4EMMA

Crystal structure of staphylococcus aureus clpp in compact conformation
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
189
structure length
173
Chain Sequence
IPTVIERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEVMIHQPLEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Helix unfolding/refolding characterizes the functional dynamics of Staphylococcus aureus Clp protease
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 62
structure length 173
sequence length 189
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, V
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4emmA00
1OD2A 3ISAA 2F9YA 4EMPA 5G1SA 4JCTA 1YG8A 3LAOA 4JFCA 4QIJA 4GHNA 4JOTA 4RYFH 2PPYA 3DJAA 5KDRA 2F9YB 4K3WA 1W2XA 1XNWA 3RSTA 4DI1A 1EF8A 3MFMA 4JWVA 2IEXA 4ZDDA 3K50A 1OD4A 1UYVA 2DEOA 3DORA 5KJPA 2VSUF 2D3TA 1PJHA 4U1AA 3TT6A 5DZKA 1NZYA 4Q0GA 1EF9A 2FZSA 4QFEA 3BEZA 5DZKH 3P2LA 4U0HA 3TLFA 2VREA 1O8UA 3HLN1 1MJ3A 3BF0A 3ZWAA 4ELWA 2VSSE 4ZDEA 1DCIA 4I4ZA 3IAVA 3QXIA 3ZW8A 4ASIA 3PEAA 2PG8A 3H81A 5DU8A 3ZWBA 3R0OA 4MOUA 3N6RB 2WTBA 5DU4A 2FW2A 5CTBA 3T8BA 5E0SA 1Y7OA 1X0UA 1DUBA 4G2RA 4JYLA 2C8TA 5INFA 4QIIA 3T3WA 1HZDA 2X24A 2HW5A 1TYFA 3R9TA 5DU6A 2ZL4A 5DTPA 3P85A 3HRXA 3MOYA 1UYRA 5INIA 1J7XA 3JU1A 4ZU2A 3L3SA 4FNDA 5FIFA 3NJDA 2NP9A 2PBPA 2VX2A 3SWXA 3KTKA 2VSUE 4RCNA 3ST9A 4K29A 4Z0MA 1NZYB 5INGA 3GMAA 3HINA 3QYRA 2J5IA 3GF3A 3T89A 5IKLB 2VSUC 1UYTA 4MXIA 2F6QA 4Q1IA 5DKPA 3V5IA 5G1QA 4OLQA 3FF6A 1FC7A 4KWBA 2ZL3A 4JJTA 3MT6A 3MYBA 5E0SH 4LK5A 3PZKA 1JXZA 3H0UA 3QREA 3Q0JA 4U0GH 3R9SA 3Q1TA 2J5GD 4RYFA 3TZ3A 4ELXA 4B3IA 1Q51A 5CTCA 2VSSA 4FNBA 3U9TB 5FUSA 3TVUA 3OC7A 2ZL0A 4F47A 2F9IB 3NJBA 3TV5A 1VRGA 4OG1A 5DUFA 4JCSA 3BPPA 5DUCA 4K2NA 4FJWD 1SZOA 2QQ3A 3SLLA 4KNPA 1FCFA 2W3PA 3QK8A 3M6MA 2F9IA 2BZRA 3HE2A 3ZW9A 4JVTA 2Q35A 3G64A 4FN7A 3M6NA 3PGQA 1XX4A 3FDUA 4U0GA 3H0QA 4JYJA 2A7KA 2Q2XA 4OMRA 1SG4A 2A81A 3U9RB 1PIXA 3ZWCA 3KTJA 1Q52A 4GM2A 3RRVA 3V5EA 2Q34A 2ZL2A 3QMJA 3KTGA 3P5MA 1WDLA 1UYSA 4WCZA 4ZDBA 3TVWA 2GTRA 1WDKA 1FC9A 3GLMA 2ZQRA 3H0JA 4WZ8B 3U9SB 1WZ8A 3VIVA 4FZWA 3TT7A 2VSUA 4FZWC 2CBYA 1K39A 4ZDFA 4WYOB 1HNUA 1FC6A 1K32A 1UIYA 3K8XA 2UZFA 1TG6A 5C90A 1WDMA 4YLHA 2FBMA 3QWDA 3R9QA 1HNOA 5C9GA 2J5IB 4NNQA 4IZCA 3KTHA 1N6EA 4EMLA 4MI2A 5DTWA 3LKEA 1YG6A 3WG5A 5G1RA 2CE3A 4IZDA 4U18A 3KTIA 4L8KA 3I47A 4B3HA 3OMEA 4JSBA 2ZQQA 4JCRA 5E0NX 3T8AA 3TDCA 4FB8A 5JBXA 1XNVA 1RJNA 1ON3A 4EMMA 4KPKA 3IB9A 4FN8A 4ZDCA 2J5GA 4B3JA 5JBWA 2VSSF 3Q7HA 3GF7A 1N6DA 3KQFA 3RSIA 3GKBA 3HP0A 2J5II 3QKAA 3STAA 5KDRB 4HC8A 2J5SA 4HNKA 4U19A 4I42A 1RJMA 1EY3A 4IZBA 4L6WA 5DL1A 3TRRA 2EJ5A 2A7SA 2F6IA 4NEKA 3R6HA 4JCQA 1N6FA 2DUBA 3H0SA 5MGBA 3H02A 3PE8A 1ON9A 4KD6A 1XNYA 2X58A 3Q0GA 3T88A 4ELSA 4I52A 3IBBA 1XO6A 3OT6A 3QXZA
chains in the Genus database with same CATH superfamily
1OD2A 3ISAA 2F9YA 4EMPA 5G1SA 4JCTA 1YG8A 3LAOA 4JFCA 4QIJA 4GHNA 4JOTA 4RYFH 2PPYA 3DJAA 5KDRA 2F9YB 4K3WA 1W2XA 1XNWA 3RSTA 4DI1A 1EF8A 3MFMA 4JWVA 2IEXA 4ZDDA 3K50A 1OD4A 1UYVA 2DEOA 3DORA 5KJPA 2VSUF 2D3TA 1PJHA 4U1AA 3TT6A 5DZKA 1NZYA 4Q0GA 1EF9A 2FZSA 4QFEA 3BEZA 5DZKH 3P2LA 4U0HA 3TLFA 2VREA 1O8UA 3HLN1 1MJ3A 3BF0A 3ZWAA 4ELWA 2VSSE 4ZDEA 1DCIA 4I4ZA 3IAVA 3QXIA 3ZW8A 4ASIA 3PEAA 2PG8A 3H81A 5DU8A 3ZWBA 3R0OA 4MOUA 3N6RB 2WTBA 5DU4A 2FW2A 5CTBA 3T8BA 5E0SA 1Y7OA 1X0UA 1DUBA 4G2RA 4JYLA 2C8TA 5INFA 4QIIA 3T3WA 1HZDA 2X24A 2HW5A 1TYFA 3R9TA 5DU6A 2ZL4A 5DTPA 3P85A 3HRXA 3MOYA 1UYRA 5INIA 1J7XA 3JU1A 4ZU2A 3L3SA 4FNDA 5FIFA 3NJDA 2NP9A 2PBPA 2VX2A 3SWXA 3KTKA 2VSUE 4RCNA 3ST9A 4K29A 4Z0MA 1NZYB 5INGA 3GMAA 3HINA 3QYRA 2J5IA 3GF3A 3T89A 5IKLB 2VSUC 1UYTA 4MXIA 2F6QA 4HDTA 4Q1IA 5DKPA 3V5IA 5G1QA 4OLQA 3FF6A 1FC7A 4KWBA 2ZL3A 4JJTA 3MT6A 3MYBA 5E0SH 4LK5A 3PZKA 1JXZA 3H0UA 3QREA 3Q0JA 4U0GH 3R9SA 3Q1TA 2J5GD 4RYFA 3TZ3A 4ELXA 4B3IA 1Q51A 5CTCA 2VSSA 4FNBA 3U9TB 5FUSA 3TVUA 3OC7A 2ZL0A 4F47A 2F9IB 3NJBA 3TV5A 1VRGA 4OG1A 5DUFA 4JCSA 3BPPA 5DUCA 4K2NA 4FJWD 1SZOA 2QQ3A 3SLLA 4KNPA 1FCFA 2W3PA 3QK8A 3M6MA 2F9IA 2BZRA 3HE2A 3ZW9A 4JVTA 2Q35A 3G64A 4FN7A 3M6NA 3PGQA 1XX4A 2YJGA 3FDUA 4U0GA 3H0QA 4JYJA 2A7KA 2Q2XA 4OMRA 1SG4A 2A81A 3U9RB 1PIXA 3ZWCA 3KTJA 1Q52A 4J2UA 4GM2A 3RRVA 3V5EA 2Q34A 2ZL2A 3QMJA 3KTGA 3P5MA 1WDLA 4NARA 1UYSA 4WCZA 4ZDBA 3TVWA 2GTRA 1WDKA 1FC9A 3GLMA 2ZQRA 3H0JA 4WZ8B 3U9SB 1WZ8A 3VIVA 4FZWA 3TT7A 2VSUA 4FZWC 2CBYA 1K39A 4ZDFA 4WYOB 1HNUA 1FC6A 1K32A 1UIYA 3K8XA 5HUQA 2UZFA 3BPTA 1TG6A 5C90A 1WDMA 4YLHA 2FBMA 3QWDA 3R9QA 1HNOA 5C9GA 2J5IB 4NNQA 4IZCA 3KTHA 1N6EA 4EMLA 4MI2A 5DTWA 3LKEA 1YG6A 3WG5A 5G1RA 2CE3A 4IZDA 4U18A 3KTIA 4L8KA 3I47A 4B3HA 3OMEA 4JSBA 2ZQQA 4JCRA 5E0NX 3T8AA 3TDCA 4FB8A 5JBXA 1XNVA 1RJNA 1ON3A 4EMMA 4KPKA 3IB9A 4FN8A 4ZDCA 2J5GA 4B3JA 5JBWA 2VSSF 3Q7HA 3GF7A 1N6DA 3KQFA 3RSIA 3GKBA 3HP0A 2J5II 3QKAA 3STAA 5KDRB 4HC8A 2J5SA 4HNKA 4U19A 4I42A 1RJMA 1EY3A 4IZBA 4L6WA 5DL1A 3TRRA 2EJ5A 2A7SA 2F6IA 4NEKA 3R6HA 4JCQA 1N6FA 2DUBA 3H0SA 5MGBA 3H02A 3PE8A 1ON9A 4KD6A 1XNYA 2X58A 3Q0GA 3T88A 4ELSA 4I52A 3IBBA 1XO6A 3OT6A 3QXZA
chains in the Genus database with same CATH topology
1OD2A 3ISAA 2F9YA 4EMPA 5G1SA 4JCTA 1YG8A 3LAOA 4JFCA 4QIJA 4GHNA 4JOTA 4RYFH 2PPYA 3DJAA 5KDRA 2F9YB 4K3WA 1W2XA 1XNWA 3RSTA 4DI1A 1EF8A 3MFMA 4JWVA 2IEXA 4ZDDA 3K50A 1OD4A 1UYVA 2DEOA 3DORA 5KJPA 2VSUF 2D3TA 1PJHA 4U1AA 3TT6A 5DZKA 1NZYA 4Q0GA 1EF9A 2FZSA 4QFEA 3BEZA 5DZKH 3P2LA 4U0HA 3TLFA 2VREA 1O8UA 3HLN1 1MJ3A 3BF0A 3ZWAA 4ELWA 2VSSE 4ZDEA 1DCIA 4I4ZA 3IAVA 3QXIA 3ZW8A 4ASIA 3PEAA 2PG8A 3H81A 5DU8A 3ZWBA 3R0OA 4MOUA 3N6RB 2WTBA 5DU4A 2FW2A 5CTBA 3T8BA 5E0SA 1Y7OA 1X0UA 1DUBA 4G2RA 4JYLA 2C8TA 5INFA 4QIIA 3T3WA 1HZDA 2X24A 2HW5A 1TYFA 3R9TA 5DU6A 2ZL4A 5DTPA 3P85A 3HRXA 3MOYA 1UYRA 5INIA 1J7XA 3JU1A 4ZU2A 3L3SA 4FNDA 5FIFA 3NJDA 2NP9A 2PBPA 2VX2A 3SWXA 3KTKA 2VSUE 4RCNA 3ST9A 4K29A 4Z0MA 1NZYB 5INGA 3GMAA 3HINA 3QYRA 2J5IA 3GF3A 3T89A 5IKLB 2VSUC 1UYTA 4MXIA 2F6QA 4HDTA 4Q1IA 5DKPA 3V5IA 5G1QA 4OLQA 3FF6A 1FC7A 4KWBA 2ZL3A 4JJTA 3MT6A 3MYBA 5E0SH 4LK5A 3PZKA 1JXZA 3H0UA 3QREA 3Q0JA 4U0GH 3R9SA 3Q1TA 2J5GD 4RYFA 3TZ3A 4ELXA 4B3IA 1Q51A 5CTCA 2VSSA 4FNBA 3U9TB 5FUSA 3TVUA 3OC7A 2ZL0A 4F47A 2F9IB 3NJBA 3TV5A 1VRGA 4OG1A 5DUFA 4JCSA 3BPPA 5DUCA 4K2NA 4FJWD 1SZOA 2QQ3A 3SLLA 4KNPA 1FCFA 2W3PA 3QK8A 3M6MA 2F9IA 2BZRA 3HE2A 3ZW9A 4JVTA 2Q35A 3G64A 4FN7A 3M6NA 3PGQA 1XX4A 2YJGA 3FDUA 4U0GA 3H0QA 4JYJA 2A7KA 2Q2XA 4OMRA 1SG4A 2A81A 3U9RB 1PIXA 3ZWCA 3KTJA 1Q52A 4J2UA 4GM2A 3RRVA 3V5EA 2Q34A 2ZL2A 3QMJA 3KTGA 3P5MA 1WDLA 4NARA 1UYSA 4WCZA 4ZDBA 3TVWA 2GTRA 1WDKA 1FC9A 3GLMA 2ZQRA 3H0JA 4WZ8B 3U9SB 1WZ8A 3VIVA 4FZWA 3TT7A 2VSUA 4FZWC 2CBYA 1K39A 4ZDFA 4WYOB 1HNUA 1FC6A 1K32A 1UIYA 3K8XA 5HUQA 2UZFA 3BPTA 1TG6A 5C90A 1WDMA 4YLHA 2FBMA 3QWDA 3R9QA 1HNOA 5C9GA 2J5IB 4NNQA 4IZCA 3KTHA 1N6EA 4EMLA 4MI2A 5DTWA 3LKEA 1YG6A 3WG5A 5G1RA 2CE3A 4IZDA 4U18A 3KTIA 4L8KA 3I47A 4B3HA 3OMEA 4JSBA 2ZQQA 4JCRA 5E0NX 3T8AA 3TDCA 4FB8A 5JBXA 1XNVA 1RJNA 1ON3A 4EMMA 4KPKA 3IB9A 4FN8A 4ZDCA 2J5GA 4B3JA 5JBWA 2VSSF 3Q7HA 3GF7A 1N6DA 3KQFA 3RSIA 3GKBA 3HP0A 2J5II 3QKAA 3STAA 5KDRB 4HC8A 2J5SA 4HNKA 4U19A 4I42A 1RJMA 1EY3A 4IZBA 4L6WA 5DL1A 3TRRA 2EJ5A 2A7SA 2F6IA 4NEKA 3R6HA 4JCQA 1N6FA 2DUBA 3H0SA 5MGBA 3H02A 3PE8A 1ON9A 4KD6A 1XNYA 2X58A 3Q0GA 3T88A 4ELSA 4I52A 3IBBA 1XO6A 3OT6A 3QXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OD2 A;  3ISA A;  2F9Y A;  4EMP A;  5G1S A;  4JCT A;  1YG8 A;  3LAO A;  4JFC A;  4QIJ A;  4GHN A;  4JOT A;  4RYF H;  2PPY A;  3DJA A;  5KDR A;  2F9Y B;  4K3W A;  1W2X A;  1XNW A;  3RST A;  4DI1 A;  1EF8 A;  3MFM A;  4JWV A;  2IEX A;  4ZDD A;  3K50 A;  1OD4 A;  1UYV A;  2DEO A;  3DOR A;  5KJP A;  2VSU F;  2D3T A;  1PJH A;  4U1A A;  3TT6 A;  5DZK A;  1NZY A;  4Q0G A;  1EF9 A;  2FZS A;  4QFE A;  3BEZ A;  5DZK H;  3P2L A;  4U0H A;  3TLF A;  2VRE A;  1O8U A;  3HLN 1;  1MJ3 A;  3BF0 A;  3ZWA A;  4ELW A;  2VSS E;  4ZDE A;  1DCI A;  4I4Z A;  3IAV A;  3QXI A;  3ZW8 A;  4ASI A;  3PEA A;  2PG8 A;  3H81 A;  5DU8 A;  3ZWB A;  3R0O A;  4MOU A;  3N6R B;  2WTB A;  5DU4 A;  2FW2 A;  5CTB A;  3T8B A;  5E0S A;  1Y7O A;  1X0U A;  1DUB A;  4G2R A;  4JYL A;  2C8T A;  5INF A;  4QII A;  3T3W A;  1HZD A;  2X24 A;  2HW5 A;  1TYF A;  3R9T A;  5DU6 A;  2ZL4 A;  5DTP A;  3P85 A;  3HRX A;  3MOY A;  1UYR A;  5INI A;  1J7X A;  3JU1 A;  4ZU2 A;  3L3S A;  4FND A;  5FIF A;  3NJD A;  2NP9 A;  2PBP A;  2VX2 A;  3SWX A;  3KTK A;  2VSU E;  4RCN A;  3ST9 A;  4K29 A;  4Z0M A;  1NZY B;  5ING A;  3GMA A;  3HIN A;  3QYR A;  2J5I A;  3GF3 A;  3T89 A;  5IKL B;  2VSU C;  1UYT A;  4MXI A;  2F6Q A;  4Q1I A;  5DKP A;  3V5I A;  5G1Q A;  4OLQ A;  3FF6 A;  1FC7 A;  4KWB A;  2ZL3 A;  4JJT A;  3MT6 A;  3MYB A;  5E0S H;  4LK5 A;  3PZK A;  1JXZ A;  3H0U A;  3QRE A;  3Q0J A;  4U0G H;  3R9S A;  3Q1T A;  2J5G D;  4RYF A;  3TZ3 A;  4ELX A;  4B3I A;  1Q51 A;  5CTC A;  2VSS A;  4FNB A;  3U9T B;  5FUS A;  3TVU A;  3OC7 A;  2ZL0 A;  4F47 A;  2F9I B;  3NJB A;  3TV5 A;  1VRG A;  4OG1 A;  5DUF A;  4JCS A;  3BPP A;  5DUC A;  4K2N A;  4FJW D;  1SZO A;  2QQ3 A;  3SLL A;  4KNP A;  1FCF A;  2W3P A;  3QK8 A;  3M6M A;  2F9I A;  2BZR A;  3HE2 A;  3ZW9 A;  4JVT A;  2Q35 A;  3G64 A;  4FN7 A;  3M6N A;  3PGQ A;  1XX4 A;  3FDU A;  4U0G A;  3H0Q A;  4JYJ A;  2A7K A;  2Q2X A;  4OMR A;  1SG4 A;  2A81 A;  3U9R B;  1PIX A;  3ZWC A;  3KTJ A;  1Q52 A;  4GM2 A;  3RRV A;  3V5E A;  2Q34 A;  2ZL2 A;  3QMJ A;  3KTG A;  3P5M A;  1WDL A;  1UYS A;  4WCZ A;  4ZDB A;  3TVW A;  2GTR A;  1WDK A;  1FC9 A;  3GLM A;  2ZQR A;  3H0J A;  4WZ8 B;  3U9S B;  1WZ8 A;  3VIV A;  4FZW A;  3TT7 A;  2VSU A;  4FZW C;  2CBY A;  1K39 A;  4ZDF A;  4WYO B;  1HNU A;  1FC6 A;  1K32 A;  1UIY A;  3K8X A;  2UZF A;  1TG6 A;  5C90 A;  1WDM A;  4YLH A;  2FBM A;  3QWD A;  3R9Q A;  1HNO A;  5C9G A;  2J5I B;  4NNQ A;  4IZC A;  3KTH A;  1N6E A;  4EML A;  4MI2 A;  5DTW A;  3LKE A;  1YG6 A;  3WG5 A;  5G1R A;  2CE3 A;  4IZD A;  4U18 A;  3KTI A;  4L8K A;  3I47 A;  4B3H A;  3OME A;  4JSB A;  2ZQQ A;  4JCR A;  5E0N X;  3T8A A;  3TDC A;  4FB8 A;  5JBX A;  1XNV A;  1RJN A;  1ON3 A;  4EMM A;  4KPK A;  3IB9 A;  4FN8 A;  4ZDC A;  2J5G A;  4B3J A;  5JBW A;  2VSS F;  3Q7H A;  3GF7 A;  1N6D A;  3KQF A;  3RSI A;  3GKB A;  3HP0 A;  2J5I I;  3QKA A;  3STA A;  5KDR B;  4HC8 A;  2J5S A;  4HNK A;  4U19 A;  4I42 A;  1RJM A;  1EY3 A;  4IZB A;  4L6W A;  5DL1 A;  3TRR A;  2EJ5 A;  2A7S A;  2F6I A;  4NEK A;  3R6H A;  4JCQ A;  1N6F A;  2DUB A;  3H0S A;  5MGB A;  3H02 A;  3PE8 A;  1ON9 A;  4KD6 A;  1XNY A;  2X58 A;  3Q0G A;  3T88 A;  4ELS A;  4I52 A;  3IBB A;  1XO6 A;  3OT6 A;  3QXZ A; 
#chains in the Genus database with same CATH topology
 1OD2 A;  3ISA A;  2F9Y A;  4EMP A;  5G1S A;  4JCT A;  1YG8 A;  3LAO A;  4JFC A;  4QIJ A;  4GHN A;  4JOT A;  4RYF H;  2PPY A;  3DJA A;  5KDR A;  2F9Y B;  4K3W A;  1W2X A;  1XNW A;  3RST A;  4DI1 A;  1EF8 A;  3MFM A;  4JWV A;  2IEX A;  4ZDD A;  3K50 A;  1OD4 A;  1UYV A;  2DEO A;  3DOR A;  5KJP A;  2VSU F;  2D3T A;  1PJH A;  4U1A A;  3TT6 A;  5DZK A;  1NZY A;  4Q0G A;  1EF9 A;  2FZS A;  4QFE A;  3BEZ A;  5DZK H;  3P2L A;  4U0H A;  3TLF A;  2VRE A;  1O8U A;  3HLN 1;  1MJ3 A;  3BF0 A;  3ZWA A;  4ELW A;  2VSS E;  4ZDE A;  1DCI A;  4I4Z A;  3IAV A;  3QXI A;  3ZW8 A;  4ASI A;  3PEA A;  2PG8 A;  3H81 A;  5DU8 A;  3ZWB A;  3R0O A;  4MOU A;  3N6R B;  2WTB A;  5DU4 A;  2FW2 A;  5CTB A;  3T8B A;  5E0S A;  1Y7O A;  1X0U A;  1DUB A;  4G2R A;  4JYL A;  2C8T A;  5INF A;  4QII A;  3T3W A;  1HZD A;  2X24 A;  2HW5 A;  1TYF A;  3R9T A;  5DU6 A;  2ZL4 A;  5DTP A;  3P85 A;  3HRX A;  3MOY A;  1UYR A;  5INI A;  1J7X A;  3JU1 A;  4ZU2 A;  3L3S A;  4FND A;  5FIF A;  3NJD A;  2NP9 A;  2PBP A;  2VX2 A;  3SWX A;  3KTK A;  2VSU E;  4RCN A;  3ST9 A;  4K29 A;  4Z0M A;  1NZY B;  5ING A;  3GMA A;  3HIN A;  3QYR A;  2J5I A;  3GF3 A;  3T89 A;  5IKL B;  2VSU C;  1UYT A;  4MXI A;  2F6Q A;  4HDT A;  4Q1I A;  5DKP A;  3V5I A;  5G1Q A;  4OLQ A;  3FF6 A;  1FC7 A;  4KWB A;  2ZL3 A;  4JJT A;  3MT6 A;  3MYB A;  5E0S H;  4LK5 A;  3PZK A;  1JXZ A;  3H0U A;  3QRE A;  3Q0J A;  4U0G H;  3R9S A;  3Q1T A;  2J5G D;  4RYF A;  3TZ3 A;  4ELX A;  4B3I A;  1Q51 A;  5CTC A;  2VSS A;  4FNB A;  3U9T B;  5FUS A;  3TVU A;  3OC7 A;  2ZL0 A;  4F47 A;  2F9I B;  3NJB A;  3TV5 A;  1VRG A;  4OG1 A;  5DUF A;  4JCS A;  3BPP A;  5DUC A;  4K2N A;  4FJW D;  1SZO A;  2QQ3 A;  3SLL A;  4KNP A;  1FCF A;  2W3P A;  3QK8 A;  3M6M A;  2F9I A;  2BZR A;  3HE2 A;  3ZW9 A;  4JVT A;  2Q35 A;  3G64 A;  4FN7 A;  3M6N A;  3PGQ A;  1XX4 A;  2YJG A;  3FDU A;  4U0G A;  3H0Q A;  4JYJ A;  2A7K A;  2Q2X A;  4OMR A;  1SG4 A;  2A81 A;  3U9R B;  1PIX A;  3ZWC A;  3KTJ A;  1Q52 A;  4J2U A;  4GM2 A;  3RRV A;  3V5E A;  2Q34 A;  2ZL2 A;  3QMJ A;  3KTG A;  3P5M A;  1WDL A;  4NAR A;  1UYS A;  4WCZ A;  4ZDB A;  3TVW A;  2GTR A;  1WDK A;  1FC9 A;  3GLM A;  2ZQR A;  3H0J A;  4WZ8 B;  3U9S B;  1WZ8 A;  3VIV A;  4FZW A;  3TT7 A;  2VSU A;  4FZW C;  2CBY A;  1K39 A;  4ZDF A;  4WYO B;  1HNU A;  1FC6 A;  1K32 A;  1UIY A;  3K8X A;  5HUQ A;  2UZF A;  3BPT A;  1TG6 A;  5C90 A;  1WDM A;  4YLH A;  2FBM A;  3QWD A;  3R9Q A;  1HNO A;  5C9G A;  2J5I B;  4NNQ A;  4IZC A;  3KTH A;  1N6E A;  4EML A;  4MI2 A;  5DTW A;  3LKE A;  1YG6 A;  3WG5 A;  5G1R A;  2CE3 A;  4IZD A;  4U18 A;  3KTI A;  4L8K A;  3I47 A;  4B3H A;  3OME A;  4JSB A;  2ZQQ A;  4JCR A;  5E0N X;  3T8A A;  3TDC A;  4FB8 A;  5JBX A;  1XNV A;  1RJN A;  1ON3 A;  4EMM A;  4KPK A;  3IB9 A;  4FN8 A;  4ZDC A;  2J5G A;  4B3J A;  5JBW A;  2VSS F;  3Q7H A;  3GF7 A;  1N6D A;  3KQF A;  3RSI A;  3GKB A;  3HP0 A;  2J5I I;  3QKA A;  3STA A;  5KDR B;  4HC8 A;  2J5S A;  4HNK A;  4U19 A;  4I42 A;  1RJM A;  1EY3 A;  4IZB A;  4L6W A;  5DL1 A;  3TRR A;  2EJ5 A;  2A7S A;  2F6I A;  4NEK A;  3R6H A;  4JCQ A;  1N6F A;  2DUB A;  3H0S A;  5MGB A;  3H02 A;  3PE8 A;  1ON9 A;  4KD6 A;  1XNY A;  2X58 A;  3Q0G A;  3T88 A;  4ELS A;  4I52 A;  3IBB A;  1XO6 A;  3OT6 A;  3QXZ A; 
#chains in the Genus database with same CATH homology
 1OD2 A;  3ISA A;  2F9Y A;  4EMP A;  5G1S A;  4JCT A;  1YG8 A;  3LAO A;  4JFC A;  4QIJ A;  4GHN A;  4JOT A;  4RYF H;  2PPY A;  3DJA A;  5KDR A;  2F9Y B;  4K3W A;  1W2X A;  1XNW A;  3RST A;  4DI1 A;  1EF8 A;  3MFM A;  4JWV A;  2IEX A;  4ZDD A;  3K50 A;  1OD4 A;  1UYV A;  2DEO A;  3DOR A;  5KJP A;  2VSU F;  2D3T A;  1PJH A;  4U1A A;  3TT6 A;  5DZK A;  1NZY A;  4Q0G A;  1EF9 A;  2FZS A;  4QFE A;  3BEZ A;  5DZK H;  3P2L A;  4U0H A;  3TLF A;  2VRE A;  1O8U A;  3HLN 1;  1MJ3 A;  3BF0 A;  3ZWA A;  4ELW A;  2VSS E;  4ZDE A;  1DCI A;  4I4Z A;  3IAV A;  3QXI A;  3ZW8 A;  4ASI A;  3PEA A;  2PG8 A;  3H81 A;  5DU8 A;  3ZWB A;  3R0O A;  4MOU A;  3N6R B;  2WTB A;  5DU4 A;  2FW2 A;  5CTB A;  3T8B A;  5E0S A;  1Y7O A;  1X0U A;  1DUB A;  4G2R A;  4JYL A;  2C8T A;  5INF A;  4QII A;  3T3W A;  1HZD A;  2X24 A;  2HW5 A;  1TYF A;  3R9T A;  5DU6 A;  2ZL4 A;  5DTP A;  3P85 A;  3HRX A;  3MOY A;  1UYR A;  5INI A;  1J7X A;  3JU1 A;  4ZU2 A;  3L3S A;  4FND A;  5FIF A;  3NJD A;  2NP9 A;  2PBP A;  2VX2 A;  3SWX A;  3KTK A;  2VSU E;  4RCN A;  3ST9 A;  4K29 A;  4Z0M A;  1NZY B;  5ING A;  3GMA A;  3HIN A;  3QYR A;  2J5I A;  3GF3 A;  3T89 A;  5IKL B;  2VSU C;  1UYT A;  4MXI A;  2F6Q A;  4HDT A;  4Q1I A;  5DKP A;  3V5I A;  5G1Q A;  4OLQ A;  3FF6 A;  1FC7 A;  4KWB A;  2ZL3 A;  4JJT A;  3MT6 A;  3MYB A;  5E0S H;  4LK5 A;  3PZK A;  1JXZ A;  3H0U A;  3QRE A;  3Q0J A;  4U0G H;  3R9S A;  3Q1T A;  2J5G D;  4RYF A;  3TZ3 A;  4ELX A;  4B3I A;  1Q51 A;  5CTC A;  2VSS A;  4FNB A;  3U9T B;  5FUS A;  3TVU A;  3OC7 A;  2ZL0 A;  4F47 A;  2F9I B;  3NJB A;  3TV5 A;  1VRG A;  4OG1 A;  5DUF A;  4JCS A;  3BPP A;  5DUC A;  4K2N A;  4FJW D;  1SZO A;  2QQ3 A;  3SLL A;  4KNP A;  1FCF A;  2W3P A;  3QK8 A;  3M6M A;  2F9I A;  2BZR A;  3HE2 A;  3ZW9 A;  4JVT A;  2Q35 A;  3G64 A;  4FN7 A;  3M6N A;  3PGQ A;  1XX4 A;  2YJG A;  3FDU A;  4U0G A;  3H0Q A;  4JYJ A;  2A7K A;  2Q2X A;  4OMR A;  1SG4 A;  2A81 A;  3U9R B;  1PIX A;  3ZWC A;  3KTJ A;  1Q52 A;  4J2U A;  4GM2 A;  3RRV A;  3V5E A;  2Q34 A;  2ZL2 A;  3QMJ A;  3KTG A;  3P5M A;  1WDL A;  4NAR A;  1UYS A;  4WCZ A;  4ZDB A;  3TVW A;  2GTR A;  1WDK A;  1FC9 A;  3GLM A;  2ZQR A;  3H0J A;  4WZ8 B;  3U9S B;  1WZ8 A;  3VIV A;  4FZW A;  3TT7 A;  2VSU A;  4FZW C;  2CBY A;  1K39 A;  4ZDF A;  4WYO B;  1HNU A;  1FC6 A;  1K32 A;  1UIY A;  3K8X A;  5HUQ A;  2UZF A;  3BPT A;  1TG6 A;  5C90 A;  1WDM A;  4YLH A;  2FBM A;  3QWD A;  3R9Q A;  1HNO A;  5C9G A;  2J5I B;  4NNQ A;  4IZC A;  3KTH A;  1N6E A;  4EML A;  4MI2 A;  5DTW A;  3LKE A;  1YG6 A;  3WG5 A;  5G1R A;  2CE3 A;  4IZD A;  4U18 A;  3KTI A;  4L8K A;  3I47 A;  4B3H A;  3OME A;  4JSB A;  2ZQQ A;  4JCR A;  5E0N X;  3T8A A;  3TDC A;  4FB8 A;  5JBX A;  1XNV A;  1RJN A;  1ON3 A;  4EMM A;  4KPK A;  3IB9 A;  4FN8 A;  4ZDC A;  2J5G A;  4B3J A;  5JBW A;  2VSS F;  3Q7H A;  3GF7 A;  1N6D A;  3KQF A;  3RSI A;  3GKB A;  3HP0 A;  2J5I I;  3QKA A;  3STA A;  5KDR B;  4HC8 A;  2J5S A;  4HNK A;  4U19 A;  4I42 A;  1RJM A;  1EY3 A;  4IZB A;  4L6W A;  5DL1 A;  3TRR A;  2EJ5 A;  2A7S A;  2F6I A;  4NEK A;  3R6H A;  4JCQ A;  1N6F A;  2DUB A;  3H0S A;  5MGB A;  3H02 A;  3PE8 A;  1ON9 A;  4KD6 A;  1XNY A;  2X58 A;  3Q0G A;  3T88 A;  4ELS A;  4I52 A;  3IBB A;  1XO6 A;  3OT6 A;  3QXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...