4EMMA

Crystal structure of staphylococcus aureus clpp in compact conformation
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
189
structure length
173
Chain Sequence
IPTVIERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEVMIHQPLEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Helix unfolding/refolding characterizes the functional dynamics of Staphylococcus aureus Clp protease
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 62
structure length 173
sequence length 189
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, V
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4emmA00
2X24A 3LAOA 1UYRA 3U9RB 3JU1A 3G64A 5DZKA 1YG8A 2ZL3A 4U0GA 5G1QA 1K39A 4IZDA 4MXIA 4JCTA 3PZKA 5E0SA 4ELXA 4JYJA 5E0NX 4ZDFA 5C9GA 4RYFA 3H0SA 5MGBA 3ZWAA 4KNPA 4WYOB 1FC6A 1UYVA 3H02A 1UIYA 5CTBA 1HZDA 3GKBA 3U9TB 2ZL4A 4U1AA 3OT6A 3PGQA 3QK8A 1JXZA 1WDMA 4JCQA 2ZL2A 3R9TA 2J5IA 3KTKA 1VRGA 3HE2A 4FZWC 3U9SB 1SG4A 3IAVA 3TDCA 5C90A 4DI1A 3T8BA 2D3TA 3Q7HA 3QMJA 3ZWCA 2ZQRA 2VSSE 4U0HA 2DUBA 3OC7A 3RSIA 1RJNA 2J5IB 2FW2A 2PG8A 2F9IA 2X58A 2A7KA 3KTIA 1WZ8A 4ASIA 3R6HA 4QIJA 2VSSF 4I4ZA 4LK5A 3ISAA 5INFA 2J5GA 4KWBA 3KTHA 4K3WA 4EMLA 1NZYB 1WDKA 3MYBA 2VSUF 3HINA 3DORA 3ZWBA 4FN7A 3T8AA 4JWVA 4OLQA 2HW5A 1UYSA 3BEZA 2F6IA 4L6WA 4ELSA 4RCNA 1HNUA 3T89A 4ZDEA 2J5II 1N6FA 3ST9A 4G2RA 3RSTA 3HRXA 1SZOA 3K50A 3TVWA 2ZQQA 4ZDBA 1N6DA 3QKAA 4GHNA 4GM2A 2CBYA 3PE8A 4IZCA 3TLFA 2C8TA 1OD4A 1ON3A 4JVTA 4JSBA 3KQFA 3H0JA 1RJMA 3BPPA 3ZW8A 4RYFH 1UYTA 2EJ5A 4U18A 3HP0A 4FJWD 4JFCA 3IB9A 4B3JA 3H0QA 3R9QA 4HNKA 4I52A 4JOTA 3WG5A 5KDRA 3TVUA 3L3SA 5G1SA 4U0GH 2F9YA 2GTRA 4EMMA 1OD2A 3I47A 2Q2XA 2VSUA 4B3HA 5KJPA 5DU4A 1N6EA 3GLMA 1WDLA 3TRRA 5FIFA 3GF7A 2CE3A 2WTBA 1XNVA 3R9SA 4OG1A 3QXIA 5DUCA 1XNWA 5DKPA 4HC8A 3K8XA 4Q0GA 5DTPA 2Q34A 5G1RA 1XNYA 3FDUA 1Q52A 3KTJA 3HLN1 5DU6A 4EMPA 1EF8A 1X0UA 3N6RB 4I42A 3SLLA 1PJHA 1ON9A 4K2NA 5JBXA 3TZ3A 4Q1IA 2J5SA 3Q0GA 4JJTA 3QREA 2W3PA 3P85A 4NEKA 1MJ3A 3H0UA 3Q1TA 4KD6A 3TT7A 3QWDA 4WZ8B 5DL1A 4ZU2A 4K29A 4MOUA 4FN8A 1FC9A 4JYLA 2FZSA 4FZWA 2BZRA 2NP9A 3M6MA 2QQ3A 1FC7A 3FF6A 5IKLB 3QXZA 2A7SA 3BF0A 4ZDDA 2UZFA 5KDRB 1HNOA 2VREA 4YLHA 3TT6A 1PIXA 3P5MA 1NZYA 4OMRA 3NJDA 2ZL0A 4NNQA 3KTGA 3OMEA 4ELWA 3MFMA 5INIA 5FUSA 5DUFA 3QYRA 3P2LA 3NJBA 3T88A 3SWXA 2DEOA 1XX4A 4ZDCA 1J7XA 1EF9A 1XO6A 2Q35A 4B3IA 4QFEA 4L8KA 1EY3A 1DCIA 3M6NA 4KPKA 4F47A 2VX2A 4JCSA 2VSUE 1Q51A 3GF3A 3H81A 1Y7OA 2F6QA 4IZBA 2F9YB 2VSSA 4Z0MA 5JBWA 3GMAA 3VIVA 4MI2A 2FBMA 2IEXA 3ZW9A 5E0SH 5CTCA 1FCFA 5DU8A 3TV5A 1DUBA 3R0OA 4U19A 5DZKH 5DTWA 1TYFA 3DJAA 3RRVA 3MOYA 3T3WA 2A81A 3MT6A 2PBPA 3STAA 1O8UA 2VSUC 3IBBA 1K32A 4FNDA 2J5GD 2F9IB 5INGA 3V5IA 3PEAA 4FB8A 2PPYA 1TG6A 4QIIA 4JCRA 3Q0JA 3V5EA 1W2XA 3LKEA 4FNBA 1YG6A 4WCZA
chains in the Genus database with same CATH superfamily
2X24A 3LAOA 1UYRA 3U9RB 3JU1A 3G64A 5DZKA 1YG8A 2ZL3A 4U0GA 5G1QA 1K39A 4IZDA 4MXIA 4JCTA 3PZKA 5E0SA 4ELXA 4JYJA 5E0NX 4ZDFA 5C9GA 4RYFA 3H0SA 5MGBA 3ZWAA 4KNPA 4WYOB 1FC6A 1UYVA 3H02A 1UIYA 5CTBA 1HZDA 3GKBA 3U9TB 2ZL4A 4U1AA 3OT6A 3PGQA 3QK8A 1JXZA 1WDMA 4JCQA 2ZL2A 3R9TA 2J5IA 3KTKA 1VRGA 3HE2A 4FZWC 3U9SB 1SG4A 3IAVA 3TDCA 5C90A 4DI1A 3T8BA 2D3TA 3Q7HA 3QMJA 3ZWCA 2ZQRA 2VSSE 4U0HA 2DUBA 3OC7A 3RSIA 1RJNA 2J5IB 2FW2A 2PG8A 2F9IA 2X58A 2A7KA 3KTIA 1WZ8A 4ASIA 3R6HA 4QIJA 2VSSF 4I4ZA 4LK5A 3ISAA 5INFA 2J5GA 4KWBA 3KTHA 4K3WA 4EMLA 1NZYB 1WDKA 3MYBA 2VSUF 3HINA 3DORA 3ZWBA 4FN7A 3T8AA 4JWVA 4OLQA 2HW5A 1UYSA 3BEZA 2F6IA 4L6WA 4ELSA 4RCNA 1HNUA 3T89A 4ZDEA 2J5II 1N6FA 3ST9A 4G2RA 3RSTA 3HRXA 1SZOA 3K50A 3TVWA 2ZQQA 4ZDBA 1N6DA 3QKAA 3BPTA 4GHNA 4GM2A 2CBYA 3PE8A 4IZCA 3TLFA 2C8TA 1OD4A 1ON3A 4JVTA 4JSBA 3KQFA 3H0JA 1RJMA 3BPPA 3ZW8A 4RYFH 1UYTA 2EJ5A 4U18A 3HP0A 4FJWD 4JFCA 3IB9A 4B3JA 3H0QA 3R9QA 4HNKA 4I52A 4JOTA 3WG5A 5KDRA 3TVUA 3L3SA 5G1SA 4U0GH 2F9YA 2GTRA 4EMMA 1OD2A 3I47A 2Q2XA 2VSUA 4B3HA 5KJPA 5DU4A 1N6EA 3GLMA 1WDLA 3TRRA 5FIFA 3GF7A 2CE3A 2WTBA 1XNVA 3R9SA 4OG1A 3QXIA 5DUCA 1XNWA 5DKPA 4HC8A 3K8XA 4Q0GA 5DTPA 2Q34A 5G1RA 1XNYA 3FDUA 1Q52A 3KTJA 5HUQA 3HLN1 5DU6A 4EMPA 1EF8A 1X0UA 3N6RB 4I42A 3SLLA 1PJHA 1ON9A 4K2NA 5JBXA 3TZ3A 4Q1IA 2J5SA 3Q0GA 4JJTA 3QREA 2W3PA 3P85A 4NEKA 1MJ3A 3H0UA 3Q1TA 4KD6A 3TT7A 4J2UA 3QWDA 4WZ8B 5DL1A 4ZU2A 4K29A 4MOUA 4FN8A 1FC9A 4JYLA 2FZSA 4FZWA 2BZRA 2NP9A 3M6MA 2QQ3A 1FC7A 3FF6A 5IKLB 3QXZA 2A7SA 3BF0A 4ZDDA 2UZFA 5KDRB 1HNOA 2VREA 4YLHA 3TT6A 1PIXA 3P5MA 1NZYA 4OMRA 3NJDA 2ZL0A 4NNQA 3KTGA 3OMEA 4ELWA 3MFMA 5INIA 5FUSA 5DUFA 3QYRA 3P2LA 3NJBA 3T88A 3SWXA 2DEOA 1XX4A 4ZDCA 1J7XA 1EF9A 1XO6A 2Q35A 4B3IA 4QFEA 4L8KA 1EY3A 1DCIA 3M6NA 4KPKA 4F47A 4NARA 2VX2A 4JCSA 2VSUE 1Q51A 3GF3A 3H81A 1Y7OA 2F6QA 4IZBA 2F9YB 2VSSA 4Z0MA 5JBWA 3GMAA 3VIVA 4MI2A 2FBMA 2IEXA 3ZW9A 5E0SH 5CTCA 1FCFA 5DU8A 3TV5A 1DUBA 3R0OA 4U19A 5DZKH 5DTWA 1TYFA 3DJAA 3RRVA 3MOYA 4HDTA 3T3WA 2A81A 3MT6A 2PBPA 3STAA 1O8UA 2VSUC 3IBBA 1K32A 2YJGA 4FNDA 2J5GD 2F9IB 5INGA 3V5IA 3PEAA 4FB8A 2PPYA 1TG6A 4QIIA 4JCRA 3Q0JA 3V5EA 1W2XA 3LKEA 4FNBA 1YG6A 4WCZA
chains in the Genus database with same CATH topology
2X24A 3LAOA 1UYRA 3U9RB 3JU1A 3G64A 5DZKA 1YG8A 2ZL3A 4U0GA 5G1QA 1K39A 4IZDA 4MXIA 4JCTA 3PZKA 5E0SA 4ELXA 4JYJA 5E0NX 4ZDFA 5C9GA 4RYFA 3H0SA 5MGBA 3ZWAA 4KNPA 4WYOB 1FC6A 1UYVA 3H02A 1UIYA 5CTBA 1HZDA 3GKBA 3U9TB 2ZL4A 4U1AA 3OT6A 3PGQA 3QK8A 1JXZA 1WDMA 4JCQA 2ZL2A 3R9TA 2J5IA 3KTKA 1VRGA 3HE2A 4FZWC 3U9SB 1SG4A 3IAVA 3TDCA 5C90A 4DI1A 3T8BA 2D3TA 3Q7HA 3QMJA 3ZWCA 2ZQRA 2VSSE 4U0HA 2DUBA 3OC7A 3RSIA 1RJNA 2J5IB 2FW2A 2PG8A 2F9IA 2X58A 2A7KA 3KTIA 1WZ8A 4ASIA 3R6HA 4QIJA 2VSSF 4I4ZA 4LK5A 3ISAA 5INFA 2J5GA 4KWBA 3KTHA 4K3WA 4EMLA 1NZYB 1WDKA 3MYBA 2VSUF 3HINA 3DORA 3ZWBA 4FN7A 3T8AA 4JWVA 4OLQA 2HW5A 1UYSA 3BEZA 2F6IA 4L6WA 4ELSA 4RCNA 1HNUA 3T89A 4ZDEA 2J5II 1N6FA 3ST9A 4G2RA 3RSTA 3HRXA 1SZOA 3K50A 3TVWA 2ZQQA 4ZDBA 1N6DA 3QKAA 3BPTA 4GHNA 4GM2A 2CBYA 3PE8A 4IZCA 3TLFA 2C8TA 1OD4A 1ON3A 4JVTA 4JSBA 3KQFA 3H0JA 1RJMA 3BPPA 3ZW8A 4RYFH 1UYTA 2EJ5A 4U18A 3HP0A 4FJWD 4JFCA 3IB9A 4B3JA 3H0QA 3R9QA 4HNKA 4I52A 4JOTA 3WG5A 5KDRA 3TVUA 3L3SA 5G1SA 4U0GH 2F9YA 2GTRA 4EMMA 1OD2A 3I47A 2Q2XA 2VSUA 4B3HA 5KJPA 5DU4A 1N6EA 3GLMA 1WDLA 3TRRA 5FIFA 3GF7A 2CE3A 2WTBA 1XNVA 3R9SA 4OG1A 3QXIA 5DUCA 1XNWA 5DKPA 4HC8A 3K8XA 4Q0GA 5DTPA 2Q34A 5G1RA 1XNYA 3FDUA 1Q52A 3KTJA 5HUQA 3HLN1 5DU6A 4EMPA 1EF8A 1X0UA 3N6RB 4I42A 3SLLA 1PJHA 1ON9A 4K2NA 5JBXA 3TZ3A 4Q1IA 2J5SA 3Q0GA 4JJTA 3QREA 2W3PA 3P85A 4NEKA 1MJ3A 3H0UA 3Q1TA 4KD6A 3TT7A 4J2UA 3QWDA 4WZ8B 5DL1A 4ZU2A 4K29A 4MOUA 4FN8A 1FC9A 4JYLA 2FZSA 4FZWA 2BZRA 2NP9A 3M6MA 2QQ3A 1FC7A 3FF6A 5IKLB 3QXZA 2A7SA 3BF0A 4ZDDA 2UZFA 5KDRB 1HNOA 2VREA 4YLHA 3TT6A 1PIXA 3P5MA 1NZYA 4OMRA 3NJDA 2ZL0A 4NNQA 3KTGA 3OMEA 4ELWA 3MFMA 5INIA 5FUSA 5DUFA 3QYRA 3P2LA 3NJBA 3T88A 3SWXA 2DEOA 1XX4A 4ZDCA 1J7XA 1EF9A 1XO6A 2Q35A 4B3IA 4QFEA 4L8KA 1EY3A 1DCIA 3M6NA 4KPKA 4F47A 4NARA 2VX2A 4JCSA 2VSUE 1Q51A 3GF3A 3H81A 1Y7OA 2F6QA 4IZBA 2F9YB 2VSSA 4Z0MA 5JBWA 3GMAA 3VIVA 4MI2A 2FBMA 2IEXA 3ZW9A 5E0SH 5CTCA 1FCFA 5DU8A 3TV5A 1DUBA 3R0OA 4U19A 5DZKH 5DTWA 1TYFA 3DJAA 3RRVA 3MOYA 4HDTA 3T3WA 2A81A 3MT6A 2PBPA 3STAA 1O8UA 2VSUC 3IBBA 1K32A 2YJGA 4FNDA 2J5GD 2F9IB 5INGA 3V5IA 3PEAA 4FB8A 2PPYA 1TG6A 4QIIA 4JCRA 3Q0JA 3V5EA 1W2XA 3LKEA 4FNBA 1YG6A 4WCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X24 A;  3LAO A;  1UYR A;  3U9R B;  3JU1 A;  3G64 A;  5DZK A;  1YG8 A;  2ZL3 A;  4U0G A;  5G1Q A;  1K39 A;  4IZD A;  4MXI A;  4JCT A;  3PZK A;  5E0S A;  4ELX A;  4JYJ A;  5E0N X;  4ZDF A;  5C9G A;  4RYF A;  3H0S A;  5MGB A;  3ZWA A;  4KNP A;  4WYO B;  1FC6 A;  1UYV A;  3H02 A;  1UIY A;  5CTB A;  1HZD A;  3GKB A;  3U9T B;  2ZL4 A;  4U1A A;  3OT6 A;  3PGQ A;  3QK8 A;  1JXZ A;  1WDM A;  4JCQ A;  2ZL2 A;  3R9T A;  2J5I A;  3KTK A;  1VRG A;  3HE2 A;  4FZW C;  3U9S B;  1SG4 A;  3IAV A;  3TDC A;  5C90 A;  4DI1 A;  3T8B A;  2D3T A;  3Q7H A;  3QMJ A;  3ZWC A;  2ZQR A;  2VSS E;  4U0H A;  2DUB A;  3OC7 A;  3RSI A;  1RJN A;  2J5I B;  2FW2 A;  2PG8 A;  2F9I A;  2X58 A;  2A7K A;  3KTI A;  1WZ8 A;  4ASI A;  3R6H A;  4QIJ A;  2VSS F;  4I4Z A;  4LK5 A;  3ISA A;  5INF A;  2J5G A;  4KWB A;  3KTH A;  4K3W A;  4EML A;  1NZY B;  1WDK A;  3MYB A;  2VSU F;  3HIN A;  3DOR A;  3ZWB A;  4FN7 A;  3T8A A;  4JWV A;  4OLQ A;  2HW5 A;  1UYS A;  3BEZ A;  2F6I A;  4L6W A;  4ELS A;  4RCN A;  1HNU A;  3T89 A;  4ZDE A;  2J5I I;  1N6F A;  3ST9 A;  4G2R A;  3RST A;  3HRX A;  1SZO A;  3K50 A;  3TVW A;  2ZQQ A;  4ZDB A;  1N6D A;  3QKA A;  4GHN A;  4GM2 A;  2CBY A;  3PE8 A;  4IZC A;  3TLF A;  2C8T A;  1OD4 A;  1ON3 A;  4JVT A;  4JSB A;  3KQF A;  3H0J A;  1RJM A;  3BPP A;  3ZW8 A;  4RYF H;  1UYT A;  2EJ5 A;  4U18 A;  3HP0 A;  4FJW D;  4JFC A;  3IB9 A;  4B3J A;  3H0Q A;  3R9Q A;  4HNK A;  4I52 A;  4JOT A;  3WG5 A;  5KDR A;  3TVU A;  3L3S A;  5G1S A;  4U0G H;  2F9Y A;  2GTR A;  4EMM A;  1OD2 A;  3I47 A;  2Q2X A;  2VSU A;  4B3H A;  5KJP A;  5DU4 A;  1N6E A;  3GLM A;  1WDL A;  3TRR A;  5FIF A;  3GF7 A;  2CE3 A;  2WTB A;  1XNV A;  3R9S A;  4OG1 A;  3QXI A;  5DUC A;  1XNW A;  5DKP A;  4HC8 A;  3K8X A;  4Q0G A;  5DTP A;  2Q34 A;  5G1R A;  1XNY A;  3FDU A;  1Q52 A;  3KTJ A;  3HLN 1;  5DU6 A;  4EMP A;  1EF8 A;  1X0U A;  3N6R B;  4I42 A;  3SLL A;  1PJH A;  1ON9 A;  4K2N A;  5JBX A;  3TZ3 A;  4Q1I A;  2J5S A;  3Q0G A;  4JJT A;  3QRE A;  2W3P A;  3P85 A;  4NEK A;  1MJ3 A;  3H0U A;  3Q1T A;  4KD6 A;  3TT7 A;  3QWD A;  4WZ8 B;  5DL1 A;  4ZU2 A;  4K29 A;  4MOU A;  4FN8 A;  1FC9 A;  4JYL A;  2FZS A;  4FZW A;  2BZR A;  2NP9 A;  3M6M A;  2QQ3 A;  1FC7 A;  3FF6 A;  5IKL B;  3QXZ A;  2A7S A;  3BF0 A;  4ZDD A;  2UZF A;  5KDR B;  1HNO A;  2VRE A;  4YLH A;  3TT6 A;  1PIX A;  3P5M A;  1NZY A;  4OMR A;  3NJD A;  2ZL0 A;  4NNQ A;  3KTG A;  3OME A;  4ELW A;  3MFM A;  5INI A;  5FUS A;  5DUF A;  3QYR A;  3P2L A;  3NJB A;  3T88 A;  3SWX A;  2DEO A;  1XX4 A;  4ZDC A;  1J7X A;  1EF9 A;  1XO6 A;  2Q35 A;  4B3I A;  4QFE A;  4L8K A;  1EY3 A;  1DCI A;  3M6N A;  4KPK A;  4F47 A;  2VX2 A;  4JCS A;  2VSU E;  1Q51 A;  3GF3 A;  3H81 A;  1Y7O A;  2F6Q A;  4IZB A;  2F9Y B;  2VSS A;  4Z0M A;  5JBW A;  3GMA A;  3VIV A;  4MI2 A;  2FBM A;  2IEX A;  3ZW9 A;  5E0S H;  5CTC A;  1FCF A;  5DU8 A;  3TV5 A;  1DUB A;  3R0O A;  4U19 A;  5DZK H;  5DTW A;  1TYF A;  3DJA A;  3RRV A;  3MOY A;  3T3W A;  2A81 A;  3MT6 A;  2PBP A;  3STA A;  1O8U A;  2VSU C;  3IBB A;  1K32 A;  4FND A;  2J5G D;  2F9I B;  5ING A;  3V5I A;  3PEA A;  4FB8 A;  2PPY A;  1TG6 A;  4QII A;  4JCR A;  3Q0J A;  3V5E A;  1W2X A;  3LKE A;  4FNB A;  1YG6 A;  4WCZ A; 
#chains in the Genus database with same CATH topology
 2X24 A;  3LAO A;  1UYR A;  3U9R B;  3JU1 A;  3G64 A;  5DZK A;  1YG8 A;  2ZL3 A;  4U0G A;  5G1Q A;  1K39 A;  4IZD A;  4MXI A;  4JCT A;  3PZK A;  5E0S A;  4ELX A;  4JYJ A;  5E0N X;  4ZDF A;  5C9G A;  4RYF A;  3H0S A;  5MGB A;  3ZWA A;  4KNP A;  4WYO B;  1FC6 A;  1UYV A;  3H02 A;  1UIY A;  5CTB A;  1HZD A;  3GKB A;  3U9T B;  2ZL4 A;  4U1A A;  3OT6 A;  3PGQ A;  3QK8 A;  1JXZ A;  1WDM A;  4JCQ A;  2ZL2 A;  3R9T A;  2J5I A;  3KTK A;  1VRG A;  3HE2 A;  4FZW C;  3U9S B;  1SG4 A;  3IAV A;  3TDC A;  5C90 A;  4DI1 A;  3T8B A;  2D3T A;  3Q7H A;  3QMJ A;  3ZWC A;  2ZQR A;  2VSS E;  4U0H A;  2DUB A;  3OC7 A;  3RSI A;  1RJN A;  2J5I B;  2FW2 A;  2PG8 A;  2F9I A;  2X58 A;  2A7K A;  3KTI A;  1WZ8 A;  4ASI A;  3R6H A;  4QIJ A;  2VSS F;  4I4Z A;  4LK5 A;  3ISA A;  5INF A;  2J5G A;  4KWB A;  3KTH A;  4K3W A;  4EML A;  1NZY B;  1WDK A;  3MYB A;  2VSU F;  3HIN A;  3DOR A;  3ZWB A;  4FN7 A;  3T8A A;  4JWV A;  4OLQ A;  2HW5 A;  1UYS A;  3BEZ A;  2F6I A;  4L6W A;  4ELS A;  4RCN A;  1HNU A;  3T89 A;  4ZDE A;  2J5I I;  1N6F A;  3ST9 A;  4G2R A;  3RST A;  3HRX A;  1SZO A;  3K50 A;  3TVW A;  2ZQQ A;  4ZDB A;  1N6D A;  3QKA A;  3BPT A;  4GHN A;  4GM2 A;  2CBY A;  3PE8 A;  4IZC A;  3TLF A;  2C8T A;  1OD4 A;  1ON3 A;  4JVT A;  4JSB A;  3KQF A;  3H0J A;  1RJM A;  3BPP A;  3ZW8 A;  4RYF H;  1UYT A;  2EJ5 A;  4U18 A;  3HP0 A;  4FJW D;  4JFC A;  3IB9 A;  4B3J A;  3H0Q A;  3R9Q A;  4HNK A;  4I52 A;  4JOT A;  3WG5 A;  5KDR A;  3TVU A;  3L3S A;  5G1S A;  4U0G H;  2F9Y A;  2GTR A;  4EMM A;  1OD2 A;  3I47 A;  2Q2X A;  2VSU A;  4B3H A;  5KJP A;  5DU4 A;  1N6E A;  3GLM A;  1WDL A;  3TRR A;  5FIF A;  3GF7 A;  2CE3 A;  2WTB A;  1XNV A;  3R9S A;  4OG1 A;  3QXI A;  5DUC A;  1XNW A;  5DKP A;  4HC8 A;  3K8X A;  4Q0G A;  5DTP A;  2Q34 A;  5G1R A;  1XNY A;  3FDU A;  1Q52 A;  3KTJ A;  5HUQ A;  3HLN 1;  5DU6 A;  4EMP A;  1EF8 A;  1X0U A;  3N6R B;  4I42 A;  3SLL A;  1PJH A;  1ON9 A;  4K2N A;  5JBX A;  3TZ3 A;  4Q1I A;  2J5S A;  3Q0G A;  4JJT A;  3QRE A;  2W3P A;  3P85 A;  4NEK A;  1MJ3 A;  3H0U A;  3Q1T A;  4KD6 A;  3TT7 A;  4J2U A;  3QWD A;  4WZ8 B;  5DL1 A;  4ZU2 A;  4K29 A;  4MOU A;  4FN8 A;  1FC9 A;  4JYL A;  2FZS A;  4FZW A;  2BZR A;  2NP9 A;  3M6M A;  2QQ3 A;  1FC7 A;  3FF6 A;  5IKL B;  3QXZ A;  2A7S A;  3BF0 A;  4ZDD A;  2UZF A;  5KDR B;  1HNO A;  2VRE A;  4YLH A;  3TT6 A;  1PIX A;  3P5M A;  1NZY A;  4OMR A;  3NJD A;  2ZL0 A;  4NNQ A;  3KTG A;  3OME A;  4ELW A;  3MFM A;  5INI A;  5FUS A;  5DUF A;  3QYR A;  3P2L A;  3NJB A;  3T88 A;  3SWX A;  2DEO A;  1XX4 A;  4ZDC A;  1J7X A;  1EF9 A;  1XO6 A;  2Q35 A;  4B3I A;  4QFE A;  4L8K A;  1EY3 A;  1DCI A;  3M6N A;  4KPK A;  4F47 A;  4NAR A;  2VX2 A;  4JCS A;  2VSU E;  1Q51 A;  3GF3 A;  3H81 A;  1Y7O A;  2F6Q A;  4IZB A;  2F9Y B;  2VSS A;  4Z0M A;  5JBW A;  3GMA A;  3VIV A;  4MI2 A;  2FBM A;  2IEX A;  3ZW9 A;  5E0S H;  5CTC A;  1FCF A;  5DU8 A;  3TV5 A;  1DUB A;  3R0O A;  4U19 A;  5DZK H;  5DTW A;  1TYF A;  3DJA A;  3RRV A;  3MOY A;  4HDT A;  3T3W A;  2A81 A;  3MT6 A;  2PBP A;  3STA A;  1O8U A;  2VSU C;  3IBB A;  1K32 A;  2YJG A;  4FND A;  2J5G D;  2F9I B;  5ING A;  3V5I A;  3PEA A;  4FB8 A;  2PPY A;  1TG6 A;  4QII A;  4JCR A;  3Q0J A;  3V5E A;  1W2X A;  3LKE A;  4FNB A;  1YG6 A;  4WCZ A; 
#chains in the Genus database with same CATH homology
 2X24 A;  3LAO A;  1UYR A;  3U9R B;  3JU1 A;  3G64 A;  5DZK A;  1YG8 A;  2ZL3 A;  4U0G A;  5G1Q A;  1K39 A;  4IZD A;  4MXI A;  4JCT A;  3PZK A;  5E0S A;  4ELX A;  4JYJ A;  5E0N X;  4ZDF A;  5C9G A;  4RYF A;  3H0S A;  5MGB A;  3ZWA A;  4KNP A;  4WYO B;  1FC6 A;  1UYV A;  3H02 A;  1UIY A;  5CTB A;  1HZD A;  3GKB A;  3U9T B;  2ZL4 A;  4U1A A;  3OT6 A;  3PGQ A;  3QK8 A;  1JXZ A;  1WDM A;  4JCQ A;  2ZL2 A;  3R9T A;  2J5I A;  3KTK A;  1VRG A;  3HE2 A;  4FZW C;  3U9S B;  1SG4 A;  3IAV A;  3TDC A;  5C90 A;  4DI1 A;  3T8B A;  2D3T A;  3Q7H A;  3QMJ A;  3ZWC A;  2ZQR A;  2VSS E;  4U0H A;  2DUB A;  3OC7 A;  3RSI A;  1RJN A;  2J5I B;  2FW2 A;  2PG8 A;  2F9I A;  2X58 A;  2A7K A;  3KTI A;  1WZ8 A;  4ASI A;  3R6H A;  4QIJ A;  2VSS F;  4I4Z A;  4LK5 A;  3ISA A;  5INF A;  2J5G A;  4KWB A;  3KTH A;  4K3W A;  4EML A;  1NZY B;  1WDK A;  3MYB A;  2VSU F;  3HIN A;  3DOR A;  3ZWB A;  4FN7 A;  3T8A A;  4JWV A;  4OLQ A;  2HW5 A;  1UYS A;  3BEZ A;  2F6I A;  4L6W A;  4ELS A;  4RCN A;  1HNU A;  3T89 A;  4ZDE A;  2J5I I;  1N6F A;  3ST9 A;  4G2R A;  3RST A;  3HRX A;  1SZO A;  3K50 A;  3TVW A;  2ZQQ A;  4ZDB A;  1N6D A;  3QKA A;  3BPT A;  4GHN A;  4GM2 A;  2CBY A;  3PE8 A;  4IZC A;  3TLF A;  2C8T A;  1OD4 A;  1ON3 A;  4JVT A;  4JSB A;  3KQF A;  3H0J A;  1RJM A;  3BPP A;  3ZW8 A;  4RYF H;  1UYT A;  2EJ5 A;  4U18 A;  3HP0 A;  4FJW D;  4JFC A;  3IB9 A;  4B3J A;  3H0Q A;  3R9Q A;  4HNK A;  4I52 A;  4JOT A;  3WG5 A;  5KDR A;  3TVU A;  3L3S A;  5G1S A;  4U0G H;  2F9Y A;  2GTR A;  4EMM A;  1OD2 A;  3I47 A;  2Q2X A;  2VSU A;  4B3H A;  5KJP A;  5DU4 A;  1N6E A;  3GLM A;  1WDL A;  3TRR A;  5FIF A;  3GF7 A;  2CE3 A;  2WTB A;  1XNV A;  3R9S A;  4OG1 A;  3QXI A;  5DUC A;  1XNW A;  5DKP A;  4HC8 A;  3K8X A;  4Q0G A;  5DTP A;  2Q34 A;  5G1R A;  1XNY A;  3FDU A;  1Q52 A;  3KTJ A;  5HUQ A;  3HLN 1;  5DU6 A;  4EMP A;  1EF8 A;  1X0U A;  3N6R B;  4I42 A;  3SLL A;  1PJH A;  1ON9 A;  4K2N A;  5JBX A;  3TZ3 A;  4Q1I A;  2J5S A;  3Q0G A;  4JJT A;  3QRE A;  2W3P A;  3P85 A;  4NEK A;  1MJ3 A;  3H0U A;  3Q1T A;  4KD6 A;  3TT7 A;  4J2U A;  3QWD A;  4WZ8 B;  5DL1 A;  4ZU2 A;  4K29 A;  4MOU A;  4FN8 A;  1FC9 A;  4JYL A;  2FZS A;  4FZW A;  2BZR A;  2NP9 A;  3M6M A;  2QQ3 A;  1FC7 A;  3FF6 A;  5IKL B;  3QXZ A;  2A7S A;  3BF0 A;  4ZDD A;  2UZF A;  5KDR B;  1HNO A;  2VRE A;  4YLH A;  3TT6 A;  1PIX A;  3P5M A;  1NZY A;  4OMR A;  3NJD A;  2ZL0 A;  4NNQ A;  3KTG A;  3OME A;  4ELW A;  3MFM A;  5INI A;  5FUS A;  5DUF A;  3QYR A;  3P2L A;  3NJB A;  3T88 A;  3SWX A;  2DEO A;  1XX4 A;  4ZDC A;  1J7X A;  1EF9 A;  1XO6 A;  2Q35 A;  4B3I A;  4QFE A;  4L8K A;  1EY3 A;  1DCI A;  3M6N A;  4KPK A;  4F47 A;  4NAR A;  2VX2 A;  4JCS A;  2VSU E;  1Q51 A;  3GF3 A;  3H81 A;  1Y7O A;  2F6Q A;  4IZB A;  2F9Y B;  2VSS A;  4Z0M A;  5JBW A;  3GMA A;  3VIV A;  4MI2 A;  2FBM A;  2IEX A;  3ZW9 A;  5E0S H;  5CTC A;  1FCF A;  5DU8 A;  3TV5 A;  1DUB A;  3R0O A;  4U19 A;  5DZK H;  5DTW A;  1TYF A;  3DJA A;  3RRV A;  3MOY A;  4HDT A;  3T3W A;  2A81 A;  3MT6 A;  2PBP A;  3STA A;  1O8U A;  2VSU C;  3IBB A;  1K32 A;  2YJG A;  4FND A;  2J5G D;  2F9I B;  5ING A;  3V5I A;  3PEA A;  4FB8 A;  2PPY A;  1TG6 A;  4QII A;  4JCR A;  3Q0J A;  3V5E A;  1W2X A;  3LKE A;  4FNB A;  1YG6 A;  4WCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...