4EMOA

Crystal structure of the ph domain of sharpin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
AAVLMAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSMHFLNPQEAQRWAVLVRGATV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sharpin
publication title Structural Analysis of SHARPIN, a Subunit of a Large Multi-protein E3 Ubiquitin Ligase, Reveals a Novel Dimerization Function for the Pleckstrin Homology Superfold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 19
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16764 Sharpin_PH Sharpin PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4emoA00
3MDBC 3SO6A 2DA0A 2ZPYA 4HAZB 3ZVRA 1P6SA 3ML4A 1FOEA 3TW1A 3MPXA 4HAYB 1Y19B 2YT0A 2DHIA 4WJ7A 2YF0A 4IOYX 1U27A 5JHGA 1WG7A 1MIXA 2UVMA 1K5GB 5KCVA 3F5RA 4HDQA 1NU2A 4TKNA 5CLLB 1WGQA 5DI9B 1V61A 2N23A 2UZSA 4KVGB 2DFKA 5D3VA 3VIAA 4Z2MB 3GYOA 3TCAA 2J0JA 4K81A 1FGYA 2D10A 5DIFB 4GMVA 3TFMA 5FI1A 2DHKA 5KQ4A 3U7DA 1XX0A 1ZSQA 1ZVRA 2Q13A 4HAXB 2Y7BA 3TO1A 3SNHA 1DBHA 3D8EA 4CHJA 1TJ6A 2E2XA 2NMBA 1P5TA 1OQNA 1H4RA 2ROVA 3SUZA 4BBKA 2YRYA 2LYDA 4KHOA 5KQ1A 1DDWA 4MT7A 1UEFA 3ULBA 2ADZA 3HQCA 1U5DA 2LULA 2DLWA 2I5FA 4MY6A 2M38A 3SV1A 3G9WA 1V89A 2K2JA 3X23A 1U5GA 1UPRA 2EJ8A 3UZTA 1MIZB 4GMXB 4D0NB 3ODWA 2P0HA 4HAUB 5GOWB 4YL8A 3IVFA 4HATB 1ZC4B 2EMSA 2YVCA 5JHHA 3PP2A 1M7RA 4ZRKA 1OY2A 3KRWA 2DYNA 3BJIA 2LG1A 1V5PA 1N3HA 2YS5A 1BTNA 1P3RA 3KZ1A 5D3YA 1X1FA 2RVBB 4WSFA 2KGXB 3ZDTA 5JP4A 5C79A 3BINA 4MK0A 3V5WA 5FI0A 3N7CA 3RCPA 1WJ1A 1KZGA 2RLOA 4GPTB 4IFSA 4F7HA 1Q67A 1GG3A 1M7EA 5HE3A 3D8DA 1J0WA 2QKLA 4DX90 3TVVA 2L2IA 2V76A 1MAIA 2I1KA 4C0AA 1E5WA 2CODA 4A6HA 4YONA 5DHFB 5DH9B 4L6EA 1PMSA 1EGXA 1NTYA 2Y8GA 2DX1A 1RJ2A 1H10A 4F7GA 5L81A 1FGZA 3KRXA 4K17A 4CYEA 4PNKA 2GCJA 3HW2B 1XR0B 2FJLA 2P8VA 1U2BA 2D11A 2YS3A 1FAOA 2COFA 1DDMA 2CRFA 4CHMA 2J0KA 2D9XA 3T06A 4K2OA 4EJNA 1WI1A 4NY0A 1DDVA 4HDOA 1RRPB 1W1DA 2HE7A 5CLQB 2YSZA 3O96A 1FHXA 2K2UA 2DYQA 1GC7A 2AEHA 5C5BA 2D9VA 1ZC3B 2D9WA 2JP2A 3QIJA 1BWNA 2DTCA 4EMOA 1SGHA 2YT1A 3CIKA 5J3YA 2IYBA 3D8FA 4IAPA 4NSWA 2GS0A 2MDXA 2DHJA 3PVLA 1BAKA 5J3TA 1XODA 3AJ4A 3LJUX 3PEGA 1LW3A 1TQZA 1I7AA 2UZRA 5LONB 4KAXB 3PVUA 4Y94A 1WGUA 3KSYA 5JLJB 4HAWB 4HB4B 2GJYA 1DYNA 5HE2A 1X11A 1KZ7A 1Y5OA 1X1GA 1EAZA 2ELAA 2KCJA 2DN6A 1PLSA 1V5UA 2R0DA 2IFSA 2GCLA 2ELBA 3CXBB 1U29A 1WJMA 2J0MA 2R09A 4GN1A 1V88A 2N0YA 4F7UP 4XWXA 3ULCA 2J59M 2QKMA 3P6AA 1X86A 1K5DB 2XQNM 4K2PA 4TYZA 2CAYA 2EMTA 2W2XC 5C5BB 5C6RA 4EKUA 2Y8FA 1SHCA 1UNRA 3DXEA 2I1JA 3A8QA 4WVFB 3AU4A 2MFQA 1UNPA 1IRSA 4HB0B 2ROZB 2DX5A 3DXDA 1EF1A 2H7EA 3DXCA 1ISNA 3F0WA 1V5MA 2H7DA 5HE0A 4GXBA 3WYFB 2VSZA 4KHAA 1Z87A 1FHWA 1ZM0A 4DX8A 2W2XD 4P7IA 3AU5A 4HAVB 1J19A 3GYPA 4KHBB 1UNQA 1KI1B 1QC6A 3OANA 4ZRIA 3VOQA 5C16A 2I5CA 2DKQA 2Z0OA 2P0FA 2MKRA 3A98B 2CY4A 1MKEA 4PQ0A 4A6FA 2X18A 1U5FA 1UPQA 2LOZA 3SYXA 1W1HA 2DKPA 1AQCA 2D9ZA 1TXDA 3ODXA 1XCGA 2PZ1A 5D3XA 5EFXA 3PSCA 4HHVA 4B6HA 1OMWA 2D4QA 2Z0QA 3ODOA 2CY5A 2LOXA 3QWMA 5J3QA 2G35A 2K00A 2NZ8B 2Z0PA 2VRWB 1BTKA 2RNRB 4GZUA 1NI2A 5HE1A 5D27A 1GC6A 2COAA 3KY9A 3NSUA 3M1IB 2KUPA 1W1GA 1WVHA 2D2QA 2HTHB 4HB2B 3U8ZA 1DROA 1XD4A 2COCA 3A8PA 2OQBA 1FB8A 2AL6A 2RGNB 4A6KA 2EC1A 4A5KA 1QQGA 2MWNB 2P0DA 4H8SA 1PFJA 2RUKB 2L1CA 4DXAB 3HK0A 5D3WA 1FHOA 2RSGA 2YS1A 1LB1A 1MPHA 1EVHA 1U5EA 1I2HA 2BCJA 2OTXA 3P7ZA 4ZRJA 2LKOA 1X05A 1B55A 3FM8C 1MK7B 1NTVA 4A6FB 3PVWA 5LOPB 2VKIA 1AWEA 2W2WA 4HB3B 3QBVB 3PZDA 3FSSA 5DHAB 3FEHA 1MK9B 3PG7A 1XKEA 2M14A 4Z2NA 2D9YA 4DBBA 3WA0A
chains in the Genus database with same CATH superfamily
3MDBC 3SO6A 4L1RA 2DA0A 2ZPYA 4HAZB 3ZVRA 1P6SA 3ML4A 1FOEA 3TW1A 3MPXA 4HAYB 1Y19B 2YT0A 2DHIA 4WJ7A 4QJ3B 2YF0A 3HSAA 4IOYX 1U27A 5JHGA 1WG7A 1MIXA 2UVMA 1K5GB 5KCVA 3F5RA 4HDQA 1NU2A 4TKNA 5CLLB 1WGQA 5DI9B 1V61A 2N23A 2UZSA 4KVGB 2DFKA 5D3VA 2R2YA 3VIAA 4Z2MB 2K49A 3GYOA 3TCAA 2J0JA 4K81A 1FGYA 2D10A 5DIFB 2KUQA 4GMVA 3TFMA 5FI1A 2DHKA 3NWAA 5KQ4A 2Z4DA 3U7DA 4QXAB 1XX0A 1ZSQA 1ZVRA 2Q13A 4HAXB 2Y7BA 3TO1A 4HSIA 3SNHA 1DBHA 3D8EA 4CHJA 1TJ6A 2E2XA 2NMBA 1P5TA 1OQNA 1H4RA 2ROVA 3SUZA 4BBKA 2YRYA 2LYDA 4KHOA 5KQ1A 1DDWA 4MT7A 1UEFA 3ULBA 2ADZA 3HQCA 1U5DA 2LULA 2DLWA 2I5FA 4MY6A 2M38A 3SV1A 3G9WA 1V89A 2K2JA 3X23A 1U5GA 1UPRA 2EJ8A 3UZTA 1MIZB 2Z59A 4GMXB 4D0NB 3ODWA 2P0HA 4HAUB 5GOWB 4YL8A 3IVFA 4HATB 5IRSA 1ZC4B 2EMSA 2YVCA 5JHHA 3PP2A 1M7RA 4ZRKA 1OY2A 3KRWA 2DYNA 3BJIA 2LG1A 1V5PA 1N3HA 2YS5A 1BTNA 1P3RA 3KZ1A 2GUMA 5D3YA 5I2SA 5I2MA 1X1FA 2RVBB 4WSFA 2KGXB 3ZDTA 5JP4A 5C79A 2ZKMX 3BINA 4MK0A 3V5WA 4QJ4B 5FI0A 3N7CA 3RCPA 1WJ1A 1KZGA 2RLOA 2KIGA 4GPTB 4IFSA 4F7HA 1Q67A 1GG3A 1M7EA 5HE3A 3D8DA 1J0WA 2QKLA 4DX90 3TVVA 2L2IA 2V76A 1MAIA 2I1KA 3A58A 4C0AA 1E5WA 2CODA 4A6HA 4YONA 5DHFB 5DH9B 4L6EA 1PMSA 1EGXA 1NTYA 2Y8GA 2DX1A 1RJ2A 1H10A 3NWDA 4F7GA 5L81A 4CSQA 1FGZA 3KRXA 4K17A 4CYEA 4PNKA 2GCJA 3HW2B 1XR0B 2FJLA 2P8VA 1U2BA 2D11A 2YS3A 1FAOA 2COFA 1DDMA 2CRFA 4QJ5B 4CHMA 2J0KA 2D9XA 3T06A 4K2OA 4EJNA 3OHMB 1WI1A 4NY0A 1DDVA 4HDOA 1RRPB 1W1DA 2HE7A 5CLQB 1T77A 2YSZA 3O96A 1FHXA 2K2UA 2DYQA 1GC7A 3B77A 2AEHA 5C5BA 2Z13A 2Z14A 2D9VA 4OSNA 1ZC3B 2D9WA 1ZYIA 2JP2A 3QIJA 1BWNA 2DTCA 4EMOA 1SGHA 2YT1A 3CIKA 5J3YA 2IYBA 3U12A 3D8FA 4IAPA 4NSWA 2GS0A 2MDXA 2DHJA 3PVLA 1BAKA 5J3TA 4KHBA 1XODA 3AJ4A 3LJUX 3PEGA 1LW3A 1TQZA 4D6WA 1I7AA 2NBVA 2UZRA 2KIEA 5LONB 2KR0A 4KAXB 3PVUA 4Y94A 1WGUA 3KSYA 2YT2A 5JLJB 4HAWB 4HB4B 2GJYA 1DYNA 5HE2A 4OT1A 1X11A 1KZ7A 1Y5OA 1X1GA 1EAZA 2ELAA 2KCJA 2DN6A 1PLSA 1V5UA 2R0DA 2IFSA 2GCLA 2ELBA 4GNKB 3CXBB 1U29A 1WJMA 2J0MA 2R09A 4GN1A 1V88A 2N0YA 4F7UP 4XWXA 3ULCA 2J59M 2QKMA 3P6AA 1X86A 1K5DB 2XQNM 4K2PA 4TYZA 2CAYA 2EMTA 2W2XC 5C5BB 5C6RA 4EKUA 2Y8FA 1SHCA 1UNRA 3DXEA 2I1JA 3A8QA 4WVFB 3AU4A 2MFQA 1UNPA 1IRSA 4HB0B 2ROZB 3NW8A 2DX5A 3DXDA 1EF1A 2H7EA 3DXCA 1ISNA 3F0WA 2RRFA 1V5MA 3FVCA 2H7DA 5HE0A 4GXBA 3WYFB 2VSZA 4KHAA 1Z87A 1FHWA 1ZM0A 4DX8A 2W2XD 4P7IA 3AU5A 4HAVB 3HIEA 1J19A 3GYPA 4KHBB 1UNQA 1KI1B 1QC6A 3OANA 4ZRIA 3VOQA 5C16A 2I5CA 2DKQA 2Z0OA 2P0FA 2MKRA 3A98B 5LG4B 2CY4A 1MKEA 4PQ0A 4A6FA 2X18A 1U5FA 1UPQA 2LOZA 3SYXA 1W1HA 2DKPA 1AQCA 2D9ZA 1TXDA 3ODXA 1XCGA 2PZ1A 3DCXA 5D3XA 5EFXA 3PSCA 4HHVA 4B6HA 1OMWA 2D4QA 2Z0QA 3ODOA 2CY5A 1MI1A 2LOXA 3QWMA 5J3QA 2G35A 2FJUB 2K00A 2NZ8B 2Z0PA 2VRWB 1BTKA 2RNRB 4GZUA 1NI2A 5HE1A 5D27A 1GC6A 2COAA 3KY9A 4DIXA 3NSUA 3M1IB 2KUPA 1W1GA 1WVHA 2D2QA 2HTHB 4HB2B 3U8ZA 1DROA 1XD4A 2COCA 4GOUA 3A8PA 2OQBA 3NWFA 1FB8A 2AL6A 2RGNB 4A6KA 2EC1A 4A5KA 1QQGA 2MWNB 2P0DA 4H8SA 1PFJA 5M4YB 2RUKB 2L1CA 4DXAB 3HK0A 5D3WA 2K8EA 1FHOA 2RSGA 2YS1A 1LB1A 1MPHA 1EVHA 1U5EA 1I2HA 2BCJA 2OTXA 3P7ZA 4ZRJA 2LKOA 1X05A 1B55A 3FM8C 1MK7B 1NTVA 4A6FB 3PVWA 5LOPB 2VKIA 1AWEA 2W2WA 4HB3B 3QBVB 3PZDA 3FSSA 5DHAB 3FEHA 1MK9B 3PG7A 1XKEA 2M14A 4Z2NA 2D9YA 4DBBA 3WA0A
chains in the Genus database with same CATH topology
3MDBC 3SO6A 2DA0A 2ZPYA 4HAZB 3ZVRA 1P6SA 3ML4A 1FOEA 3TW1A 3MPXA 4HAYB 1Y19B 2YT0A 2DHIA 4WJ7A 2YF0A 4IOYX 1U27A 5JHGA 1WG7A 1MIXA 2UVMA 1K5GB 5KCVA 3F5RA 4HDQA 1NU2A 4TKNA 5CLLB 1WGQA 5DI9B 1V61A 2N23A 2UZSA 4KVGB 2DFKA 5D3VA 3VIAA 4Z2MB 3GYOA 3TCAA 2J0JA 4K81A 1FGYA 2D10A 5DIFB 4GMVA 3TFMA 5FI1A 2DHKA 5KQ4A 3U7DA 1XX0A 1ZSQA 1ZVRA 2Q13A 4HAXB 2Y7BA 3TO1A 3SNHA 1DBHA 3D8EA 4CHJA 1TJ6A 2E2XA 2NMBA 1P5TA 1OQNA 1H4RA 2ROVA 3SUZA 4BBKA 2YRYA 2LYDA 4KHOA 5KQ1A 1DDWA 4MT7A 1UEFA 3ULBA 2ADZA 3HQCA 1U5DA 2LULA 2DLWA 2I5FA 4MY6A 2M38A 3SV1A 3G9WA 1V89A 2K2JA 3X23A 1U5GA 1UPRA 2EJ8A 3UZTA 1MIZB 4GMXB 4D0NB 3ODWA 2P0HA 4HAUB 5GOWB 4YL8A 3IVFA 4HATB 1ZC4B 2EMSA 2YVCA 5JHHA 3PP2A 1M7RA 4ZRKA 1OY2A 3KRWA 2DYNA 3BJIA 2LG1A 1V5PA 1N3HA 2YS5A 1BTNA 1P3RA 3KZ1A 5D3YA 1X1FA 2RVBB 4WSFA 2KGXB 3ZDTA 5JP4A 5C79A 3BINA 4MK0A 3V5WA 5FI0A 3N7CA 3RCPA 1WJ1A 1KZGA 2RLOA 4GPTB 4IFSA 4F7HA 1Q67A 1GG3A 1M7EA 5HE3A 3D8DA 1J0WA 2QKLA 4DX90 3TVVA 2L2IA 2V76A 1MAIA 2I1KA 4C0AA 1E5WA 2CODA 4A6HA 4YONA 5DHFB 5DH9B 4L6EA 1PMSA 1EGXA 1NTYA 2Y8GA 2DX1A 1RJ2A 1H10A 4F7GA 5L81A 1FGZA 3KRXA 4K17A 4CYEA 4PNKA 2GCJA 3HW2B 1XR0B 2FJLA 2P8VA 1U2BA 2D11A 2YS3A 1FAOA 2COFA 1DDMA 2CRFA 4CHMA 2J0KA 2D9XA 3T06A 4K2OA 4EJNA 1WI1A 4NY0A 1DDVA 4HDOA 1RRPB 1W1DA 2HE7A 5CLQB 2YSZA 3O96A 1FHXA 2K2UA 2DYQA 1GC7A 2AEHA 5C5BA 2D9VA 1ZC3B 2D9WA 2JP2A 3QIJA 1BWNA 2DTCA 4EMOA 1SGHA 2YT1A 3CIKA 5J3YA 2IYBA 3D8FA 4IAPA 4NSWA 2GS0A 2MDXA 2DHJA 3PVLA 1BAKA 5J3TA 1XODA 3AJ4A 3LJUX 3PEGA 1LW3A 1TQZA 1I7AA 2UZRA 5LONB 4KAXB 3PVUA 4Y94A 1WGUA 3KSYA 5JLJB 4HAWB 4HB4B 2GJYA 1DYNA 5HE2A 1X11A 1KZ7A 1Y5OA 1X1GA 1EAZA 2ELAA 2KCJA 2DN6A 1PLSA 1V5UA 2R0DA 2IFSA 2GCLA 2ELBA 3CXBB 1U29A 1WJMA 2J0MA 2R09A 4GN1A 1V88A 2N0YA 4F7UP 4XWXA 3ULCA 2J59M 2QKMA 3P6AA 1X86A 1K5DB 2XQNM 4K2PA 4TYZA 2CAYA 2EMTA 2W2XC 5C5BB 5C6RA 4EKUA 2Y8FA 1SHCA 1UNRA 3DXEA 2I1JA 3A8QA 4WVFB 3AU4A 2MFQA 1UNPA 1IRSA 4HB0B 2ROZB 2DX5A 3DXDA 1EF1A 2H7EA 3DXCA 1ISNA 3F0WA 1V5MA 2H7DA 5HE0A 4GXBA 3WYFB 2VSZA 4KHAA 1Z87A 1FHWA 1ZM0A 4DX8A 2W2XD 4P7IA 3AU5A 4HAVB 1J19A 3GYPA 4KHBB 1UNQA 1KI1B 1QC6A 3OANA 4ZRIA 3VOQA 5C16A 2I5CA 2DKQA 2Z0OA 2P0FA 2MKRA 3A98B 2CY4A 1MKEA 4PQ0A 4A6FA 2X18A 1U5FA 1UPQA 2LOZA 3SYXA 1W1HA 2DKPA 1AQCA 2D9ZA 1TXDA 3ODXA 1XCGA 2PZ1A 5D3XA 5EFXA 3PSCA 4HHVA 4B6HA 1OMWA 2D4QA 2Z0QA 3ODOA 2CY5A 2LOXA 3QWMA 5J3QA 2G35A 2K00A 2NZ8B 2Z0PA 2VRWB 1BTKA 2RNRB 4GZUA 1NI2A 5HE1A 5D27A 1GC6A 2COAA 3KY9A 3NSUA 3M1IB 2KUPA 1W1GA 1WVHA 2D2QA 2HTHB 4HB2B 3U8ZA 1DROA 1XD4A 2COCA 3A8PA 2OQBA 1FB8A 2AL6A 2RGNB 4A6KA 2EC1A 4A5KA 1QQGA 2MWNB 2P0DA 4H8SA 1PFJA 2RUKB 2L1CA 4DXAB 3HK0A 5D3WA 1FHOA 2RSGA 2YS1A 1LB1A 1MPHA 1EVHA 1U5EA 1I2HA 2BCJA 2OTXA 3P7ZA 4ZRJA 2LKOA 1X05A 1B55A 3FM8C 1MK7B 1NTVA 4A6FB 3PVWA 5LOPB 2VKIA 1AWEA 2W2WA 4HB3B 3QBVB 3PZDA 3FSSA 5DHAB 3FEHA 1MK9B 3PG7A 1XKEA 2M14A 4Z2NA 2D9YA 4DBBA 3WA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MDB C;  3SO6 A;  2DA0 A;  2ZPY A;  4HAZ B;  3ZVR A;  1P6S A;  3ML4 A;  1FOE A;  3TW1 A;  3MPX A;  4HAY B;  1Y19 B;  2YT0 A;  2DHI A;  4WJ7 A;  2YF0 A;  4IOY X;  1U27 A;  5JHG A;  1WG7 A;  1MIX A;  2UVM A;  1K5G B;  5KCV A;  3F5R A;  4HDQ A;  1NU2 A;  4TKN A;  5CLL B;  1WGQ A;  5DI9 B;  1V61 A;  2N23 A;  2UZS A;  4KVG B;  2DFK A;  5D3V A;  3VIA A;  4Z2M B;  3GYO A;  3TCA A;  2J0J A;  4K81 A;  1FGY A;  2D10 A;  5DIF B;  4GMV A;  3TFM A;  5FI1 A;  2DHK A;  5KQ4 A;  3U7D A;  1XX0 A;  1ZSQ A;  1ZVR A;  2Q13 A;  4HAX B;  2Y7B A;  3TO1 A;  3SNH A;  1DBH A;  3D8E A;  4CHJ A;  1TJ6 A;  2E2X A;  2NMB A;  1P5T A;  1OQN A;  1H4R A;  2ROV A;  3SUZ A;  4BBK A;  2YRY A;  2LYD A;  4KHO A;  5KQ1 A;  1DDW A;  4MT7 A;  1UEF A;  3ULB A;  2ADZ A;  3HQC A;  1U5D A;  2LUL A;  2DLW A;  2I5F A;  4MY6 A;  2M38 A;  3SV1 A;  3G9W A;  1V89 A;  2K2J A;  3X23 A;  1U5G A;  1UPR A;  2EJ8 A;  3UZT A;  1MIZ B;  4GMX B;  4D0N B;  3ODW A;  2P0H A;  4HAU B;  5GOW B;  4YL8 A;  3IVF A;  4HAT B;  1ZC4 B;  2EMS A;  2YVC A;  5JHH A;  3PP2 A;  1M7R A;  4ZRK A;  1OY2 A;  3KRW A;  2DYN A;  3BJI A;  2LG1 A;  1V5P A;  1N3H A;  2YS5 A;  1BTN A;  1P3R A;  3KZ1 A;  5D3Y A;  1X1F A;  2RVB B;  4WSF A;  2KGX B;  3ZDT A;  5JP4 A;  5C79 A;  3BIN A;  4MK0 A;  3V5W A;  5FI0 A;  3N7C A;  3RCP A;  1WJ1 A;  1KZG A;  2RLO A;  4GPT B;  4IFS A;  4F7H A;  1Q67 A;  1GG3 A;  1M7E A;  5HE3 A;  3D8D A;  1J0W A;  2QKL A;  4DX9 0;  3TVV A;  2L2I A;  2V76 A;  1MAI A;  2I1K A;  4C0A A;  1E5W A;  2COD A;  4A6H A;  4YON A;  5DHF B;  5DH9 B;  4L6E A;  1PMS A;  1EGX A;  1NTY A;  2Y8G A;  2DX1 A;  1RJ2 A;  1H10 A;  4F7G A;  5L81 A;  1FGZ A;  3KRX A;  4K17 A;  4CYE A;  4PNK A;  2GCJ A;  3HW2 B;  1XR0 B;  2FJL A;  2P8V A;  1U2B A;  2D11 A;  2YS3 A;  1FAO A;  2COF A;  1DDM A;  2CRF A;  4CHM A;  2J0K A;  2D9X A;  3T06 A;  4K2O A;  4EJN A;  1WI1 A;  4NY0 A;  1DDV A;  4HDO A;  1RRP B;  1W1D A;  2HE7 A;  5CLQ B;  2YSZ A;  3O96 A;  1FHX A;  2K2U A;  2DYQ A;  1GC7 A;  2AEH A;  5C5B A;  2D9V A;  1ZC3 B;  2D9W A;  2JP2 A;  3QIJ A;  1BWN A;  2DTC A;  4EMO A;  1SGH A;  2YT1 A;  3CIK A;  5J3Y A;  2IYB A;  3D8F A;  4IAP A;  4NSW A;  2GS0 A;  2MDX A;  2DHJ A;  3PVL A;  1BAK A;  5J3T A;  1XOD A;  3AJ4 A;  3LJU X;  3PEG A;  1LW3 A;  1TQZ A;  1I7A A;  2UZR A;  5LON B;  4KAX B;  3PVU A;  4Y94 A;  1WGU A;  3KSY A;  5JLJ B;  4HAW B;  4HB4 B;  2GJY A;  1DYN A;  5HE2 A;  1X11 A;  1KZ7 A;  1Y5O A;  1X1G A;  1EAZ A;  2ELA A;  2KCJ A;  2DN6 A;  1PLS A;  1V5U A;  2R0D A;  2IFS A;  2GCL A;  2ELB A;  3CXB B;  1U29 A;  1WJM A;  2J0M A;  2R09 A;  4GN1 A;  1V88 A;  2N0Y A;  4F7U P;  4XWX A;  3ULC A;  2J59 M;  2QKM A;  3P6A A;  1X86 A;  1K5D B;  2XQN M;  4K2P A;  4TYZ A;  2CAY A;  2EMT A;  2W2X C;  5C5B B;  5C6R A;  4EKU A;  2Y8F A;  1SHC A;  1UNR A;  3DXE A;  2I1J A;  3A8Q A;  4WVF B;  3AU4 A;  2MFQ A;  1UNP A;  1IRS A;  4HB0 B;  2ROZ B;  2DX5 A;  3DXD A;  1EF1 A;  2H7E A;  3DXC A;  1ISN A;  3F0W A;  1V5M A;  2H7D A;  5HE0 A;  4GXB A;  3WYF B;  2VSZ A;  4KHA A;  1Z87 A;  1FHW A;  1ZM0 A;  4DX8 A;  2W2X D;  4P7I A;  3AU5 A;  4HAV B;  1J19 A;  3GYP A;  4KHB B;  1UNQ A;  1KI1 B;  1QC6 A;  3OAN A;  4ZRI A;  3VOQ A;  5C16 A;  2I5C A;  2DKQ A;  2Z0O A;  2P0F A;  2MKR A;  3A98 B;  2CY4 A;  1MKE A;  4PQ0 A;  4A6F A;  2X18 A;  1U5F A;  1UPQ A;  2LOZ A;  3SYX A;  1W1H A;  2DKP A;  1AQC A;  2D9Z A;  1TXD A;  3ODX A;  1XCG A;  2PZ1 A;  5D3X A;  5EFX A;  3PSC A;  4HHV A;  4B6H A;  1OMW A;  2D4Q A;  2Z0Q A;  3ODO A;  2CY5 A;  2LOX A;  3QWM A;  5J3Q A;  2G35 A;  2K00 A;  2NZ8 B;  2Z0P A;  2VRW B;  1BTK A;  2RNR B;  4GZU A;  1NI2 A;  5HE1 A;  5D27 A;  1GC6 A;  2COA A;  3KY9 A;  3NSU A;  3M1I B;  2KUP A;  1W1G A;  1WVH A;  2D2Q A;  2HTH B;  4HB2 B;  3U8Z A;  1DRO A;  1XD4 A;  2COC A;  3A8P A;  2OQB A;  1FB8 A;  2AL6 A;  2RGN B;  4A6K A;  2EC1 A;  4A5K A;  1QQG A;  2MWN B;  2P0D A;  4H8S A;  1PFJ A;  2RUK B;  2L1C A;  4DXA B;  3HK0 A;  5D3W A;  1FHO A;  2RSG A;  2YS1 A;  1LB1 A;  1MPH A;  1EVH A;  1U5E A;  1I2H A;  2BCJ A;  2OTX A;  3P7Z A;  4ZRJ A;  2LKO A;  1X05 A;  1B55 A;  3FM8 C;  1MK7 B;  1NTV A;  4A6F B;  3PVW A;  5LOP B;  2VKI A;  1AWE A;  2W2W A;  4HB3 B;  3QBV B;  3PZD A;  3FSS A;  5DHA B;  3FEH A;  1MK9 B;  3PG7 A;  1XKE A;  2M14 A;  4Z2N A;  2D9Y A;  4DBB A;  3WA0 A; 
#chains in the Genus database with same CATH topology
 3MDB C;  3SO6 A;  4L1R A;  2DA0 A;  2ZPY A;  4HAZ B;  3ZVR A;  1P6S A;  3ML4 A;  1FOE A;  3TW1 A;  3MPX A;  4HAY B;  1Y19 B;  2YT0 A;  2DHI A;  4WJ7 A;  4QJ3 B;  2YF0 A;  3HSA A;  4IOY X;  1U27 A;  5JHG A;  1WG7 A;  1MIX A;  2UVM A;  1K5G B;  5KCV A;  3F5R A;  4HDQ A;  1NU2 A;  4TKN A;  5CLL B;  1WGQ A;  5DI9 B;  1V61 A;  2N23 A;  2UZS A;  4KVG B;  2DFK A;  5D3V A;  2R2Y A;  3VIA A;  4Z2M B;  2K49 A;  3GYO A;  3TCA A;  2J0J A;  4K81 A;  1FGY A;  2D10 A;  5DIF B;  2KUQ A;  4GMV A;  3TFM A;  5FI1 A;  2DHK A;  3NWA A;  5KQ4 A;  2Z4D A;  3U7D A;  4QXA B;  1XX0 A;  1ZSQ A;  1ZVR A;  2Q13 A;  4HAX B;  2Y7B A;  3TO1 A;  4HSI A;  3SNH A;  1DBH A;  3D8E A;  4CHJ A;  1TJ6 A;  2E2X A;  2NMB A;  1P5T A;  1OQN A;  1H4R A;  2ROV A;  3SUZ A;  4BBK A;  2YRY A;  2LYD A;  4KHO A;  5KQ1 A;  1DDW A;  4MT7 A;  1UEF A;  3ULB A;  2ADZ A;  3HQC A;  1U5D A;  2LUL A;  2DLW A;  2I5F A;  4MY6 A;  2M38 A;  3SV1 A;  3G9W A;  1V89 A;  2K2J A;  3X23 A;  1U5G A;  1UPR A;  2EJ8 A;  3UZT A;  1MIZ B;  2Z59 A;  4GMX B;  4D0N B;  3ODW A;  2P0H A;  4HAU B;  5GOW B;  4YL8 A;  3IVF A;  4HAT B;  5IRS A;  1ZC4 B;  2EMS A;  2YVC A;  5JHH A;  3PP2 A;  1M7R A;  4ZRK A;  1OY2 A;  3KRW A;  2DYN A;  3BJI A;  2LG1 A;  1V5P A;  1N3H A;  2YS5 A;  1BTN A;  1P3R A;  3KZ1 A;  2GUM A;  5D3Y A;  5I2S A;  5I2M A;  1X1F A;  2RVB B;  4WSF A;  2KGX B;  3ZDT A;  5JP4 A;  5C79 A;  2ZKM X;  3BIN A;  4MK0 A;  3V5W A;  4QJ4 B;  5FI0 A;  3N7C A;  3RCP A;  1WJ1 A;  1KZG A;  2RLO A;  2KIG A;  4GPT B;  4IFS A;  4F7H A;  1Q67 A;  1GG3 A;  1M7E A;  5HE3 A;  3D8D A;  1J0W A;  2QKL A;  4DX9 0;  3TVV A;  2L2I A;  2V76 A;  1MAI A;  2I1K A;  3A58 A;  4C0A A;  1E5W A;  2COD A;  4A6H A;  4YON A;  5DHF B;  5DH9 B;  4L6E A;  1PMS A;  1EGX A;  1NTY A;  2Y8G A;  2DX1 A;  1RJ2 A;  1H10 A;  3NWD A;  4F7G A;  5L81 A;  4CSQ A;  1FGZ A;  3KRX A;  4K17 A;  4CYE A;  4PNK A;  2GCJ A;  3HW2 B;  1XR0 B;  2FJL A;  2P8V A;  1U2B A;  2D11 A;  2YS3 A;  1FAO A;  2COF A;  1DDM A;  2CRF A;  4QJ5 B;  4CHM A;  2J0K A;  2D9X A;  3T06 A;  4K2O A;  4EJN A;  3OHM B;  1WI1 A;  4NY0 A;  1DDV A;  4HDO A;  1RRP B;  1W1D A;  2HE7 A;  5CLQ B;  1T77 A;  2YSZ A;  3O96 A;  1FHX A;  2K2U A;  2DYQ A;  1GC7 A;  3B77 A;  2AEH A;  5C5B A;  2Z13 A;  2Z14 A;  2D9V A;  4OSN A;  1ZC3 B;  2D9W A;  1ZYI A;  2JP2 A;  3QIJ A;  1BWN A;  2DTC A;  4EMO A;  1SGH A;  2YT1 A;  3CIK A;  5J3Y A;  2IYB A;  3U12 A;  3D8F A;  4IAP A;  4NSW A;  2GS0 A;  2MDX A;  2DHJ A;  3PVL A;  1BAK A;  5J3T A;  4KHB A;  1XOD A;  3AJ4 A;  3LJU X;  3PEG A;  1LW3 A;  1TQZ A;  4D6W A;  1I7A A;  2NBV A;  2UZR A;  2KIE A;  5LON B;  2KR0 A;  4KAX B;  3PVU A;  4Y94 A;  1WGU A;  3KSY A;  2YT2 A;  5JLJ B;  4HAW B;  4HB4 B;  2GJY A;  1DYN A;  5HE2 A;  4OT1 A;  1X11 A;  1KZ7 A;  1Y5O A;  1X1G A;  1EAZ A;  2ELA A;  2KCJ A;  2DN6 A;  1PLS A;  1V5U A;  2R0D A;  2IFS A;  2GCL A;  2ELB A;  4GNK B;  3CXB B;  1U29 A;  1WJM A;  2J0M A;  2R09 A;  4GN1 A;  1V88 A;  2N0Y A;  4F7U P;  4XWX A;  3ULC A;  2J59 M;  2QKM A;  3P6A A;  1X86 A;  1K5D B;  2XQN M;  4K2P A;  4TYZ A;  2CAY A;  2EMT A;  2W2X C;  5C5B B;  5C6R A;  4EKU A;  2Y8F A;  1SHC A;  1UNR A;  3DXE A;  2I1J A;  3A8Q A;  4WVF B;  3AU4 A;  2MFQ A;  1UNP A;  1IRS A;  4HB0 B;  2ROZ B;  3NW8 A;  2DX5 A;  3DXD A;  1EF1 A;  2H7E A;  3DXC A;  1ISN A;  3F0W A;  2RRF A;  1V5M A;  3FVC A;  2H7D A;  5HE0 A;  4GXB A;  3WYF B;  2VSZ A;  4KHA A;  1Z87 A;  1FHW A;  1ZM0 A;  4DX8 A;  2W2X D;  4P7I A;  3AU5 A;  4HAV B;  3HIE A;  1J19 A;  3GYP A;  4KHB B;  1UNQ A;  1KI1 B;  1QC6 A;  3OAN A;  4ZRI A;  3VOQ A;  5C16 A;  2I5C A;  2DKQ A;  2Z0O A;  2P0F A;  2MKR A;  3A98 B;  5LG4 B;  2CY4 A;  1MKE A;  4PQ0 A;  4A6F A;  2X18 A;  1U5F A;  1UPQ A;  2LOZ A;  3SYX A;  1W1H A;  2DKP A;  1AQC A;  2D9Z A;  1TXD A;  3ODX A;  1XCG A;  2PZ1 A;  3DCX A;  5D3X A;  5EFX A;  3PSC A;  4HHV A;  4B6H A;  1OMW A;  2D4Q A;  2Z0Q A;  3ODO A;  2CY5 A;  1MI1 A;  2LOX A;  3QWM A;  5J3Q A;  2G35 A;  2FJU B;  2K00 A;  2NZ8 B;  2Z0P A;  2VRW B;  1BTK A;  2RNR B;  4GZU A;  1NI2 A;  5HE1 A;  5D27 A;  1GC6 A;  2COA A;  3KY9 A;  4DIX A;  3NSU A;  3M1I B;  2KUP A;  1W1G A;  1WVH A;  2D2Q A;  2HTH B;  4HB2 B;  3U8Z A;  1DRO A;  1XD4 A;  2COC A;  4GOU A;  3A8P A;  2OQB A;  3NWF A;  1FB8 A;  2AL6 A;  2RGN B;  4A6K A;  2EC1 A;  4A5K A;  1QQG A;  2MWN B;  2P0D A;  4H8S A;  1PFJ A;  5M4Y B;  2RUK B;  2L1C A;  4DXA B;  3HK0 A;  5D3W A;  2K8E A;  1FHO A;  2RSG A;  2YS1 A;  1LB1 A;  1MPH A;  1EVH A;  1U5E A;  1I2H A;  2BCJ A;  2OTX A;  3P7Z A;  4ZRJ A;  2LKO A;  1X05 A;  1B55 A;  3FM8 C;  1MK7 B;  1NTV A;  4A6F B;  3PVW A;  5LOP B;  2VKI A;  1AWE A;  2W2W A;  4HB3 B;  3QBV B;  3PZD A;  3FSS A;  5DHA B;  3FEH A;  1MK9 B;  3PG7 A;  1XKE A;  2M14 A;  4Z2N A;  2D9Y A;  4DBB A;  3WA0 A; 
#chains in the Genus database with same CATH homology
 3MDB C;  3SO6 A;  2DA0 A;  2ZPY A;  4HAZ B;  3ZVR A;  1P6S A;  3ML4 A;  1FOE A;  3TW1 A;  3MPX A;  4HAY B;  1Y19 B;  2YT0 A;  2DHI A;  4WJ7 A;  2YF0 A;  4IOY X;  1U27 A;  5JHG A;  1WG7 A;  1MIX A;  2UVM A;  1K5G B;  5KCV A;  3F5R A;  4HDQ A;  1NU2 A;  4TKN A;  5CLL B;  1WGQ A;  5DI9 B;  1V61 A;  2N23 A;  2UZS A;  4KVG B;  2DFK A;  5D3V A;  3VIA A;  4Z2M B;  3GYO A;  3TCA A;  2J0J A;  4K81 A;  1FGY A;  2D10 A;  5DIF B;  4GMV A;  3TFM A;  5FI1 A;  2DHK A;  5KQ4 A;  3U7D A;  1XX0 A;  1ZSQ A;  1ZVR A;  2Q13 A;  4HAX B;  2Y7B A;  3TO1 A;  3SNH A;  1DBH A;  3D8E A;  4CHJ A;  1TJ6 A;  2E2X A;  2NMB A;  1P5T A;  1OQN A;  1H4R A;  2ROV A;  3SUZ A;  4BBK A;  2YRY A;  2LYD A;  4KHO A;  5KQ1 A;  1DDW A;  4MT7 A;  1UEF A;  3ULB A;  2ADZ A;  3HQC A;  1U5D A;  2LUL A;  2DLW A;  2I5F A;  4MY6 A;  2M38 A;  3SV1 A;  3G9W A;  1V89 A;  2K2J A;  3X23 A;  1U5G A;  1UPR A;  2EJ8 A;  3UZT A;  1MIZ B;  4GMX B;  4D0N B;  3ODW A;  2P0H A;  4HAU B;  5GOW B;  4YL8 A;  3IVF A;  4HAT B;  1ZC4 B;  2EMS A;  2YVC A;  5JHH A;  3PP2 A;  1M7R A;  4ZRK A;  1OY2 A;  3KRW A;  2DYN A;  3BJI A;  2LG1 A;  1V5P A;  1N3H A;  2YS5 A;  1BTN A;  1P3R A;  3KZ1 A;  5D3Y A;  1X1F A;  2RVB B;  4WSF A;  2KGX B;  3ZDT A;  5JP4 A;  5C79 A;  3BIN A;  4MK0 A;  3V5W A;  5FI0 A;  3N7C A;  3RCP A;  1WJ1 A;  1KZG A;  2RLO A;  4GPT B;  4IFS A;  4F7H A;  1Q67 A;  1GG3 A;  1M7E A;  5HE3 A;  3D8D A;  1J0W A;  2QKL A;  4DX9 0;  3TVV A;  2L2I A;  2V76 A;  1MAI A;  2I1K A;  4C0A A;  1E5W A;  2COD A;  4A6H A;  4YON A;  5DHF B;  5DH9 B;  4L6E A;  1PMS A;  1EGX A;  1NTY A;  2Y8G A;  2DX1 A;  1RJ2 A;  1H10 A;  4F7G A;  5L81 A;  1FGZ A;  3KRX A;  4K17 A;  4CYE A;  4PNK A;  2GCJ A;  3HW2 B;  1XR0 B;  2FJL A;  2P8V A;  1U2B A;  2D11 A;  2YS3 A;  1FAO A;  2COF A;  1DDM A;  2CRF A;  4CHM A;  2J0K A;  2D9X A;  3T06 A;  4K2O A;  4EJN A;  1WI1 A;  4NY0 A;  1DDV A;  4HDO A;  1RRP B;  1W1D A;  2HE7 A;  5CLQ B;  2YSZ A;  3O96 A;  1FHX A;  2K2U A;  2DYQ A;  1GC7 A;  2AEH A;  5C5B A;  2D9V A;  1ZC3 B;  2D9W A;  2JP2 A;  3QIJ A;  1BWN A;  2DTC A;  4EMO A;  1SGH A;  2YT1 A;  3CIK A;  5J3Y A;  2IYB A;  3D8F A;  4IAP A;  4NSW A;  2GS0 A;  2MDX A;  2DHJ A;  3PVL A;  1BAK A;  5J3T A;  1XOD A;  3AJ4 A;  3LJU X;  3PEG A;  1LW3 A;  1TQZ A;  1I7A A;  2UZR A;  5LON B;  4KAX B;  3PVU A;  4Y94 A;  1WGU A;  3KSY A;  5JLJ B;  4HAW B;  4HB4 B;  2GJY A;  1DYN A;  5HE2 A;  1X11 A;  1KZ7 A;  1Y5O A;  1X1G A;  1EAZ A;  2ELA A;  2KCJ A;  2DN6 A;  1PLS A;  1V5U A;  2R0D A;  2IFS A;  2GCL A;  2ELB A;  3CXB B;  1U29 A;  1WJM A;  2J0M A;  2R09 A;  4GN1 A;  1V88 A;  2N0Y A;  4F7U P;  4XWX A;  3ULC A;  2J59 M;  2QKM A;  3P6A A;  1X86 A;  1K5D B;  2XQN M;  4K2P A;  4TYZ A;  2CAY A;  2EMT A;  2W2X C;  5C5B B;  5C6R A;  4EKU A;  2Y8F A;  1SHC A;  1UNR A;  3DXE A;  2I1J A;  3A8Q A;  4WVF B;  3AU4 A;  2MFQ A;  1UNP A;  1IRS A;  4HB0 B;  2ROZ B;  2DX5 A;  3DXD A;  1EF1 A;  2H7E A;  3DXC A;  1ISN A;  3F0W A;  1V5M A;  2H7D A;  5HE0 A;  4GXB A;  3WYF B;  2VSZ A;  4KHA A;  1Z87 A;  1FHW A;  1ZM0 A;  4DX8 A;  2W2X D;  4P7I A;  3AU5 A;  4HAV B;  1J19 A;  3GYP A;  4KHB B;  1UNQ A;  1KI1 B;  1QC6 A;  3OAN A;  4ZRI A;  3VOQ A;  5C16 A;  2I5C A;  2DKQ A;  2Z0O A;  2P0F A;  2MKR A;  3A98 B;  2CY4 A;  1MKE A;  4PQ0 A;  4A6F A;  2X18 A;  1U5F A;  1UPQ A;  2LOZ A;  3SYX A;  1W1H A;  2DKP A;  1AQC A;  2D9Z A;  1TXD A;  3ODX A;  1XCG A;  2PZ1 A;  5D3X A;  5EFX A;  3PSC A;  4HHV A;  4B6H A;  1OMW A;  2D4Q A;  2Z0Q A;  3ODO A;  2CY5 A;  2LOX A;  3QWM A;  5J3Q A;  2G35 A;  2K00 A;  2NZ8 B;  2Z0P A;  2VRW B;  1BTK A;  2RNR B;  4GZU A;  1NI2 A;  5HE1 A;  5D27 A;  1GC6 A;  2COA A;  3KY9 A;  3NSU A;  3M1I B;  2KUP A;  1W1G A;  1WVH A;  2D2Q A;  2HTH B;  4HB2 B;  3U8Z A;  1DRO A;  1XD4 A;  2COC A;  3A8P A;  2OQB A;  1FB8 A;  2AL6 A;  2RGN B;  4A6K A;  2EC1 A;  4A5K A;  1QQG A;  2MWN B;  2P0D A;  4H8S A;  1PFJ A;  2RUK B;  2L1C A;  4DXA B;  3HK0 A;  5D3W A;  1FHO A;  2RSG A;  2YS1 A;  1LB1 A;  1MPH A;  1EVH A;  1U5E A;  1I2H A;  2BCJ A;  2OTX A;  3P7Z A;  4ZRJ A;  2LKO A;  1X05 A;  1B55 A;  3FM8 C;  1MK7 B;  1NTV A;  4A6F B;  3PVW A;  5LOP B;  2VKI A;  1AWE A;  2W2W A;  4HB3 B;  3QBV B;  3PZD A;  3FSS A;  5DHA B;  3FEH A;  1MK9 B;  3PG7 A;  1XKE A;  2M14 A;  4Z2N A;  2D9Y A;  4DBB A;  3WA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...