4EMOA

Crystal structure of the ph domain of sharpin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
AAVLMAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSMHFLNPQEAQRWAVLVRGATV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of SHARPIN, a Subunit of a Large Multi-protein E3 Ubiquitin Ligase, Reveals a Novel Dimerization Function for the Pleckstrin Homology Superfold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Sharpin
total genus 19
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16764 Sharpin_PH Sharpin PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4emoA00
2PZ1A 5DHFB 3BJIA 1X1FA 5JHHA 1BTNA 3NSUA 1J19A 1V61A 3KRWA 2COAA 3SNHA 4CHJA 1DDVA 4HAWB 2Z0PA 3PVLA 3QBVB 4TKNA 2YT1A 4Y94A 3MPXA 1UNQA 5D27A 2CY5A 1DDMA 3OANA 2JP2A 5DH9B 3SV1A 4ZRJA 2RVBB 1XODA 1V5PA 2YF0A 2ELAA 3AU4A 4WSFA 1K5DB 1NTVA 2LULA 1MIZB 4MK0A 5JP4A 4K2PA 2E2XA 1N3HA 1XD4A 2Y8FA 3U8ZA 1KZGA 3P6AA 1TXDA 2P0DA 1BWNA 2DKPA 2J59M 5FI1A 4GMVA 3M1IB 3D8DA 4IAPA 1WVHA 1FHWA 2I1KA 3ODXA 1W1HA 3PSCA 1WGQA 3F5RA 2LOZA 2Q13A 4DXAB 4Z2MB 2X18A 3PVUA 1GC6A 3SO6A 2VKIA 4HAYB 4PQ0A 4WVFB 2AL6A 4HAVB 3FEHA 2N0YA 5D3WA 2D9XA 2VSZA 1UPQA 1OMWA 1UPRA 2M38A 1B55A 4KAXB 1KI1B 2D11A 3PVWA 1U5FA 1QC6A 1WJ1A 1H10A 2NZ8B 2DTCA 2Z0QA 3TCAA 1FB8A 4KHAA 5CLLB 1Z87A 4MY6A 1W1DA 3T06A 5KCVA 1U5EA 3QWMA 4DX8A 1EGXA 1I7AA 2YSZA 2Y7BA 2COFA 4KHOA 4HAUB 2I1JA 3A8QA 3VOQA 3G9WA 1U5GA 3P7ZA 4HHVA 4HDQA 1WI1A 2H7DA 2R0DA 4HB3B 1GC7A 2K2UA 3F0WA 3X23A 3ODOA 3DXCA 3ZVRA 1W1GA 2EMSA 2DHKA 2RUKB 2AEHA 3KRXA 2N23A 2J0KA 1PMSA 2LG1A 4ZRKA 2OTXA 2GJYA 2J0JA 5HE1A 4L6EA 2UZRA 2DHIA 2DX5A 2YS1A 5C5BB 2QKMA 4HB2B 4EMOA 4A5KA 4HB0B 3WYFB 2I5CA 3GYPA 2LOXA 4GZUA 2R09A 4IOYX 1UNRA 2CRFA 1OY2A 1UEFA 5C6RA 1TQZA 2DN6A 2DKQA 1FOEA 3A8PA 3QIJA 1SHCA 2W2WA 3KY9A 1H4RA 2HTHB 3TW1A 1P5TA 3RCPA 3TO1A 4HATB 5HE3A 5LONB 5DHAB 2P0FA 1M7EA 4P7IA 5HE0A 4CHMA 4HDOA 1ISNA 2XQNM 4H8SA 1E5WA 3BINA 1Y19B 3CXBB 4C0AA 2M14A 1ZC4B 3V5WA 4HB4B 4GXBA 4A6KA 3WA0A 3DXDA 5C5BA 1IRSA 2YS3A 2Y8GA 1XCGA 1X1GA 5D3XA 4DBBA 2ADZA 2YS5A 2DA0A 4B6HA 4Z2NA 2RNRB 1X05A 1V5UA 1Y5OA 2LKOA 3ULCA 1SGHA 1EAZA 2EC1A 1FHOA 2FJLA 5DIFB 2P0HA 1Q67A 3D8EA 1AQCA 1NU2A 4NY0A 1FGYA 1FAOA 1QQGA 2RLOA 4A6FB 2ZPYA 2GCJA 2D9YA 2VRWB 5FI0A 3U7DA 3MDBC 1I2HA 2D9ZA 2EMTA 2I5FA 2YRYA 4WJ7A 5EFXA 1BTKA 1MK9B 2D4QA 4F7GA 3PP2A 3TFMA 2DLWA 1P3RA 3UZTA 2UZSA 1XKEA 4F7UP 4YONA 2ROVA 3KZ1A 2RSGA 4GMXB 5JLJB 1DYNA 1MAIA 3VIAA 3ODWA 3GYOA 4HAXB 5J3YA 3A98B 1TJ6A 2ROZB 4EJNA 1U2BA 1ZVRA 1MIXA 1U29A 2RGNB 5D3YA 2D2QA 4XWXA 4CYEA 2CODA 2J0MA 1DBHA 2W2XD 2L1CA 3D8FA 1NI2A 2COCA 3N7CA 2GS0A 5J3TA 2KUPA 2Z0OA 1FHXA 1NTYA 4A6FA 1XX0A 1U27A 1X86A 1M7RA 2UVMA 3CIKA 2L2IA 4NSWA 4KVGB 2D10A 4D0NB 4GN1A 2K00A 3HW2B 2ELBA 4HAZB 1LW3A 4EKUA 4F7HA 2YT0A 1XR0B 2H7EA 5JHGA 2MWNB 2BCJA 3PEGA 4MT7A 2MKRA 4KHBB 1RRPB 1MK7B 1P6SA 5DI9B 2EJ8A 4A6HA 5LOPB 1DROA 4K17A 4DX90 2KCJA 2DFKA 2DYNA 4K2OA 3SYXA 5CLQB 1K5GB 3ML4A 2QKLA 4TYZA 1WGUA 1J0WA 1RJ2A 4BBKA 3TVVA 1AWEA 1ZC3B 4ZRIA 2OQBA 1WJMA 4K81A 3KSYA 5C16A 1MPHA 3LJUX 3ULBA 2DYQA 1ZM0A 2V76A 2LYDA 2GCLA 2DHJA 1KZ7A 3SUZA 1EF1A 2MFQA 1GG3A 1MKEA 2D9WA 1PFJA 1ZSQA 1DDWA 2CY4A 3O96A 5GOWB 4GPTB 1U5DA 2IYBA 3HK0A 5L81A 1V88A 1OQNA 5C79A 2NMBA 5KQ1A 1FGZA 5D3VA 3FM8C 3PG7A 1WG7A 2IFSA 2CAYA 2W2XC 1UNPA 2G35A 2DX1A 5J3QA 3PZDA 3AU5A 2MDXA 5HE2A 1V5MA 2HE7A 3IVFA 4YL8A 1LB1A 1X11A 4PNKA 3AJ4A 5KQ4A 3ZDTA 2K2JA 1PLSA 1BAKA 2D9VA 3FSSA 1EVHA 4IFSA 1V89A 2P8VA 2KGXB 3DXEA 2YVCA 3HQCA
chains in the Genus database with same CATH superfamily
2PZ1A 5DHFB 4QJ4B 3BJIA 1X1FA 5JHHA 1BTNA 3NSUA 1J19A 1V61A 3KRWA 3FVCA 2COAA 3SNHA 4CHJA 1DDVA 4HAWB 2Z0PA 3PVLA 3QBVB 4TKNA 2YT1A 4Y94A 3MPXA 1UNQA 5D27A 2CY5A 1DDMA 3OANA 2JP2A 5DH9B 2KIEA 3SV1A 2GUMA 4ZRJA 2RVBB 1XODA 1V5PA 2YF0A 2ELAA 3AU4A 4WSFA 1K5DB 1NTVA 2LULA 1MIZB 4MK0A 5JP4A 5I2SA 4K2PA 2E2XA 1N3HA 1XD4A 2Y8FA 3U8ZA 1KZGA 3P6AA 1TXDA 2P0DA 1BWNA 2DKPA 2J59M 5FI1A 4GMVA 3M1IB 4OSNA 3D8DA 2Z4DA 4IAPA 1WVHA 1FHWA 2I1KA 3ODXA 1W1HA 3PSCA 1WGQA 3F5RA 2LOZA 2Q13A 4DXAB 4Z2MB 2X18A 4KHBA 3PVUA 1GC6A 3SO6A 2VKIA 2YT2A 4HAYB 4PQ0A 4WVFB 2AL6A 4HAVB 3FEHA 2N0YA 5D3WA 2D9XA 2VSZA 1UPQA 1OMWA 1UPRA 2M38A 1B55A 4KAXB 1KI1B 2D11A 3PVWA 1U5FA 1QC6A 1WJ1A 3DCXA 2RRFA 1H10A 2NZ8B 2DTCA 2Z0QA 3TCAA 1FB8A 4KHAA 5CLLB 1Z87A 4MY6A 1W1DA 3T06A 5KCVA 1U5EA 3QWMA 4DX8A 2R2YA 1I7AA 2KIGA 1EGXA 2YSZA 2Y7BA 2COFA 4KHOA 4HAUB 2I1JA 3A8QA 4QJ3B 2NBVA 3VOQA 5M4YB 3NWFA 3G9WA 1U5GA 3P7ZA 4HHVA 4HDQA 1WI1A 2H7DA 2R0DA 4HB3B 1GC7A 2K2UA 3F0WA 3X23A 3ODOA 3DXCA 3ZVRA 1W1GA 2EMSA 2DHKA 2RUKB 2AEHA 3KRXA 2K49A 2N23A 3B77A 2J0KA 1PMSA 2LG1A 4ZRKA 2OTXA 2GJYA 2J0JA 5HE1A 4L6EA 2UZRA 2DHIA 2DX5A 2YS1A 5C5BB 2QKMA 4HB2B 4EMOA 4A5KA 4HB0B 3WYFB 5I2MA 2I5CA 3GYPA 2LOXA 4GZUA 2R09A 4IOYX 1UNRA 2CRFA 1OY2A 1UEFA 5C6RA 1TQZA 2DN6A 2DKQA 4HSIA 1FOEA 3A8PA 3QIJA 1SHCA 2W2WA 3KY9A 1H4RA 2HTHB 4D6WA 3TW1A 1P5TA 3RCPA 3TO1A 4HATB 5HE3A 5LONB 5DHAB 2P0FA 1M7EA 4P7IA 4QXAB 5HE0A 4CHMA 4HDOA 1ISNA 2XQNM 4H8SA 1E5WA 3BINA 1Y19B 3CXBB 1T77A 4C0AA 2M14A 1ZC4B 3V5WA 4HB4B 4GXBA 4A6KA 3WA0A 4OT1A 3DXDA 5C5BA 1IRSA 2YS3A 2Y8GA 3NWAA 1XCGA 1X1GA 5D3XA 4DBBA 2Z14A 2ADZA 2YS5A 2DA0A 4B6HA 4Z2NA 2RNRB 1X05A 1V5UA 1Y5OA 2LKOA 3ULCA 5LG4B 1SGHA 1EAZA 2EC1A 1FHOA 2FJLA 5DIFB 2P0HA 1Q67A 2K8EA 3D8EA 1AQCA 1NU2A 4NY0A 1FGYA 1FAOA 1QQGA 2RLOA 4A6FB 2ZPYA 2GCJA 3HSAA 2D9YA 2VRWB 4QJ5B 5FI0A 3U7DA 3MDBC 1I2HA 2D9ZA 2EMTA 2I5FA 2YRYA 4WJ7A 5EFXA 1BTKA 1MK9B 2D4QA 4GNKB 4F7GA 3PP2A 3TFMA 2DLWA 1P3RA 3OHMB 3UZTA 2UZSA 1XKEA 4F7UP 4YONA 2ROVA 3KZ1A 2RSGA 2KR0A 4GMXB 5JLJB 1DYNA 1MAIA 3VIAA 3ODWA 3GYOA 4HAXB 5J3YA 4GOUA 3A98B 1TJ6A 2ROZB 4EJNA 1U2BA 1ZVRA 1MIXA 1U29A 2RGNB 5D3YA 2D2QA 4XWXA 4CYEA 2CODA 2J0MA 1DBHA 2W2XD 2L1CA 3D8FA 1NI2A 2COCA 3N7CA 3HIEA 2ZKMX 2GS0A 5J3TA 2KUPA 2Z0OA 1FHXA 1NTYA 4A6FA 1XX0A 1U27A 1X86A 1M7RA 3NW8A 2UVMA 3CIKA 2FJUB 2L2IA 4NSWA 4KVGB 2D10A 2Z13A 4D0NB 4GN1A 2K00A 3HW2B 2ELBA 4HAZB 1LW3A 4EKUA 4F7HA 2YT0A 1XR0B 2H7EA 3A58A 5JHGA 2MWNB 2BCJA 3PEGA 2Z59A 4MT7A 2MKRA 4KHBB 1RRPB 1MK7B 4CSQA 1P6SA 5DI9B 3NWDA 2EJ8A 4A6HA 5LOPB 1DROA 4K17A 4DX90 2KCJA 2DFKA 2DYNA 4K2OA 3SYXA 5CLQB 1K5GB 3ML4A 2QKLA 4TYZA 1WGUA 1J0WA 1RJ2A 4BBKA 3TVVA 1AWEA 1ZC3B 4ZRIA 2OQBA 1WJMA 4K81A 3KSYA 5C16A 5IRSA 1MPHA 3LJUX 3ULBA 2DYQA 1ZM0A 2V76A 2LYDA 2GCLA 2DHJA 1KZ7A 3SUZA 4L1RA 1EF1A 4DIXA 2MFQA 1GG3A 1MKEA 2D9WA 1PFJA 1ZSQA 1DDWA 2CY4A 3O96A 5GOWB 4GPTB 1U5DA 2IYBA 3HK0A 5L81A 1V88A 1OQNA 5C79A 1MI1A 2NMBA 5KQ1A 1FGZA 5D3VA 3FM8C 3PG7A 1WG7A 2IFSA 2CAYA 2W2XC 1UNPA 2G35A 2DX1A 5J3QA 3PZDA 1ZYIA 3AU5A 2MDXA 5HE2A 1V5MA 2HE7A 3IVFA 4YL8A 1LB1A 1X11A 4PNKA 2KUQA 3AJ4A 5KQ4A 3ZDTA 2K2JA 1PLSA 1BAKA 2D9VA 3FSSA 3U12A 1EVHA 4IFSA 1V89A 2P8VA 2KGXB 3DXEA 2YVCA 3HQCA
chains in the Genus database with same CATH topology
2PZ1A 5DHFB 3BJIA 1X1FA 5JHHA 1BTNA 3NSUA 1J19A 1V61A 3KRWA 2COAA 3SNHA 4CHJA 1DDVA 4HAWB 2Z0PA 3PVLA 3QBVB 4TKNA 2YT1A 4Y94A 3MPXA 1UNQA 5D27A 2CY5A 1DDMA 3OANA 2JP2A 5DH9B 3SV1A 4ZRJA 2RVBB 1XODA 1V5PA 2YF0A 2ELAA 3AU4A 4WSFA 1K5DB 1NTVA 2LULA 1MIZB 4MK0A 5JP4A 4K2PA 2E2XA 1N3HA 1XD4A 2Y8FA 3U8ZA 1KZGA 3P6AA 1TXDA 2P0DA 1BWNA 2DKPA 2J59M 5FI1A 4GMVA 3M1IB 3D8DA 4IAPA 1WVHA 1FHWA 2I1KA 3ODXA 1W1HA 3PSCA 1WGQA 3F5RA 2LOZA 2Q13A 4DXAB 4Z2MB 2X18A 3PVUA 1GC6A 3SO6A 2VKIA 4HAYB 4PQ0A 4WVFB 2AL6A 4HAVB 3FEHA 2N0YA 5D3WA 2D9XA 2VSZA 1UPQA 1OMWA 1UPRA 2M38A 1B55A 4KAXB 1KI1B 2D11A 3PVWA 1U5FA 1QC6A 1WJ1A 1H10A 2NZ8B 2DTCA 2Z0QA 3TCAA 1FB8A 4KHAA 5CLLB 1Z87A 4MY6A 1W1DA 3T06A 5KCVA 1U5EA 3QWMA 4DX8A 1EGXA 1I7AA 2YSZA 2Y7BA 2COFA 4KHOA 4HAUB 2I1JA 3A8QA 3VOQA 3G9WA 1U5GA 3P7ZA 4HHVA 4HDQA 1WI1A 2H7DA 2R0DA 4HB3B 1GC7A 2K2UA 3F0WA 3X23A 3ODOA 3DXCA 3ZVRA 1W1GA 2EMSA 2DHKA 2RUKB 2AEHA 3KRXA 2N23A 2J0KA 1PMSA 2LG1A 4ZRKA 2OTXA 2GJYA 2J0JA 5HE1A 4L6EA 2UZRA 2DHIA 2DX5A 2YS1A 5C5BB 2QKMA 4HB2B 4EMOA 4A5KA 4HB0B 3WYFB 2I5CA 3GYPA 2LOXA 4GZUA 2R09A 4IOYX 1UNRA 2CRFA 1OY2A 1UEFA 5C6RA 1TQZA 2DN6A 2DKQA 1FOEA 3A8PA 3QIJA 1SHCA 2W2WA 3KY9A 1H4RA 2HTHB 3TW1A 1P5TA 3RCPA 3TO1A 4HATB 5HE3A 5LONB 5DHAB 2P0FA 1M7EA 4P7IA 5HE0A 4CHMA 4HDOA 1ISNA 2XQNM 4H8SA 1E5WA 3BINA 1Y19B 3CXBB 4C0AA 2M14A 1ZC4B 3V5WA 4HB4B 4GXBA 4A6KA 3WA0A 3DXDA 5C5BA 1IRSA 2YS3A 2Y8GA 1XCGA 1X1GA 5D3XA 4DBBA 2ADZA 2YS5A 2DA0A 4B6HA 4Z2NA 2RNRB 1X05A 1V5UA 1Y5OA 2LKOA 3ULCA 1SGHA 1EAZA 2EC1A 1FHOA 2FJLA 5DIFB 2P0HA 1Q67A 3D8EA 1AQCA 1NU2A 4NY0A 1FGYA 1FAOA 1QQGA 2RLOA 4A6FB 2ZPYA 2GCJA 2D9YA 2VRWB 5FI0A 3U7DA 3MDBC 1I2HA 2D9ZA 2EMTA 2I5FA 2YRYA 4WJ7A 5EFXA 1BTKA 1MK9B 2D4QA 4F7GA 3PP2A 3TFMA 2DLWA 1P3RA 3UZTA 2UZSA 1XKEA 4F7UP 4YONA 2ROVA 3KZ1A 2RSGA 4GMXB 5JLJB 1DYNA 1MAIA 3VIAA 3ODWA 3GYOA 4HAXB 5J3YA 3A98B 1TJ6A 2ROZB 4EJNA 1U2BA 1ZVRA 1MIXA 1U29A 2RGNB 5D3YA 2D2QA 4XWXA 4CYEA 2CODA 2J0MA 1DBHA 2W2XD 2L1CA 3D8FA 1NI2A 2COCA 3N7CA 2GS0A 5J3TA 2KUPA 2Z0OA 1FHXA 1NTYA 4A6FA 1XX0A 1U27A 1X86A 1M7RA 2UVMA 3CIKA 2L2IA 4NSWA 4KVGB 2D10A 4D0NB 4GN1A 2K00A 3HW2B 2ELBA 4HAZB 1LW3A 4EKUA 4F7HA 2YT0A 1XR0B 2H7EA 5JHGA 2MWNB 2BCJA 3PEGA 4MT7A 2MKRA 4KHBB 1RRPB 1MK7B 1P6SA 5DI9B 2EJ8A 4A6HA 5LOPB 1DROA 4K17A 4DX90 2KCJA 2DFKA 2DYNA 4K2OA 3SYXA 5CLQB 1K5GB 3ML4A 2QKLA 4TYZA 1WGUA 1J0WA 1RJ2A 4BBKA 3TVVA 1AWEA 1ZC3B 4ZRIA 2OQBA 1WJMA 4K81A 3KSYA 5C16A 1MPHA 3LJUX 3ULBA 2DYQA 1ZM0A 2V76A 2LYDA 2GCLA 2DHJA 1KZ7A 3SUZA 1EF1A 2MFQA 1GG3A 1MKEA 2D9WA 1PFJA 1ZSQA 1DDWA 2CY4A 3O96A 5GOWB 4GPTB 1U5DA 2IYBA 3HK0A 5L81A 1V88A 1OQNA 5C79A 2NMBA 5KQ1A 1FGZA 5D3VA 3FM8C 3PG7A 1WG7A 2IFSA 2CAYA 2W2XC 1UNPA 2G35A 2DX1A 5J3QA 3PZDA 3AU5A 2MDXA 5HE2A 1V5MA 2HE7A 3IVFA 4YL8A 1LB1A 1X11A 4PNKA 3AJ4A 5KQ4A 3ZDTA 2K2JA 1PLSA 1BAKA 2D9VA 3FSSA 1EVHA 4IFSA 1V89A 2P8VA 2KGXB 3DXEA 2YVCA 3HQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZ1 A;  5DHF B;  3BJI A;  1X1F A;  5JHH A;  1BTN A;  3NSU A;  1J19 A;  1V61 A;  3KRW A;  2COA A;  3SNH A;  4CHJ A;  1DDV A;  4HAW B;  2Z0P A;  3PVL A;  3QBV B;  4TKN A;  2YT1 A;  4Y94 A;  3MPX A;  1UNQ A;  5D27 A;  2CY5 A;  1DDM A;  3OAN A;  2JP2 A;  5DH9 B;  3SV1 A;  4ZRJ A;  2RVB B;  1XOD A;  1V5P A;  2YF0 A;  2ELA A;  3AU4 A;  4WSF A;  1K5D B;  1NTV A;  2LUL A;  1MIZ B;  4MK0 A;  5JP4 A;  4K2P A;  2E2X A;  1N3H A;  1XD4 A;  2Y8F A;  3U8Z A;  1KZG A;  3P6A A;  1TXD A;  2P0D A;  1BWN A;  2DKP A;  2J59 M;  5FI1 A;  4GMV A;  3M1I B;  3D8D A;  4IAP A;  1WVH A;  1FHW A;  2I1K A;  3ODX A;  1W1H A;  3PSC A;  1WGQ A;  3F5R A;  2LOZ A;  2Q13 A;  4DXA B;  4Z2M B;  2X18 A;  3PVU A;  1GC6 A;  3SO6 A;  2VKI A;  4HAY B;  4PQ0 A;  4WVF B;  2AL6 A;  4HAV B;  3FEH A;  2N0Y A;  5D3W A;  2D9X A;  2VSZ A;  1UPQ A;  1OMW A;  1UPR A;  2M38 A;  1B55 A;  4KAX B;  1KI1 B;  2D11 A;  3PVW A;  1U5F A;  1QC6 A;  1WJ1 A;  1H10 A;  2NZ8 B;  2DTC A;  2Z0Q A;  3TCA A;  1FB8 A;  4KHA A;  5CLL B;  1Z87 A;  4MY6 A;  1W1D A;  3T06 A;  5KCV A;  1U5E A;  3QWM A;  4DX8 A;  1EGX A;  1I7A A;  2YSZ A;  2Y7B A;  2COF A;  4KHO A;  4HAU B;  2I1J A;  3A8Q A;  3VOQ A;  3G9W A;  1U5G A;  3P7Z A;  4HHV A;  4HDQ A;  1WI1 A;  2H7D A;  2R0D A;  4HB3 B;  1GC7 A;  2K2U A;  3F0W A;  3X23 A;  3ODO A;  3DXC A;  3ZVR A;  1W1G A;  2EMS A;  2DHK A;  2RUK B;  2AEH A;  3KRX A;  2N23 A;  2J0K A;  1PMS A;  2LG1 A;  4ZRK A;  2OTX A;  2GJY A;  2J0J A;  5HE1 A;  4L6E A;  2UZR A;  2DHI A;  2DX5 A;  2YS1 A;  5C5B B;  2QKM A;  4HB2 B;  4EMO A;  4A5K A;  4HB0 B;  3WYF B;  2I5C A;  3GYP A;  2LOX A;  4GZU A;  2R09 A;  4IOY X;  1UNR A;  2CRF A;  1OY2 A;  1UEF A;  5C6R A;  1TQZ A;  2DN6 A;  2DKQ A;  1FOE A;  3A8P A;  3QIJ A;  1SHC A;  2W2W A;  3KY9 A;  1H4R A;  2HTH B;  3TW1 A;  1P5T A;  3RCP A;  3TO1 A;  4HAT B;  5HE3 A;  5LON B;  5DHA B;  2P0F A;  1M7E A;  4P7I A;  5HE0 A;  4CHM A;  4HDO A;  1ISN A;  2XQN M;  4H8S A;  1E5W A;  3BIN A;  1Y19 B;  3CXB B;  4C0A A;  2M14 A;  1ZC4 B;  3V5W A;  4HB4 B;  4GXB A;  4A6K A;  3WA0 A;  3DXD A;  5C5B A;  1IRS A;  2YS3 A;  2Y8G A;  1XCG A;  1X1G A;  5D3X A;  4DBB A;  2ADZ A;  2YS5 A;  2DA0 A;  4B6H A;  4Z2N A;  2RNR B;  1X05 A;  1V5U A;  1Y5O A;  2LKO A;  3ULC A;  1SGH A;  1EAZ A;  2EC1 A;  1FHO A;  2FJL A;  5DIF B;  2P0H A;  1Q67 A;  3D8E A;  1AQC A;  1NU2 A;  4NY0 A;  1FGY A;  1FAO A;  1QQG A;  2RLO A;  4A6F B;  2ZPY A;  2GCJ A;  2D9Y A;  2VRW B;  5FI0 A;  3U7D A;  3MDB C;  1I2H A;  2D9Z A;  2EMT A;  2I5F A;  2YRY A;  4WJ7 A;  5EFX A;  1BTK A;  1MK9 B;  2D4Q A;  4F7G A;  3PP2 A;  3TFM A;  2DLW A;  1P3R A;  3UZT A;  2UZS A;  1XKE A;  4F7U P;  4YON A;  2ROV A;  3KZ1 A;  2RSG A;  4GMX B;  5JLJ B;  1DYN A;  1MAI A;  3VIA A;  3ODW A;  3GYO A;  4HAX B;  5J3Y A;  3A98 B;  1TJ6 A;  2ROZ B;  4EJN A;  1U2B A;  1ZVR A;  1MIX A;  1U29 A;  2RGN B;  5D3Y A;  2D2Q A;  4XWX A;  4CYE A;  2COD A;  2J0M A;  1DBH A;  2W2X D;  2L1C A;  3D8F A;  1NI2 A;  2COC A;  3N7C A;  2GS0 A;  5J3T A;  2KUP A;  2Z0O A;  1FHX A;  1NTY A;  4A6F A;  1XX0 A;  1U27 A;  1X86 A;  1M7R A;  2UVM A;  3CIK A;  2L2I A;  4NSW A;  4KVG B;  2D10 A;  4D0N B;  4GN1 A;  2K00 A;  3HW2 B;  2ELB A;  4HAZ B;  1LW3 A;  4EKU A;  4F7H A;  2YT0 A;  1XR0 B;  2H7E A;  5JHG A;  2MWN B;  2BCJ A;  3PEG A;  4MT7 A;  2MKR A;  4KHB B;  1RRP B;  1MK7 B;  1P6S A;  5DI9 B;  2EJ8 A;  4A6H A;  5LOP B;  1DRO A;  4K17 A;  4DX9 0;  2KCJ A;  2DFK A;  2DYN A;  4K2O A;  3SYX A;  5CLQ B;  1K5G B;  3ML4 A;  2QKL A;  4TYZ A;  1WGU A;  1J0W A;  1RJ2 A;  4BBK A;  3TVV A;  1AWE A;  1ZC3 B;  4ZRI A;  2OQB A;  1WJM A;  4K81 A;  3KSY A;  5C16 A;  1MPH A;  3LJU X;  3ULB A;  2DYQ A;  1ZM0 A;  2V76 A;  2LYD A;  2GCL A;  2DHJ A;  1KZ7 A;  3SUZ A;  1EF1 A;  2MFQ A;  1GG3 A;  1MKE A;  2D9W A;  1PFJ A;  1ZSQ A;  1DDW A;  2CY4 A;  3O96 A;  5GOW B;  4GPT B;  1U5D A;  2IYB A;  3HK0 A;  5L81 A;  1V88 A;  1OQN A;  5C79 A;  2NMB A;  5KQ1 A;  1FGZ A;  5D3V A;  3FM8 C;  3PG7 A;  1WG7 A;  2IFS A;  2CAY A;  2W2X C;  1UNP A;  2G35 A;  2DX1 A;  5J3Q A;  3PZD A;  3AU5 A;  2MDX A;  5HE2 A;  1V5M A;  2HE7 A;  3IVF A;  4YL8 A;  1LB1 A;  1X11 A;  4PNK A;  3AJ4 A;  5KQ4 A;  3ZDT A;  2K2J A;  1PLS A;  1BAK A;  2D9V A;  3FSS A;  1EVH A;  4IFS A;  1V89 A;  2P8V A;  2KGX B;  3DXE A;  2YVC A;  3HQC A; 
#chains in the Genus database with same CATH topology
 2PZ1 A;  5DHF B;  4QJ4 B;  3BJI A;  1X1F A;  5JHH A;  1BTN A;  3NSU A;  1J19 A;  1V61 A;  3KRW A;  3FVC A;  2COA A;  3SNH A;  4CHJ A;  1DDV A;  4HAW B;  2Z0P A;  3PVL A;  3QBV B;  4TKN A;  2YT1 A;  4Y94 A;  3MPX A;  1UNQ A;  5D27 A;  2CY5 A;  1DDM A;  3OAN A;  2JP2 A;  5DH9 B;  2KIE A;  3SV1 A;  2GUM A;  4ZRJ A;  2RVB B;  1XOD A;  1V5P A;  2YF0 A;  2ELA A;  3AU4 A;  4WSF A;  1K5D B;  1NTV A;  2LUL A;  1MIZ B;  4MK0 A;  5JP4 A;  5I2S A;  4K2P A;  2E2X A;  1N3H A;  1XD4 A;  2Y8F A;  3U8Z A;  1KZG A;  3P6A A;  1TXD A;  2P0D A;  1BWN A;  2DKP A;  2J59 M;  5FI1 A;  4GMV A;  3M1I B;  4OSN A;  3D8D A;  2Z4D A;  4IAP A;  1WVH A;  1FHW A;  2I1K A;  3ODX A;  1W1H A;  3PSC A;  1WGQ A;  3F5R A;  2LOZ A;  2Q13 A;  4DXA B;  4Z2M B;  2X18 A;  4KHB A;  3PVU A;  1GC6 A;  3SO6 A;  2VKI A;  2YT2 A;  4HAY B;  4PQ0 A;  4WVF B;  2AL6 A;  4HAV B;  3FEH A;  2N0Y A;  5D3W A;  2D9X A;  2VSZ A;  1UPQ A;  1OMW A;  1UPR A;  2M38 A;  1B55 A;  4KAX B;  1KI1 B;  2D11 A;  3PVW A;  1U5F A;  1QC6 A;  1WJ1 A;  3DCX A;  2RRF A;  1H10 A;  2NZ8 B;  2DTC A;  2Z0Q A;  3TCA A;  1FB8 A;  4KHA A;  5CLL B;  1Z87 A;  4MY6 A;  1W1D A;  3T06 A;  5KCV A;  1U5E A;  3QWM A;  4DX8 A;  2R2Y A;  1I7A A;  2KIG A;  1EGX A;  2YSZ A;  2Y7B A;  2COF A;  4KHO A;  4HAU B;  2I1J A;  3A8Q A;  4QJ3 B;  2NBV A;  3VOQ A;  5M4Y B;  3NWF A;  3G9W A;  1U5G A;  3P7Z A;  4HHV A;  4HDQ A;  1WI1 A;  2H7D A;  2R0D A;  4HB3 B;  1GC7 A;  2K2U A;  3F0W A;  3X23 A;  3ODO A;  3DXC A;  3ZVR A;  1W1G A;  2EMS A;  2DHK A;  2RUK B;  2AEH A;  3KRX A;  2K49 A;  2N23 A;  3B77 A;  2J0K A;  1PMS A;  2LG1 A;  4ZRK A;  2OTX A;  2GJY A;  2J0J A;  5HE1 A;  4L6E A;  2UZR A;  2DHI A;  2DX5 A;  2YS1 A;  5C5B B;  2QKM A;  4HB2 B;  4EMO A;  4A5K A;  4HB0 B;  3WYF B;  5I2M A;  2I5C A;  3GYP A;  2LOX A;  4GZU A;  2R09 A;  4IOY X;  1UNR A;  2CRF A;  1OY2 A;  1UEF A;  5C6R A;  1TQZ A;  2DN6 A;  2DKQ A;  4HSI A;  1FOE A;  3A8P A;  3QIJ A;  1SHC A;  2W2W A;  3KY9 A;  1H4R A;  2HTH B;  4D6W A;  3TW1 A;  1P5T A;  3RCP A;  3TO1 A;  4HAT B;  5HE3 A;  5LON B;  5DHA B;  2P0F A;  1M7E A;  4P7I A;  4QXA B;  5HE0 A;  4CHM A;  4HDO A;  1ISN A;  2XQN M;  4H8S A;  1E5W A;  3BIN A;  1Y19 B;  3CXB B;  1T77 A;  4C0A A;  2M14 A;  1ZC4 B;  3V5W A;  4HB4 B;  4GXB A;  4A6K A;  3WA0 A;  4OT1 A;  3DXD A;  5C5B A;  1IRS A;  2YS3 A;  2Y8G A;  3NWA A;  1XCG A;  1X1G A;  5D3X A;  4DBB A;  2Z14 A;  2ADZ A;  2YS5 A;  2DA0 A;  4B6H A;  4Z2N A;  2RNR B;  1X05 A;  1V5U A;  1Y5O A;  2LKO A;  3ULC A;  5LG4 B;  1SGH A;  1EAZ A;  2EC1 A;  1FHO A;  2FJL A;  5DIF B;  2P0H A;  1Q67 A;  2K8E A;  3D8E A;  1AQC A;  1NU2 A;  4NY0 A;  1FGY A;  1FAO A;  1QQG A;  2RLO A;  4A6F B;  2ZPY A;  2GCJ A;  3HSA A;  2D9Y A;  2VRW B;  4QJ5 B;  5FI0 A;  3U7D A;  3MDB C;  1I2H A;  2D9Z A;  2EMT A;  2I5F A;  2YRY A;  4WJ7 A;  5EFX A;  1BTK A;  1MK9 B;  2D4Q A;  4GNK B;  4F7G A;  3PP2 A;  3TFM A;  2DLW A;  1P3R A;  3OHM B;  3UZT A;  2UZS A;  1XKE A;  4F7U P;  4YON A;  2ROV A;  3KZ1 A;  2RSG A;  2KR0 A;  4GMX B;  5JLJ B;  1DYN A;  1MAI A;  3VIA A;  3ODW A;  3GYO A;  4HAX B;  5J3Y A;  4GOU A;  3A98 B;  1TJ6 A;  2ROZ B;  4EJN A;  1U2B A;  1ZVR A;  1MIX A;  1U29 A;  2RGN B;  5D3Y A;  2D2Q A;  4XWX A;  4CYE A;  2COD A;  2J0M A;  1DBH A;  2W2X D;  2L1C A;  3D8F A;  1NI2 A;  2COC A;  3N7C A;  3HIE A;  2ZKM X;  2GS0 A;  5J3T A;  2KUP A;  2Z0O A;  1FHX A;  1NTY A;  4A6F A;  1XX0 A;  1U27 A;  1X86 A;  1M7R A;  3NW8 A;  2UVM A;  3CIK A;  2FJU B;  2L2I A;  4NSW A;  4KVG B;  2D10 A;  2Z13 A;  4D0N B;  4GN1 A;  2K00 A;  3HW2 B;  2ELB A;  4HAZ B;  1LW3 A;  4EKU A;  4F7H A;  2YT0 A;  1XR0 B;  2H7E A;  3A58 A;  5JHG A;  2MWN B;  2BCJ A;  3PEG A;  2Z59 A;  4MT7 A;  2MKR A;  4KHB B;  1RRP B;  1MK7 B;  4CSQ A;  1P6S A;  5DI9 B;  3NWD A;  2EJ8 A;  4A6H A;  5LOP B;  1DRO A;  4K17 A;  4DX9 0;  2KCJ A;  2DFK A;  2DYN A;  4K2O A;  3SYX A;  5CLQ B;  1K5G B;  3ML4 A;  2QKL A;  4TYZ A;  1WGU A;  1J0W A;  1RJ2 A;  4BBK A;  3TVV A;  1AWE A;  1ZC3 B;  4ZRI A;  2OQB A;  1WJM A;  4K81 A;  3KSY A;  5C16 A;  5IRS A;  1MPH A;  3LJU X;  3ULB A;  2DYQ A;  1ZM0 A;  2V76 A;  2LYD A;  2GCL A;  2DHJ A;  1KZ7 A;  3SUZ A;  4L1R A;  1EF1 A;  4DIX A;  2MFQ A;  1GG3 A;  1MKE A;  2D9W A;  1PFJ A;  1ZSQ A;  1DDW A;  2CY4 A;  3O96 A;  5GOW B;  4GPT B;  1U5D A;  2IYB A;  3HK0 A;  5L81 A;  1V88 A;  1OQN A;  5C79 A;  1MI1 A;  2NMB A;  5KQ1 A;  1FGZ A;  5D3V A;  3FM8 C;  3PG7 A;  1WG7 A;  2IFS A;  2CAY A;  2W2X C;  1UNP A;  2G35 A;  2DX1 A;  5J3Q A;  3PZD A;  1ZYI A;  3AU5 A;  2MDX A;  5HE2 A;  1V5M A;  2HE7 A;  3IVF A;  4YL8 A;  1LB1 A;  1X11 A;  4PNK A;  2KUQ A;  3AJ4 A;  5KQ4 A;  3ZDT A;  2K2J A;  1PLS A;  1BAK A;  2D9V A;  3FSS A;  3U12 A;  1EVH A;  4IFS A;  1V89 A;  2P8V A;  2KGX B;  3DXE A;  2YVC A;  3HQC A; 
#chains in the Genus database with same CATH homology
 2PZ1 A;  5DHF B;  3BJI A;  1X1F A;  5JHH A;  1BTN A;  3NSU A;  1J19 A;  1V61 A;  3KRW A;  2COA A;  3SNH A;  4CHJ A;  1DDV A;  4HAW B;  2Z0P A;  3PVL A;  3QBV B;  4TKN A;  2YT1 A;  4Y94 A;  3MPX A;  1UNQ A;  5D27 A;  2CY5 A;  1DDM A;  3OAN A;  2JP2 A;  5DH9 B;  3SV1 A;  4ZRJ A;  2RVB B;  1XOD A;  1V5P A;  2YF0 A;  2ELA A;  3AU4 A;  4WSF A;  1K5D B;  1NTV A;  2LUL A;  1MIZ B;  4MK0 A;  5JP4 A;  4K2P A;  2E2X A;  1N3H A;  1XD4 A;  2Y8F A;  3U8Z A;  1KZG A;  3P6A A;  1TXD A;  2P0D A;  1BWN A;  2DKP A;  2J59 M;  5FI1 A;  4GMV A;  3M1I B;  3D8D A;  4IAP A;  1WVH A;  1FHW A;  2I1K A;  3ODX A;  1W1H A;  3PSC A;  1WGQ A;  3F5R A;  2LOZ A;  2Q13 A;  4DXA B;  4Z2M B;  2X18 A;  3PVU A;  1GC6 A;  3SO6 A;  2VKI A;  4HAY B;  4PQ0 A;  4WVF B;  2AL6 A;  4HAV B;  3FEH A;  2N0Y A;  5D3W A;  2D9X A;  2VSZ A;  1UPQ A;  1OMW A;  1UPR A;  2M38 A;  1B55 A;  4KAX B;  1KI1 B;  2D11 A;  3PVW A;  1U5F A;  1QC6 A;  1WJ1 A;  1H10 A;  2NZ8 B;  2DTC A;  2Z0Q A;  3TCA A;  1FB8 A;  4KHA A;  5CLL B;  1Z87 A;  4MY6 A;  1W1D A;  3T06 A;  5KCV A;  1U5E A;  3QWM A;  4DX8 A;  1EGX A;  1I7A A;  2YSZ A;  2Y7B A;  2COF A;  4KHO A;  4HAU B;  2I1J A;  3A8Q A;  3VOQ A;  3G9W A;  1U5G A;  3P7Z A;  4HHV A;  4HDQ A;  1WI1 A;  2H7D A;  2R0D A;  4HB3 B;  1GC7 A;  2K2U A;  3F0W A;  3X23 A;  3ODO A;  3DXC A;  3ZVR A;  1W1G A;  2EMS A;  2DHK A;  2RUK B;  2AEH A;  3KRX A;  2N23 A;  2J0K A;  1PMS A;  2LG1 A;  4ZRK A;  2OTX A;  2GJY A;  2J0J A;  5HE1 A;  4L6E A;  2UZR A;  2DHI A;  2DX5 A;  2YS1 A;  5C5B B;  2QKM A;  4HB2 B;  4EMO A;  4A5K A;  4HB0 B;  3WYF B;  2I5C A;  3GYP A;  2LOX A;  4GZU A;  2R09 A;  4IOY X;  1UNR A;  2CRF A;  1OY2 A;  1UEF A;  5C6R A;  1TQZ A;  2DN6 A;  2DKQ A;  1FOE A;  3A8P A;  3QIJ A;  1SHC A;  2W2W A;  3KY9 A;  1H4R A;  2HTH B;  3TW1 A;  1P5T A;  3RCP A;  3TO1 A;  4HAT B;  5HE3 A;  5LON B;  5DHA B;  2P0F A;  1M7E A;  4P7I A;  5HE0 A;  4CHM A;  4HDO A;  1ISN A;  2XQN M;  4H8S A;  1E5W A;  3BIN A;  1Y19 B;  3CXB B;  4C0A A;  2M14 A;  1ZC4 B;  3V5W A;  4HB4 B;  4GXB A;  4A6K A;  3WA0 A;  3DXD A;  5C5B A;  1IRS A;  2YS3 A;  2Y8G A;  1XCG A;  1X1G A;  5D3X A;  4DBB A;  2ADZ A;  2YS5 A;  2DA0 A;  4B6H A;  4Z2N A;  2RNR B;  1X05 A;  1V5U A;  1Y5O A;  2LKO A;  3ULC A;  1SGH A;  1EAZ A;  2EC1 A;  1FHO A;  2FJL A;  5DIF B;  2P0H A;  1Q67 A;  3D8E A;  1AQC A;  1NU2 A;  4NY0 A;  1FGY A;  1FAO A;  1QQG A;  2RLO A;  4A6F B;  2ZPY A;  2GCJ A;  2D9Y A;  2VRW B;  5FI0 A;  3U7D A;  3MDB C;  1I2H A;  2D9Z A;  2EMT A;  2I5F A;  2YRY A;  4WJ7 A;  5EFX A;  1BTK A;  1MK9 B;  2D4Q A;  4F7G A;  3PP2 A;  3TFM A;  2DLW A;  1P3R A;  3UZT A;  2UZS A;  1XKE A;  4F7U P;  4YON A;  2ROV A;  3KZ1 A;  2RSG A;  4GMX B;  5JLJ B;  1DYN A;  1MAI A;  3VIA A;  3ODW A;  3GYO A;  4HAX B;  5J3Y A;  3A98 B;  1TJ6 A;  2ROZ B;  4EJN A;  1U2B A;  1ZVR A;  1MIX A;  1U29 A;  2RGN B;  5D3Y A;  2D2Q A;  4XWX A;  4CYE A;  2COD A;  2J0M A;  1DBH A;  2W2X D;  2L1C A;  3D8F A;  1NI2 A;  2COC A;  3N7C A;  2GS0 A;  5J3T A;  2KUP A;  2Z0O A;  1FHX A;  1NTY A;  4A6F A;  1XX0 A;  1U27 A;  1X86 A;  1M7R A;  2UVM A;  3CIK A;  2L2I A;  4NSW A;  4KVG B;  2D10 A;  4D0N B;  4GN1 A;  2K00 A;  3HW2 B;  2ELB A;  4HAZ B;  1LW3 A;  4EKU A;  4F7H A;  2YT0 A;  1XR0 B;  2H7E A;  5JHG A;  2MWN B;  2BCJ A;  3PEG A;  4MT7 A;  2MKR A;  4KHB B;  1RRP B;  1MK7 B;  1P6S A;  5DI9 B;  2EJ8 A;  4A6H A;  5LOP B;  1DRO A;  4K17 A;  4DX9 0;  2KCJ A;  2DFK A;  2DYN A;  4K2O A;  3SYX A;  5CLQ B;  1K5G B;  3ML4 A;  2QKL A;  4TYZ A;  1WGU A;  1J0W A;  1RJ2 A;  4BBK A;  3TVV A;  1AWE A;  1ZC3 B;  4ZRI A;  2OQB A;  1WJM A;  4K81 A;  3KSY A;  5C16 A;  1MPH A;  3LJU X;  3ULB A;  2DYQ A;  1ZM0 A;  2V76 A;  2LYD A;  2GCL A;  2DHJ A;  1KZ7 A;  3SUZ A;  1EF1 A;  2MFQ A;  1GG3 A;  1MKE A;  2D9W A;  1PFJ A;  1ZSQ A;  1DDW A;  2CY4 A;  3O96 A;  5GOW B;  4GPT B;  1U5D A;  2IYB A;  3HK0 A;  5L81 A;  1V88 A;  1OQN A;  5C79 A;  2NMB A;  5KQ1 A;  1FGZ A;  5D3V A;  3FM8 C;  3PG7 A;  1WG7 A;  2IFS A;  2CAY A;  2W2X C;  1UNP A;  2G35 A;  2DX1 A;  5J3Q A;  3PZD A;  3AU5 A;  2MDX A;  5HE2 A;  1V5M A;  2HE7 A;  3IVF A;  4YL8 A;  1LB1 A;  1X11 A;  4PNK A;  3AJ4 A;  5KQ4 A;  3ZDT A;  2K2J A;  1PLS A;  1BAK A;  2D9V A;  3FSS A;  1EVH A;  4IFS A;  1V89 A;  2P8V A;  2KGX B;  3DXE A;  2YVC A;  3HQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...