4EMMA

Crystal structure of staphylococcus aureus clpp in compact conformation
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
189
structure length
173
Chain Sequence
b'IPTVIERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEVMIHQPLEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title Helix unfolding/refolding characterizes the functional dynamics of Staphylococcus aureus Clp protease
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 62
structure length 173
sequence length 189
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, V
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4emmA00
4FN8A 3L3SA 4U0GA 4EMMA 3R9TA 4GHNA 1N6FA 3M6NA 2WTBA 3TLFA 5DZKA 4EMLA 3T89A 1WDKA 1Q52A 3GF7A 3TV5A 2CE3A 1JXZA 3IBBA 4U18A 2Q2XA 2ZL3A 1TG6A 3QK8A 3M6MA 3QXZA 3FF6A 1YG8A 3N6RB 3GKBA 4U19A 4OLQA 2J5II 3H0JA 4RYFH 3ZW9A 3TVUA 5CTBA 3FDUA 4MI2A 4ELSA 2F9IA 2DUBA 1YG6A 1TYFA 5INFA 4HNKA 5G1RA 2FBMA 4B3HA 4RYFA 5DKPA 4ZU2A 3P2LA 4I4ZA 2FW2A 3NJDA 4FZWC 3KTGA 3Q0GA 1UYSA 4Q0GA 2F6QA 2IEXA 1WDMA 4JOTA 2J5SA 1FC9A 2X58A 5DTPA 3T3WA 3PZKA 1SZOA 3KTHA 1EY3A 3QKAA 2VSUC 5IKLB 4QIIA 4ZDCA 1UIYA 2F9IB 3OMEA 4WYOB 3VIVA 3KQFA 4OMRA 1XNWA 2ZQRA 2GTRA 3T88A 2C8TA 1RJMA 5JBXA 4NNQA 3NJBA 5KDRA 3IAVA 4ZDBA 4ZDDA 1VRGA 2QQ3A 1UYTA 3TT7A 1ON3A 4NEKA 5INIA 4JCQA 3ZWBA 3MFMA 4IZDA 1XNVA 2VSSE 3BPPA 2J5IA 4ZDEA 1PJHA 3KTIA 4Z0MA 2VX2A 3BEZA 4YLHA 3PGQA 2A81A 4GM2A 1ON9A 4ASIA 1OD4A 1J7XA 2VSSA 5FIFA 5DU4A 4B3IA 2Q35A 3MYBA 1N6DA 1K32A 3ZW8A 5KDRB 5JBWA 3I47A 4ELWA 3K50A 5G1SA 2Q34A 2X24A 3DJAA 3SLLA 5G1QA 5E0SH 5E0NX 2ZL0A 3V5EA 5INGA 4FB8A 4DI1A 4MOUA 3QYRA 3MOYA 4L8KA 3TVWA 1XO6A 2J5IB 1HZDA 4JSBA 5E0SA 4I42A 2EJ5A 3H0SA 2F6IA 5C90A 3GF3A 1X0UA 3U9RB 5DUCA 1K39A 3HLN1 2PPYA 3IB9A 2UZFA 5DU8A 3TZ3A 3HRXA 3R9SA 4G2RA 3R0OA 1HNUA 4I52A 3Q1TA 4FNDA 4K3WA 5KJPA 2PBPA 2ZL4A 2F9YA 4KD6A 3U9TB 3G64A 4WZ8B 3MT6A 3P85A 4WCZA 3TT6A 1FC7A 3R6HA 4JWVA 2A7SA 3BF0A 2VSUF 1W2XA 4OG1A 3OT6A 1HNOA 4F47A 3KTKA 1XX4A 4FN7A 1N6EA 1UYRA 4QFEA 3ZWCA 1DUBA 4LK5A 3Q7HA 4JCTA 3H0QA 1DCIA 3GLMA 2J5GA 3HE2A 4HC8A 4U0HA 1Q51A 5FUSA 4FZWA 4JYJA 3H81A 4ELXA 1SG4A 5DUFA 1WDLA 4IZBA 5DL1A 3RSTA 5DU6A 4JCSA 2F9YB 5DTWA 4MXIA 3QMJA 2J5GD 3HP0A 3V5IA 5MGBA 2VSUE 4JVTA 1UYVA 4RCNA 1WZ8A 3K8XA 4K29A 3T8AA 2BZRA 1OD2A 3H02A 4QIJA 3ISAA 2VSUA 2DEOA 2FZSA 1FCFA 2W3PA 2VREA 4JYLA 3RSIA 3PEAA 2CBYA 3P5MA 3T8BA 2A7KA 4K2NA 1NZYA 1FC6A 3LAOA 3JU1A 2ZL2A 1Y7OA 4KNPA 3SWXA 3HINA 3STAA 1EF9A 3QXIA 1EF8A 4B3JA 4L6WA 3H0UA 4KWBA 4ZDFA 4Q1IA 3R9QA 3TDCA 3WG5A 3TRRA 3U9SB 4JFCA 5C9GA 1RJNA 2PG8A 2VSSF 2NP9A 3PE8A 4KPKA 3ST9A 3RRVA 4JCRA 1O8UA 1PIXA 4FNBA 3GMAA 4IZCA 4JJTA 4U1AA 1MJ3A 1XNYA 3Q0JA 4EMPA 2D3TA 5CTCA 1NZYB 3OC7A 3LKEA 4U0GH 3QWDA 3ZWAA 2HW5A 3QREA 3KTJA 5DZKH 4FJWD 3DORA 2ZQQA
chains in the Genus database with same CATH superfamily
4FN8A 3L3SA 4U0GA 4EMMA 3R9TA 4GHNA 1N6FA 3M6NA 2WTBA 3TLFA 5DZKA 4EMLA 3T89A 1WDKA 1Q52A 3GF7A 3TV5A 2CE3A 1JXZA 3IBBA 4U18A 2Q2XA 2ZL3A 1TG6A 3QK8A 3M6MA 3QXZA 3FF6A 1YG8A 3N6RB 3GKBA 4U19A 4OLQA 2J5II 3H0JA 4RYFH 3ZW9A 3TVUA 5CTBA 3FDUA 4MI2A 4ELSA 2F9IA 2DUBA 1YG6A 3BPTA 1TYFA 5INFA 4HNKA 5G1RA 2FBMA 4B3HA 4RYFA 5DKPA 4ZU2A 3P2LA 4I4ZA 2FW2A 3NJDA 4FZWC 3KTGA 3Q0GA 1UYSA 2YJGA 4Q0GA 2F6QA 2IEXA 1WDMA 4JOTA 2J5SA 1FC9A 2X58A 5DTPA 3T3WA 3PZKA 1SZOA 3KTHA 1EY3A 3QKAA 2VSUC 5IKLB 4QIIA 4ZDCA 1UIYA 2F9IB 3OMEA 4WYOB 3VIVA 3KQFA 4OMRA 1XNWA 2ZQRA 2GTRA 3T88A 2C8TA 1RJMA 5JBXA 4NNQA 3NJBA 5KDRA 3IAVA 4ZDBA 4ZDDA 1VRGA 2QQ3A 1UYTA 3TT7A 1ON3A 4NEKA 5INIA 4JCQA 3ZWBA 3MFMA 4IZDA 1XNVA 2VSSE 3BPPA 2J5IA 4ZDEA 1PJHA 3KTIA 4Z0MA 2VX2A 3BEZA 4YLHA 3PGQA 2A81A 4GM2A 1ON9A 4ASIA 1OD4A 4J2UA 1J7XA 2VSSA 5FIFA 4HDTA 5DU4A 4B3IA 2Q35A 3MYBA 1N6DA 1K32A 3ZW8A 5KDRB 5JBWA 3I47A 4ELWA 3K50A 5G1SA 2Q34A 2X24A 3DJAA 3SLLA 5G1QA 5E0SH 5E0NX 2ZL0A 3V5EA 5INGA 4FB8A 4DI1A 4MOUA 3QYRA 3MOYA 4L8KA 3TVWA 1XO6A 2J5IB 1HZDA 4JSBA 5E0SA 4I42A 2EJ5A 3H0SA 2F6IA 5C90A 3GF3A 1X0UA 3U9RB 5DUCA 1K39A 3HLN1 2PPYA 3IB9A 2UZFA 5DU8A 3TZ3A 3HRXA 3R9SA 4G2RA 3R0OA 1HNUA 4I52A 3Q1TA 4FNDA 4K3WA 5KJPA 2PBPA 2ZL4A 2F9YA 4KD6A 3G64A 4WZ8B 3U9TB 3MT6A 3P85A 4WCZA 3TT6A 1FC7A 3R6HA 4JWVA 2A7SA 3BF0A 2VSUF 1W2XA 4OG1A 3OT6A 1HNOA 4F47A 3KTKA 1XX4A 4FN7A 1N6EA 1UYRA 4QFEA 3ZWCA 1DUBA 4LK5A 3Q7HA 4JCTA 3H0QA 1DCIA 3GLMA 2J5GA 3HE2A 4HC8A 4U0HA 1Q51A 5FUSA 4FZWA 4JYJA 3H81A 4ELXA 1SG4A 5DUFA 1WDLA 4IZBA 5DL1A 3RSTA 5DU6A 4JCSA 2F9YB 5DTWA 4MXIA 3QMJA 2J5GD 3HP0A 3V5IA 5MGBA 2VSUE 4JVTA 1UYVA 4RCNA 1WZ8A 3K8XA 4K29A 4NARA 3T8AA 2BZRA 1OD2A 3H02A 4QIJA 3ISAA 2VSUA 2DEOA 2FZSA 1FCFA 2W3PA 2VREA 4JYLA 3RSIA 3PEAA 2CBYA 3P5MA 3T8BA 2A7KA 4K2NA 1NZYA 1FC6A 3LAOA 3JU1A 2ZL2A 1Y7OA 4KNPA 3SWXA 3HINA 3STAA 1EF9A 3QXIA 1EF8A 4B3JA 4L6WA 3H0UA 4KWBA 4ZDFA 4Q1IA 3R9QA 3TDCA 3WG5A 3TRRA 3U9SB 4JFCA 5C9GA 1RJNA 2PG8A 2VSSF 2NP9A 3PE8A 4KPKA 3ST9A 3RRVA 4JCRA 1O8UA 1PIXA 4FNBA 3GMAA 4IZCA 4JJTA 4U1AA 1MJ3A 1XNYA 3Q0JA 4EMPA 2D3TA 5CTCA 1NZYB 3OC7A 3LKEA 4U0GH 3QWDA 5HUQA 3ZWAA 2HW5A 3QREA 3KTJA 5DZKH 4FJWD 3DORA 2ZQQA
chains in the Genus database with same CATH topology
4FN8A 3L3SA 4U0GA 4EMMA 3R9TA 4GHNA 1N6FA 3M6NA 2WTBA 3TLFA 5DZKA 4EMLA 3T89A 1WDKA 1Q52A 3GF7A 3TV5A 2CE3A 1JXZA 3IBBA 4U18A 2Q2XA 2ZL3A 1TG6A 3QK8A 3M6MA 3QXZA 3FF6A 1YG8A 3N6RB 3GKBA 4U19A 4OLQA 2J5II 3H0JA 4RYFH 3ZW9A 3TVUA 5CTBA 3FDUA 4MI2A 4ELSA 2F9IA 2DUBA 1YG6A 3BPTA 1TYFA 5INFA 4HNKA 5G1RA 2FBMA 4B3HA 4RYFA 5DKPA 4ZU2A 3P2LA 4I4ZA 2FW2A 3NJDA 4FZWC 3KTGA 3Q0GA 1UYSA 2YJGA 4Q0GA 2F6QA 2IEXA 1WDMA 4JOTA 2J5SA 1FC9A 2X58A 5DTPA 3T3WA 3PZKA 1SZOA 3KTHA 1EY3A 3QKAA 2VSUC 5IKLB 4QIIA 4ZDCA 1UIYA 2F9IB 3OMEA 4WYOB 3VIVA 3KQFA 4OMRA 1XNWA 2ZQRA 2GTRA 3T88A 2C8TA 1RJMA 5JBXA 4NNQA 3NJBA 5KDRA 3IAVA 4ZDBA 4ZDDA 1VRGA 2QQ3A 1UYTA 3TT7A 1ON3A 4NEKA 5INIA 4JCQA 3ZWBA 3MFMA 4IZDA 1XNVA 2VSSE 3BPPA 2J5IA 4ZDEA 1PJHA 3KTIA 4Z0MA 2VX2A 3BEZA 4YLHA 3PGQA 2A81A 4GM2A 1ON9A 4ASIA 1OD4A 4J2UA 1J7XA 2VSSA 5FIFA 4HDTA 5DU4A 4B3IA 2Q35A 3MYBA 1N6DA 1K32A 3ZW8A 5KDRB 5JBWA 3I47A 4ELWA 3K50A 5G1SA 2Q34A 2X24A 3DJAA 3SLLA 5G1QA 5E0SH 5E0NX 2ZL0A 3V5EA 5INGA 4FB8A 4DI1A 4MOUA 3QYRA 3MOYA 4L8KA 3TVWA 1XO6A 2J5IB 1HZDA 4JSBA 5E0SA 4I42A 2EJ5A 3H0SA 2F6IA 5C90A 3GF3A 1X0UA 3U9RB 5DUCA 1K39A 3HLN1 2PPYA 3IB9A 2UZFA 5DU8A 3TZ3A 3HRXA 3R9SA 4G2RA 3R0OA 1HNUA 4I52A 3Q1TA 4FNDA 4K3WA 5KJPA 2PBPA 2ZL4A 2F9YA 4KD6A 3G64A 4WZ8B 3U9TB 3MT6A 3P85A 4WCZA 3TT6A 1FC7A 3R6HA 4JWVA 2A7SA 3BF0A 2VSUF 1W2XA 4OG1A 3OT6A 1HNOA 4F47A 3KTKA 1XX4A 4FN7A 1N6EA 1UYRA 4QFEA 3ZWCA 1DUBA 4LK5A 3Q7HA 4JCTA 3H0QA 1DCIA 3GLMA 2J5GA 3HE2A 4HC8A 4U0HA 1Q51A 5FUSA 4FZWA 4JYJA 3H81A 4ELXA 1SG4A 5DUFA 1WDLA 4IZBA 5DL1A 3RSTA 5DU6A 4JCSA 2F9YB 5DTWA 4MXIA 3QMJA 2J5GD 3HP0A 3V5IA 5MGBA 2VSUE 4JVTA 1UYVA 4RCNA 1WZ8A 3K8XA 4K29A 4NARA 3T8AA 2BZRA 1OD2A 3H02A 4QIJA 3ISAA 2VSUA 2DEOA 2FZSA 1FCFA 2W3PA 2VREA 4JYLA 3RSIA 3PEAA 2CBYA 3P5MA 3T8BA 2A7KA 4K2NA 1NZYA 1FC6A 3LAOA 3JU1A 2ZL2A 1Y7OA 4KNPA 3SWXA 3HINA 3STAA 1EF9A 3QXIA 1EF8A 4B3JA 4L6WA 3H0UA 4KWBA 4ZDFA 4Q1IA 3R9QA 3TDCA 3WG5A 3TRRA 3U9SB 4JFCA 5C9GA 1RJNA 2PG8A 2VSSF 2NP9A 3PE8A 4KPKA 3ST9A 3RRVA 4JCRA 1O8UA 1PIXA 4FNBA 3GMAA 4IZCA 4JJTA 4U1AA 1MJ3A 1XNYA 3Q0JA 4EMPA 2D3TA 5CTCA 1NZYB 3OC7A 3LKEA 4U0GH 3QWDA 5HUQA 3ZWAA 2HW5A 3QREA 3KTJA 5DZKH 4FJWD 3DORA 2ZQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FN8 A;  3L3S A;  4U0G A;  4EMM A;  3R9T A;  4GHN A;  1N6F A;  3M6N A;  2WTB A;  3TLF A;  5DZK A;  4EML A;  3T89 A;  1WDK A;  1Q52 A;  3GF7 A;  3TV5 A;  2CE3 A;  1JXZ A;  3IBB A;  4U18 A;  2Q2X A;  2ZL3 A;  1TG6 A;  3QK8 A;  3M6M A;  3QXZ A;  3FF6 A;  1YG8 A;  3N6R B;  3GKB A;  4U19 A;  4OLQ A;  2J5I I;  3H0J A;  4RYF H;  3ZW9 A;  3TVU A;  5CTB A;  3FDU A;  4MI2 A;  4ELS A;  2F9I A;  2DUB A;  1YG6 A;  1TYF A;  5INF A;  4HNK A;  5G1R A;  2FBM A;  4B3H A;  4RYF A;  5DKP A;  4ZU2 A;  3P2L A;  4I4Z A;  2FW2 A;  3NJD A;  4FZW C;  3KTG A;  3Q0G A;  1UYS A;  4Q0G A;  2F6Q A;  2IEX A;  1WDM A;  4JOT A;  2J5S A;  1FC9 A;  2X58 A;  5DTP A;  3T3W A;  3PZK A;  1SZO A;  3KTH A;  1EY3 A;  3QKA A;  2VSU C;  5IKL B;  4QII A;  4ZDC A;  1UIY A;  2F9I B;  3OME A;  4WYO B;  3VIV A;  3KQF A;  4OMR A;  1XNW A;  2ZQR A;  2GTR A;  3T88 A;  2C8T A;  1RJM A;  5JBX A;  4NNQ A;  3NJB A;  5KDR A;  3IAV A;  4ZDB A;  4ZDD A;  1VRG A;  2QQ3 A;  1UYT A;  3TT7 A;  1ON3 A;  4NEK A;  5INI A;  4JCQ A;  3ZWB A;  3MFM A;  4IZD A;  1XNV A;  2VSS E;  3BPP A;  2J5I A;  4ZDE A;  1PJH A;  3KTI A;  4Z0M A;  2VX2 A;  3BEZ A;  4YLH A;  3PGQ A;  2A81 A;  4GM2 A;  1ON9 A;  4ASI A;  1OD4 A;  1J7X A;  2VSS A;  5FIF A;  5DU4 A;  4B3I A;  2Q35 A;  3MYB A;  1N6D A;  1K32 A;  3ZW8 A;  5KDR B;  5JBW A;  3I47 A;  4ELW A;  3K50 A;  5G1S A;  2Q34 A;  2X24 A;  3DJA A;  3SLL A;  5G1Q A;  5E0S H;  5E0N X;  2ZL0 A;  3V5E A;  5ING A;  4FB8 A;  4DI1 A;  4MOU A;  3QYR A;  3MOY A;  4L8K A;  3TVW A;  1XO6 A;  2J5I B;  1HZD A;  4JSB A;  5E0S A;  4I42 A;  2EJ5 A;  3H0S A;  2F6I A;  5C90 A;  3GF3 A;  1X0U A;  3U9R B;  5DUC A;  1K39 A;  3HLN 1;  2PPY A;  3IB9 A;  2UZF A;  5DU8 A;  3TZ3 A;  3HRX A;  3R9S A;  4G2R A;  3R0O A;  1HNU A;  4I52 A;  3Q1T A;  4FND A;  4K3W A;  5KJP A;  2PBP A;  2ZL4 A;  2F9Y A;  4KD6 A;  3U9T B;  3G64 A;  4WZ8 B;  3MT6 A;  3P85 A;  4WCZ A;  3TT6 A;  1FC7 A;  3R6H A;  4JWV A;  2A7S A;  3BF0 A;  2VSU F;  1W2X A;  4OG1 A;  3OT6 A;  1HNO A;  4F47 A;  3KTK A;  1XX4 A;  4FN7 A;  1N6E A;  1UYR A;  4QFE A;  3ZWC A;  1DUB A;  4LK5 A;  3Q7H A;  4JCT A;  3H0Q A;  1DCI A;  3GLM A;  2J5G A;  3HE2 A;  4HC8 A;  4U0H A;  1Q51 A;  5FUS A;  4FZW A;  4JYJ A;  3H81 A;  4ELX A;  1SG4 A;  5DUF A;  1WDL A;  4IZB A;  5DL1 A;  3RST A;  5DU6 A;  4JCS A;  2F9Y B;  5DTW A;  4MXI A;  3QMJ A;  2J5G D;  3HP0 A;  3V5I A;  5MGB A;  2VSU E;  4JVT A;  1UYV A;  4RCN A;  1WZ8 A;  3K8X A;  4K29 A;  3T8A A;  2BZR A;  1OD2 A;  3H02 A;  4QIJ A;  3ISA A;  2VSU A;  2DEO A;  2FZS A;  1FCF A;  2W3P A;  2VRE A;  4JYL A;  3RSI A;  3PEA A;  2CBY A;  3P5M A;  3T8B A;  2A7K A;  4K2N A;  1NZY A;  1FC6 A;  3LAO A;  3JU1 A;  2ZL2 A;  1Y7O A;  4KNP A;  3SWX A;  3HIN A;  3STA A;  1EF9 A;  3QXI A;  1EF8 A;  4B3J A;  4L6W A;  3H0U A;  4KWB A;  4ZDF A;  4Q1I A;  3R9Q A;  3TDC A;  3WG5 A;  3TRR A;  3U9S B;  4JFC A;  5C9G A;  1RJN A;  2PG8 A;  2VSS F;  2NP9 A;  3PE8 A;  4KPK A;  3ST9 A;  3RRV A;  4JCR A;  1O8U A;  1PIX A;  4FNB A;  3GMA A;  4IZC A;  4JJT A;  4U1A A;  1MJ3 A;  1XNY A;  3Q0J A;  4EMP A;  2D3T A;  5CTC A;  1NZY B;  3OC7 A;  3LKE A;  4U0G H;  3QWD A;  3ZWA A;  2HW5 A;  3QRE A;  3KTJ A;  5DZK H;  4FJW D;  3DOR A;  2ZQQ A; 
#chains in the Genus database with same CATH topology
 4FN8 A;  3L3S A;  4U0G A;  4EMM A;  3R9T A;  4GHN A;  1N6F A;  3M6N A;  2WTB A;  3TLF A;  5DZK A;  4EML A;  3T89 A;  1WDK A;  1Q52 A;  3GF7 A;  3TV5 A;  2CE3 A;  1JXZ A;  3IBB A;  4U18 A;  2Q2X A;  2ZL3 A;  1TG6 A;  3QK8 A;  3M6M A;  3QXZ A;  3FF6 A;  1YG8 A;  3N6R B;  3GKB A;  4U19 A;  4OLQ A;  2J5I I;  3H0J A;  4RYF H;  3ZW9 A;  3TVU A;  5CTB A;  3FDU A;  4MI2 A;  4ELS A;  2F9I A;  2DUB A;  1YG6 A;  3BPT A;  1TYF A;  5INF A;  4HNK A;  5G1R A;  2FBM A;  4B3H A;  4RYF A;  5DKP A;  4ZU2 A;  3P2L A;  4I4Z A;  2FW2 A;  3NJD A;  4FZW C;  3KTG A;  3Q0G A;  1UYS A;  2YJG A;  4Q0G A;  2F6Q A;  2IEX A;  1WDM A;  4JOT A;  2J5S A;  1FC9 A;  2X58 A;  5DTP A;  3T3W A;  3PZK A;  1SZO A;  3KTH A;  1EY3 A;  3QKA A;  2VSU C;  5IKL B;  4QII A;  4ZDC A;  1UIY A;  2F9I B;  3OME A;  4WYO B;  3VIV A;  3KQF A;  4OMR A;  1XNW A;  2ZQR A;  2GTR A;  3T88 A;  2C8T A;  1RJM A;  5JBX A;  4NNQ A;  3NJB A;  5KDR A;  3IAV A;  4ZDB A;  4ZDD A;  1VRG A;  2QQ3 A;  1UYT A;  3TT7 A;  1ON3 A;  4NEK A;  5INI A;  4JCQ A;  3ZWB A;  3MFM A;  4IZD A;  1XNV A;  2VSS E;  3BPP A;  2J5I A;  4ZDE A;  1PJH A;  3KTI A;  4Z0M A;  2VX2 A;  3BEZ A;  4YLH A;  3PGQ A;  2A81 A;  4GM2 A;  1ON9 A;  4ASI A;  1OD4 A;  4J2U A;  1J7X A;  2VSS A;  5FIF A;  4HDT A;  5DU4 A;  4B3I A;  2Q35 A;  3MYB A;  1N6D A;  1K32 A;  3ZW8 A;  5KDR B;  5JBW A;  3I47 A;  4ELW A;  3K50 A;  5G1S A;  2Q34 A;  2X24 A;  3DJA A;  3SLL A;  5G1Q A;  5E0S H;  5E0N X;  2ZL0 A;  3V5E A;  5ING A;  4FB8 A;  4DI1 A;  4MOU A;  3QYR A;  3MOY A;  4L8K A;  3TVW A;  1XO6 A;  2J5I B;  1HZD A;  4JSB A;  5E0S A;  4I42 A;  2EJ5 A;  3H0S A;  2F6I A;  5C90 A;  3GF3 A;  1X0U A;  3U9R B;  5DUC A;  1K39 A;  3HLN 1;  2PPY A;  3IB9 A;  2UZF A;  5DU8 A;  3TZ3 A;  3HRX A;  3R9S A;  4G2R A;  3R0O A;  1HNU A;  4I52 A;  3Q1T A;  4FND A;  4K3W A;  5KJP A;  2PBP A;  2ZL4 A;  2F9Y A;  4KD6 A;  3G64 A;  4WZ8 B;  3U9T B;  3MT6 A;  3P85 A;  4WCZ A;  3TT6 A;  1FC7 A;  3R6H A;  4JWV A;  2A7S A;  3BF0 A;  2VSU F;  1W2X A;  4OG1 A;  3OT6 A;  1HNO A;  4F47 A;  3KTK A;  1XX4 A;  4FN7 A;  1N6E A;  1UYR A;  4QFE A;  3ZWC A;  1DUB A;  4LK5 A;  3Q7H A;  4JCT A;  3H0Q A;  1DCI A;  3GLM A;  2J5G A;  3HE2 A;  4HC8 A;  4U0H A;  1Q51 A;  5FUS A;  4FZW A;  4JYJ A;  3H81 A;  4ELX A;  1SG4 A;  5DUF A;  1WDL A;  4IZB A;  5DL1 A;  3RST A;  5DU6 A;  4JCS A;  2F9Y B;  5DTW A;  4MXI A;  3QMJ A;  2J5G D;  3HP0 A;  3V5I A;  5MGB A;  2VSU E;  4JVT A;  1UYV A;  4RCN A;  1WZ8 A;  3K8X A;  4K29 A;  4NAR A;  3T8A A;  2BZR A;  1OD2 A;  3H02 A;  4QIJ A;  3ISA A;  2VSU A;  2DEO A;  2FZS A;  1FCF A;  2W3P A;  2VRE A;  4JYL A;  3RSI A;  3PEA A;  2CBY A;  3P5M A;  3T8B A;  2A7K A;  4K2N A;  1NZY A;  1FC6 A;  3LAO A;  3JU1 A;  2ZL2 A;  1Y7O A;  4KNP A;  3SWX A;  3HIN A;  3STA A;  1EF9 A;  3QXI A;  1EF8 A;  4B3J A;  4L6W A;  3H0U A;  4KWB A;  4ZDF A;  4Q1I A;  3R9Q A;  3TDC A;  3WG5 A;  3TRR A;  3U9S B;  4JFC A;  5C9G A;  1RJN A;  2PG8 A;  2VSS F;  2NP9 A;  3PE8 A;  4KPK A;  3ST9 A;  3RRV A;  4JCR A;  1O8U A;  1PIX A;  4FNB A;  3GMA A;  4IZC A;  4JJT A;  4U1A A;  1MJ3 A;  1XNY A;  3Q0J A;  4EMP A;  2D3T A;  5CTC A;  1NZY B;  3OC7 A;  3LKE A;  4U0G H;  3QWD A;  5HUQ A;  3ZWA A;  2HW5 A;  3QRE A;  3KTJ A;  5DZK H;  4FJW D;  3DOR A;  2ZQQ A; 
#chains in the Genus database with same CATH homology
 4FN8 A;  3L3S A;  4U0G A;  4EMM A;  3R9T A;  4GHN A;  1N6F A;  3M6N A;  2WTB A;  3TLF A;  5DZK A;  4EML A;  3T89 A;  1WDK A;  1Q52 A;  3GF7 A;  3TV5 A;  2CE3 A;  1JXZ A;  3IBB A;  4U18 A;  2Q2X A;  2ZL3 A;  1TG6 A;  3QK8 A;  3M6M A;  3QXZ A;  3FF6 A;  1YG8 A;  3N6R B;  3GKB A;  4U19 A;  4OLQ A;  2J5I I;  3H0J A;  4RYF H;  3ZW9 A;  3TVU A;  5CTB A;  3FDU A;  4MI2 A;  4ELS A;  2F9I A;  2DUB A;  1YG6 A;  3BPT A;  1TYF A;  5INF A;  4HNK A;  5G1R A;  2FBM A;  4B3H A;  4RYF A;  5DKP A;  4ZU2 A;  3P2L A;  4I4Z A;  2FW2 A;  3NJD A;  4FZW C;  3KTG A;  3Q0G A;  1UYS A;  2YJG A;  4Q0G A;  2F6Q A;  2IEX A;  1WDM A;  4JOT A;  2J5S A;  1FC9 A;  2X58 A;  5DTP A;  3T3W A;  3PZK A;  1SZO A;  3KTH A;  1EY3 A;  3QKA A;  2VSU C;  5IKL B;  4QII A;  4ZDC A;  1UIY A;  2F9I B;  3OME A;  4WYO B;  3VIV A;  3KQF A;  4OMR A;  1XNW A;  2ZQR A;  2GTR A;  3T88 A;  2C8T A;  1RJM A;  5JBX A;  4NNQ A;  3NJB A;  5KDR A;  3IAV A;  4ZDB A;  4ZDD A;  1VRG A;  2QQ3 A;  1UYT A;  3TT7 A;  1ON3 A;  4NEK A;  5INI A;  4JCQ A;  3ZWB A;  3MFM A;  4IZD A;  1XNV A;  2VSS E;  3BPP A;  2J5I A;  4ZDE A;  1PJH A;  3KTI A;  4Z0M A;  2VX2 A;  3BEZ A;  4YLH A;  3PGQ A;  2A81 A;  4GM2 A;  1ON9 A;  4ASI A;  1OD4 A;  4J2U A;  1J7X A;  2VSS A;  5FIF A;  4HDT A;  5DU4 A;  4B3I A;  2Q35 A;  3MYB A;  1N6D A;  1K32 A;  3ZW8 A;  5KDR B;  5JBW A;  3I47 A;  4ELW A;  3K50 A;  5G1S A;  2Q34 A;  2X24 A;  3DJA A;  3SLL A;  5G1Q A;  5E0S H;  5E0N X;  2ZL0 A;  3V5E A;  5ING A;  4FB8 A;  4DI1 A;  4MOU A;  3QYR A;  3MOY A;  4L8K A;  3TVW A;  1XO6 A;  2J5I B;  1HZD A;  4JSB A;  5E0S A;  4I42 A;  2EJ5 A;  3H0S A;  2F6I A;  5C90 A;  3GF3 A;  1X0U A;  3U9R B;  5DUC A;  1K39 A;  3HLN 1;  2PPY A;  3IB9 A;  2UZF A;  5DU8 A;  3TZ3 A;  3HRX A;  3R9S A;  4G2R A;  3R0O A;  1HNU A;  4I52 A;  3Q1T A;  4FND A;  4K3W A;  5KJP A;  2PBP A;  2ZL4 A;  2F9Y A;  4KD6 A;  3G64 A;  4WZ8 B;  3U9T B;  3MT6 A;  3P85 A;  4WCZ A;  3TT6 A;  1FC7 A;  3R6H A;  4JWV A;  2A7S A;  3BF0 A;  2VSU F;  1W2X A;  4OG1 A;  3OT6 A;  1HNO A;  4F47 A;  3KTK A;  1XX4 A;  4FN7 A;  1N6E A;  1UYR A;  4QFE A;  3ZWC A;  1DUB A;  4LK5 A;  3Q7H A;  4JCT A;  3H0Q A;  1DCI A;  3GLM A;  2J5G A;  3HE2 A;  4HC8 A;  4U0H A;  1Q51 A;  5FUS A;  4FZW A;  4JYJ A;  3H81 A;  4ELX A;  1SG4 A;  5DUF A;  1WDL A;  4IZB A;  5DL1 A;  3RST A;  5DU6 A;  4JCS A;  2F9Y B;  5DTW A;  4MXI A;  3QMJ A;  2J5G D;  3HP0 A;  3V5I A;  5MGB A;  2VSU E;  4JVT A;  1UYV A;  4RCN A;  1WZ8 A;  3K8X A;  4K29 A;  4NAR A;  3T8A A;  2BZR A;  1OD2 A;  3H02 A;  4QIJ A;  3ISA A;  2VSU A;  2DEO A;  2FZS A;  1FCF A;  2W3P A;  2VRE A;  4JYL A;  3RSI A;  3PEA A;  2CBY A;  3P5M A;  3T8B A;  2A7K A;  4K2N A;  1NZY A;  1FC6 A;  3LAO A;  3JU1 A;  2ZL2 A;  1Y7O A;  4KNP A;  3SWX A;  3HIN A;  3STA A;  1EF9 A;  3QXI A;  1EF8 A;  4B3J A;  4L6W A;  3H0U A;  4KWB A;  4ZDF A;  4Q1I A;  3R9Q A;  3TDC A;  3WG5 A;  3TRR A;  3U9S B;  4JFC A;  5C9G A;  1RJN A;  2PG8 A;  2VSS F;  2NP9 A;  3PE8 A;  4KPK A;  3ST9 A;  3RRV A;  4JCR A;  1O8U A;  1PIX A;  4FNB A;  3GMA A;  4IZC A;  4JJT A;  4U1A A;  1MJ3 A;  1XNY A;  3Q0J A;  4EMP A;  2D3T A;  5CTC A;  1NZY B;  3OC7 A;  3LKE A;  4U0G H;  3QWD A;  5HUQ A;  3ZWA A;  2HW5 A;  3QRE A;  3KTJ A;  5DZK H;  4FJW D;  3DOR A;  2ZQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...