  1Q7Y U;  2HKQ B;  4LDV A;  2GBQ A;  2DER A;  3ASK A;  2DXU A;  4KRT A;  3CCV Q;  1FX7 A;  4OMQ A;  1YIJ A;  1M1K R;  4J8O A;  2K6D A;  2ED0 A;  1G3S A;  2DZC A;  2GF7 A;  3RBB B;  1PHT A;  1M2V A;  2J6K A;  3E1S A;  2JNG A;  5KYW A;  2P4R A;  2EQK A;  2Z0W A;  2LCC A;  1W70 A;  3BE3 A;  1N8R C;  1WJQ A;  4HCZ A;  2CH4 W;  5GAM d;  2CRE A;  2LX7 A;  5M9O A;  2PVO B;  2JM8 A;  2QQS A;  3PMI A;  1LOJ A;  4A4F A;  2QQB A;  7AT1 B;  3CCS T;  1QVP A;  3ZL7 C;  2QEX A;  3M0U A;  3CBO A;  3L2U A;  1ZLM A;  1MGQ A;  4BE2 A;  3Q1J A;  1Q86 R;  2ESW A;  3RDV A;  2BIV A;  2NUT A;  2EIF A;  4II1 A;  4AT1 B;  3JB9 H;  2RQU A;  1OPL A;  2LQN A;  3HFO A;  5FWC A;  3FEO A;  1M90 R;  2EYZ A;  1GFD A;  2JM9 A;  1JJ2 A;  5GAN 6;  1EFN A;  2B8A A;  2RHY A;  1VQ6 T;  4KT0 E;  4D8K A;  3OA6 A;  1YHQ A;  4OMF B;  2NUP B;  4AFQ C;  1KD1 R;  2V26 A;  4J9E A;  3OSS C;  5LJ3 h;  3OBY A;  1RAE B;  3S3N A;  1AEY A;  5DLO A;  4E2F B;  4E7K A;  3CCJ T;  4CRI A;  4PKC C;  2CT3 A;  3RKY A;  1IO6 A;  3PTA A;  1ZSZ B;  2E3H A;  3VS5 A;  4KGZ B;  5LJ3 g;  2L3P A;  2DO3 A;  3CCQ A;  5GAN 3;  3JCM e;  4IIO A;  1FYN A;  2MWO A;  4PK4 A;  4J9G A;  4M77 G;  2DEQ A;  2HBW A;  5GMK e;  1NYF A;  5FRM A;  4MDW A;  4C92 F;  2DIG A;  4N4G A;  3EHR A;  1AD5 A;  1S72 Q;  1M1G A;  1IXD A;  1W2B S;  2ZPH B;  1U06 A;  2VUB A;  4C0G A;  2JZ2 A;  2PU9 B;  2LQK A;  3TSZ A;  2A28 A;  3CCU A;  2KNB B;  4BE1 A;  1HJD A;  5IHN A;  4LN2 A;  2EJG A;  3HFN A;  1VQ7 A;  3VYH B;  1RI9 A;  1D1A A;  4FSX A;  4C92 D;  4IIM A;  5GAO n;  2BZX A;  3LWI A;  2E10 A;  3QUI A;  4KUI A;  1NEG A;  4BY6 B;  1HYO A;  2JTM A;  3H9N A;  1Y96 B;  3MO8 A;  2W10 A;  2E6Z A;  1BCO A;  4HCB A;  5IN1 A;  4HKE A;  3OYM A;  1C0M A;  3JSC A;  1YJN A;  1IRX A;  2L0A A;  4M78 G;  4C0D C;  5LJ5 e;  1I81 A;  1TS9 A;  2P4T A;  2CYZ B;  1BIA A;  5IHI A;  4RTW A;  1AWX A;  4AG2 C;  3OW2 S;  2HQX A;  3GPL A;  4JJB A;  4X9C A;  2KAF A;  4PJO E;  2RJC A;  3WVD B;  3F70 A;  2RPN A;  3JRZ A;  4M7D B;  1PCX A;  1SG5 A;  1OZ3 A;  1AOJ A;  1WHK A;  1SKU B;  2SRC A;  4ZGD B;  2AHJ B;  2YLB A;  2R5A A;  3H8Z A;  2DYI A;  4FW2 A;  3FJ5 A;  2X35 A;  3I56 T;  4ESR A;  5C0M A;  3GP8 A;  3OMC A;  3M59 A;  4OMO A;  4IUV A;  3H0F A;  4C92 E;  1X6B A;  1WI7 A;  2QQA A;  3JCM h;  3O5Z A;  1M3C A;  1UHF A;  3A8L B;  1AZG B;  2CZ1 B;  1UG1 A;  1K73 C;  2P0P A;  2DVE A;  1NPP A;  1KC8 C;  5C6S A;  1YIT T;  1H92 A;  1VQP Q;  1I8F A;  1OU9 A;  4UC4 A;  5CKF A;  2ED1 A;  2P84 A;  2AKL A;  4JZ3 A;  3CME A;  1ZUY A;  3V8J A;  2E4H A;  3NTK A;  2NYS A;  1N9R A;  2EYW A;  1HXD A;  2HL3 A;  3FLG A;  3TU4 K;  5I11 A;  4GY5 A;  2P0Q A;  2K5I A;  3LW5 E;  1YIT Q;  2C0I A;  2Y90 A;  4QVZ A;  5KE3 A;  3G7Z A;  3CCE A;  2O4X A;  4M75 G;  2YUO A;  4OB0 B;  1B34 A;  4EMK C;  1BCM A;  1KQS S;  1HSQ A;  3QZ9 B;  1U3O A;  4EMK A;  3DLM A;  2LJ1 A;  4CC4 B;  3RKX A;  5KE2 A;  4LD6 A;  1QW1 A;  1NEB A;  2ZAE A;  2HL5 C;  3CD6 T;  3MEU A;  4Q5W A;  3C4S A;  3QJ6 A;  3M0S A;  5CKD A;  3MPU B;  3IQL A;  3J80 E;  5GAN h;  1MNE A;  3JCM f;  1N9S A;  3AT1 B;  4XK8 E;  1DJ7 B;  1ZQ1 A;  2CP5 A;  3CCR T;  3GLX A;  4HT9 A;  3BDU A;  1GRI A;  4WCI A;  4KUL A;  5GAN g;  2O2O A;  4O5V A;  2CP6 A;  1SEM A;  1JQQ A;  5CO7 A;  4MDX A;  1LPL A;  3CD6 Q;  2DTH A;  1XTD A;  2LQ8 A;  2RHZ A;  1XOV A;  2OTJ A;  5KYU B;  3E19 A;  2EJF A;  3QXE B;  5KH6 A;  2OTL T;  2AZS A;  3DB4 A;  4C8Q F;  2LQW A;  4GLM A;  2BE9 B;  4KBM B;  3OYI A;  2EFI A;  4L5G A;  4PL6 A;  5GMK j;  1YBY A;  4J7F A;  3L2V A;  2JXB A;  4Z02 A;  1AWW A;  1M2V B;  2J7I A;  4LD9 K;  1BI0 A;  5KYW B;  4C8Q D;  2AIR B;  3E9F A;  2F5K A;  2KT1 A;  2C06 A;  1M8V A;  1UGR B;  3REB B;  5LJ5 f;  2BTT A;  2KYB A;  2OTL Q;  5IAY A;  3QII A;  1YJ9 Q;  2RN8 A;  3JB9 F;  2K3X A;  5KCO A;  1ZHI A;  4PFO A;  3EGU A;  3OYE A;  2DL8 A;  3PFS A;  1VQL Q;  2COZ A;  3LH0 A;  1YFN A;  5L8R E;  3CCM A;  1YI2 T;  3MCA B;  3JB9 D;  1GXI E;  1TG0 A;  4BD3 A;  5LJ5 j;  3OYA A;  2LJ0 A;  1JJ2 S;  2NUT B;  4ME7 A;  2J6O A;  2GGR A;  2K4Y A;  4X34 A;  4C0F A;  1MND A;  1JB0 E;  3MHX A;  2ZPI B;  4RG8 A;  3NMZ C;  3SDZ A;  1HD3 A;  1PSF A;  2XKO C;  1R0C B;  1T0H A;  1G3T A;  4WTO B;  3X20 B;  5GAM h;  1SRL A;  4XU3 A;  2DBK A;  3S3M A;  2D0Q B;  2ABL A;  3M0Q A;  2FG0 A;  5GAM g;  3ZEH A;  1VQO T;  1Y96 A;  3UAT A;  4C8Q E;  4J9B A;  3M53 A;  2HKN A;  4JLG A;  2EGA A;  2X3W D;  1KHC A;  2DL7 A;  3CCL T;  2JOY A;  2M0O A;  1QP2 A;  2D9T A;  5HY6 A;  4M7D A;  2CT4 A;  4R55 A;  1M3B A;  2CSI A;  1AWJ A;  3JV3 A;  1WQW A;  1Y07 A;  1IB8 A;  2E3I A;  4HA8 A;  5LL6 S;  1UEC A;  3L2W A;  2FL7 A;  1K9M C;  1M3A A;  1VQ9 A;  3CCL Q;  1GFC A;  3QDR B;  1Q7Y C;  3MP1 A;  3RR6 A;  1VQN Q;  4PJO C;  3FB9 A;  2YRC A;  2YWW A;  4PJO A;  4EMG A;  3V8K A;  3JB9 I;  4BB7 A;  5D6X A;  3CCV A;  2WSE E;  3CMA T;  4FSS A;  3OBW A;  2KXC A;  3G71 T;  5CVI A;  4C0D B;  2DIL A;  1O75 A;  1WIE A;  2KGT A;  2M0Y A;  4OB1 B;  4M77 D;  3A8H B;  2V1R A;  2CH4 A;  2MK5 A;  2QGF B;  2JS2 A;  3CMA Q;  1M1K U;  1OEB A;  1KQ1 A;  5I2M A;  2YUQ A;  1K8A U;  3UA7 A;  3G71 Q;  3SD4 A;  2EYQ A;  3GOX A;  2GTO A;  2VYT A;  2YDL A;  4BUG A;  2HSE B;  5LJ5 d;  2J6F A;  2RA2 A;  1AZE A;  1FWZ A;  1TUC A;  3CC4 Q;  3PNW C;  4MZM A;  4JRQ A;  4M78 F;  4HT8 A;  2DF6 A;  1QWF A;  1YJW T;  3E2U A;  2FVU A;  3GNG A;  2EQM A;  2EYX A;  4J9D A;  4KGX B;  2DZ9 A;  1VQK Q;  3A8G B;  1TUD A;  3SEM A;  1NG2 A;  4BE0 A;  3CCS A;  5DLQ E;  2QAS A;  1PD1 A;  4OGE A;  2A37 A;  4M78 D;  1UEB A;  4CC3 A;  1PM3 A;  1T0J A;  1FMW A;  1WA7 A;  1X69 A;  2JVV A;  5LJ3 e;  2LT4 A;  2BKD N;  1K0X A;  1F1B B;  2E12 A;  3M56 A;  5EC7 A;  1VUB A;  1VQ6 A;  1M27 C;  3QKJ A;  1U5S A;  1VQM A;  2X9H A;  5KYU A;  2KY9 A;  1KD1 U;  2XU8 A;  4CC7 A;  2YUP A;  4E7S A;  3CCJ A;  2DRM A;  3N5B B;  2KVQ G;  3L42 A;  2O4X B;  3BY7 A;  3MEV A;  1B34 B;  3R6O A;  4F04 B;  4LE9 A;  4NS5 A;  4EMK B;  3E9G A;  4Z88 A;  4E7L A;  1K8A R;  1H3Z A;  1ABO A;  1CSK A;  4E7H A;  2I0N A;  2AKK A;  1BI3 A;  4N0A C;  3OY9 A;  4M78 E;  1W6X A;  3LWH A;  4N0A A;  2M9U A;  3CBM A;  4HVW A;  2QA4 T;  1K76 A;  2RI2 A;  5I21 A;  5GMK l;  1M9S A;  4XTY A;  1S1N A;  3TSW A;  1QVG A;  2NUZ A;  1OX9 A;  3RES A;  4M75 F;  4RTT A;  2A08 A;  3VS4 A;  3PE0 A;  4M7A C;  2E5K A;  2LX9 A;  2AT1 B;  8ATC B;  1RAD B;  5FU7 C;  2QA4 Q;  4M7A A;  2M16 A;  4RMO A;  4JRP A;  2ROL A;  1KG1 A;  2SEM A;  1NM7 A;  4KH1 B;  1RAA B;  2LCL A;  4C0Z A;  4RG2 A;  1KQS P;  4LNP A;  4D6W A;  3M0R A;  5KCH A;  3RNJ A;  3DKM A;  1G3Y A;  3CPW A;  4M75 D;  1Q82 U;  1JRI A;  1ZBX A;  5GJW B;  4DBF A;  2D0N A;  4E7Z A;  2QAZ A;  3EG1 A;  1UGQ B;  3L2Q A;  1AT1 B;  4EDU A;  2O88 A;  4OF1 A;  2EKH A;  2VXE A;  2HBP A;  2HD0 A;  4B6M A;  1TOV A;  1S72 T;  3OS1 A;  3PVL A;  1YP5 A;  1X01 A;  3CC2 T;  1UB4 A;  3OS0 A;  1D1C A;  3I56 A;  2CUD A;  3ZBD A;  4QVD A;  3EFO A;  4DOW A;  4OMN A;  2EQJ A;  2RQT A;  2NWM A;  1TUG B;  5AYF A;  2CP2 A;  1TSF A;  2A7Y A;  1M2O A;  4C8Q C;  1K4U S;  3AHU A;  2WSF E;  4C8Q A;  3CC2 Q;  2A0F B;  4OB3 B;  1WX6 A;  2QDY B;  4A4H A;  4NL3 A;  1GCQ C;  3G4S A;  3HHT B;  4M75 E;  2LC4 A;  2VWF A;  3UDC A;  1IHW A;  2HNI A;  2FPE A;  1YIJ Q;  3M57 A;  3QWY A;  3G1J A;  1MMA A;  2DA9 A;  2QG9 B;  1RAG B;  2PQW A;  4ZN3 A;  4RTU A;  2DYB A;  3J81 E;  1E7O A;  2KBT A;  1SF9 A;  2JMC A;  4A4E A;  2DNU A;  1Q82 R;  1SSF A;  5GAO r;  2ATC B;  2M1H A;  5LJ3 f;  3X24 B;  1PG5 B;  4JLI A;  2F69 A;  2EPD A;  4F7U F;  3OYB A;  1ZUK A;  4N4I A;  1PKS A;  1UJY A;  3G6E T;  4N4H A;  2VB6 A;  2DX1 A;  4RUG A;  2YRD A;  1D09 B;  2B86 A;  3NGP A;  5GAN e;  3THK A;  2X51 A;  1N8R U;  2FO0 A;  2GFU A;  2LNH B;  3I35 A;  2QEX Q;  1UFF A;  3UF4 A;  1T3S A;  4C5I A;  1VA7 A;  2MMP A;  1W4S A;  2O9S A;  2PNI A;  3CD6 A;  2C0O A;  2BZ8 A;  5LJ3 j;  2RO0 A;  3G6E Q;  1VQP T;  2H3J A;  5GAO l;  1FXX A;  4J5Y A;  3C94 A;  4PJO B;  1V29 B;  3CCR A;  1KQ2 A;  3JCM V;  4VUB A;  4FIB A;  1UGP B;  2ZZD A;  3SWN C;  2RNA A;  1YHQ Q;  3JCM J;  1Y57 A;  4YTL A;  1HK9 A;  3BFM A;  2KRS A;  3FJP A;  4DBQ A;  2F2W A;  1ZA1 B;  2A36 A;  3PGG A;  4B9X A;  3KUF A;  5GAN 2;  2QGG A;  1U8R A;  2RI3 A;  2XMF A;  2XID A;  3OS5 A;  2OTL A;  3CCQ Q;  4PJL A;  1PRL C;  3NPF A;  3RIR A;  2H3E B;  1VQ7 T;  2A3L A;  5J3B A;  4XU2 A;  1OU8 A;  3PIO A;  3JCM X;  1QKW A;  1VQ5 T;  1BI2 A;  3V8L A;  4F7U E;  2MWP A;  2FHD A;  1FMV A;  2V8I A;  2E5Q A;  3URG A;  2D8H A;  1PWT A;  2XDB A;  1RAB B;  3CCU Q;  3X28 B;  1MMN A;  4JJC A;  3QSU A;  1VQ7 Q;  2EYY A;  1N8R R;  3M4Y A;  2FRY A;  5GAN 5;  2EKO A;  1VQ5 Q;  4A54 A;  1WNL A;  1X27 A;  3QJY A;  1R77 A;  2ZPF B;  2CSQ A;  1N5Z A;  1Q81 C;  1KIK A;  1WHL A;  4E7J A;  4ZTJ A;  1YI2 A;  3P8B B;  5GAM e;  4B9W A;  9ATC B;  2Y4X A;  1X43 A;  5GMK m;  1YJN Q;  1JEG A;  4M7D G;  2DIQ A;  4JPB W;  1R0B G;  3SFM A;  1NPR A;  2D8J A;  4TVR A;  4ZGJ B;  3TRE A;  1BI1 A;  2YSQ A;  4PFP A;  4CI0 C;  1NJI C;  1QCO A;  2QYZ A;  2MAM A;  1PNJ A;  3QZ5 B;  3OYD A;  2CGH A;  3OSV A;  1QLY A;  2V8J A;  4L59 A;  2FEI A;  4M78 C;  2XK0 A;  4PJO G;  1VQO A;  3M54 A;  3EGD A;  2DLP A;  4IUQ A;  3UT1 A;  4M78 A;  1YJ9 T;  3ULR B;  2IIM A;  1RAI B;  3H41 A;  1BKB A;  3V7S A;  2FPF A;  4ATO A;  4OB2 B;  2KE9 A;  4OMP A;  1QVF A;  3VJP A;  2XHC A;  4LDY A;  3X26 B;  2I2L A;  1VQL T;  4XU1 A;  3CCL A;  2XI9 A;  2LP5 A;  2L3R A;  5FRN A;  4PJJ A;  2KMT A;  2LT1 A;  1QVG S;  4IUR A;  2AK5 A;  3ER0 A;  2DTI A;  3J7A F;  4A53 A;  4J9C A;  1AWO A;  1KK7 A;  4RCB A;  1GBQ A;  1ZX6 A;  1ZSZ C;  5GAN f;  1Z9Q A;  2RB6 A;  1WXT A;  3S6W A;  2JTE A;  2E64 A;  3CME Q;  2BZY A;  2QQR A;  4Y92 A;  4M7A B;  1M1K C;  3CPW S;  3QYH B;  1TH7 A;  5FU7 B;  2DTO A;  2RH2 A;  4AMC A;  1CKB A;  3CMA A;  2K3Y A;  2PVG B;  2L5Q A;  2QTX A;  1VQ8 A;  1H8K A;  2RQW A;  1G83 A;  2FPD A;  3CCE Q;  1M1F A;  2L8D A;  2XIC A;  3OYJ A;  5GAN j;  2W0Z A;  2XDD A;  2QDL A;  2X4X A;  2K2M A;  2Y4Y A;  3DB3 A;  2DKG A;  4F16 A;  2EVR A;  3H0I A;  1G3W A;  1M5Q 1;  4ANJ A;  4LDX A;  2IVW A;  3MET A;  1X2K A;  3UA6 A;  1TU0 B;  4M75 C;  1Q86 C;  2XDP A;  3PT9 A;  3EFO B;  2OX7 A;  4PFZ A;  2FZG B;  4J9I A;  1VQN T;  1M90 C;  1I07 A;  2J05 A;  4C5E A;  5HK3 A;  1YJW A;  2EGC A;  4NOY A;  4C8Q B;  3VV0 A;  3UWN A;  2DMO A;  2OTJ Q;  4NL2 A;  4EMH A;  2EW3 A;  5CR2 A;  3I55 A;  1K73 R;  3HRS A;  2MF2 A;  1KD1 C;  1BK2 A;  5GAO m;  1UHC A;  2PUO B;  1KC8 R;  3JCM d;  2O31 A;  2MI6 A;  4XTZ A;  1D0Y A;  4BDY A;  2DM1 A;  2DK3 A;  3CXC A;  2HSP A;  3T9N A;  4OMM A;  1UE9 A;  2FB7 A;  1R8O B;  1ACM B;  5KYY A;  4M77 F;  1D3B A;  2YUN A;  5GAM f;  1V76 A;  3QHS A;  4DA4 A;  1UGS B;  3HRT A;  2X3X D;  2D6F A;  3CC7 T;  1Z9Z A;  2VV5 A;  4Z89 A;  4RTX A;  2GFA A;  5CIU A;  1LVK A;  1I5O B;  1NLP C;  4A63 B;  4C92 C;  4PLI A;  2K3B A;  4M7A G;  1WPY A;  2F5T X;  1QKX A;  2HDA A;  4QQG A;  3C12 A;  4C92 A;  3CC4 T;  1UDL A;  2CDT A;  1NZ9 A;  1VOM A;  1NYG A;  1WHJ A;  4KGV B;  1W2B P;  2QXF A;  1JBM A;  2YT6 A;  3CC7 Q;  5GAM j;  2YXY A;  4PNO A;  3VS6 A;  1I5L A;  1VQK T;  2G6F X;  4LDU A;  3A1P A;  2QI2 A;  2J06 A;  4M4Z A;  5GJV B;  4X9D A;  4BI4 A;  4E7I A;  3ME9 A;  2VKN A;  3KFV A;  1Y0M A;  2KK4 A;  4LUE A;  2CZ6 B;  2K5L A;  2ZGW A;  3EHQ A;  3MKD A;  1BBZ A;  3EG0 A;  3VRY A;  2RF0 A;  1WYX A;  5GMK i;  1PD0 A;  4FT2 A;  2ZPG B;  3M0T A;  3VRZ A;  4FYX B;  3SWN B;  1XNI A;  5KYX B;  3OW2 P;  2KRN A;  1WHH A;  3OYL A;  3RMQ A;  1ARK A;  1X6O A;  4F7U A;  4RTZ A;  1X75 C;  4Y28 E;  4XAX B;  3D7S B;  2DBM A;  4M77 E;  1WHM A;  3CPF A;  2DPP B;  3HP9 A;  4MZP A;  4QT7 A;  2COW A;  2KEA A;  4JRK A;  1D1B A;  2KRO A;  4WF2 A;  4XTU A;  2WAC A;  3TQ7 P;  5A0G A;  2RMO A;  4XTV A;  3NFC A;  2GTJ A;  3C0C A;  2RD1 A;  4QKU A;  1JO8 A;  2LTO A;  3FRN A;  3RKW A;  2K7A A;  3OYF A;  5L23 A;  2ZPE B;  1S72 A;  3HPW A;  5CKE A;  2MIO A;  2IG0 A;  3OQ5 A;  4LDW A;  1VQ9 Q;  2RJF A;  1B7T A;  3MP6 A;  3M55 A;  3QWX X;  1GL5 A;  5IT9 E;  1K9M U;  1WLP B;  2IPO B;  3QPH A;  1TTH B;  3RMS A;  1UGV A;  3L2Z A;  2BUD A;  4HXJ A;  4DQ2 A;  2RQV A;  4XTW A;  5CKB A;  1NBE B;  5FU6 C;  5GAN 8;  1LJO A;  1N6A A;  3M5A A;  2LMJ A;  4QQ6 A;  1U1T A;  3MP8 A;  3GNF B;  1RL2 A;  5CCA A;  1FMK A;  3PMT A;  1TWB A;  2C0T A;  3U23 A;  2HEQ A;  3JB9 J;  1C1A A;  4FU6 A;  1VQ4 T;  3HRU A;  4JS5 A;  3EGD B;  4M78 B;  1QVF S;  5IHK A;  3HSB A;  2FZC B;  2F2V A;  3OYY A;  3H0H A;  1N27 A;  3A5Z B;  4ZGE B;  3EGX A;  1QQJ A;  2ECZ A;  2ROT A;  4M7D F;  3G6E A;  1VQ4 Q;  3VUZ A;  2L89 A;  5CKH A;  3CQT A;  4AFZ C;  2GCX A;  4OGC A;  4Z8A A;  4HVV A;  3CCS Q;  1WFW A;  1X6G A;  1G2B A;  2KSS A;  3LH5 A;  1PSE A;  2GNC A;  2P0K A;  4JJD A;  5IH2 A;  2CZ0 B;  5GAN 4;  4M7D D;  2EQI A;  2D1X A;  2KDS A;  1VQM T;  3FIF A;  2NLU A;  4PJO F;  3EFS A;  1IGQ A;  2JMA A;  4V2S A;  1K9M R;  1Q7Y R;  2HAX A;  4D8D A;  1VQP A;  4FT4 A;  1ZSG A;  2LJ3 A;  5CQX A;  1YIJ T;  3P8D A;  2HQE A;  3JAM E;  3A98 A;  4EPC A;  2F2X A;  1VQ6 Q;  2CP3 A;  3JCM c;  3OMG A;  4PJO D;  3LGF A;  4QW2 A;  1A0N B; 
#chains in the Genus database with same CATH homology
 3QSU A;  1NE8 A;  1VQO T;  1Y96 A;  4IUU A;  1Q86 U;  2DAQ A;  3M4Y A;  3QYG B;  4C8Q E;  2CZ7 B;  5GAN 5;  4KUD K;  2EKO A;  4A54 A;  1YIT A;  1WNL A;  3QJY A;  3M53 A;  3ZFJ A;  2ZPF B;  1M90 U;  2XG8 D;  1Q81 C;  3PIP A;  5GAO q;  4E7J A;  4ZTJ A;  1YI2 A;  3CCV T;  4JLG A;  3P8B B;  2QQ9 A;  4B9W A;  5GAM e;  2DXB A;  4JRI A;  3JB9 G;  5HKC A;  2Y4X A;  5GMK m;  1U1S A;  1KHC A;  3QO3 A;  3L2R A;  3OYK A;  3CC2 A;  4L6V 5;  4A4G A;  3CCL T;  4M77 B;  4M7D G;  2DIQ A;  2JOY A;  2M0O A;  3SFM A;  1QP2 A;  1NPR A;  4TVR A;  4ZGJ B;  2D9T A;  5HY6 A;  4M7D A;  1VQ5 A;  3TRE A;  2QEX T;  1Q7Y U;  4R55 A;  1BI1 A;  5FRO A;  4LDV A;  2JUF A;  3ASK A;  4M7D E;  1WQW A;  4CI0 C;  2DXU A;  3S3O A;  1FX7 A;  1YIJ A;  1NJI C;  1Y07 A;  4M75 B;  4HA8 A;  4J8O A;  3MEW A;  5LL6 S;  2MAM A;  5I2S A;  3L2W A;  2FL7 A;  1K9M C;  3QZ5 B;  3OYD A;  2CGH A;  1VQ9 A;  1G3S A;  3OSV A;  2CKK A;  3QDR B;  1Q7Y C;  3MP1 A;  4L59 A;  2V8J A;  4PJO G;  4M78 C;  1VQO A;  2XK0 A;  2DZC A;  2GF7 A;  3M54 A;  4PJO C;  3FB9 A;  2X4W A;  3E1S A;  4IUQ A;  2JNG A;  3UT1 A;  4M78 A;  2O01 E;  5A0D A;  4PJO A;  4XQ3 A;  1BIB A;  5D6W A;  3V7R A;  3V8K A;  4EMG A;  3JB9 I;  1YJ9 T;  4BB7 A;  4MMK A;  3V7S A;  1BKB A;  5D6X A;  1YHQ T;  3CXC S;  4ATO A;  2EQK A;  3OYC A;  4OB2 B;  3CCV A;  2WSE E;  2LCC A;  3CMA T;  1QVF A;  3VJP A;  1N8R C;  2XHC A;  1WJQ A;  4HCZ A;  4LDY A;  5GAM d;  3OBW A;  2I2L A;  3X26 B;  1VQL T;  4XU1 A;  5CVI A;  4C0D B;  5M9O A;  3G71 T;  3CCL A;  2XI9 A;  2PVO B;  2L3R A;  1O75 A;  2QQS A;  3PMI A;  5FRN A;  1LOJ A;  4A4F A;  2QQB A;  3CCS T;  2LVM A;  2RHI A;  3CCQ T;  1QVP A;  2QEX A;  2KMT A;  3X25 B;  2LT1 A;  1D3B B;  4OB1 B;  3CBO A;  3L2U A;  4M77 D;  1AHJ B;  3A8H B;  1MGQ A;  4J6X A;  4IUR A;  1QVG S;  3ER0 A;  2DTI A;  2CS7 A;  3J7A F;  2JN0 A;  3Q1J A;  3SWN A;  4A53 A;  4BE2 A;  1M1K U;  3JCM b;  2BIV A;  1KQ1 A;  4FL6 A;  2EIF A;  4II1 A;  5I2M A;  1K8A U;  3JB9 H;  4RCB A;  1IZ6 A;  2DD5 A;  3HFO A;  3SD4 A;  2EYQ A;  3GOX A;  3FEO A;  5GAN f;  2X4J A;  2RB6 A;  2E1H A;  1QP3 A;  2VYT A;  3S6W A;  4BUG A;  2E64 A;  5LJ5 d;  1OYX A;  4QW2 A;  4C92 B;  5GAN 6;  1JJ2 A;  2B8A A;  2RHY A;  2RA2 A;  3BDL A;  5CQY A;  1VQ6 T;  2QQR A;  4KT0 E;  1YJ9 A;  1FWZ A;  4M7A B;  4BAC A;  1M1K C;  3CPW S;  3CCU T;  5J26 A;  3OA6 A;  3QYH B;  1YHQ A;  4DOV A;  1TH7 A;  3LGL A;  3PNW C;  4MZM A;  4OMF B;  5FU7 B;  5GMK h;  3JCM g;  4JRQ A;  4J7I A;  4M78 F;  2DTO A;  2RH2 A;  4HT8 A;  3G4S T;  3OSS C;  5LJ3 h;  3OBY A;  2K3Y A;  3CMA A;  2PVG B;  3S3N A;  2GQV A;  1YIJ T;  4GLK A;  5DLO A;  1YJW T;  2L5Q A;  2QTX A;  3CCJ T;  2FVU A;  4CRI A;  4E7K A;  1VQ8 A;  4PKC C;  5J39 A;  3GNG A;  2EQM A;  3RKY A;  1VQL A;  3PTA A;  1IRE B;  5CK9 A;  1XQH A;  2DZ9 A;  4HCC A;  5LJ3 g;  1M1F A;  3A8G B;  2L8D A;  2XIC A;  4J6W A;  3OYJ A;  2DO3 A;  4BE0 A;  3CCS A;  5DLQ E;  3CCQ A;  5GAN 3;  3JCM e;  5GAN j;  4OGE A;  3RUX A;  3HL8 A;  2XDD A;  2MWO A;  4M78 D;  3M4G A;  3OS2 A;  2X4X A;  3KBG A;  2EJ9 A;  1UEB A;  1YJN T;  2LDM A;  4M77 G;  2Y4Y A;  4RCC A;  4M77 C;  2DEQ A;  4JDS A;  3DB3 A;  1YCY A;  4XU0 A;  5GMK e;  2DKG A;  2JVV A;  5FRM A;  4M77 A;  4MDW A;  5LJ3 e;  2LT4 A;  4C92 F;  3INZ A;  2BKD N;  2DIG A;  1G3W A;  2E12 A;  4N4G A;  1M5Q 1;  3M56 A;  4M7A F;  3M9Q A;  4BI8 B;  4LDX A;  2IVW A;  3MET A;  1M1G A;  1W2B S;  3FC3 A;  1VUB A;  1VQ6 A;  2ZPH B;  4M75 C;  1Q86 C;  2VUB A;  4C0G A;  2JZ2 A;  2PU9 B;  4F7U B;  2LQK A;  5LJ5 h;  3CCU A;  4BDZ A;  4BE1 A;  3QKJ A;  2XDP A;  3PT9 A;  1KHI A;  1VQM A;  2EJG A;  3HFN A;  1KD1 U;  2KY9 A;  3VYH B;  2XU8 A;  4ELZ C;  4QVC A;  3NTI A;  4FSX A;  4C92 D;  1M90 C;  1VQ7 A;  1VQN T;  5GAO n;  2LNV A;  4C5E A;  5HK3 A;  1YJW A;  3LWI A;  3CCJ A;  5LJ5 g;  4M7A D;  2E10 A;  2V8K A;  3QUI A;  2R58 A;  3N5B B;  4KUI A;  3UPU A;  2KVQ G;  3L42 A;  2O4X B;  3BY7 A;  3MEV A;  1B34 B;  4NOY A;  3R6O A;  4BY6 B;  4C8Q B;  2JTM A;  3VV0 A;  3UWN A;  1RI0 A;  2K57 A;  2X4Y A;  4NL2 A;  4EMH A;  1Y96 B;  5CR2 A;  3I55 A;  3HRS A;  3MO8 A;  4NS5 A;  4EMK B;  2MF2 A;  1KD1 C;  2G3R A;  3E9G A;  5GAO m;  2E6Z A;  4E7L A;  2PUO B;  5IN1 A;  4HCB A;  4HKE A;  3OYM A;  2ZPB B;  3JSC A;  1YJN A;  1H3Z A;  3JCM d;  1H64 1;  4FM4 B;  2MI6 A;  4M78 G;  4C0D C;  5LJ5 e;  3MEA A;  5D6Y A;  4E7H A;  1I81 A;  2P4T A;  2CYZ B;  1BIA A;  4XTZ A;  4BDY A;  2DK3 A;  3OB9 A;  3CXC A;  1BI3 A;  3OW2 S;  2VC8 A;  3O8V A;  4N0A C;  3TCJ A;  3OY9 A;  2HQX A;  3T9N A;  5LJ3 d;  3GPL A;  3NTH A;  2FB7 A;  4X9C A;  1R8O B;  2KAF A;  4M78 E;  4PJO E;  3LWH A;  3LLR A;  4M77 F;  2M9U A;  3CBM A;  4N0A A;  2QA4 T;  1D3B A;  2RJC A;  3WVD B;  5GAM f;  3F70 A;  3QHS A;  2RI2 A;  3JRZ A;  5I21 A;  5GMK l;  4DA4 A;  1UGS B;  4M7D B;  1M9S A;  3HRT A;  4XTY A;  3CC7 T;  1OZ3 A;  2D6F A;  2VV5 A;  4C5G A;  1VQN A;  2GFA A;  3CME T;  3QG1 A;  1Y71 A;  1QVG A;  5CIU A;  4C92 G;  4ZGD B;  3RES A;  4C92 C;  2AHJ B;  2YLB A;  4PLI A;  1BYM A;  4M75 F;  2R5A A;  4M7A G;  1WPY A;  3H8Z A;  2F5T X;  4M7A C;  4QQG A;  3WXM B;  2LX9 A;  3C12 A;  4C92 A;  3CC4 T;  2X35 A;  3HKS A;  3I56 T;  5C0M A;  3GP8 A;  1K73 U;  5FU7 C;  2E6N A;  1NZ9 A;  3OMC A;  2VGM A;  2M16 A;  3M59 A;  4RMO A;  4RKU E;  4M7A A;  4IUV A;  5CAI A;  4C92 E;  4JRP A;  3L1A A;  5FU6 B;  3OYH A;  1KG1 A;  1KC8 U;  2QXF A;  2LCL A;  1JBM A;  4C0Z A;  4RG2 A;  4JJN K;  4M7A E;  5GAM j;  4PNO A;  4D6W A;  3VUB A;  5KCH A;  1I5L A;  3CCE T;  2QQA A;  3DKM A;  1G3Y A;  1VIF A;  3CPW A;  4LDU A;  4M75 D;  3JCM h;  1VQK T;  1G5V A;  2QI2 A;  1Q82 U;  2RI5 A;  1JRI A;  1ZBX A;  3A8L B;  2CZ1 B;  2DXC A;  1K73 C;  2P0P A;  2DVE A;  4X9D A;  4BI4 A;  4E7I A;  1NPP A;  1UGQ B;  3ME9 A;  1K8A C;  3L2Q A;  3SB2 A;  1KC8 C;  4EDU A;  4J83 A;  2KK4 A;  4ELY C;  4OF1 A;  2CZ6 B;  5C6S A;  1YIT T;  2VXE A;  2HBP A;  2K5L A;  2ZGW A;  1I8F A;  1WJS A;  2E65 A;  3G71 A;  3CC7 A;  2HD0 A;  3A8O B;  3P8H A;  4UC4 A;  5CKF A;  1OI1 A;  3BW1 A;  1S72 T;  3OS1 A;  5GMK i;  3CME A;  4FT2 A;  2ZPG B;  2JTF A;  3V8J A;  1OZ2 A;  3SWN B;  1XNI A;  1X01 A;  3NTK A;  4ZTF A;  3CC2 T;  1UB4 A;  2DD4 A;  3OS0 A;  4F7U G;  1N9R A;  1HXD A;  3FLG A;  3TU4 K;  3CC4 A;  3I56 A;  3OYL A;  1M4Z A;  2K2V A;  4GY5 A;  3RMQ A;  1X6O A;  2YRV A;  2P0Q A;  2VGN A;  4F7U A;  3VU3 C;  3ZBD A;  2K5I A;  3LW5 E;  4BI3 A;  4QVD A;  4DOW A;  1X75 C;  5GAN 7;  2EQJ A;  2Y90 A;  4Y28 E;  4QVZ A;  5KE3 A;  5AYF A;  4XAX B;  1W2B A;  3VYG A;  3G7Z A;  2A7Y A;  4M77 E;  3JCM P;  3CCE A;  2RJD A;  2RHX A;  4BY6 C;  4C8Q C;  2EAY A;  1VQK A;  3AHU A;  2OTJ T;  2WSF E;  1Q81 U;  2O4X A;  3M58 A;  1Y7X A;  3CPF A;  2YHT A;  2DPP B;  4M75 G;  1B34 A;  3HP9 A;  4OB0 B;  4EMK C;  4MZP A;  4C8Q A;  1KQS S;  3QZ9 B;  4OB3 B;  3CBP A;  4JRK A;  2QDY B;  4M75 A;  4A4H A;  4EMK A;  3DLM A;  4NL3 A;  2R5M A;  4WF2 A;  4XTU A;  2WAC A;  3G4S A;  3HHT B;  2RJE A;  3RKX A;  5A0G A;  5KE2 A;  4XTV A;  3NFC A;  3WVE B;  4M75 E;  2LC4 A;  4LD6 A;  3H6Z A;  3UDC A;  2RD1 A;  2LTO A;  3FRN A;  1QW1 A;  4IKF A;  3CD6 T;  3RKW A;  3MEU A;  3QBY A;  2EWN A;  4PLL A;  2HNI A;  4Q5W A;  3V7C A;  3M57 A;  3C4S A;  3OYF A;  3QJ6 A;  2ZPE B;  1S72 A;  1VIE A;  3JCM Q;  3HPW A;  5CKD A;  2E41 A;  5CKE A;  2IG0 A;  3OQ5 A;  2KQW A;  4C5H A;  4LDW A;  5GAN h;  3J80 E;  2VXF A;  3JCM f;  1N9S A;  2RJF A;  3TEE A;  2DXT A;  3MP6 A;  1DJ7 B;  1ZQ1 A;  2PQW A;  3M55 A;  4XK8 E;  3CCR T;  1NJI U;  4M7D C;  3GLX A;  4ZN1 A;  3BDU A;  4ZN3 A;  4HT9 A;  4OP0 A;  5IT9 E;  3JCM W;  4E47 A;  5A2Q E;  3OW2 A;  3J81 E;  1K9M U;  2R57 A;  4KUL A;  5FLX E;  1I4K 1;  3QPH A;  5GAN g;  4A4E A;  5DM7 R;  1WGS A;  4O5V A;  1SSF A;  3RMS A;  3DLL A;  5GAO r;  2M1H A;  5LJ3 f;  3L2Z A;  5CO7 A;  3X24 B;  4R56 A;  4MDX A;  4JLI A;  2F69 A;  3EAE A;  2BUD A;  2DTH A;  4F7U F;  4O6J A;  3OYB A;  1XTD A;  2LQ8 A;  2RHZ A;  3FDR A;  4N4I A;  4DQ2 A;  3G6E T;  1XOV A;  4XTW A;  2OTJ A;  4N4H A;  3GIB A;  3E19 A;  5CKB A;  5EG2 A;  5FU6 C;  5GAN e;  5GAN 8;  2EJF A;  1MHN A;  1LJO A;  3CCM T;  1N8R U;  1N6A A;  3M5A A;  5GAO p;  3C95 A;  3QXE B;  5KH6 A;  2GFU A;  4QQ6 A;  2OTL T;  1U1T A;  3DB4 A;  4C8Q F;  3MP8 A;  3GNF B;  1RL2 A;  5CCA A;  4C5I A;  4KBM B;  3OYI A;  2MMP A;  4IUT A;  2EFI A;  3PMT A;  1W4S A;  4L5G A;  4PL6 A;  2PUK B;  1YBY A;  5DY9 A;  4J7F A;  5GMK j;  3OYN A;  3CD6 A;  2FYK A;  3A8M B;  3L2V A;  2EQU A;  5LJ3 j;  2RO0 A;  3JB9 J;  4FU6 A;  4P5N A;  1VQ4 T;  3HRU A;  4JS5 A;  4Z02 A;  3VKI A;  1VQ8 T;  2DJZ A;  2H3J A;  1VQP T;  4LD9 K;  1BI0 A;  1FXX A;  4J5Y A;  3C94 A;  4M78 B;  1V29 B;  1P92 A;  5GAO l;  3CCR A;  1QVF S;  4C8Q D;  4PJO B;  3E9F A;  2F5K A;  1KQ2 A;  2C06 A;  3JCM V;  4VUB A;  3HSB A;  1UGR B;  4FIB A;  2RM4 A;  5LJ5 f;  1M8V A;  3EFR A;  1UGP B;  4QQD A;  2PVD B;  2RK2 A;  5IAY A;  2ZZD A;  2LRQ A;  3OYY A;  3QII A;  3JB9 F;  1N27 A;  4MML A;  3A5Z B;  2K3X A;  5KCO A;  3SWN C;  4OVA A;  1ZHI A;  4ZGE B;  4JS4 A;  3JCM J;  2E70 A;  4YTL A;  1HK9 A;  3LX7 A;  4M7D F;  3BFM A;  4J6Y A;  3LYI A;  5HK0 A;  3G6E A;  3RER A;  3OYE A;  2QA4 A;  3FJP A;  4A4K A;  3VUZ A;  2L89 A;  5CKH A;  3PFS A;  3KXT A;  3PGG A;  2GCX A;  4B9X A;  1O9S A;  2RHU A;  3LH0 A;  1Q82 C;  4Y91 A;  4JUV A;  3KUF A;  4OGC A;  5L8R E;  3CCM A;  5GAN 2;  1WQ7 A;  3MCA B;  1YI2 T;  3JB9 D;  5GAN d;  2RI3 A;  1U8R A;  1GXI E;  2XID A;  3OS5 A;  2KSS A;  2OTL A;  1PSE A;  2P0K A;  2CZ0 B;  5GAN 4;  4M7D D;  4BD3 A;  5LJ5 j;  3OYA A;  3GF5 A;  4ME7 A;  1JJ2 S;  2KDS A;  1VQM T;  3CEY A;  3RIR A;  2K4Y A;  3FIF A;  4X34 A;  2A3L A;  2NLU A;  5J3B A;  4C0F A;  4XU2 A;  1WJR A;  4PJO F;  1VQ7 T;  1JB0 E;  3EFS A;  3MHX A;  3PIO A;  4V2S A;  3JCM X;  1VQ5 T;  4XTX A;  2ZPI B;  1BI2 A;  4RG8 A;  1VQ4 A;  3V8L A;  3SDZ A;  1PSF A;  2XKO C;  2HAX A;  1VQP A;  4FT4 A;  1EIF A;  1G3T A;  2MWP A;  2WSC E;  2FHD A;  3X20 B;  4F7U E;  5CQX A;  5GAM h;  4IUP A;  4MZT A;  2K5F A;  2V8I A;  1LNX A;  4C8Q G;  2E5Q A;  3P8D A;  3I55 T;  2HQE A;  2OAU A;  4XU3 A;  3URG A;  3JAM E;  1KQS A;  4EPC A;  2YLC A;  2D0Q B;  3S3M A;  2XDB A;  2XD0 A;  2RK1 A;  3JCM c;  3OMG A;  3OYG A;  3X28 B;  4PJO D;  1VQ9 T;  3LGF A;  5GAM g;  2ZCF B;  5A0L A;  3ZEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...