4EMOA

Crystal structure of the ph domain of sharpin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
b'AAVLMAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSMHFLNPQEAQRWAVLVRGATV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sharpin
publication title Structural Analysis of SHARPIN, a Subunit of a Large Multi-protein E3 Ubiquitin Ligase, Reveals a Novel Dimerization Function for the Pleckstrin Homology Superfold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 19
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16764 Sharpin_PH Sharpin PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4emoA00
3SV1A 5CLQB 1U5GA 4HAUB 1NU2A 1TJ6A 4HATB 2VSZA 2CRFA 2N0YA 1P6SA 2MFQA 1GC6A 5C6RA 2RGNB 3GYPA 2X18A 2BCJA 3PVUA 3PVLA 1MPHA 1RRPB 2DKPA 2W2XC 2LKOA 2DHKA 1GG3A 5HE2A 3LJUX 3PP2A 2QKMA 3HW2B 1FHWA 3DXCA 2GCLA 1ISNA 2H7DA 4EKUA 4CHJA 3A8QA 4H8SA 3D8DA 1P5TA 4HAYB 2IFSA 2IYBA 1EAZA 1NTYA 2GJYA 2HTHB 3BJIA 3D8EA 3VOQA 4MT7A 1KI1B 4PNKA 4KHAA 3A98B 5C79A 1E5WA 5CLLB 1NTVA 2EC1A 2JP2A 2MWNB 2RNRB 1XD4A 1PFJA 1V89A 2YS3A 4BBKA 4IFSA 5DHFB 3CIKA 2RLOA 3NSUA 1OQNA 5DH9B 1DDMA 1DYNA 4PQ0A 1AWEA 2YT1A 5J3YA 2VRWB 1J19A 2CODA 2EMTA 3M1IB 4CHMA 4HB4B 5KQ1A 2K2JA 4F7GA 1WGQA 2DFKA 3KSYA 2OQBA 2D2QA 5D3YA 3TFMA 2ELAA 1SGHA 1RJ2A 2CY4A 2EMSA 3P7ZA 2R09A 1KZ7A 3U7DA 2G35A 3KRWA 4DBBA 4K2PA 2UVMA 1QC6A 2FJLA 1MIZB 2COCA 4HAZB 3CXBB 1H4RA 1W1HA 2D9WA 2DN6A 4K2OA 5FI0A 2Z0OA 4EJNA 2YVCA 2RSGA 1UPRA 3X23A 1K5DB 1UNPA 2ADZA 1MIXA 2L2IA 4F7UP 1J0WA 4D0NB 3ODXA 4DXAB 1PLSA 3FSSA 2KGXB 1BWNA 2YS5A 4KHOA 2LOXA 4KVGB 2DHJA 5JLJB 3P6AA 2Z0QA 1MAIA 1WG7A 5D3XA 1N3HA 4ZRJA 5KCVA 1QQGA 2AL6A 1EGXA 2I5FA 4CYEA 1BTKA 3V5WA 2GS0A 5DHAB 3PVWA 4B6HA 1Y19B 2R0DA 5J3TA 3ODOA 5LONB 5L81A 2RUKB 2DA0A 5C16A 1V88A 2AEHA 5HE3A 1K5GB 3SO6A 2UZRA 2J0MA 1MK7B 4DX90 1W1GA 4HAXB 2YT0A 1SHCA 1V5UA 2J59M 2J0KA 3AJ4A 1KZGA 5J3QA 3TCAA 4K17A 4GZUA 1WJ1A 3F0WA 1M7RA 2V76A 2I1JA 2P8VA 1AQCA 3SUZA 3SYXA 4WVFB 2DX1A 3AU4A 2P0FA 2HE7A 2H7EA 4Y94A 1XR0B 2DHIA 5C5BB 2D11A 2I1KA 2MKRA 1EVHA 4K81A 2COFA 1Z87A 1DDVA 1U2BA 2D10A 2NZ8B 4YONA 3BINA 3T06A 3G9WA 1U5FA 3DXDA 4C0AA 1Q67A 2YRYA 2Z0PA 2D4QA 2ROVA 4NSWA 1EF1A 2M14A 5FI1A 3OANA 4GXBA 1ZSQA 4A6FB 5D27A 1XKEA 2YS1A 3TW1A 3GYOA 4IOYX 4MY6A 2M38A 2Y8GA 2K00A 1XODA 2W2WA 4HDOA 3D8FA 5EFXA 2MDXA 2LYDA 1U29A 1X05A 1W1DA 1FGZA 1UEFA 1Y5OA 1X1GA 2CAYA 1WI1A 3TVVA 4HDQA 2K2UA 1ZC4B 3MDBC 4Z2MB 3RCPA 5DIFB 4A5KA 4HAVB 4P7IA 2D9YA 1U5EA 1MK9B 2W2XD 1LW3A 1B55A 2VKIA 2P0HA 3KY9A 2J0JA 1BAKA 1WJMA 4A6KA 1DBHA 3QIJA 3PG7A 1WGUA 2Y7BA 2RVBB 1ZVRA 1TXDA 3A8PA 1DROA 5JP4A 1FOEA 4HAWB 1NI2A 3U8ZA 2DKQA 2ROZB 2E2XA 5GOWB 3ZVRA 3ML4A 3IVFA 2OTXA 1ZC3B 1ZM0A 3VIAA 4ZRKA 2N23A 1P3RA 4KHBB 3FM8C 2L1CA 4DX8A 1V61A 1XX0A 2P0DA 1X11A 3FEHA 4NY0A 4HHVA 2DX5A 2LG1A 3QWMA 3TO1A 1WVHA 2ELBA 4GMXB 3HK0A 2LULA 1I2HA 2YF0A 2D9XA 5D3VA 2DTCA 5LOPB 3WYFB 1UPQA 2CY5A 3KZ1A 4ZRIA 4GPTB 4WJ7A 4EMOA 4Z2NA 5JHGA 1IRSA 3WA0A 2ZPYA 4XWXA 1FGYA 3F5RA 1FHXA 1LB1A 2Q13A 2COAA 3ZDTA 2UZSA 3AU5A 3MPXA 4MK0A 3QBVB 4GMVA 4HB0B 5JHHA 5D3WA 2NMBA 4WSFA 2I5CA 1PMSA 2QKLA 2XQNM 5HE0A 2DLWA 3PZDA 1I7AA 1XCGA 2KUPA 1DDWA 2LOZA 4IAPA 4HB2B 4L6EA 1U27A 1H10A 3DXEA 1OMWA 1BTNA 5DI9B 1X86A 2DYNA 3KRXA 1FAOA 2Y8FA 1MKEA 2KCJA 2D9ZA 3SNHA 1UNQA 3ULCA 5C5BA 1X1FA 3HQCA 3O96A 2YSZA 5KQ4A 3ODWA 3PSCA 1GC7A 1TQZA 4F7HA 1UNRA 2DYQA 1V5PA 1OY2A 1U5DA 2GCJA 4GN1A 5HE1A 3ULBA 2EJ8A 4HB3B 3N7CA 3PEGA 1V5MA 1FB8A 2D9VA 2PZ1A 1M7EA 4A6HA 4TYZA 4A6FA 4TKNA 4YL8A 3UZTA 1FHOA 4KAXB
chains in the Genus database with same CATH superfamily
3SV1A 5CLQB 1U5GA 4HAUB 1NU2A 1TJ6A 4HATB 2VSZA 2CRFA 2N0YA 1P6SA 2MFQA 1GC6A 5C6RA 2RGNB 3GYPA 2X18A 2BCJA 3PVUA 3PVLA 1MPHA 1RRPB 2DKPA 2W2XC 2LKOA 2DHKA 1GG3A 5HE2A 3LJUX 3PP2A 2QKMA 3HW2B 1FHWA 3DXCA 2GCLA 5M4YB 1ISNA 2H7DA 4EKUA 4OSNA 4CHJA 3A8QA 4H8SA 2R2YA 3D8DA 1P5TA 4HAYB 4HSIA 2IFSA 2IYBA 1EAZA 1NTYA 2GJYA 5I2MA 2HTHB 3BJIA 5IRSA 3D8EA 3VOQA 4MT7A 1KI1B 4PNKA 4KHAA 3A98B 5C79A 1E5WA 5CLLB 1NTVA 2EC1A 2JP2A 2Z4DA 2MWNB 2RNRB 1XD4A 1PFJA 3A58A 1V89A 2YS3A 4BBKA 4IFSA 3FVCA 5DHFB 3CIKA 4CSQA 2RLOA 3NSUA 1OQNA 5DH9B 1DDMA 1DYNA 4PQ0A 1AWEA 2YT1A 5J3YA 2Z59A 2VRWB 1J19A 2CODA 2EMTA 3M1IB 4CHMA 4HB4B 5KQ1A 3NWDA 2K2JA 4F7GA 1WGQA 2DFKA 3NW8A 3KSYA 2OQBA 2D2QA 5D3YA 3TFMA 2ELAA 1SGHA 1RJ2A 2CY4A 2EMSA 3P7ZA 2R09A 1KZ7A 3U7DA 2G35A 3KRWA 4DBBA 4K2PA 2KR0A 2UVMA 1QC6A 2FJLA 1MIZB 2COCA 4HAZB 3CXBB 1H4RA 1W1HA 2D9WA 2DN6A 4K2OA 5FI0A 2Z0OA 4EJNA 2YVCA 2RSGA 1UPRA 3X23A 1K5DB 1UNPA 2ADZA 1MIXA 2L2IA 4F7UP 1J0WA 4D0NB 3ODXA 4DXAB 1PLSA 3FSSA 2KGXB 1BWNA 2YS5A 4KHOA 3DCXA 2LOXA 4KVGB 2DHJA 5JLJB 3P6AA 4D6WA 2Z0QA 1MAIA 1WG7A 5D3XA 2Z14A 1N3HA 4ZRJA 5KCVA 1QQGA 2AL6A 1EGXA 2I5FA 4CYEA 1BTKA 3V5WA 2GS0A 5DHAB 3PVWA 4B6HA 2RRFA 1Y19B 2R0DA 5J3TA 3HSAA 4GOUA 3ODOA 5LONB 3NWAA 5L81A 2RUKB 2DA0A 5C16A 1V88A 2AEHA 5HE3A 1K5GB 3SO6A 2UZRA 2K49A 2J0MA 1MK7B 4DX90 1W1GA 4HAXB 2YT0A 1SHCA 1V5UA 2J59M 2J0KA 2NBVA 3AJ4A 1KZGA 3OHMB 5J3QA 3TCAA 4K17A 4GZUA 1WJ1A 4DIXA 3F0WA 1M7RA 2V76A 2I1JA 4L1RA 2P8VA 1AQCA 3SUZA 3SYXA 4WVFB 2DX1A 3AU4A 2P0FA 2HE7A 2H7EA 4Y94A 1XR0B 2DHIA 5C5BB 4KHBA 2D11A 2I1KA 2MKRA 1EVHA 4K81A 2COFA 1Z87A 1DDVA 3HIEA 1U2BA 2D10A 2NZ8B 4YONA 3BINA 3T06A 3G9WA 1ZYIA 1U5FA 3DXDA 4C0AA 1Q67A 2YRYA 2Z0PA 2D4QA 2ROVA 4NSWA 1EF1A 2M14A 3U12A 5FI1A 3OANA 4GXBA 1ZSQA 4A6FB 5D27A 1XKEA 2YS1A 1T77A 3TW1A 3GYOA 4IOYX 4MY6A 2ZKMX 2M38A 2Y8GA 2K00A 4GNKB 1XODA 2W2WA 4HDOA 3D8FA 5LG4B 5I2SA 5EFXA 2MDXA 2LYDA 1U29A 1X05A 1W1DA 1FGZA 1UEFA 1Y5OA 2KIEA 1X1GA 2CAYA 1WI1A 3TVVA 4HDQA 2K2UA 1MI1A 1ZC4B 2KUQA 3MDBC 4Z2MB 3RCPA 5DIFB 4A5KA 2FJUB 4HAVB 4P7IA 2D9YA 2KIGA 1U5EA 1MK9B 2W2XD 1LW3A 1B55A 4OT1A 2VKIA 2P0HA 2J0JA 3KY9A 1BAKA 1WJMA 4A6KA 1DBHA 3QIJA 3PG7A 1WGUA 2Y7BA 2RVBB 1ZVRA 1TXDA 3A8PA 1DROA 2K8EA 5JP4A 1FOEA 4HAWB 1NI2A 3U8ZA 2DKQA 2ROZB 2E2XA 5GOWB 3ZVRA 3ML4A 3IVFA 2OTXA 1ZC3B 1ZM0A 3VIAA 4ZRKA 2Z13A 2N23A 1P3RA 4KHBB 3FM8C 2L1CA 4DX8A 1V61A 1XX0A 2P0DA 1X11A 3FEHA 4NY0A 4HHVA 2DX5A 2LG1A 3QWMA 3TO1A 1WVHA 2ELBA 4GMXB 3HK0A 2LULA 1I2HA 2YF0A 2D9XA 5D3VA 2DTCA 5LOPB 3WYFB 1UPQA 2CY5A 3KZ1A 4ZRIA 4GPTB 4WJ7A 4EMOA 4Z2NA 5JHGA 1IRSA 3WA0A 4QJ3B 2ZPYA 4XWXA 1FGYA 3F5RA 1FHXA 1LB1A 2Q13A 2COAA 3ZDTA 2UZSA 3AU5A 3MPXA 4MK0A 3QBVB 4GMVA 4HB0B 5JHHA 5D3WA 2NMBA 4WSFA 2I5CA 3B77A 1PMSA 2QKLA 2XQNM 5HE0A 2DLWA 3PZDA 1I7AA 1XCGA 2KUPA 1DDWA 2LOZA 4IAPA 4HB2B 3NWFA 4L6EA 1U27A 1H10A 3DXEA 1OMWA 1BTNA 5DI9B 1X86A 2DYNA 3KRXA 1FAOA 2Y8FA 1MKEA 2KCJA 2D9ZA 3SNHA 1UNQA 3ULCA 5C5BA 1X1FA 3HQCA 3O96A 4QXAB 2YSZA 5KQ4A 3ODWA 3PSCA 1GC7A 1TQZA 4F7HA 1UNRA 2DYQA 1V5PA 1OY2A 1U5DA 4QJ4B 2GCJA 4GN1A 5HE1A 2GUMA 3ULBA 2EJ8A 4HB3B 3N7CA 3PEGA 4QJ5B 1V5MA 1FB8A 2D9VA 2PZ1A 1M7EA 4A6HA 4TYZA 4A6FA 4TKNA 4YL8A 3UZTA 1FHOA 2YT2A 4KAXB
chains in the Genus database with same CATH topology
3SV1A 5CLQB 1U5GA 4HAUB 1NU2A 1TJ6A 4HATB 2VSZA 2CRFA 2N0YA 1P6SA 2MFQA 1GC6A 5C6RA 2RGNB 3GYPA 2X18A 2BCJA 3PVUA 3PVLA 1MPHA 1RRPB 2DKPA 2W2XC 2LKOA 2DHKA 1GG3A 5HE2A 3LJUX 3PP2A 2QKMA 3HW2B 1FHWA 3DXCA 2GCLA 1ISNA 2H7DA 4EKUA 4CHJA 3A8QA 4H8SA 3D8DA 1P5TA 4HAYB 2IFSA 2IYBA 1EAZA 1NTYA 2GJYA 2HTHB 3BJIA 3D8EA 3VOQA 4MT7A 1KI1B 4PNKA 4KHAA 3A98B 5C79A 1E5WA 5CLLB 1NTVA 2EC1A 2JP2A 2MWNB 2RNRB 1XD4A 1PFJA 1V89A 2YS3A 4BBKA 4IFSA 5DHFB 3CIKA 2RLOA 3NSUA 1OQNA 5DH9B 1DDMA 1DYNA 4PQ0A 1AWEA 2YT1A 5J3YA 2VRWB 1J19A 2CODA 2EMTA 3M1IB 4CHMA 4HB4B 5KQ1A 2K2JA 4F7GA 1WGQA 2DFKA 3KSYA 2OQBA 2D2QA 5D3YA 3TFMA 2ELAA 1SGHA 1RJ2A 2CY4A 2EMSA 3P7ZA 2R09A 1KZ7A 3U7DA 2G35A 3KRWA 4DBBA 4K2PA 2UVMA 1QC6A 2FJLA 1MIZB 2COCA 4HAZB 3CXBB 1H4RA 1W1HA 2D9WA 2DN6A 4K2OA 5FI0A 2Z0OA 4EJNA 2YVCA 2RSGA 1UPRA 3X23A 1K5DB 1UNPA 2ADZA 1MIXA 2L2IA 4F7UP 1J0WA 4D0NB 3ODXA 4DXAB 1PLSA 3FSSA 2KGXB 1BWNA 2YS5A 4KHOA 2LOXA 4KVGB 2DHJA 5JLJB 3P6AA 2Z0QA 1MAIA 1WG7A 5D3XA 1N3HA 4ZRJA 5KCVA 1QQGA 2AL6A 1EGXA 2I5FA 4CYEA 1BTKA 3V5WA 2GS0A 5DHAB 3PVWA 4B6HA 1Y19B 2R0DA 5J3TA 3ODOA 5LONB 5L81A 2RUKB 2DA0A 5C16A 1V88A 2AEHA 5HE3A 1K5GB 3SO6A 2UZRA 2J0MA 1MK7B 4DX90 1W1GA 4HAXB 2YT0A 1SHCA 1V5UA 2J59M 2J0KA 3AJ4A 1KZGA 5J3QA 3TCAA 4K17A 4GZUA 1WJ1A 3F0WA 1M7RA 2V76A 2I1JA 2P8VA 1AQCA 3SUZA 3SYXA 4WVFB 2DX1A 3AU4A 2P0FA 2HE7A 2H7EA 4Y94A 1XR0B 2DHIA 5C5BB 2D11A 2I1KA 2MKRA 1EVHA 4K81A 2COFA 1Z87A 1DDVA 1U2BA 2D10A 2NZ8B 4YONA 3BINA 3T06A 3G9WA 1U5FA 3DXDA 4C0AA 1Q67A 2YRYA 2Z0PA 2D4QA 2ROVA 4NSWA 1EF1A 2M14A 5FI1A 3OANA 4GXBA 1ZSQA 4A6FB 5D27A 1XKEA 2YS1A 3TW1A 3GYOA 4IOYX 4MY6A 2M38A 2Y8GA 2K00A 1XODA 2W2WA 4HDOA 3D8FA 5EFXA 2MDXA 2LYDA 1U29A 1X05A 1W1DA 1FGZA 1UEFA 1Y5OA 1X1GA 2CAYA 1WI1A 3TVVA 4HDQA 2K2UA 1ZC4B 3MDBC 4Z2MB 3RCPA 5DIFB 4A5KA 4HAVB 4P7IA 2D9YA 1U5EA 1MK9B 2W2XD 1LW3A 1B55A 2VKIA 2P0HA 3KY9A 2J0JA 1BAKA 1WJMA 4A6KA 1DBHA 3QIJA 3PG7A 1WGUA 2Y7BA 2RVBB 1ZVRA 1TXDA 3A8PA 1DROA 5JP4A 1FOEA 4HAWB 1NI2A 3U8ZA 2DKQA 2ROZB 2E2XA 5GOWB 3ZVRA 3ML4A 3IVFA 2OTXA 1ZC3B 1ZM0A 3VIAA 4ZRKA 2N23A 1P3RA 4KHBB 3FM8C 2L1CA 4DX8A 1V61A 1XX0A 2P0DA 1X11A 3FEHA 4NY0A 4HHVA 2DX5A 2LG1A 3QWMA 3TO1A 1WVHA 2ELBA 4GMXB 3HK0A 2LULA 1I2HA 2YF0A 2D9XA 5D3VA 2DTCA 5LOPB 3WYFB 1UPQA 2CY5A 3KZ1A 4ZRIA 4GPTB 4WJ7A 4EMOA 4Z2NA 5JHGA 1IRSA 3WA0A 2ZPYA 4XWXA 1FGYA 3F5RA 1FHXA 1LB1A 2Q13A 2COAA 3ZDTA 2UZSA 3AU5A 3MPXA 4MK0A 3QBVB 4GMVA 4HB0B 5JHHA 5D3WA 2NMBA 4WSFA 2I5CA 1PMSA 2QKLA 2XQNM 5HE0A 2DLWA 3PZDA 1I7AA 1XCGA 2KUPA 1DDWA 2LOZA 4IAPA 4HB2B 4L6EA 1U27A 1H10A 3DXEA 1OMWA 1BTNA 5DI9B 1X86A 2DYNA 3KRXA 1FAOA 2Y8FA 1MKEA 2KCJA 2D9ZA 3SNHA 1UNQA 3ULCA 5C5BA 1X1FA 3HQCA 3O96A 2YSZA 5KQ4A 3ODWA 3PSCA 1GC7A 1TQZA 4F7HA 1UNRA 2DYQA 1V5PA 1OY2A 1U5DA 2GCJA 4GN1A 5HE1A 3ULBA 2EJ8A 4HB3B 3N7CA 3PEGA 1V5MA 1FB8A 2D9VA 2PZ1A 1M7EA 4A6HA 4TYZA 4A6FA 4TKNA 4YL8A 3UZTA 1FHOA 4KAXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SV1 A;  5CLQ B;  1U5G A;  4HAU B;  1NU2 A;  1TJ6 A;  4HAT B;  2VSZ A;  2CRF A;  2N0Y A;  1P6S A;  2MFQ A;  1GC6 A;  5C6R A;  2RGN B;  3GYP A;  2X18 A;  2BCJ A;  3PVU A;  3PVL A;  1MPH A;  1RRP B;  2DKP A;  2W2X C;  2LKO A;  2DHK A;  1GG3 A;  5HE2 A;  3LJU X;  3PP2 A;  2QKM A;  3HW2 B;  1FHW A;  3DXC A;  2GCL A;  1ISN A;  2H7D A;  4EKU A;  4CHJ A;  3A8Q A;  4H8S A;  3D8D A;  1P5T A;  4HAY B;  2IFS A;  2IYB A;  1EAZ A;  1NTY A;  2GJY A;  2HTH B;  3BJI A;  3D8E A;  3VOQ A;  4MT7 A;  1KI1 B;  4PNK A;  4KHA A;  3A98 B;  5C79 A;  1E5W A;  5CLL B;  1NTV A;  2EC1 A;  2JP2 A;  2MWN B;  2RNR B;  1XD4 A;  1PFJ A;  1V89 A;  2YS3 A;  4BBK A;  4IFS A;  5DHF B;  3CIK A;  2RLO A;  3NSU A;  1OQN A;  5DH9 B;  1DDM A;  1DYN A;  4PQ0 A;  1AWE A;  2YT1 A;  5J3Y A;  2VRW B;  1J19 A;  2COD A;  2EMT A;  3M1I B;  4CHM A;  4HB4 B;  5KQ1 A;  2K2J A;  4F7G A;  1WGQ A;  2DFK A;  3KSY A;  2OQB A;  2D2Q A;  5D3Y A;  3TFM A;  2ELA A;  1SGH A;  1RJ2 A;  2CY4 A;  2EMS A;  3P7Z A;  2R09 A;  1KZ7 A;  3U7D A;  2G35 A;  3KRW A;  4DBB A;  4K2P A;  2UVM A;  1QC6 A;  2FJL A;  1MIZ B;  2COC A;  4HAZ B;  3CXB B;  1H4R A;  1W1H A;  2D9W A;  2DN6 A;  4K2O A;  5FI0 A;  2Z0O A;  4EJN A;  2YVC A;  2RSG A;  1UPR A;  3X23 A;  1K5D B;  1UNP A;  2ADZ A;  1MIX A;  2L2I A;  4F7U P;  1J0W A;  4D0N B;  3ODX A;  4DXA B;  1PLS A;  3FSS A;  2KGX B;  1BWN A;  2YS5 A;  4KHO A;  2LOX A;  4KVG B;  2DHJ A;  5JLJ B;  3P6A A;  2Z0Q A;  1MAI A;  1WG7 A;  5D3X A;  1N3H A;  4ZRJ A;  5KCV A;  1QQG A;  2AL6 A;  1EGX A;  2I5F A;  4CYE A;  1BTK A;  3V5W A;  2GS0 A;  5DHA B;  3PVW A;  4B6H A;  1Y19 B;  2R0D A;  5J3T A;  3ODO A;  5LON B;  5L81 A;  2RUK B;  2DA0 A;  5C16 A;  1V88 A;  2AEH A;  5HE3 A;  1K5G B;  3SO6 A;  2UZR A;  2J0M A;  1MK7 B;  4DX9 0;  1W1G A;  4HAX B;  2YT0 A;  1SHC A;  1V5U A;  2J59 M;  2J0K A;  3AJ4 A;  1KZG A;  5J3Q A;  3TCA A;  4K17 A;  4GZU A;  1WJ1 A;  3F0W A;  1M7R A;  2V76 A;  2I1J A;  2P8V A;  1AQC A;  3SUZ A;  3SYX A;  4WVF B;  2DX1 A;  3AU4 A;  2P0F A;  2HE7 A;  2H7E A;  4Y94 A;  1XR0 B;  2DHI A;  5C5B B;  2D11 A;  2I1K A;  2MKR A;  1EVH A;  4K81 A;  2COF A;  1Z87 A;  1DDV A;  1U2B A;  2D10 A;  2NZ8 B;  4YON A;  3BIN A;  3T06 A;  3G9W A;  1U5F A;  3DXD A;  4C0A A;  1Q67 A;  2YRY A;  2Z0P A;  2D4Q A;  2ROV A;  4NSW A;  1EF1 A;  2M14 A;  5FI1 A;  3OAN A;  4GXB A;  1ZSQ A;  4A6F B;  5D27 A;  1XKE A;  2YS1 A;  3TW1 A;  3GYO A;  4IOY X;  4MY6 A;  2M38 A;  2Y8G A;  2K00 A;  1XOD A;  2W2W A;  4HDO A;  3D8F A;  5EFX A;  2MDX A;  2LYD A;  1U29 A;  1X05 A;  1W1D A;  1FGZ A;  1UEF A;  1Y5O A;  1X1G A;  2CAY A;  1WI1 A;  3TVV A;  4HDQ A;  2K2U A;  1ZC4 B;  3MDB C;  4Z2M B;  3RCP A;  5DIF B;  4A5K A;  4HAV B;  4P7I A;  2D9Y A;  1U5E A;  1MK9 B;  2W2X D;  1LW3 A;  1B55 A;  2VKI A;  2P0H A;  3KY9 A;  2J0J A;  1BAK A;  1WJM A;  4A6K A;  1DBH A;  3QIJ A;  3PG7 A;  1WGU A;  2Y7B A;  2RVB B;  1ZVR A;  1TXD A;  3A8P A;  1DRO A;  5JP4 A;  1FOE A;  4HAW B;  1NI2 A;  3U8Z A;  2DKQ A;  2ROZ B;  2E2X A;  5GOW B;  3ZVR A;  3ML4 A;  3IVF A;  2OTX A;  1ZC3 B;  1ZM0 A;  3VIA A;  4ZRK A;  2N23 A;  1P3R A;  4KHB B;  3FM8 C;  2L1C A;  4DX8 A;  1V61 A;  1XX0 A;  2P0D A;  1X11 A;  3FEH A;  4NY0 A;  4HHV A;  2DX5 A;  2LG1 A;  3QWM A;  3TO1 A;  1WVH A;  2ELB A;  4GMX B;  3HK0 A;  2LUL A;  1I2H A;  2YF0 A;  2D9X A;  5D3V A;  2DTC A;  5LOP B;  3WYF B;  1UPQ A;  2CY5 A;  3KZ1 A;  4ZRI A;  4GPT B;  4WJ7 A;  4EMO A;  4Z2N A;  5JHG A;  1IRS A;  3WA0 A;  2ZPY A;  4XWX A;  1FGY A;  3F5R A;  1FHX A;  1LB1 A;  2Q13 A;  2COA A;  3ZDT A;  2UZS A;  3AU5 A;  3MPX A;  4MK0 A;  3QBV B;  4GMV A;  4HB0 B;  5JHH A;  5D3W A;  2NMB A;  4WSF A;  2I5C A;  1PMS A;  2QKL A;  2XQN M;  5HE0 A;  2DLW A;  3PZD A;  1I7A A;  1XCG A;  2KUP A;  1DDW A;  2LOZ A;  4IAP A;  4HB2 B;  4L6E A;  1U27 A;  1H10 A;  3DXE A;  1OMW A;  1BTN A;  5DI9 B;  1X86 A;  2DYN A;  3KRX A;  1FAO A;  2Y8F A;  1MKE A;  2KCJ A;  2D9Z A;  3SNH A;  1UNQ A;  3ULC A;  5C5B A;  1X1F A;  3HQC A;  3O96 A;  2YSZ A;  5KQ4 A;  3ODW A;  3PSC A;  1GC7 A;  1TQZ A;  4F7H A;  1UNR A;  2DYQ A;  1V5P A;  1OY2 A;  1U5D A;  2GCJ A;  4GN1 A;  5HE1 A;  3ULB A;  2EJ8 A;  4HB3 B;  3N7C A;  3PEG A;  1V5M A;  1FB8 A;  2D9V A;  2PZ1 A;  1M7E A;  4A6H A;  4TYZ A;  4A6F A;  4TKN A;  4YL8 A;  3UZT A;  1FHO A;  4KAX B; 
#chains in the Genus database with same CATH topology
 3SV1 A;  5CLQ B;  1U5G A;  4HAU B;  1NU2 A;  1TJ6 A;  4HAT B;  2VSZ A;  2CRF A;  2N0Y A;  1P6S A;  2MFQ A;  1GC6 A;  5C6R A;  2RGN B;  3GYP A;  2X18 A;  2BCJ A;  3PVU A;  3PVL A;  1MPH A;  1RRP B;  2DKP A;  2W2X C;  2LKO A;  2DHK A;  1GG3 A;  5HE2 A;  3LJU X;  3PP2 A;  2QKM A;  3HW2 B;  1FHW A;  3DXC A;  2GCL A;  5M4Y B;  1ISN A;  2H7D A;  4EKU A;  4OSN A;  4CHJ A;  3A8Q A;  4H8S A;  2R2Y A;  3D8D A;  1P5T A;  4HAY B;  4HSI A;  2IFS A;  2IYB A;  1EAZ A;  1NTY A;  2GJY A;  5I2M A;  2HTH B;  3BJI A;  5IRS A;  3D8E A;  3VOQ A;  4MT7 A;  1KI1 B;  4PNK A;  4KHA A;  3A98 B;  5C79 A;  1E5W A;  5CLL B;  1NTV A;  2EC1 A;  2JP2 A;  2Z4D A;  2MWN B;  2RNR B;  1XD4 A;  1PFJ A;  3A58 A;  1V89 A;  2YS3 A;  4BBK A;  4IFS A;  3FVC A;  5DHF B;  3CIK A;  4CSQ A;  2RLO A;  3NSU A;  1OQN A;  5DH9 B;  1DDM A;  1DYN A;  4PQ0 A;  1AWE A;  2YT1 A;  5J3Y A;  2Z59 A;  2VRW B;  1J19 A;  2COD A;  2EMT A;  3M1I B;  4CHM A;  4HB4 B;  5KQ1 A;  3NWD A;  2K2J A;  4F7G A;  1WGQ A;  2DFK A;  3NW8 A;  3KSY A;  2OQB A;  2D2Q A;  5D3Y A;  3TFM A;  2ELA A;  1SGH A;  1RJ2 A;  2CY4 A;  2EMS A;  3P7Z A;  2R09 A;  1KZ7 A;  3U7D A;  2G35 A;  3KRW A;  4DBB A;  4K2P A;  2KR0 A;  2UVM A;  1QC6 A;  2FJL A;  1MIZ B;  2COC A;  4HAZ B;  3CXB B;  1H4R A;  1W1H A;  2D9W A;  2DN6 A;  4K2O A;  5FI0 A;  2Z0O A;  4EJN A;  2YVC A;  2RSG A;  1UPR A;  3X23 A;  1K5D B;  1UNP A;  2ADZ A;  1MIX A;  2L2I A;  4F7U P;  1J0W A;  4D0N B;  3ODX A;  4DXA B;  1PLS A;  3FSS A;  2KGX B;  1BWN A;  2YS5 A;  4KHO A;  3DCX A;  2LOX A;  4KVG B;  2DHJ A;  5JLJ B;  3P6A A;  4D6W A;  2Z0Q A;  1MAI A;  1WG7 A;  5D3X A;  2Z14 A;  1N3H A;  4ZRJ A;  5KCV A;  1QQG A;  2AL6 A;  1EGX A;  2I5F A;  4CYE A;  1BTK A;  3V5W A;  2GS0 A;  5DHA B;  3PVW A;  4B6H A;  2RRF A;  1Y19 B;  2R0D A;  5J3T A;  3HSA A;  4GOU A;  3ODO A;  5LON B;  3NWA A;  5L81 A;  2RUK B;  2DA0 A;  5C16 A;  1V88 A;  2AEH A;  5HE3 A;  1K5G B;  3SO6 A;  2UZR A;  2K49 A;  2J0M A;  1MK7 B;  4DX9 0;  1W1G A;  4HAX B;  2YT0 A;  1SHC A;  1V5U A;  2J59 M;  2J0K A;  2NBV A;  3AJ4 A;  1KZG A;  3OHM B;  5J3Q A;  3TCA A;  4K17 A;  4GZU A;  1WJ1 A;  4DIX A;  3F0W A;  1M7R A;  2V76 A;  2I1J A;  4L1R A;  2P8V A;  1AQC A;  3SUZ A;  3SYX A;  4WVF B;  2DX1 A;  3AU4 A;  2P0F A;  2HE7 A;  2H7E A;  4Y94 A;  1XR0 B;  2DHI A;  5C5B B;  4KHB A;  2D11 A;  2I1K A;  2MKR A;  1EVH A;  4K81 A;  2COF A;  1Z87 A;  1DDV A;  3HIE A;  1U2B A;  2D10 A;  2NZ8 B;  4YON A;  3BIN A;  3T06 A;  3G9W A;  1ZYI A;  1U5F A;  3DXD A;  4C0A A;  1Q67 A;  2YRY A;  2Z0P A;  2D4Q A;  2ROV A;  4NSW A;  1EF1 A;  2M14 A;  3U12 A;  5FI1 A;  3OAN A;  4GXB A;  1ZSQ A;  4A6F B;  5D27 A;  1XKE A;  2YS1 A;  1T77 A;  3TW1 A;  3GYO A;  4IOY X;  4MY6 A;  2ZKM X;  2M38 A;  2Y8G A;  2K00 A;  4GNK B;  1XOD A;  2W2W A;  4HDO A;  3D8F A;  5LG4 B;  5I2S A;  5EFX A;  2MDX A;  2LYD A;  1U29 A;  1X05 A;  1W1D A;  1FGZ A;  1UEF A;  1Y5O A;  2KIE A;  1X1G A;  2CAY A;  1WI1 A;  3TVV A;  4HDQ A;  2K2U A;  1MI1 A;  1ZC4 B;  2KUQ A;  3MDB C;  4Z2M B;  3RCP A;  5DIF B;  4A5K A;  2FJU B;  4HAV B;  4P7I A;  2D9Y A;  2KIG A;  1U5E A;  1MK9 B;  2W2X D;  1LW3 A;  1B55 A;  4OT1 A;  2VKI A;  2P0H A;  2J0J A;  3KY9 A;  1BAK A;  1WJM A;  4A6K A;  1DBH A;  3QIJ A;  3PG7 A;  1WGU A;  2Y7B A;  2RVB B;  1ZVR A;  1TXD A;  3A8P A;  1DRO A;  2K8E A;  5JP4 A;  1FOE A;  4HAW B;  1NI2 A;  3U8Z A;  2DKQ A;  2ROZ B;  2E2X A;  5GOW B;  3ZVR A;  3ML4 A;  3IVF A;  2OTX A;  1ZC3 B;  1ZM0 A;  3VIA A;  4ZRK A;  2Z13 A;  2N23 A;  1P3R A;  4KHB B;  3FM8 C;  2L1C A;  4DX8 A;  1V61 A;  1XX0 A;  2P0D A;  1X11 A;  3FEH A;  4NY0 A;  4HHV A;  2DX5 A;  2LG1 A;  3QWM A;  3TO1 A;  1WVH A;  2ELB A;  4GMX B;  3HK0 A;  2LUL A;  1I2H A;  2YF0 A;  2D9X A;  5D3V A;  2DTC A;  5LOP B;  3WYF B;  1UPQ A;  2CY5 A;  3KZ1 A;  4ZRI A;  4GPT B;  4WJ7 A;  4EMO A;  4Z2N A;  5JHG A;  1IRS A;  3WA0 A;  4QJ3 B;  2ZPY A;  4XWX A;  1FGY A;  3F5R A;  1FHX A;  1LB1 A;  2Q13 A;  2COA A;  3ZDT A;  2UZS A;  3AU5 A;  3MPX A;  4MK0 A;  3QBV B;  4GMV A;  4HB0 B;  5JHH A;  5D3W A;  2NMB A;  4WSF A;  2I5C A;  3B77 A;  1PMS A;  2QKL A;  2XQN M;  5HE0 A;  2DLW A;  3PZD A;  1I7A A;  1XCG A;  2KUP A;  1DDW A;  2LOZ A;  4IAP A;  4HB2 B;  3NWF A;  4L6E A;  1U27 A;  1H10 A;  3DXE A;  1OMW A;  1BTN A;  5DI9 B;  1X86 A;  2DYN A;  3KRX A;  1FAO A;  2Y8F A;  1MKE A;  2KCJ A;  2D9Z A;  3SNH A;  1UNQ A;  3ULC A;  5C5B A;  1X1F A;  3HQC A;  3O96 A;  4QXA B;  2YSZ A;  5KQ4 A;  3ODW A;  3PSC A;  1GC7 A;  1TQZ A;  4F7H A;  1UNR A;  2DYQ A;  1V5P A;  1OY2 A;  1U5D A;  4QJ4 B;  2GCJ A;  4GN1 A;  5HE1 A;  2GUM A;  3ULB A;  2EJ8 A;  4HB3 B;  3N7C A;  3PEG A;  4QJ5 B;  1V5M A;  1FB8 A;  2D9V A;  2PZ1 A;  1M7E A;  4A6H A;  4TYZ A;  4A6F A;  4TKN A;  4YL8 A;  3UZT A;  1FHO A;  2YT2 A;  4KAX B; 
#chains in the Genus database with same CATH homology
 3SV1 A;  5CLQ B;  1U5G A;  4HAU B;  1NU2 A;  1TJ6 A;  4HAT B;  2VSZ A;  2CRF A;  2N0Y A;  1P6S A;  2MFQ A;  1GC6 A;  5C6R A;  2RGN B;  3GYP A;  2X18 A;  2BCJ A;  3PVU A;  3PVL A;  1MPH A;  1RRP B;  2DKP A;  2W2X C;  2LKO A;  2DHK A;  1GG3 A;  5HE2 A;  3LJU X;  3PP2 A;  2QKM A;  3HW2 B;  1FHW A;  3DXC A;  2GCL A;  1ISN A;  2H7D A;  4EKU A;  4CHJ A;  3A8Q A;  4H8S A;  3D8D A;  1P5T A;  4HAY B;  2IFS A;  2IYB A;  1EAZ A;  1NTY A;  2GJY A;  2HTH B;  3BJI A;  3D8E A;  3VOQ A;  4MT7 A;  1KI1 B;  4PNK A;  4KHA A;  3A98 B;  5C79 A;  1E5W A;  5CLL B;  1NTV A;  2EC1 A;  2JP2 A;  2MWN B;  2RNR B;  1XD4 A;  1PFJ A;  1V89 A;  2YS3 A;  4BBK A;  4IFS A;  5DHF B;  3CIK A;  2RLO A;  3NSU A;  1OQN A;  5DH9 B;  1DDM A;  1DYN A;  4PQ0 A;  1AWE A;  2YT1 A;  5J3Y A;  2VRW B;  1J19 A;  2COD A;  2EMT A;  3M1I B;  4CHM A;  4HB4 B;  5KQ1 A;  2K2J A;  4F7G A;  1WGQ A;  2DFK A;  3KSY A;  2OQB A;  2D2Q A;  5D3Y A;  3TFM A;  2ELA A;  1SGH A;  1RJ2 A;  2CY4 A;  2EMS A;  3P7Z A;  2R09 A;  1KZ7 A;  3U7D A;  2G35 A;  3KRW A;  4DBB A;  4K2P A;  2UVM A;  1QC6 A;  2FJL A;  1MIZ B;  2COC A;  4HAZ B;  3CXB B;  1H4R A;  1W1H A;  2D9W A;  2DN6 A;  4K2O A;  5FI0 A;  2Z0O A;  4EJN A;  2YVC A;  2RSG A;  1UPR A;  3X23 A;  1K5D B;  1UNP A;  2ADZ A;  1MIX A;  2L2I A;  4F7U P;  1J0W A;  4D0N B;  3ODX A;  4DXA B;  1PLS A;  3FSS A;  2KGX B;  1BWN A;  2YS5 A;  4KHO A;  2LOX A;  4KVG B;  2DHJ A;  5JLJ B;  3P6A A;  2Z0Q A;  1MAI A;  1WG7 A;  5D3X A;  1N3H A;  4ZRJ A;  5KCV A;  1QQG A;  2AL6 A;  1EGX A;  2I5F A;  4CYE A;  1BTK A;  3V5W A;  2GS0 A;  5DHA B;  3PVW A;  4B6H A;  1Y19 B;  2R0D A;  5J3T A;  3ODO A;  5LON B;  5L81 A;  2RUK B;  2DA0 A;  5C16 A;  1V88 A;  2AEH A;  5HE3 A;  1K5G B;  3SO6 A;  2UZR A;  2J0M A;  1MK7 B;  4DX9 0;  1W1G A;  4HAX B;  2YT0 A;  1SHC A;  1V5U A;  2J59 M;  2J0K A;  3AJ4 A;  1KZG A;  5J3Q A;  3TCA A;  4K17 A;  4GZU A;  1WJ1 A;  3F0W A;  1M7R A;  2V76 A;  2I1J A;  2P8V A;  1AQC A;  3SUZ A;  3SYX A;  4WVF B;  2DX1 A;  3AU4 A;  2P0F A;  2HE7 A;  2H7E A;  4Y94 A;  1XR0 B;  2DHI A;  5C5B B;  2D11 A;  2I1K A;  2MKR A;  1EVH A;  4K81 A;  2COF A;  1Z87 A;  1DDV A;  1U2B A;  2D10 A;  2NZ8 B;  4YON A;  3BIN A;  3T06 A;  3G9W A;  1U5F A;  3DXD A;  4C0A A;  1Q67 A;  2YRY A;  2Z0P A;  2D4Q A;  2ROV A;  4NSW A;  1EF1 A;  2M14 A;  5FI1 A;  3OAN A;  4GXB A;  1ZSQ A;  4A6F B;  5D27 A;  1XKE A;  2YS1 A;  3TW1 A;  3GYO A;  4IOY X;  4MY6 A;  2M38 A;  2Y8G A;  2K00 A;  1XOD A;  2W2W A;  4HDO A;  3D8F A;  5EFX A;  2MDX A;  2LYD A;  1U29 A;  1X05 A;  1W1D A;  1FGZ A;  1UEF A;  1Y5O A;  1X1G A;  2CAY A;  1WI1 A;  3TVV A;  4HDQ A;  2K2U A;  1ZC4 B;  3MDB C;  4Z2M B;  3RCP A;  5DIF B;  4A5K A;  4HAV B;  4P7I A;  2D9Y A;  1U5E A;  1MK9 B;  2W2X D;  1LW3 A;  1B55 A;  2VKI A;  2P0H A;  3KY9 A;  2J0J A;  1BAK A;  1WJM A;  4A6K A;  1DBH A;  3QIJ A;  3PG7 A;  1WGU A;  2Y7B A;  2RVB B;  1ZVR A;  1TXD A;  3A8P A;  1DRO A;  5JP4 A;  1FOE A;  4HAW B;  1NI2 A;  3U8Z A;  2DKQ A;  2ROZ B;  2E2X A;  5GOW B;  3ZVR A;  3ML4 A;  3IVF A;  2OTX A;  1ZC3 B;  1ZM0 A;  3VIA A;  4ZRK A;  2N23 A;  1P3R A;  4KHB B;  3FM8 C;  2L1C A;  4DX8 A;  1V61 A;  1XX0 A;  2P0D A;  1X11 A;  3FEH A;  4NY0 A;  4HHV A;  2DX5 A;  2LG1 A;  3QWM A;  3TO1 A;  1WVH A;  2ELB A;  4GMX B;  3HK0 A;  2LUL A;  1I2H A;  2YF0 A;  2D9X A;  5D3V A;  2DTC A;  5LOP B;  3WYF B;  1UPQ A;  2CY5 A;  3KZ1 A;  4ZRI A;  4GPT B;  4WJ7 A;  4EMO A;  4Z2N A;  5JHG A;  1IRS A;  3WA0 A;  2ZPY A;  4XWX A;  1FGY A;  3F5R A;  1FHX A;  1LB1 A;  2Q13 A;  2COA A;  3ZDT A;  2UZS A;  3AU5 A;  3MPX A;  4MK0 A;  3QBV B;  4GMV A;  4HB0 B;  5JHH A;  5D3W A;  2NMB A;  4WSF A;  2I5C A;  1PMS A;  2QKL A;  2XQN M;  5HE0 A;  2DLW A;  3PZD A;  1I7A A;  1XCG A;  2KUP A;  1DDW A;  2LOZ A;  4IAP A;  4HB2 B;  4L6E A;  1U27 A;  1H10 A;  3DXE A;  1OMW A;  1BTN A;  5DI9 B;  1X86 A;  2DYN A;  3KRX A;  1FAO A;  2Y8F A;  1MKE A;  2KCJ A;  2D9Z A;  3SNH A;  1UNQ A;  3ULC A;  5C5B A;  1X1F A;  3HQC A;  3O96 A;  2YSZ A;  5KQ4 A;  3ODW A;  3PSC A;  1GC7 A;  1TQZ A;  4F7H A;  1UNR A;  2DYQ A;  1V5P A;  1OY2 A;  1U5D A;  2GCJ A;  4GN1 A;  5HE1 A;  3ULB A;  2EJ8 A;  4HB3 B;  3N7C A;  3PEG A;  1V5M A;  1FB8 A;  2D9V A;  2PZ1 A;  1M7E A;  4A6H A;  4TYZ A;  4A6F A;  4TKN A;  4YL8 A;  3UZT A;  1FHO A;  4KAX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...