4EMOA

Crystal structure of the ph domain of sharpin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
AAVLMAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSMHFLNPQEAQRWAVLVRGATV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sharpin
publication title Structural Analysis of SHARPIN, a Subunit of a Large Multi-protein E3 Ubiquitin Ligase, Reveals a Novel Dimerization Function for the Pleckstrin Homology Superfold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 19
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16764 Sharpin_PH Sharpin PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4emoA00
4F7GA 1NTYA 4HB3B 3SYXA 3ODXA 2LULA 1E5WA 1XD4A 2J59M 3UZTA 3GYOA 2DKQA 3T06A 2EMTA 1DYNA 1MIXA 1WJMA 1LB1A 5DH9B 4K2OA 5GOWB 2DKPA 4HAUB 1WI1A 5KQ1A 5JHGA 3KSYA 1ZC4B 5C6RA 1MK7B 2LKOA 2CY4A 1J0WA 1UNRA 2QKLA 2I1JA 2DTCA 1EVHA 1WJ1A 2ELBA 2R09A 4NSWA 3BINA 3F0WA 3DXEA 2Z0PA 3VOQA 1DDMA 2Q13A 2RLOA 1TXDA 1J19A 2OQBA 2GJYA 1BAKA 4PQ0A 4B6HA 1FGYA 2RUKB 4GN1A 4A5KA 4YL8A 1Z87A 3ODWA 2I5FA 3PP2A 3O96A 1TJ6A 3PVLA 5LONB 4CHJA 2I1KA 4IAPA 3ZDTA 5C79A 3VIAA 3DXDA 4A6FB 1LW3A 5HE0A 2L2IA 3WA0A 1MKEA 3A8PA 2MWNB 1V5PA 3PSCA 1W1DA 2J0MA 1U5EA 1XR0B 2D9WA 2CRFA 1ZM0A 1ZSQA 3N7CA 5D3VA 3SNHA 3MDBC 4EMOA 5JP4A 3TVVA 1GC7A 4L6EA 1ZC3B 4XWXA 1FHOA 2H7EA 3CIKA 2CODA 1KZ7A 1UNQA 3OANA 1B55A 3HQCA 2W2XD 2YSZA 2VRWB 3M1IB 2DHJA 5DHFB 2J0JA 3U7DA 2DFKA 1U29A 1V89A 3PG7A 3P6AA 1U5FA 2P0DA 2ROZB 3WYFB 3D8EA 1V5MA 4Y94A 1MIZB 2AL6A 1Y19B 2W2WA 2D2QA 1DROA 2YRYA 1I2HA 2P8VA 4HHVA 4EJNA 2E2XA 4YONA 4ZRJA 2JP2A 1U5GA 5HE3A 3ULCA 5CLLB 4NY0A 5EFXA 1GC6A 2COAA 3A98B 1FOEA 5HE1A 3X23A 4DX8A 3PVWA 1WGQA 2VSZA 2ROVA 3ZVRA 2NZ8B 1X1FA 2EC1A 4HAYB 1N3HA 3ML4A 2Y8FA 3HW2B 1X86A 1FHWA 2KUPA 2D9XA 1NI2A 4WVFB 1UEFA 1PMSA 1FHXA 2RNRB 4C0AA 3D8DA 1X1GA 3U8ZA 2UZRA 2YS1A 2D9YA 3ULBA 4HAVB 2DX5A 4GMXB 2DX1A 4GXBA 3PZDA 3SUZA 1MPHA 3AJ4A 4F7HA 5FI1A 4HDOA 1TQZA 1Y5OA 1BTNA 2H7DA 2LYDA 2GS0A 2Z0QA 5KCVA 4EKUA 5DIFB 1AWEA 2CY5A 1V88A 2IFSA 2COFA 2L1CA 3FEHA 1XX0A 2YS5A 2D11A 1RRPB 2KGXB 4A6HA 2V76A 5J3YA 2UZSA 3AU5A 2YT1A 1X05A 2K2JA 1P6SA 1P3RA 1IRSA 1QQGA 2DHKA 3IVFA 1I7AA 1OY2A 4Z2NA 5HE2A 4WSFA 1KI1B 3DXCA 1BTKA 1ISNA 3P7ZA 3CXBB 4KHAA 4KAXB 1SHCA 4K81A 1UNPA 4Z2MB 1MK9B 4ZRIA 5KQ4A 2M38A 3KY9A 4WJ7A 2I5CA 2Y7BA 2YS3A 1OQNA 4MY6A 4MK0A 1W1GA 1BWNA 1SGHA 4KHBB 1NU2A 5J3TA 3GYPA 3TO1A 4HB4B 1AQCA 1P5TA 2RVBB 4MT7A 3SV1A 2J0KA 5L81A 3G9WA 1GG3A 1PLSA 1K5GB 1K5DB 1M7EA 2MDXA 4IOYX 2IYBA 2D10A 2NMBA 1WVHA 2ELAA 2MFQA 4PNKA 2XQNM 2X18A 2KCJA 4HATB 1V61A 5D3WA 4D0NB 1M7RA 2RGNB 2ZPYA 1FGZA 2YT0A 2P0HA 1U27A 1W1HA 2OTXA 3QWMA 2DA0A 3QIJA 1DDVA 4ZRKA 4GPTB 4CYEA 2VKIA 3D8FA 3LJUX 5C5BA 5CLQB 1WGUA 2LOZA 3NSUA 3KRWA 1XODA 4A6KA 4F7UP 2N0YA 1U5DA 3TFMA 4BBKA 1DBHA 2PZ1A 4IFSA 3TCAA 4P7IA 1RJ2A 1XKEA 1FB8A 1H10A 3PEGA 3QBVB 2YF0A 3PVUA 4KVGB 1OMWA 3BJIA 4TKNA 5C16A 5JLJB 4H8SA 4TYZA 4KHOA 1FAOA 3HK0A 3MPXA 4K2PA 2AEHA 2DLWA 2DHIA 4CHMA 2GCLA 4HAZB 4HAXB 2LG1A 1PFJA 2MKRA 5LOPB 3KZ1A 3F5RA 1V5UA 5D27A 1Q67A 1WG7A 1UPRA 2DYQA 4HDQA 2D9ZA 3SO6A 4HB2B 3FSSA 1MAIA 2EMSA 2GCJA 3KRXA 3FM8C 2D4QA 2DYNA 2R0DA 2Z0OA 1H4RA 1ZVRA 4DX90 5D3YA 2YVCA 4HB0B 2G35A 2RSGA 2ADZA 2COCA 2HTHB 2HE7A 1DDWA 3A8QA 2K2UA 1X11A 5J3QA 4GMVA 5D3XA 5DHAB 1UPQA 4GZUA 2DN6A 2Y8GA 2EJ8A 2UVMA 1EGXA 2QKMA 5C5BB 3RCPA 1QC6A 1EF1A 3ODOA 5FI0A 2CAYA 1XCGA 2M14A 4A6FA 3AU4A 1EAZA 1KZGA 1NTVA 1U2BA 4DBBA 2K00A 5DI9B 2BCJA 2FJLA 2LOXA 2W2XC 3V5WA 2P0FA 4K17A 4DXAB 3TW1A 2D9VA 4HAWB 5JHHA 2N23A
chains in the Genus database with same CATH superfamily
4F7GA 1NTYA 4HB3B 3SYXA 3ODXA 2LULA 1E5WA 1XD4A 2J59M 3UZTA 3GYOA 2DKQA 2KIEA 2KR0A 3T06A 2EMTA 1DYNA 1MIXA 1T77A 1WJMA 1LB1A 3OHMB 5DH9B 4K2OA 5GOWB 2DKPA 4HAUB 1WI1A 5KQ1A 5JHGA 3KSYA 1ZC4B 5C6RA 1MK7B 2LKOA 2CY4A 2KUQA 1J0WA 1UNRA 2QKLA 2I1JA 2DTCA 1EVHA 1WJ1A 3HSAA 2ELBA 2R09A 4NSWA 3BINA 3F0WA 3DXEA 2Z0PA 3VOQA 1DDMA 2Q13A 2RLOA 1TXDA 1J19A 2OQBA 5I2MA 2GJYA 1BAKA 4PQ0A 4B6HA 1FGYA 2RUKB 4GN1A 4A5KA 4YL8A 1Z87A 3ODWA 2I5FA 3PP2A 1MI1A 3O96A 1TJ6A 3PVLA 5LONB 4CHJA 2I1KA 4IAPA 3ZDTA 5C79A 3U12A 3VIAA 3DXDA 2FJUB 4A6FB 1LW3A 5HE0A 2L2IA 3WA0A 1MKEA 3A8PA 2MWNB 1V5PA 3A58A 1W1DA 3PSCA 2J0MA 1U5EA 1XR0B 2D9WA 2CRFA 1ZM0A 1ZSQA 3N7CA 5D3VA 3SNHA 3MDBC 3NWAA 4EMOA 5JP4A 3TVVA 1GC7A 4L6EA 1ZC3B 4XWXA 3FVCA 1FHOA 2H7EA 3CIKA 2CODA 1KZ7A 1UNQA 3OANA 1ZYIA 1B55A 3HQCA 2W2XD 2YSZA 2VRWB 3M1IB 2DHJA 2K8EA 5DHFB 2J0JA 3U7DA 2DFKA 1U29A 1V89A 3PG7A 3P6AA 1U5FA 2P0DA 2ROZB 3WYFB 3D8EA 1V5MA 4Y94A 1MIZB 2AL6A 4GOUA 1Y19B 2W2WA 2D2QA 1DROA 2YRYA 1I2HA 2P8VA 4HHVA 4EJNA 2E2XA 4YONA 4ZRJA 2JP2A 3NWFA 1U5GA 5HE3A 2YT2A 3ULCA 5CLLB 4NY0A 5EFXA 1GC6A 2KIGA 2COAA 3A98B 3DCXA 1FOEA 5HE1A 3X23A 4DX8A 3PVWA 1WGQA 2Z59A 2VSZA 2ROVA 2K49A 2NBVA 3ZVRA 2NZ8B 1X1FA 2EC1A 4HAYB 1N3HA 3ML4A 2Y8FA 3HW2B 1X86A 1FHWA 2KUPA 2D9XA 1NI2A 4WVFB 4D6WA 1UEFA 1PMSA 1FHXA 2RNRB 4C0AA 3D8DA 4KHBA 1X1GA 3U8ZA 2UZRA 2YS1A 2D9YA 3ULBA 4HAVB 2DX5A 2R2YA 4GMXB 2DX1A 4GXBA 3PZDA 3SUZA 1MPHA 3AJ4A 4F7HA 3HIEA 5FI1A 4HDOA 1TQZA 1Y5OA 1BTNA 2H7DA 2LYDA 2GS0A 2Z0QA 5KCVA 4EKUA 5DIFB 1AWEA 2CY5A 1V88A 2IFSA 4QJ5B 2COFA 2L1CA 3FEHA 1XX0A 3NWDA 2YS5A 2D11A 1RRPB 2KGXB 4A6HA 2V76A 5J3YA 2UZSA 3AU5A 2YT1A 1X05A 2K2JA 1P6SA 1P3RA 1IRSA 1QQGA 2DHKA 3IVFA 1I7AA 1OY2A 4Z2NA 5HE2A 4WSFA 1KI1B 3DXCA 1BTKA 1ISNA 3P7ZA 3CXBB 4QXAB 4KHAA 4OSNA 4KAXB 1SHCA 4K81A 1UNPA 4Z2MB 1MK9B 4DIXA 4ZRIA 5KQ4A 2M38A 3KY9A 4WJ7A 2I5CA 4QJ4B 2Y7BA 2YS3A 1OQNA 4MY6A 4MK0A 1W1GA 1BWNA 5I2SA 1SGHA 4KHBB 1NU2A 5J3TA 5M4YB 3GYPA 3TO1A 4HB4B 1AQCA 1P5TA 2GUMA 2RVBB 4GNKB 2J0KA 4MT7A 3SV1A 5L81A 3G9WA 1GG3A 1PLSA 1K5GB 1K5DB 1M7EA 2MDXA 4IOYX 2IYBA 2D10A 2NMBA 1WVHA 2ELAA 2MFQA 4PNKA 2XQNM 2X18A 2KCJA 4HATB 1V61A 5D3WA 4D0NB 1M7RA 2RGNB 2ZPYA 1FGZA 2YT0A 2P0HA 1U27A 1W1HA 2OTXA 3QWMA 2DA0A 3QIJA 1DDVA 4ZRKA 4GPTB 4CYEA 2VKIA 3D8FA 4CSQA 3LJUX 5C5BA 5CLQB 1WGUA 2LOZA 3NSUA 3KRWA 1XODA 4A6KA 4F7UP 2N0YA 1U5DA 3TFMA 4BBKA 1DBHA 2PZ1A 4IFSA 3TCAA 4P7IA 1RJ2A 1XKEA 1FB8A 1H10A 3PEGA 3QBVB 2YF0A 3PVUA 4KVGB 1OMWA 3BJIA 4TKNA 5C16A 5JLJB 4H8SA 4TYZA 4KHOA 1FAOA 3HK0A 3MPXA 4K2PA 4QJ3B 2AEHA 2DLWA 2DHIA 4CHMA 2GCLA 4HAZB 4HAXB 2LG1A 1PFJA 2Z13A 2MKRA 5LOPB 3KZ1A 3F5RA 1V5UA 5D27A 1Q67A 1WG7A 1UPRA 2DYQA 3NW8A 4HDQA 2D9ZA 3SO6A 4HB2B 3FSSA 1MAIA 2EMSA 2GCJA 3KRXA 3FM8C 2D4QA 2DYNA 2R0DA 2Z0OA 1H4RA 1ZVRA 4DX90 5D3YA 2YVCA 4HB0B 2G35A 2RSGA 2ADZA 5IRSA 2COCA 2HTHB 2HE7A 1DDWA 3A8QA 2K2UA 1X11A 5J3QA 4GMVA 5D3XA 5DHAB 1UPQA 4GZUA 2DN6A 2Y8GA 2EJ8A 2UVMA 1EGXA 2QKMA 5C5BB 3RCPA 2Z14A 1QC6A 1EF1A 3ODOA 5FI0A 2CAYA 2ZKMX 1XCGA 5LG4B 2M14A 4A6FA 3AU4A 1EAZA 1KZGA 1NTVA 1U2BA 2Z4DA 4DBBA 3B77A 2K00A 5DI9B 2RRFA 2BCJA 2FJLA 2LOXA 2W2XC 4L1RA 3V5WA 2P0FA 4K17A 4DXAB 3TW1A 2D9VA 4OT1A 4HAWB 4HSIA 5JHHA 2N23A
chains in the Genus database with same CATH topology
4F7GA 1NTYA 4HB3B 3SYXA 3ODXA 2LULA 1E5WA 1XD4A 2J59M 3UZTA 3GYOA 2DKQA 3T06A 2EMTA 1DYNA 1MIXA 1WJMA 1LB1A 5DH9B 4K2OA 5GOWB 2DKPA 4HAUB 1WI1A 5KQ1A 5JHGA 3KSYA 1ZC4B 5C6RA 1MK7B 2LKOA 2CY4A 1J0WA 1UNRA 2QKLA 2I1JA 2DTCA 1EVHA 1WJ1A 2ELBA 2R09A 4NSWA 3BINA 3F0WA 3DXEA 2Z0PA 3VOQA 1DDMA 2Q13A 2RLOA 1TXDA 1J19A 2OQBA 2GJYA 1BAKA 4PQ0A 4B6HA 1FGYA 2RUKB 4GN1A 4A5KA 4YL8A 1Z87A 3ODWA 2I5FA 3PP2A 3O96A 1TJ6A 3PVLA 5LONB 4CHJA 2I1KA 4IAPA 3ZDTA 5C79A 3VIAA 3DXDA 4A6FB 1LW3A 5HE0A 2L2IA 3WA0A 1MKEA 3A8PA 2MWNB 1V5PA 3PSCA 1W1DA 2J0MA 1U5EA 1XR0B 2D9WA 2CRFA 1ZM0A 1ZSQA 3N7CA 5D3VA 3SNHA 3MDBC 4EMOA 5JP4A 3TVVA 1GC7A 4L6EA 1ZC3B 4XWXA 1FHOA 2H7EA 3CIKA 2CODA 1KZ7A 1UNQA 3OANA 1B55A 3HQCA 2W2XD 2YSZA 2VRWB 3M1IB 2DHJA 5DHFB 2J0JA 3U7DA 2DFKA 1U29A 1V89A 3PG7A 3P6AA 1U5FA 2P0DA 2ROZB 3WYFB 3D8EA 1V5MA 4Y94A 1MIZB 2AL6A 1Y19B 2W2WA 2D2QA 1DROA 2YRYA 1I2HA 2P8VA 4HHVA 4EJNA 2E2XA 4YONA 4ZRJA 2JP2A 1U5GA 5HE3A 3ULCA 5CLLB 4NY0A 5EFXA 1GC6A 2COAA 3A98B 1FOEA 5HE1A 3X23A 4DX8A 3PVWA 1WGQA 2VSZA 2ROVA 3ZVRA 2NZ8B 1X1FA 2EC1A 4HAYB 1N3HA 3ML4A 2Y8FA 3HW2B 1X86A 1FHWA 2KUPA 2D9XA 1NI2A 4WVFB 1UEFA 1PMSA 1FHXA 2RNRB 4C0AA 3D8DA 1X1GA 3U8ZA 2UZRA 2YS1A 2D9YA 3ULBA 4HAVB 2DX5A 4GMXB 2DX1A 4GXBA 3PZDA 3SUZA 1MPHA 3AJ4A 4F7HA 5FI1A 4HDOA 1TQZA 1Y5OA 1BTNA 2H7DA 2LYDA 2GS0A 2Z0QA 5KCVA 4EKUA 5DIFB 1AWEA 2CY5A 1V88A 2IFSA 2COFA 2L1CA 3FEHA 1XX0A 2YS5A 2D11A 1RRPB 2KGXB 4A6HA 2V76A 5J3YA 2UZSA 3AU5A 2YT1A 1X05A 2K2JA 1P6SA 1P3RA 1IRSA 1QQGA 2DHKA 3IVFA 1I7AA 1OY2A 4Z2NA 5HE2A 4WSFA 1KI1B 3DXCA 1BTKA 1ISNA 3P7ZA 3CXBB 4KHAA 4KAXB 1SHCA 4K81A 1UNPA 4Z2MB 1MK9B 4ZRIA 5KQ4A 2M38A 3KY9A 4WJ7A 2I5CA 2Y7BA 2YS3A 1OQNA 4MY6A 4MK0A 1W1GA 1BWNA 1SGHA 4KHBB 1NU2A 5J3TA 3GYPA 3TO1A 4HB4B 1AQCA 1P5TA 2RVBB 4MT7A 3SV1A 2J0KA 5L81A 3G9WA 1GG3A 1PLSA 1K5GB 1K5DB 1M7EA 2MDXA 4IOYX 2IYBA 2D10A 2NMBA 1WVHA 2ELAA 2MFQA 4PNKA 2XQNM 2X18A 2KCJA 4HATB 1V61A 5D3WA 4D0NB 1M7RA 2RGNB 2ZPYA 1FGZA 2YT0A 2P0HA 1U27A 1W1HA 2OTXA 3QWMA 2DA0A 3QIJA 1DDVA 4ZRKA 4GPTB 4CYEA 2VKIA 3D8FA 3LJUX 5C5BA 5CLQB 1WGUA 2LOZA 3NSUA 3KRWA 1XODA 4A6KA 4F7UP 2N0YA 1U5DA 3TFMA 4BBKA 1DBHA 2PZ1A 4IFSA 3TCAA 4P7IA 1RJ2A 1XKEA 1FB8A 1H10A 3PEGA 3QBVB 2YF0A 3PVUA 4KVGB 1OMWA 3BJIA 4TKNA 5C16A 5JLJB 4H8SA 4TYZA 4KHOA 1FAOA 3HK0A 3MPXA 4K2PA 2AEHA 2DLWA 2DHIA 4CHMA 2GCLA 4HAZB 4HAXB 2LG1A 1PFJA 2MKRA 5LOPB 3KZ1A 3F5RA 1V5UA 5D27A 1Q67A 1WG7A 1UPRA 2DYQA 4HDQA 2D9ZA 3SO6A 4HB2B 3FSSA 1MAIA 2EMSA 2GCJA 3KRXA 3FM8C 2D4QA 2DYNA 2R0DA 2Z0OA 1H4RA 1ZVRA 4DX90 5D3YA 2YVCA 4HB0B 2G35A 2RSGA 2ADZA 2COCA 2HTHB 2HE7A 1DDWA 3A8QA 2K2UA 1X11A 5J3QA 4GMVA 5D3XA 5DHAB 1UPQA 4GZUA 2DN6A 2Y8GA 2EJ8A 2UVMA 1EGXA 2QKMA 5C5BB 3RCPA 1QC6A 1EF1A 3ODOA 5FI0A 2CAYA 1XCGA 2M14A 4A6FA 3AU4A 1EAZA 1KZGA 1NTVA 1U2BA 4DBBA 2K00A 5DI9B 2BCJA 2FJLA 2LOXA 2W2XC 3V5WA 2P0FA 4K17A 4DXAB 3TW1A 2D9VA 4HAWB 5JHHA 2N23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7G A;  1NTY A;  4HB3 B;  3SYX A;  3ODX A;  2LUL A;  1E5W A;  1XD4 A;  2J59 M;  3UZT A;  3GYO A;  2DKQ A;  3T06 A;  2EMT A;  1DYN A;  1MIX A;  1WJM A;  1LB1 A;  5DH9 B;  4K2O A;  5GOW B;  2DKP A;  4HAU B;  1WI1 A;  5KQ1 A;  5JHG A;  3KSY A;  1ZC4 B;  5C6R A;  1MK7 B;  2LKO A;  2CY4 A;  1J0W A;  1UNR A;  2QKL A;  2I1J A;  2DTC A;  1EVH A;  1WJ1 A;  2ELB A;  2R09 A;  4NSW A;  3BIN A;  3F0W A;  3DXE A;  2Z0P A;  3VOQ A;  1DDM A;  2Q13 A;  2RLO A;  1TXD A;  1J19 A;  2OQB A;  2GJY A;  1BAK A;  4PQ0 A;  4B6H A;  1FGY A;  2RUK B;  4GN1 A;  4A5K A;  4YL8 A;  1Z87 A;  3ODW A;  2I5F A;  3PP2 A;  3O96 A;  1TJ6 A;  3PVL A;  5LON B;  4CHJ A;  2I1K A;  4IAP A;  3ZDT A;  5C79 A;  3VIA A;  3DXD A;  4A6F B;  1LW3 A;  5HE0 A;  2L2I A;  3WA0 A;  1MKE A;  3A8P A;  2MWN B;  1V5P A;  3PSC A;  1W1D A;  2J0M A;  1U5E A;  1XR0 B;  2D9W A;  2CRF A;  1ZM0 A;  1ZSQ A;  3N7C A;  5D3V A;  3SNH A;  3MDB C;  4EMO A;  5JP4 A;  3TVV A;  1GC7 A;  4L6E A;  1ZC3 B;  4XWX A;  1FHO A;  2H7E A;  3CIK A;  2COD A;  1KZ7 A;  1UNQ A;  3OAN A;  1B55 A;  3HQC A;  2W2X D;  2YSZ A;  2VRW B;  3M1I B;  2DHJ A;  5DHF B;  2J0J A;  3U7D A;  2DFK A;  1U29 A;  1V89 A;  3PG7 A;  3P6A A;  1U5F A;  2P0D A;  2ROZ B;  3WYF B;  3D8E A;  1V5M A;  4Y94 A;  1MIZ B;  2AL6 A;  1Y19 B;  2W2W A;  2D2Q A;  1DRO A;  2YRY A;  1I2H A;  2P8V A;  4HHV A;  4EJN A;  2E2X A;  4YON A;  4ZRJ A;  2JP2 A;  1U5G A;  5HE3 A;  3ULC A;  5CLL B;  4NY0 A;  5EFX A;  1GC6 A;  2COA A;  3A98 B;  1FOE A;  5HE1 A;  3X23 A;  4DX8 A;  3PVW A;  1WGQ A;  2VSZ A;  2ROV A;  3ZVR A;  2NZ8 B;  1X1F A;  2EC1 A;  4HAY B;  1N3H A;  3ML4 A;  2Y8F A;  3HW2 B;  1X86 A;  1FHW A;  2KUP A;  2D9X A;  1NI2 A;  4WVF B;  1UEF A;  1PMS A;  1FHX A;  2RNR B;  4C0A A;  3D8D A;  1X1G A;  3U8Z A;  2UZR A;  2YS1 A;  2D9Y A;  3ULB A;  4HAV B;  2DX5 A;  4GMX B;  2DX1 A;  4GXB A;  3PZD A;  3SUZ A;  1MPH A;  3AJ4 A;  4F7H A;  5FI1 A;  4HDO A;  1TQZ A;  1Y5O A;  1BTN A;  2H7D A;  2LYD A;  2GS0 A;  2Z0Q A;  5KCV A;  4EKU A;  5DIF B;  1AWE A;  2CY5 A;  1V88 A;  2IFS A;  2COF A;  2L1C A;  3FEH A;  1XX0 A;  2YS5 A;  2D11 A;  1RRP B;  2KGX B;  4A6H A;  2V76 A;  5J3Y A;  2UZS A;  3AU5 A;  2YT1 A;  1X05 A;  2K2J A;  1P6S A;  1P3R A;  1IRS A;  1QQG A;  2DHK A;  3IVF A;  1I7A A;  1OY2 A;  4Z2N A;  5HE2 A;  4WSF A;  1KI1 B;  3DXC A;  1BTK A;  1ISN A;  3P7Z A;  3CXB B;  4KHA A;  4KAX B;  1SHC A;  4K81 A;  1UNP A;  4Z2M B;  1MK9 B;  4ZRI A;  5KQ4 A;  2M38 A;  3KY9 A;  4WJ7 A;  2I5C A;  2Y7B A;  2YS3 A;  1OQN A;  4MY6 A;  4MK0 A;  1W1G A;  1BWN A;  1SGH A;  4KHB B;  1NU2 A;  5J3T A;  3GYP A;  3TO1 A;  4HB4 B;  1AQC A;  1P5T A;  2RVB B;  4MT7 A;  3SV1 A;  2J0K A;  5L81 A;  3G9W A;  1GG3 A;  1PLS A;  1K5G B;  1K5D B;  1M7E A;  2MDX A;  4IOY X;  2IYB A;  2D10 A;  2NMB A;  1WVH A;  2ELA A;  2MFQ A;  4PNK A;  2XQN M;  2X18 A;  2KCJ A;  4HAT B;  1V61 A;  5D3W A;  4D0N B;  1M7R A;  2RGN B;  2ZPY A;  1FGZ A;  2YT0 A;  2P0H A;  1U27 A;  1W1H A;  2OTX A;  3QWM A;  2DA0 A;  3QIJ A;  1DDV A;  4ZRK A;  4GPT B;  4CYE A;  2VKI A;  3D8F A;  3LJU X;  5C5B A;  5CLQ B;  1WGU A;  2LOZ A;  3NSU A;  3KRW A;  1XOD A;  4A6K A;  4F7U P;  2N0Y A;  1U5D A;  3TFM A;  4BBK A;  1DBH A;  2PZ1 A;  4IFS A;  3TCA A;  4P7I A;  1RJ2 A;  1XKE A;  1FB8 A;  1H10 A;  3PEG A;  3QBV B;  2YF0 A;  3PVU A;  4KVG B;  1OMW A;  3BJI A;  4TKN A;  5C16 A;  5JLJ B;  4H8S A;  4TYZ A;  4KHO A;  1FAO A;  3HK0 A;  3MPX A;  4K2P A;  2AEH A;  2DLW A;  2DHI A;  4CHM A;  2GCL A;  4HAZ B;  4HAX B;  2LG1 A;  1PFJ A;  2MKR A;  5LOP B;  3KZ1 A;  3F5R A;  1V5U A;  5D27 A;  1Q67 A;  1WG7 A;  1UPR A;  2DYQ A;  4HDQ A;  2D9Z A;  3SO6 A;  4HB2 B;  3FSS A;  1MAI A;  2EMS A;  2GCJ A;  3KRX A;  3FM8 C;  2D4Q A;  2DYN A;  2R0D A;  2Z0O A;  1H4R A;  1ZVR A;  4DX9 0;  5D3Y A;  2YVC A;  4HB0 B;  2G35 A;  2RSG A;  2ADZ A;  2COC A;  2HTH B;  2HE7 A;  1DDW A;  3A8Q A;  2K2U A;  1X11 A;  5J3Q A;  4GMV A;  5D3X A;  5DHA B;  1UPQ A;  4GZU A;  2DN6 A;  2Y8G A;  2EJ8 A;  2UVM A;  1EGX A;  2QKM A;  5C5B B;  3RCP A;  1QC6 A;  1EF1 A;  3ODO A;  5FI0 A;  2CAY A;  1XCG A;  2M14 A;  4A6F A;  3AU4 A;  1EAZ A;  1KZG A;  1NTV A;  1U2B A;  4DBB A;  2K00 A;  5DI9 B;  2BCJ A;  2FJL A;  2LOX A;  2W2X C;  3V5W A;  2P0F A;  4K17 A;  4DXA B;  3TW1 A;  2D9V A;  4HAW B;  5JHH A;  2N23 A; 
#chains in the Genus database with same CATH topology
 4F7G A;  1NTY A;  4HB3 B;  3SYX A;  3ODX A;  2LUL A;  1E5W A;  1XD4 A;  2J59 M;  3UZT A;  3GYO A;  2DKQ A;  2KIE A;  2KR0 A;  3T06 A;  2EMT A;  1DYN A;  1MIX A;  1T77 A;  1WJM A;  1LB1 A;  3OHM B;  5DH9 B;  4K2O A;  5GOW B;  2DKP A;  4HAU B;  1WI1 A;  5KQ1 A;  5JHG A;  3KSY A;  1ZC4 B;  5C6R A;  1MK7 B;  2LKO A;  2CY4 A;  2KUQ A;  1J0W A;  1UNR A;  2QKL A;  2I1J A;  2DTC A;  1EVH A;  1WJ1 A;  3HSA A;  2ELB A;  2R09 A;  4NSW A;  3BIN A;  3F0W A;  3DXE A;  2Z0P A;  3VOQ A;  1DDM A;  2Q13 A;  2RLO A;  1TXD A;  1J19 A;  2OQB A;  5I2M A;  2GJY A;  1BAK A;  4PQ0 A;  4B6H A;  1FGY A;  2RUK B;  4GN1 A;  4A5K A;  4YL8 A;  1Z87 A;  3ODW A;  2I5F A;  3PP2 A;  1MI1 A;  3O96 A;  1TJ6 A;  3PVL A;  5LON B;  4CHJ A;  2I1K A;  4IAP A;  3ZDT A;  5C79 A;  3U12 A;  3VIA A;  3DXD A;  2FJU B;  4A6F B;  1LW3 A;  5HE0 A;  2L2I A;  3WA0 A;  1MKE A;  3A8P A;  2MWN B;  1V5P A;  3A58 A;  1W1D A;  3PSC A;  2J0M A;  1U5E A;  1XR0 B;  2D9W A;  2CRF A;  1ZM0 A;  1ZSQ A;  3N7C A;  5D3V A;  3SNH A;  3MDB C;  3NWA A;  4EMO A;  5JP4 A;  3TVV A;  1GC7 A;  4L6E A;  1ZC3 B;  4XWX A;  3FVC A;  1FHO A;  2H7E A;  3CIK A;  2COD A;  1KZ7 A;  1UNQ A;  3OAN A;  1ZYI A;  1B55 A;  3HQC A;  2W2X D;  2YSZ A;  2VRW B;  3M1I B;  2DHJ A;  2K8E A;  5DHF B;  2J0J A;  3U7D A;  2DFK A;  1U29 A;  1V89 A;  3PG7 A;  3P6A A;  1U5F A;  2P0D A;  2ROZ B;  3WYF B;  3D8E A;  1V5M A;  4Y94 A;  1MIZ B;  2AL6 A;  4GOU A;  1Y19 B;  2W2W A;  2D2Q A;  1DRO A;  2YRY A;  1I2H A;  2P8V A;  4HHV A;  4EJN A;  2E2X A;  4YON A;  4ZRJ A;  2JP2 A;  3NWF A;  1U5G A;  5HE3 A;  2YT2 A;  3ULC A;  5CLL B;  4NY0 A;  5EFX A;  1GC6 A;  2KIG A;  2COA A;  3A98 B;  3DCX A;  1FOE A;  5HE1 A;  3X23 A;  4DX8 A;  3PVW A;  1WGQ A;  2Z59 A;  2VSZ A;  2ROV A;  2K49 A;  2NBV A;  3ZVR A;  2NZ8 B;  1X1F A;  2EC1 A;  4HAY B;  1N3H A;  3ML4 A;  2Y8F A;  3HW2 B;  1X86 A;  1FHW A;  2KUP A;  2D9X A;  1NI2 A;  4WVF B;  4D6W A;  1UEF A;  1PMS A;  1FHX A;  2RNR B;  4C0A A;  3D8D A;  4KHB A;  1X1G A;  3U8Z A;  2UZR A;  2YS1 A;  2D9Y A;  3ULB A;  4HAV B;  2DX5 A;  2R2Y A;  4GMX B;  2DX1 A;  4GXB A;  3PZD A;  3SUZ A;  1MPH A;  3AJ4 A;  4F7H A;  3HIE A;  5FI1 A;  4HDO A;  1TQZ A;  1Y5O A;  1BTN A;  2H7D A;  2LYD A;  2GS0 A;  2Z0Q A;  5KCV A;  4EKU A;  5DIF B;  1AWE A;  2CY5 A;  1V88 A;  2IFS A;  4QJ5 B;  2COF A;  2L1C A;  3FEH A;  1XX0 A;  3NWD A;  2YS5 A;  2D11 A;  1RRP B;  2KGX B;  4A6H A;  2V76 A;  5J3Y A;  2UZS A;  3AU5 A;  2YT1 A;  1X05 A;  2K2J A;  1P6S A;  1P3R A;  1IRS A;  1QQG A;  2DHK A;  3IVF A;  1I7A A;  1OY2 A;  4Z2N A;  5HE2 A;  4WSF A;  1KI1 B;  3DXC A;  1BTK A;  1ISN A;  3P7Z A;  3CXB B;  4QXA B;  4KHA A;  4OSN A;  4KAX B;  1SHC A;  4K81 A;  1UNP A;  4Z2M B;  1MK9 B;  4DIX A;  4ZRI A;  5KQ4 A;  2M38 A;  3KY9 A;  4WJ7 A;  2I5C A;  4QJ4 B;  2Y7B A;  2YS3 A;  1OQN A;  4MY6 A;  4MK0 A;  1W1G A;  1BWN A;  5I2S A;  1SGH A;  4KHB B;  1NU2 A;  5J3T A;  5M4Y B;  3GYP A;  3TO1 A;  4HB4 B;  1AQC A;  1P5T A;  2GUM A;  2RVB B;  4GNK B;  2J0K A;  4MT7 A;  3SV1 A;  5L81 A;  3G9W A;  1GG3 A;  1PLS A;  1K5G B;  1K5D B;  1M7E A;  2MDX A;  4IOY X;  2IYB A;  2D10 A;  2NMB A;  1WVH A;  2ELA A;  2MFQ A;  4PNK A;  2XQN M;  2X18 A;  2KCJ A;  4HAT B;  1V61 A;  5D3W A;  4D0N B;  1M7R A;  2RGN B;  2ZPY A;  1FGZ A;  2YT0 A;  2P0H A;  1U27 A;  1W1H A;  2OTX A;  3QWM A;  2DA0 A;  3QIJ A;  1DDV A;  4ZRK A;  4GPT B;  4CYE A;  2VKI A;  3D8F A;  4CSQ A;  3LJU X;  5C5B A;  5CLQ B;  1WGU A;  2LOZ A;  3NSU A;  3KRW A;  1XOD A;  4A6K A;  4F7U P;  2N0Y A;  1U5D A;  3TFM A;  4BBK A;  1DBH A;  2PZ1 A;  4IFS A;  3TCA A;  4P7I A;  1RJ2 A;  1XKE A;  1FB8 A;  1H10 A;  3PEG A;  3QBV B;  2YF0 A;  3PVU A;  4KVG B;  1OMW A;  3BJI A;  4TKN A;  5C16 A;  5JLJ B;  4H8S A;  4TYZ A;  4KHO A;  1FAO A;  3HK0 A;  3MPX A;  4K2P A;  4QJ3 B;  2AEH A;  2DLW A;  2DHI A;  4CHM A;  2GCL A;  4HAZ B;  4HAX B;  2LG1 A;  1PFJ A;  2Z13 A;  2MKR A;  5LOP B;  3KZ1 A;  3F5R A;  1V5U A;  5D27 A;  1Q67 A;  1WG7 A;  1UPR A;  2DYQ A;  3NW8 A;  4HDQ A;  2D9Z A;  3SO6 A;  4HB2 B;  3FSS A;  1MAI A;  2EMS A;  2GCJ A;  3KRX A;  3FM8 C;  2D4Q A;  2DYN A;  2R0D A;  2Z0O A;  1H4R A;  1ZVR A;  4DX9 0;  5D3Y A;  2YVC A;  4HB0 B;  2G35 A;  2RSG A;  2ADZ A;  5IRS A;  2COC A;  2HTH B;  2HE7 A;  1DDW A;  3A8Q A;  2K2U A;  1X11 A;  5J3Q A;  4GMV A;  5D3X A;  5DHA B;  1UPQ A;  4GZU A;  2DN6 A;  2Y8G A;  2EJ8 A;  2UVM A;  1EGX A;  2QKM A;  5C5B B;  3RCP A;  2Z14 A;  1QC6 A;  1EF1 A;  3ODO A;  5FI0 A;  2CAY A;  2ZKM X;  1XCG A;  5LG4 B;  2M14 A;  4A6F A;  3AU4 A;  1EAZ A;  1KZG A;  1NTV A;  1U2B A;  2Z4D A;  4DBB A;  3B77 A;  2K00 A;  5DI9 B;  2RRF A;  2BCJ A;  2FJL A;  2LOX A;  2W2X C;  4L1R A;  3V5W A;  2P0F A;  4K17 A;  4DXA B;  3TW1 A;  2D9V A;  4OT1 A;  4HAW B;  4HSI A;  5JHH A;  2N23 A; 
#chains in the Genus database with same CATH homology
 4F7G A;  1NTY A;  4HB3 B;  3SYX A;  3ODX A;  2LUL A;  1E5W A;  1XD4 A;  2J59 M;  3UZT A;  3GYO A;  2DKQ A;  3T06 A;  2EMT A;  1DYN A;  1MIX A;  1WJM A;  1LB1 A;  5DH9 B;  4K2O A;  5GOW B;  2DKP A;  4HAU B;  1WI1 A;  5KQ1 A;  5JHG A;  3KSY A;  1ZC4 B;  5C6R A;  1MK7 B;  2LKO A;  2CY4 A;  1J0W A;  1UNR A;  2QKL A;  2I1J A;  2DTC A;  1EVH A;  1WJ1 A;  2ELB A;  2R09 A;  4NSW A;  3BIN A;  3F0W A;  3DXE A;  2Z0P A;  3VOQ A;  1DDM A;  2Q13 A;  2RLO A;  1TXD A;  1J19 A;  2OQB A;  2GJY A;  1BAK A;  4PQ0 A;  4B6H A;  1FGY A;  2RUK B;  4GN1 A;  4A5K A;  4YL8 A;  1Z87 A;  3ODW A;  2I5F A;  3PP2 A;  3O96 A;  1TJ6 A;  3PVL A;  5LON B;  4CHJ A;  2I1K A;  4IAP A;  3ZDT A;  5C79 A;  3VIA A;  3DXD A;  4A6F B;  1LW3 A;  5HE0 A;  2L2I A;  3WA0 A;  1MKE A;  3A8P A;  2MWN B;  1V5P A;  3PSC A;  1W1D A;  2J0M A;  1U5E A;  1XR0 B;  2D9W A;  2CRF A;  1ZM0 A;  1ZSQ A;  3N7C A;  5D3V A;  3SNH A;  3MDB C;  4EMO A;  5JP4 A;  3TVV A;  1GC7 A;  4L6E A;  1ZC3 B;  4XWX A;  1FHO A;  2H7E A;  3CIK A;  2COD A;  1KZ7 A;  1UNQ A;  3OAN A;  1B55 A;  3HQC A;  2W2X D;  2YSZ A;  2VRW B;  3M1I B;  2DHJ A;  5DHF B;  2J0J A;  3U7D A;  2DFK A;  1U29 A;  1V89 A;  3PG7 A;  3P6A A;  1U5F A;  2P0D A;  2ROZ B;  3WYF B;  3D8E A;  1V5M A;  4Y94 A;  1MIZ B;  2AL6 A;  1Y19 B;  2W2W A;  2D2Q A;  1DRO A;  2YRY A;  1I2H A;  2P8V A;  4HHV A;  4EJN A;  2E2X A;  4YON A;  4ZRJ A;  2JP2 A;  1U5G A;  5HE3 A;  3ULC A;  5CLL B;  4NY0 A;  5EFX A;  1GC6 A;  2COA A;  3A98 B;  1FOE A;  5HE1 A;  3X23 A;  4DX8 A;  3PVW A;  1WGQ A;  2VSZ A;  2ROV A;  3ZVR A;  2NZ8 B;  1X1F A;  2EC1 A;  4HAY B;  1N3H A;  3ML4 A;  2Y8F A;  3HW2 B;  1X86 A;  1FHW A;  2KUP A;  2D9X A;  1NI2 A;  4WVF B;  1UEF A;  1PMS A;  1FHX A;  2RNR B;  4C0A A;  3D8D A;  1X1G A;  3U8Z A;  2UZR A;  2YS1 A;  2D9Y A;  3ULB A;  4HAV B;  2DX5 A;  4GMX B;  2DX1 A;  4GXB A;  3PZD A;  3SUZ A;  1MPH A;  3AJ4 A;  4F7H A;  5FI1 A;  4HDO A;  1TQZ A;  1Y5O A;  1BTN A;  2H7D A;  2LYD A;  2GS0 A;  2Z0Q A;  5KCV A;  4EKU A;  5DIF B;  1AWE A;  2CY5 A;  1V88 A;  2IFS A;  2COF A;  2L1C A;  3FEH A;  1XX0 A;  2YS5 A;  2D11 A;  1RRP B;  2KGX B;  4A6H A;  2V76 A;  5J3Y A;  2UZS A;  3AU5 A;  2YT1 A;  1X05 A;  2K2J A;  1P6S A;  1P3R A;  1IRS A;  1QQG A;  2DHK A;  3IVF A;  1I7A A;  1OY2 A;  4Z2N A;  5HE2 A;  4WSF A;  1KI1 B;  3DXC A;  1BTK A;  1ISN A;  3P7Z A;  3CXB B;  4KHA A;  4KAX B;  1SHC A;  4K81 A;  1UNP A;  4Z2M B;  1MK9 B;  4ZRI A;  5KQ4 A;  2M38 A;  3KY9 A;  4WJ7 A;  2I5C A;  2Y7B A;  2YS3 A;  1OQN A;  4MY6 A;  4MK0 A;  1W1G A;  1BWN A;  1SGH A;  4KHB B;  1NU2 A;  5J3T A;  3GYP A;  3TO1 A;  4HB4 B;  1AQC A;  1P5T A;  2RVB B;  4MT7 A;  3SV1 A;  2J0K A;  5L81 A;  3G9W A;  1GG3 A;  1PLS A;  1K5G B;  1K5D B;  1M7E A;  2MDX A;  4IOY X;  2IYB A;  2D10 A;  2NMB A;  1WVH A;  2ELA A;  2MFQ A;  4PNK A;  2XQN M;  2X18 A;  2KCJ A;  4HAT B;  1V61 A;  5D3W A;  4D0N B;  1M7R A;  2RGN B;  2ZPY A;  1FGZ A;  2YT0 A;  2P0H A;  1U27 A;  1W1H A;  2OTX A;  3QWM A;  2DA0 A;  3QIJ A;  1DDV A;  4ZRK A;  4GPT B;  4CYE A;  2VKI A;  3D8F A;  3LJU X;  5C5B A;  5CLQ B;  1WGU A;  2LOZ A;  3NSU A;  3KRW A;  1XOD A;  4A6K A;  4F7U P;  2N0Y A;  1U5D A;  3TFM A;  4BBK A;  1DBH A;  2PZ1 A;  4IFS A;  3TCA A;  4P7I A;  1RJ2 A;  1XKE A;  1FB8 A;  1H10 A;  3PEG A;  3QBV B;  2YF0 A;  3PVU A;  4KVG B;  1OMW A;  3BJI A;  4TKN A;  5C16 A;  5JLJ B;  4H8S A;  4TYZ A;  4KHO A;  1FAO A;  3HK0 A;  3MPX A;  4K2P A;  2AEH A;  2DLW A;  2DHI A;  4CHM A;  2GCL A;  4HAZ B;  4HAX B;  2LG1 A;  1PFJ A;  2MKR A;  5LOP B;  3KZ1 A;  3F5R A;  1V5U A;  5D27 A;  1Q67 A;  1WG7 A;  1UPR A;  2DYQ A;  4HDQ A;  2D9Z A;  3SO6 A;  4HB2 B;  3FSS A;  1MAI A;  2EMS A;  2GCJ A;  3KRX A;  3FM8 C;  2D4Q A;  2DYN A;  2R0D A;  2Z0O A;  1H4R A;  1ZVR A;  4DX9 0;  5D3Y A;  2YVC A;  4HB0 B;  2G35 A;  2RSG A;  2ADZ A;  2COC A;  2HTH B;  2HE7 A;  1DDW A;  3A8Q A;  2K2U A;  1X11 A;  5J3Q A;  4GMV A;  5D3X A;  5DHA B;  1UPQ A;  4GZU A;  2DN6 A;  2Y8G A;  2EJ8 A;  2UVM A;  1EGX A;  2QKM A;  5C5B B;  3RCP A;  1QC6 A;  1EF1 A;  3ODO A;  5FI0 A;  2CAY A;  1XCG A;  2M14 A;  4A6F A;  3AU4 A;  1EAZ A;  1KZG A;  1NTV A;  1U2B A;  4DBB A;  2K00 A;  5DI9 B;  2BCJ A;  2FJL A;  2LOX A;  2W2X C;  3V5W A;  2P0F A;  4K17 A;  4DXA B;  3TW1 A;  2D9V A;  4HAW B;  5JHH A;  2N23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...