4EMLA

Synechocystis sp. pcc 6803 1,4-dihydroxy-2-naphthoyl-coenzyme a synthase (menb) in complex with bicarbonate
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
275
structure length
261
Chain Sequence
MDWHIAKHYDDILYYKAGGIAKIVINRPHKRNAFRPQTVFELYDAFCNAREDNRIGVVLLTGAGPHSDGKYAFCSGGDQSRLNVLDLQRLIRSMPKVVIALVAGYAIGGGHVLHLVCDLTIAADNAIFGQTGPKVGSFDGGFGSSYLARIVGQKKAREIWYLCRQYSAQEAERMGMVNTVVPVDRLEEEGIQWAKEILSKSPLAIRCLKAAFNADCDGQAGLQELAGNATLLYYMTEEGSEGKQAFLEKRPPDFSQYPWLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site binding and catalytic role of bicarbonate in 1,4-dihydroxy-2-naphthoyl coenzyme A synthases from vitamin K biosynthetic pathways
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Lyase
molecule keywords Naphthoate synthase
total genus 98
structure length 261
sequence length 275
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 4emlA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4emlA01
2FW2A 3TVUA 3WG5A 3OMEA 1UYTA 4RYFA 1UYVA 3VIVA 3H0QA 5INFA 3ISAA 1XNWA 4ELWA 1O8UA 3K50A 4FN7A 3KTIA 3GKBA 5DL1A 4EMLA 2Q35A 1OD4A 4JCRA 4KNPA 4FNBA 3KTJA 3TLFA 1VRGA 1XO6A 5INIA 4ELXA 4RYFH 4ELSA 2A7KA 2J5GD 4U18A 4DI1A 3SLLA 4ZDEA 5KDRA 4MXIA 1WZ8A 2J5II 1N6DA 5G1SA 1EF9A 3M6MA 3LAOA 4I52A 1PIXA 3KQFA 1RJNA 1Q52A 3K8XA 1FCFA 5KJPA 3I47A 3TRRA 5C90A 3PE8A 3T8BA 1W2XA 2CE3A 3OC7A 4Q1IA 3MYBA 3T88A 2EJ5A 5DUFA 2HW5A 4JWVA 4IZDA 5G1QA 3STAA 5FUSA 4U0GA 3PGQA 2NP9A 2F6IA 3NJDA 3DJAA 2QQ3A 2X24A 2FZSA 3U9RB 4B3IA 2VSSA 4HC8A 5FIFA 1DCIA 3IAVA 4MI2A 4WZ8B 5CTBA 3TT6A 5E0NX 1FC9A 1JXZA 1EF8A 4HNKA 3QXZA 4U0GH 1FC7A 4MOUA 3Q1TA 5MGBA 5DU4A 2CBYA 4JCTA 3FF6A 4KPKA 2Q34A 2FBMA 3T3WA 2ZL2A 5JBWA 1DUBA 2PBPA 1J7XA 3QMJA 3ZW9A 2ZL4A 3FDUA 3QWDA 3TDCA 5KDRB 4ZDBA 4JVTA 3QYRA 2F9IB 3H81A 3T89A 1SG4A 3TT7A 3R9QA 5DZKH 2VSUA 3OT6A 2F9IA 1UYRA 4L8KA 3T8AA 3LKEA 3TZ3A 4GM2A 3NJBA 4U0HA 4QFEA 4LK5A 4FJWD 3IB9A 1NZYB 4QIJA 3ST9A 4B3JA 5JBXA 4JOTA 1WDMA 3MFMA 3BPPA 5DTWA 2UZFA 5DZKA 3H0JA 3QKAA 3N6RB 4OMRA 1RJMA 1N6EA 2IEXA 1YG8A 4GHNA 5DKPA 4EMPA 1YG6A 2VSUE 2VSSE 2F9YB 5DU6A 2VX2A 2VSSF 1XX4A 1HNUA 3P5MA 5DU8A 3JU1A 4ZDCA 2BZRA 1X0UA 5E0SH 4K2NA 3HRXA 4B3HA 2C8TA 3Q7HA 3SWXA 4KD6A 3DORA 4OLQA 3R9TA 3MT6A 1PJHA 4NEKA 3H0SA 1ON9A 2ZL0A 2D3TA 4WCZA 4ZDDA 2X58A 3ZWBA 4I4ZA 2A7SA 4JYLA 4KWBA 4JFCA 2PG8A 4U1AA 2A81A 2J5GA 4EMMA 1FC6A 1HZDA 4FZWA 1Y7OA 4WYOB 3HP0A 5DTPA 4JYJA 2VREA 3RRVA 1NZYA 1MJ3A 3HE2A 4U19A 1XNVA 2J5SA 3V5IA 2ZQQA 3P2LA 3RSTA 4QIIA 3H02A 4JSBA 1OD2A 2DUBA 4RCNA 5C9GA 1HNOA 4JCQA 4IZCA 1N6FA 4K3WA 4I42A 1TG6A 5IKLB 4FN8A 4IZBA 3P85A 4F47A 3KTGA 2VSUF 5DUCA 2ZL3A 2Q2XA 4YLHA 3H0UA 4ASIA 3GMAA 4ZDFA 2DEOA 3QREA 3R6HA 3GF7A 2F9YA 3L3SA 4JCSA 2GTRA 3U9SB 3GLMA 3U9TB 2ZQRA 3RSIA 4ZU2A 4K29A 4FNDA 3ZWCA 3Q0GA 2VSUC 3ZW8A 3BEZA 1K32A 3KTKA 1EY3A 3MOYA 1WDKA 1K39A 2WTBA 1ON3A 3IBBA 1UYSA 4NNQA 2J5IA 4Q0GA 4FZWC 5CTCA 5E0SA 3TV5A 4FB8A 3R0OA 4Z0MA 2J5IB 3TVWA 3V5EA 1WDLA 1SZOA 4JJTA 4G2RA 1XNYA 3R9SA 2F6QA 3G64A 2W3PA 1UIYA 3HLN1 4OG1A 3GF3A 5G1RA 3QK8A 3HINA 1Q51A 3Q0JA 3QXIA 3M6NA 1TYFA 3PEAA 4L6WA 3ZWAA 3BF0A 3KTHA 3PZKA 2PPYA 5INGA
chains in the Genus database with same CATH superfamily
3O4XE 2FW2A 3TVUA 3WG5A 3OMEA 1UYTA 4RYFA 1UYVA 3VIVA 3H0QA 5INFA 3ISAA 1XNWA 4ELWA 1O8UA 3K50A 4FN7A 3KTIA 3GKBA 5DL1A 4EMLA 2Q35A 1OD4A 4JCRA 4KNPA 3L8IA 3KTJA 4FNBA 3ADDA 3TLFA 1VRGA 1XO6A 5INIA 4ELXA 4J2UA 4RYFH 4ELSA 2A7KA 2J5GD 4U18A 4DI1A 3SLLA 4ZDEA 5KDRA 4MXIA 1WZ8A 2J5II 1N6DA 5G1SA 1EF9A 3M6MA 3LAOA 4I52A 1PIXA 3KQFA 1RJNA 1Q52A 3K8XA 1FCFA 5KJPA 3I47A 3TRRA 5C90A 3PE8A 3T8BA 1W2XA 2CE3A 3OC7A 4Q1IA 3MYBA 3T88A 2EJ5A 5DUFA 2HW5A 4JWVA 4IZDA 5HUQA 3A4LA 5G1QA 3STAA 5FUSA 4U0GA 3PGQA 2NP9A 2F6IA 3NJDA 3DJAA 2QQ3A 2X24A 2FZSA 1UX4A 3U9RB 3RQFA 4B3IA 2VSSA 4HC8A 5FIFA 1DCIA 3IAVA 4MI2A 4WZ8B 5CTBA 3TT6A 5E0NX 1FC9A 1JXZA 1EF8A 4HNKA 3QXZA 4U0GH 1FC7A 4MOUA 3Q1TA 5MGBA 5DU4A 2CBYA 4JCTA 3FF6A 4KPKA 2Q34A 2FBMA 3T3WA 2ZL2A 5JBWA 3A4NA 1DUBA 2PBPA 1J7XA 3QMJA 3ZW9A 2ZL4A 3FDUA 3QWDA 3TDCA 5KDRB 4ZDBA 4JVTA 3QYRA 1Y64B 2F9IB 3H81A 3AM1A 3RQGA 3T89A 1SG4A 3TT7A 3R9QA 5DZKH 2VSUA 3OT6A 2F9IA 1UYRA 4L8KA 3T8AA 3LKEA 3TZ3A 4GM2A 3NJBA 4U0HA 4QFEA 4LK5A 4FJWD 3IB9A 3W8IB 3RQEA 1NZYB 4QIJA 3ST9A 4B3JA 5JBXA 4JOTA 3BPTA 1WDMA 3MFMA 3BPPA 5DTWA 2UZFA 5DZKA 3H0JA 3QKAA 3N6RB 4OMRA 1RJMA 1N6EA 2IEXA 1YG8A 4GHNA 5DKPA 4EMPA 1YG6A 2VSUE 2VSSE 2F9YB 5DU6A 2VX2A 2VSSF 1XX4A 3IRBA 1HNUA 3P5MA 5DU8A 3JU1A 4ZDCA 3A4MA 3L8JA 2BZRA 1X0UA 5E0SH 4K2NA 3HRXA 4B3HA 2C8TA 3Q7HA 3SWXA 4KD6A 3DORA 4OLQA 3R9TA 3MT6A 1PJHA 4NEKA 3H0SA 1ON9A 2ZL0A 2D3TA 4WCZA 4ZDDA 2X58A 3ZWBA 4I4ZA 2A7SA 4JYLA 4KWBA 4JFCA 2PG8A 4U1AA 2A81A 2J5GA 4EMMA 1FC6A 1HZDA 4FZWA 1Y7OA 4WYOB 3HP0A 5DTPA 4JYJA 2VREA 3RRVA 1NZYA 1MJ3A 3HE2A 4U19A 1XNVA 2J5SA 3V5IA 2ZQQA 3P2LA 1UX5A 3RSTA 4QIIA 3H02A 4JSBA 1OD2A 2DUBA 4RCNA 5C9GA 1HNOA 4JCQA 4IZCA 1N6FA 4K3WA 3W8HB 4I42A 1TG6A 5IKLB 4FN8A 4IZBA 3P85A 4F47A 3KTGA 2VSUF 5DUCA 2ZL3A 2Q2XA 4YLHA 3H0UA 4ASIA 3GMAA 4ZDFA 2DEOA 3AJMA 3QREA 3R6HA 3GF7A 2F9YA 3L3SA 4JCSA 2GTRA 3U9SB 3GLMA 3U9TB 3ADCA 2ZQRA 3RSIA 4ZU2A 4K29A 4FNDA 3ZWCA 3Q0GA 2VSUC 3ZW8A 3BEZA 1K32A 3KTKA 1EY3A 3MOYA 1WDKA 1K39A 2WTBA 1ON3A 3IBBA 1UYSA 4NARA 2YJGA 4NNQA 2J5IA 4Q0GA 4FZWC 5CTCA 5E0SA 3TV5A 4FB8A 3R0OA 4Z0MA 2J5IB 3TVWA 3V5EA 1WDLA 1SZOA 4JJTA 4G2RA 1XNYA 3R9SA 2F6QA 3G64A 2W3PA 1UIYA 3HLN1 4OG1A 3GF3A 5G1RA 3QK8A 3HINA 4GEHB 1Q51A 3Q0JA 3QXIA 3M6NA 1TYFA 3PEAA 4L6WA 3ZWAA 3BF0A 3ADBA 4HDTA 3KTHA 3PZKA 2PPYA 2P63A 5INGA
chains in the Genus database with same CATH topology
2FW2A 3TVUA 3WG5A 3OMEA 1UYTA 4RYFA 1UYVA 3VIVA 3H0QA 5INFA 3ISAA 1XNWA 4ELWA 1O8UA 3K50A 4FN7A 3KTIA 3GKBA 5DL1A 4EMLA 2Q35A 1OD4A 4JCRA 4KNPA 4FNBA 3KTJA 3TLFA 1VRGA 1XO6A 5INIA 4ELXA 4J2UA 4RYFH 4ELSA 2A7KA 2J5GD 4U18A 4DI1A 3SLLA 4ZDEA 5KDRA 4MXIA 1WZ8A 2J5II 1N6DA 5G1SA 1EF9A 3M6MA 3LAOA 4I52A 1PIXA 3KQFA 1RJNA 1Q52A 3K8XA 1FCFA 5KJPA 3I47A 3TRRA 5C90A 3PE8A 3T8BA 1W2XA 2CE3A 3OC7A 4Q1IA 3MYBA 3T88A 2EJ5A 5DUFA 2HW5A 4JWVA 4IZDA 5HUQA 5G1QA 3STAA 5FUSA 4U0GA 3PGQA 2NP9A 2F6IA 3NJDA 3DJAA 2QQ3A 2X24A 2FZSA 3U9RB 4B3IA 2VSSA 4HC8A 5FIFA 1DCIA 3IAVA 4MI2A 4WZ8B 5CTBA 3TT6A 5E0NX 1FC9A 1JXZA 1EF8A 4HNKA 3QXZA 4U0GH 1FC7A 4MOUA 3Q1TA 5MGBA 5DU4A 2CBYA 4JCTA 3FF6A 4KPKA 2Q34A 2FBMA 3T3WA 2ZL2A 5JBWA 1DUBA 2PBPA 1J7XA 3QMJA 3ZW9A 2ZL4A 3FDUA 3QWDA 3TDCA 5KDRB 4ZDBA 4JVTA 3QYRA 2F9IB 3H81A 3T89A 1SG4A 3TT7A 3R9QA 5DZKH 2VSUA 3OT6A 2F9IA 1UYRA 4L8KA 3T8AA 3LKEA 3TZ3A 4GM2A 3NJBA 4U0HA 4QFEA 4LK5A 4FJWD 3IB9A 1NZYB 4QIJA 3ST9A 4B3JA 5JBXA 4JOTA 3BPTA 1WDMA 3MFMA 3BPPA 5DTWA 2UZFA 5DZKA 3H0JA 3QKAA 3N6RB 4OMRA 1RJMA 1N6EA 2IEXA 1YG8A 4GHNA 5DKPA 4EMPA 1YG6A 2VSUE 2VSSE 2F9YB 5DU6A 2VX2A 2VSSF 1XX4A 1HNUA 3P5MA 5DU8A 3JU1A 4ZDCA 2BZRA 1X0UA 5E0SH 4K2NA 3HRXA 4B3HA 2C8TA 3Q7HA 3SWXA 4KD6A 3DORA 4OLQA 3R9TA 3MT6A 1PJHA 4NEKA 3H0SA 1ON9A 2ZL0A 2D3TA 4WCZA 4ZDDA 2X58A 3ZWBA 4I4ZA 2A7SA 4JYLA 4KWBA 4JFCA 2PG8A 4U1AA 2A81A 2J5GA 4EMMA 1FC6A 1HZDA 4FZWA 1Y7OA 4WYOB 3HP0A 5DTPA 4JYJA 2VREA 3RRVA 1NZYA 1MJ3A 3HE2A 4U19A 1XNVA 2J5SA 3V5IA 2ZQQA 3P2LA 3RSTA 4QIIA 3H02A 4JSBA 1OD2A 2DUBA 4RCNA 5C9GA 1HNOA 4JCQA 4IZCA 1N6FA 4K3WA 4I42A 1TG6A 5IKLB 4FN8A 4IZBA 3P85A 4F47A 3KTGA 2VSUF 5DUCA 2ZL3A 2Q2XA 4YLHA 3H0UA 4ASIA 3GMAA 4ZDFA 2DEOA 3QREA 3R6HA 3GF7A 2F9YA 3L3SA 4JCSA 2GTRA 3U9SB 3GLMA 3U9TB 2ZQRA 3RSIA 4ZU2A 4K29A 4FNDA 3ZWCA 3Q0GA 2VSUC 3ZW8A 3BEZA 1K32A 3KTKA 1EY3A 3MOYA 1WDKA 1K39A 2WTBA 1ON3A 3IBBA 1UYSA 4NARA 2YJGA 4NNQA 2J5IA 4Q0GA 4FZWC 5CTCA 5E0SA 3TV5A 4FB8A 3R0OA 4Z0MA 2J5IB 3TVWA 3V5EA 1WDLA 1SZOA 4JJTA 4G2RA 1XNYA 3R9SA 2F6QA 3G64A 2W3PA 1UIYA 3HLN1 4OG1A 3GF3A 5G1RA 3QK8A 3HINA 1Q51A 3Q0JA 3QXIA 3M6NA 1TYFA 3PEAA 4L6WA 3ZWAA 3BF0A 4HDTA 3KTHA 3PZKA 2PPYA 5INGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FW2 A;  3TVU A;  3WG5 A;  3OME A;  1UYT A;  4RYF A;  1UYV A;  3VIV A;  3H0Q A;  5INF A;  3ISA A;  1XNW A;  4ELW A;  1O8U A;  3K50 A;  4FN7 A;  3KTI A;  3GKB A;  5DL1 A;  4EML A;  2Q35 A;  1OD4 A;  4JCR A;  4KNP A;  4FNB A;  3KTJ A;  3TLF A;  1VRG A;  1XO6 A;  5INI A;  4ELX A;  4RYF H;  4ELS A;  2A7K A;  2J5G D;  4U18 A;  4DI1 A;  3SLL A;  4ZDE A;  5KDR A;  4MXI A;  1WZ8 A;  2J5I I;  1N6D A;  5G1S A;  1EF9 A;  3M6M A;  3LAO A;  4I52 A;  1PIX A;  3KQF A;  1RJN A;  1Q52 A;  3K8X A;  1FCF A;  5KJP A;  3I47 A;  3TRR A;  5C90 A;  3PE8 A;  3T8B A;  1W2X A;  2CE3 A;  3OC7 A;  4Q1I A;  3MYB A;  3T88 A;  2EJ5 A;  5DUF A;  2HW5 A;  4JWV A;  4IZD A;  5G1Q A;  3STA A;  5FUS A;  4U0G A;  3PGQ A;  2NP9 A;  2F6I A;  3NJD A;  3DJA A;  2QQ3 A;  2X24 A;  2FZS A;  3U9R B;  4B3I A;  2VSS A;  4HC8 A;  5FIF A;  1DCI A;  3IAV A;  4MI2 A;  4WZ8 B;  5CTB A;  3TT6 A;  5E0N X;  1FC9 A;  1JXZ A;  1EF8 A;  4HNK A;  3QXZ A;  4U0G H;  1FC7 A;  4MOU A;  3Q1T A;  5MGB A;  5DU4 A;  2CBY A;  4JCT A;  3FF6 A;  4KPK A;  2Q34 A;  2FBM A;  3T3W A;  2ZL2 A;  5JBW A;  1DUB A;  2PBP A;  1J7X A;  3QMJ A;  3ZW9 A;  2ZL4 A;  3FDU A;  3QWD A;  3TDC A;  5KDR B;  4ZDB A;  4JVT A;  3QYR A;  2F9I B;  3H81 A;  3T89 A;  1SG4 A;  3TT7 A;  3R9Q A;  5DZK H;  2VSU A;  3OT6 A;  2F9I A;  1UYR A;  4L8K A;  3T8A A;  3LKE A;  3TZ3 A;  4GM2 A;  3NJB A;  4U0H A;  4QFE A;  4LK5 A;  4FJW D;  3IB9 A;  1NZY B;  4QIJ A;  3ST9 A;  4B3J A;  5JBX A;  4JOT A;  1WDM A;  3MFM A;  3BPP A;  5DTW A;  2UZF A;  5DZK A;  3H0J A;  3QKA A;  3N6R B;  4OMR A;  1RJM A;  1N6E A;  2IEX A;  1YG8 A;  4GHN A;  5DKP A;  4EMP A;  1YG6 A;  2VSU E;  2VSS E;  2F9Y B;  5DU6 A;  2VX2 A;  2VSS F;  1XX4 A;  1HNU A;  3P5M A;  5DU8 A;  3JU1 A;  4ZDC A;  2BZR A;  1X0U A;  5E0S H;  4K2N A;  3HRX A;  4B3H A;  2C8T A;  3Q7H A;  3SWX A;  4KD6 A;  3DOR A;  4OLQ A;  3R9T A;  3MT6 A;  1PJH A;  4NEK A;  3H0S A;  1ON9 A;  2ZL0 A;  2D3T A;  4WCZ A;  4ZDD A;  2X58 A;  3ZWB A;  4I4Z A;  2A7S A;  4JYL A;  4KWB A;  4JFC A;  2PG8 A;  4U1A A;  2A81 A;  2J5G A;  4EMM A;  1FC6 A;  1HZD A;  4FZW A;  1Y7O A;  4WYO B;  3HP0 A;  5DTP A;  4JYJ A;  2VRE A;  3RRV A;  1NZY A;  1MJ3 A;  3HE2 A;  4U19 A;  1XNV A;  2J5S A;  3V5I A;  2ZQQ A;  3P2L A;  3RST A;  4QII A;  3H02 A;  4JSB A;  1OD2 A;  2DUB A;  4RCN A;  5C9G A;  1HNO A;  4JCQ A;  4IZC A;  1N6F A;  4K3W A;  4I42 A;  1TG6 A;  5IKL B;  4FN8 A;  4IZB A;  3P85 A;  4F47 A;  3KTG A;  2VSU F;  5DUC A;  2ZL3 A;  2Q2X A;  4YLH A;  3H0U A;  4ASI A;  3GMA A;  4ZDF A;  2DEO A;  3QRE A;  3R6H A;  3GF7 A;  2F9Y A;  3L3S A;  4JCS A;  2GTR A;  3U9S B;  3GLM A;  3U9T B;  2ZQR A;  3RSI A;  4ZU2 A;  4K29 A;  4FND A;  3ZWC A;  3Q0G A;  2VSU C;  3ZW8 A;  3BEZ A;  1K32 A;  3KTK A;  1EY3 A;  3MOY A;  1WDK A;  1K39 A;  2WTB A;  1ON3 A;  3IBB A;  1UYS A;  4NNQ A;  2J5I A;  4Q0G A;  4FZW C;  5CTC A;  5E0S A;  3TV5 A;  4FB8 A;  3R0O A;  4Z0M A;  2J5I B;  3TVW A;  3V5E A;  1WDL A;  1SZO A;  4JJT A;  4G2R A;  1XNY A;  3R9S A;  2F6Q A;  3G64 A;  2W3P A;  1UIY A;  3HLN 1;  4OG1 A;  3GF3 A;  5G1R A;  3QK8 A;  3HIN A;  1Q51 A;  3Q0J A;  3QXI A;  3M6N A;  1TYF A;  3PEA A;  4L6W A;  3ZWA A;  3BF0 A;  3KTH A;  3PZK A;  2PPY A;  5ING A; 
#chains in the Genus database with same CATH topology
 3O4X E;  2FW2 A;  3TVU A;  3WG5 A;  3OME A;  1UYT A;  4RYF A;  1UYV A;  3VIV A;  3H0Q A;  5INF A;  3ISA A;  1XNW A;  4ELW A;  1O8U A;  3K50 A;  4FN7 A;  3KTI A;  3GKB A;  5DL1 A;  4EML A;  2Q35 A;  1OD4 A;  4JCR A;  4KNP A;  3L8I A;  3KTJ A;  4FNB A;  3ADD A;  3TLF A;  1VRG A;  1XO6 A;  5INI A;  4ELX A;  4J2U A;  4RYF H;  4ELS A;  2A7K A;  2J5G D;  4U18 A;  4DI1 A;  3SLL A;  4ZDE A;  5KDR A;  4MXI A;  1WZ8 A;  2J5I I;  1N6D A;  5G1S A;  1EF9 A;  3M6M A;  3LAO A;  4I52 A;  1PIX A;  3KQF A;  1RJN A;  1Q52 A;  3K8X A;  1FCF A;  5KJP A;  3I47 A;  3TRR A;  5C90 A;  3PE8 A;  3T8B A;  1W2X A;  2CE3 A;  3OC7 A;  4Q1I A;  3MYB A;  3T88 A;  2EJ5 A;  5DUF A;  2HW5 A;  4JWV A;  4IZD A;  5HUQ A;  3A4L A;  5G1Q A;  3STA A;  5FUS A;  4U0G A;  3PGQ A;  2NP9 A;  2F6I A;  3NJD A;  3DJA A;  2QQ3 A;  2X24 A;  2FZS A;  1UX4 A;  3U9R B;  3RQF A;  4B3I A;  2VSS A;  4HC8 A;  5FIF A;  1DCI A;  3IAV A;  4MI2 A;  4WZ8 B;  5CTB A;  3TT6 A;  5E0N X;  1FC9 A;  1JXZ A;  1EF8 A;  4HNK A;  3QXZ A;  4U0G H;  1FC7 A;  4MOU A;  3Q1T A;  5MGB A;  5DU4 A;  2CBY A;  4JCT A;  3FF6 A;  4KPK A;  2Q34 A;  2FBM A;  3T3W A;  2ZL2 A;  5JBW A;  3A4N A;  1DUB A;  2PBP A;  1J7X A;  3QMJ A;  3ZW9 A;  2ZL4 A;  3FDU A;  3QWD A;  3TDC A;  5KDR B;  4ZDB A;  4JVT A;  3QYR A;  1Y64 B;  2F9I B;  3H81 A;  3AM1 A;  3RQG A;  3T89 A;  1SG4 A;  3TT7 A;  3R9Q A;  5DZK H;  2VSU A;  3OT6 A;  2F9I A;  1UYR A;  4L8K A;  3T8A A;  3LKE A;  3TZ3 A;  4GM2 A;  3NJB A;  4U0H A;  4QFE A;  4LK5 A;  4FJW D;  3IB9 A;  3W8I B;  3RQE A;  1NZY B;  4QIJ A;  3ST9 A;  4B3J A;  5JBX A;  4JOT A;  3BPT A;  1WDM A;  3MFM A;  3BPP A;  5DTW A;  2UZF A;  5DZK A;  3H0J A;  3QKA A;  3N6R B;  4OMR A;  1RJM A;  1N6E A;  2IEX A;  1YG8 A;  4GHN A;  5DKP A;  4EMP A;  1YG6 A;  2VSU E;  2VSS E;  2F9Y B;  5DU6 A;  2VX2 A;  2VSS F;  1XX4 A;  3IRB A;  1HNU A;  3P5M A;  5DU8 A;  3JU1 A;  4ZDC A;  3A4M A;  3L8J A;  2BZR A;  1X0U A;  5E0S H;  4K2N A;  3HRX A;  4B3H A;  2C8T A;  3Q7H A;  3SWX A;  4KD6 A;  3DOR A;  4OLQ A;  3R9T A;  3MT6 A;  1PJH A;  4NEK A;  3H0S A;  1ON9 A;  2ZL0 A;  2D3T A;  4WCZ A;  4ZDD A;  2X58 A;  3ZWB A;  4I4Z A;  2A7S A;  4JYL A;  4KWB A;  4JFC A;  2PG8 A;  4U1A A;  2A81 A;  2J5G A;  4EMM A;  1FC6 A;  1HZD A;  4FZW A;  1Y7O A;  4WYO B;  3HP0 A;  5DTP A;  4JYJ A;  2VRE A;  3RRV A;  1NZY A;  1MJ3 A;  3HE2 A;  4U19 A;  1XNV A;  2J5S A;  3V5I A;  2ZQQ A;  3P2L A;  1UX5 A;  3RST A;  4QII A;  3H02 A;  4JSB A;  1OD2 A;  2DUB A;  4RCN A;  5C9G A;  1HNO A;  4JCQ A;  4IZC A;  1N6F A;  4K3W A;  3W8H B;  4I42 A;  1TG6 A;  5IKL B;  4FN8 A;  4IZB A;  3P85 A;  4F47 A;  3KTG A;  2VSU F;  5DUC A;  2ZL3 A;  2Q2X A;  4YLH A;  3H0U A;  4ASI A;  3GMA A;  4ZDF A;  2DEO A;  3AJM A;  3QRE A;  3R6H A;  3GF7 A;  2F9Y A;  3L3S A;  4JCS A;  2GTR A;  3U9S B;  3GLM A;  3U9T B;  3ADC A;  2ZQR A;  3RSI A;  4ZU2 A;  4K29 A;  4FND A;  3ZWC A;  3Q0G A;  2VSU C;  3ZW8 A;  3BEZ A;  1K32 A;  3KTK A;  1EY3 A;  3MOY A;  1WDK A;  1K39 A;  2WTB A;  1ON3 A;  3IBB A;  1UYS A;  4NAR A;  2YJG A;  4NNQ A;  2J5I A;  4Q0G A;  4FZW C;  5CTC A;  5E0S A;  3TV5 A;  4FB8 A;  3R0O A;  4Z0M A;  2J5I B;  3TVW A;  3V5E A;  1WDL A;  1SZO A;  4JJT A;  4G2R A;  1XNY A;  3R9S A;  2F6Q A;  3G64 A;  2W3P A;  1UIY A;  3HLN 1;  4OG1 A;  3GF3 A;  5G1R A;  3QK8 A;  3HIN A;  4GEH B;  1Q51 A;  3Q0J A;  3QXI A;  3M6N A;  1TYF A;  3PEA A;  4L6W A;  3ZWA A;  3BF0 A;  3ADB A;  4HDT A;  3KTH A;  3PZK A;  2PPY A;  2P63 A;  5ING A; 
#chains in the Genus database with same CATH homology
 2FW2 A;  3TVU A;  3WG5 A;  3OME A;  1UYT A;  4RYF A;  1UYV A;  3VIV A;  3H0Q A;  5INF A;  3ISA A;  1XNW A;  4ELW A;  1O8U A;  3K50 A;  4FN7 A;  3KTI A;  3GKB A;  5DL1 A;  4EML A;  2Q35 A;  1OD4 A;  4JCR A;  4KNP A;  4FNB A;  3KTJ A;  3TLF A;  1VRG A;  1XO6 A;  5INI A;  4ELX A;  4J2U A;  4RYF H;  4ELS A;  2A7K A;  2J5G D;  4U18 A;  4DI1 A;  3SLL A;  4ZDE A;  5KDR A;  4MXI A;  1WZ8 A;  2J5I I;  1N6D A;  5G1S A;  1EF9 A;  3M6M A;  3LAO A;  4I52 A;  1PIX A;  3KQF A;  1RJN A;  1Q52 A;  3K8X A;  1FCF A;  5KJP A;  3I47 A;  3TRR A;  5C90 A;  3PE8 A;  3T8B A;  1W2X A;  2CE3 A;  3OC7 A;  4Q1I A;  3MYB A;  3T88 A;  2EJ5 A;  5DUF A;  2HW5 A;  4JWV A;  4IZD A;  5HUQ A;  5G1Q A;  3STA A;  5FUS A;  4U0G A;  3PGQ A;  2NP9 A;  2F6I A;  3NJD A;  3DJA A;  2QQ3 A;  2X24 A;  2FZS A;  3U9R B;  4B3I A;  2VSS A;  4HC8 A;  5FIF A;  1DCI A;  3IAV A;  4MI2 A;  4WZ8 B;  5CTB A;  3TT6 A;  5E0N X;  1FC9 A;  1JXZ A;  1EF8 A;  4HNK A;  3QXZ A;  4U0G H;  1FC7 A;  4MOU A;  3Q1T A;  5MGB A;  5DU4 A;  2CBY A;  4JCT A;  3FF6 A;  4KPK A;  2Q34 A;  2FBM A;  3T3W A;  2ZL2 A;  5JBW A;  1DUB A;  2PBP A;  1J7X A;  3QMJ A;  3ZW9 A;  2ZL4 A;  3FDU A;  3QWD A;  3TDC A;  5KDR B;  4ZDB A;  4JVT A;  3QYR A;  2F9I B;  3H81 A;  3T89 A;  1SG4 A;  3TT7 A;  3R9Q A;  5DZK H;  2VSU A;  3OT6 A;  2F9I A;  1UYR A;  4L8K A;  3T8A A;  3LKE A;  3TZ3 A;  4GM2 A;  3NJB A;  4U0H A;  4QFE A;  4LK5 A;  4FJW D;  3IB9 A;  1NZY B;  4QIJ A;  3ST9 A;  4B3J A;  5JBX A;  4JOT A;  3BPT A;  1WDM A;  3MFM A;  3BPP A;  5DTW A;  2UZF A;  5DZK A;  3H0J A;  3QKA A;  3N6R B;  4OMR A;  1RJM A;  1N6E A;  2IEX A;  1YG8 A;  4GHN A;  5DKP A;  4EMP A;  1YG6 A;  2VSU E;  2VSS E;  2F9Y B;  5DU6 A;  2VX2 A;  2VSS F;  1XX4 A;  1HNU A;  3P5M A;  5DU8 A;  3JU1 A;  4ZDC A;  2BZR A;  1X0U A;  5E0S H;  4K2N A;  3HRX A;  4B3H A;  2C8T A;  3Q7H A;  3SWX A;  4KD6 A;  3DOR A;  4OLQ A;  3R9T A;  3MT6 A;  1PJH A;  4NEK A;  3H0S A;  1ON9 A;  2ZL0 A;  2D3T A;  4WCZ A;  4ZDD A;  2X58 A;  3ZWB A;  4I4Z A;  2A7S A;  4JYL A;  4KWB A;  4JFC A;  2PG8 A;  4U1A A;  2A81 A;  2J5G A;  4EMM A;  1FC6 A;  1HZD A;  4FZW A;  1Y7O A;  4WYO B;  3HP0 A;  5DTP A;  4JYJ A;  2VRE A;  3RRV A;  1NZY A;  1MJ3 A;  3HE2 A;  4U19 A;  1XNV A;  2J5S A;  3V5I A;  2ZQQ A;  3P2L A;  3RST A;  4QII A;  3H02 A;  4JSB A;  1OD2 A;  2DUB A;  4RCN A;  5C9G A;  1HNO A;  4JCQ A;  4IZC A;  1N6F A;  4K3W A;  4I42 A;  1TG6 A;  5IKL B;  4FN8 A;  4IZB A;  3P85 A;  4F47 A;  3KTG A;  2VSU F;  5DUC A;  2ZL3 A;  2Q2X A;  4YLH A;  3H0U A;  4ASI A;  3GMA A;  4ZDF A;  2DEO A;  3QRE A;  3R6H A;  3GF7 A;  2F9Y A;  3L3S A;  4JCS A;  2GTR A;  3U9S B;  3GLM A;  3U9T B;  2ZQR A;  3RSI A;  4ZU2 A;  4K29 A;  4FND A;  3ZWC A;  3Q0G A;  2VSU C;  3ZW8 A;  3BEZ A;  1K32 A;  3KTK A;  1EY3 A;  3MOY A;  1WDK A;  1K39 A;  2WTB A;  1ON3 A;  3IBB A;  1UYS A;  4NAR A;  2YJG A;  4NNQ A;  2J5I A;  4Q0G A;  4FZW C;  5CTC A;  5E0S A;  3TV5 A;  4FB8 A;  3R0O A;  4Z0M A;  2J5I B;  3TVW A;  3V5E A;  1WDL A;  1SZO A;  4JJT A;  4G2R A;  1XNY A;  3R9S A;  2F6Q A;  3G64 A;  2W3P A;  1UIY A;  3HLN 1;  4OG1 A;  3GF3 A;  5G1R A;  3QK8 A;  3HIN A;  1Q51 A;  3Q0J A;  3QXI A;  3M6N A;  1TYF A;  3PEA A;  4L6W A;  3ZWA A;  3BF0 A;  4HDT A;  3KTH A;  3PZK A;  2PPY A;  5ING A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...