4EMOA

Crystal structure of the ph domain of sharpin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
AAVLMAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSMHFLNPQEAQRWAVLVRGATV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of SHARPIN, a Subunit of a Large Multi-protein E3 Ubiquitin Ligase, Reveals a Novel Dimerization Function for the Pleckstrin Homology Superfold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Sharpin
total genus 19
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16764 Sharpin_PH Sharpin PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4emoA00
1X1FA 4ZRJA 1U29A 3ZDTA 1WVHA 4L6EA 4HAVB 4MT7A 4KVGB 3D8DA 4EMOA 1FGYA 2MKRA 5D3VA 1X86A 2UZRA 4DX8A 1X1GA 4HDOA 1V5PA 4GZUA 3BJIA 4ZRIA 2J0JA 4GXBA 1H4RA 4A6FB 1DDVA 3FM8C 5EFXA 3FEHA 4GMXB 1RRPB 1TXDA 5LOPB 1U2BA 3KRXA 2K2JA 3ODXA 5CLQB 1XR0B 1EGXA 2DFKA 2Z0QA 1EF1A 3HK0A 3P6AA 2VRWB 2D9ZA 1MAIA 4CYEA 4Z2MB 2BCJA 2DX1A 3SO6A 3DXCA 2DHKA 4GN1A 1P5TA 5C79A 1OQNA 1QQGA 1WG7A 2I1KA 4A5KA 3PZDA 3MPXA 5J3YA 1BTKA 3KY9A 1E5WA 2QKMA 2I1JA 1LB1A 4K2OA 3HQCA 1ZVRA 4BBKA 4YL8A 4XWXA 3AU5A 2D9WA 4A6FA 3A98B 1XKEA 3A8PA 5DHAB 1RJ2A 5CLLB 1U5DA 2DYQA 1EAZA 4B6HA 3ODWA 4K81A 2D10A 2OQBA 2W2WA 2I5FA 1MIXA 1MKEA 2LULA 2MDXA 1I2HA 1Y5OA 2J0KA 2D9YA 2ROVA 2D11A 5J3TA 2RLOA 1MK7B 2CY4A 2CRFA 2LOXA 1FHOA 2LG1A 4GPTB 1AWEA 4HAUB 2NMBA 2ROZB 2COCA 3AJ4A 1OMWA 1FHWA 2CY5A 2EC1A 5DHFB 1XCGA 2DYNA 1GG3A 4HB4B 4CHMA 5D3YA 4HB3B 2YVCA 5D3XA 4C0AA 2Y8GA 1J19A 2G35A 2RNRB 2RSGA 1Y19B 4HAWB 5HE1A 2LOZA 1X05A 2UVMA 2N0YA 2ELAA 2FJLA 4Y94A 1BAKA 2RVBB 2COFA 4MY6A 4TKNA 1OY2A 3PVUA 1WGUA 4PNKA 3PVLA 2D9XA 1GC6A 4HB0B 3V5WA 3CXBB 1KZ7A 3WYFB 3GYOA 4EJNA 3ULBA 2GCLA 3FSSA 2NZ8B 1U5EA 4WVFB 4CHJA 2J0MA 4P7IA 2DLWA 3TCAA 2CAYA 3AU4A 1V61A 4WJ7A 4DXAB 1M7RA 3QIJA 2CODA 2DKQA 3HW2B 1Q67A 3SNHA 2UZSA 2YS3A 5DH9B 1XODA 2P8VA 3WA0A 2QKLA 4K17A 1NTYA 4IFSA 2GCJA 3UZTA 4GMVA 1FHXA 3PP2A 1GC7A 5J3QA 4MK0A 3TFMA 3D8EA 1FGZA 2ZPYA 1J0WA 3NSUA 2YF0A 3VIAA 4A6KA 2EMTA 3D8FA 5JLJB 2JP2A 1WJ1A 3QBVB 2DHIA 2X18A 2V76A 2HE7A 1KZGA 1ISNA 4Z2NA 4HAXB 2IYBA 2ADZA 1XD4A 2Z0OA 1PMSA 4NY0A 3BINA 2YS1A 3PG7A 1DDWA 4KAXB 1I7AA 1NTVA 5C5BA 3T06A 3SUZA 5FI0A 1V89A 1U27A 4IAPA 2DA0A 1WJMA 3SYXA 1FB8A 1V5MA 2PZ1A 1ZSQA 2K2UA 4F7HA 5JHGA 1MPHA 2H7EA 1SHCA 1W1GA 2D4QA 1U5FA 1QC6A 1DYNA 1MIZB 2IFSA 1TJ6A 2L2IA 3SV1A 3O96A 3P7ZA 2LYDA 4DBBA 2RGNB 1MK9B 3TO1A 2KGXB 1BWNA 1SGHA 2Z0PA 2J59M 3M1IB 3U7DA 2VKIA 2KCJA 1WGQA 1UPRA 1ZC4B 2DHJA 2E2XA 1FOEA 2XQNM 3ULCA 2GJYA 2Y7BA 2YSZA 1K5DB 1IRSA 4WSFA 1XX0A 1U5GA 4D0NB 2M38A 1TQZA 4F7GA 1H10A 2W2XD 2COAA 1LW3A 1KI1B 5GOWB 3LJUX 1UNRA 4NSWA 1P3RA 1ZC3B 2RUKB 4F7UP 2MFQA 2YT1A 3KSYA 2L1CA 2HTHB 2YS5A 2K00A 4TYZA 2KUPA 1X11A 2LKOA 3VOQA 3IVFA 2EJ8A 3X23A 3CIKA 1UNQA 2W2XC 2EMSA 3MDBC 3ODOA 4HDQA 2MWNB 5HE2A 1NI2A 5D3WA 1ZM0A 3DXEA 3ZVRA 1N3HA 3PVWA 4ZRKA 4HAYB 4K2PA 3U8ZA 2ELBA 3TW1A 1PFJA 4HHVA 3N7CA 5JHHA 2VSZA 4HATB 1UNPA 4KHOA 5KCVA 5HE3A 5DIFB 4PQ0A 3F0WA 4A6HA 5KQ4A 1B55A 1P6SA 2AEHA 2P0FA 2M14A 4KHBB 5C5BB 1M7EA 1PLSA 1DDMA 4HAZB 2D9VA 1NU2A 2I5CA 2DKPA 5L81A 2N23A 2AL6A 2GS0A 4YONA 5FI1A 1FAOA 2OTXA 4DX90 3PSCA 1W1DA 2DN6A 5KQ1A 1BTNA 3PEGA 2P0DA 5DI9B 2DTCA 2R0DA 2R09A 3KZ1A 2YT0A 1W1HA 3A8QA 1K5GB 3GYPA 3TVVA 5C6RA 1UEFA 1UPQA 1EVHA 2P0HA 1DROA 2Y8FA 5D27A 1WI1A 4KHAA 3RCPA 1V5UA 2Q13A 5LONB 2DX5A 1Z87A 1V88A 2H7DA 3ML4A 3DXDA 3G9WA 4EKUA 5C16A 1DBHA 3QWMA 1AQCA 3OANA 4IOYX 3F5RA 4HB2B 2YRYA 4H8SA 5JP4A 3KRWA 5HE0A 2D2QA
chains in the Genus database with same CATH superfamily
1X1FA 2KUQA 4ZRJA 1U29A 1T77A 3ZDTA 1WVHA 4L6EA 4HAVB 4MT7A 4KVGB 3D8DA 4EMOA 1FGYA 2MKRA 5D3VA 1X86A 2UZRA 4DX8A 1X1GA 4OSNA 4HDOA 1V5PA 4GZUA 3BJIA 4ZRIA 2J0JA 4GXBA 1H4RA 4A6FB 1DDVA 3FM8C 5EFXA 4L1RA 3FEHA 4GMXB 4DIXA 1RRPB 1TXDA 5LOPB 1U2BA 3KRXA 2K2JA 3ODXA 5CLQB 1XR0B 1EGXA 2DFKA 2Z0QA 2R2YA 1EF1A 3HK0A 3P6AA 2VRWB 2D9ZA 1MAIA 4CYEA 4Z2MB 2BCJA 2DX1A 3SO6A 3DXCA 2DHKA 4GN1A 1P5TA 2KR0A 2GUMA 5C79A 1OQNA 1QQGA 1WG7A 2I1KA 4A5KA 3PZDA 3MPXA 5J3YA 1BTKA 3KY9A 1E5WA 5M4YB 2QKMA 2I1JA 1LB1A 4K2OA 3HQCA 1ZVRA 4BBKA 4YL8A 4XWXA 3AU5A 2D9WA 4A6FA 3A98B 1XKEA 3A8PA 5DHAB 1RJ2A 5CLLB 1U5DA 2DYQA 1EAZA 4B6HA 3ODWA 4K81A 2D10A 2OQBA 2W2WA 2I5FA 1MIXA 1MKEA 2LULA 2MDXA 1I2HA 1Y5OA 2J0KA 2D9YA 2ROVA 2D11A 5J3TA 2RLOA 1MK7B 2CY4A 2CRFA 2LOXA 1FHOA 2LG1A 4GPTB 1AWEA 4HAUB 2NMBA 2ROZB 2COCA 3AJ4A 1OMWA 4HSIA 1FHWA 2CY5A 2EC1A 5DHFB 2ZKMX 1XCGA 2DYNA 1GG3A 4HB4B 4CHMA 5D3YA 4HB3B 2YVCA 3B77A 5D3XA 2K8EA 3HSAA 4C0AA 5LG4B 2Y8GA 1J19A 2G35A 2RNRB 2RSGA 1Y19B 4HAWB 5HE1A 3HIEA 2LOZA 1X05A 2UVMA 2N0YA 2Z4DA 2ELAA 2FJLA 4Y94A 1BAKA 2RVBB 2COFA 4MY6A 4TKNA 1OY2A 3PVUA 1WGUA 4PNKA 3PVLA 2KIEA 2D9XA 1GC6A 4HB0B 3V5WA 2FJUB 3CXBB 1KZ7A 3WYFB 3GYOA 4EJNA 3ULBA 2GCLA 3FSSA 2NZ8B 1U5EA 4WVFB 4CHJA 2J0MA 4P7IA 2DLWA 3TCAA 2CAYA 3AU4A 1V61A 4WJ7A 4DXAB 1M7RA 3QIJA 3FVCA 2CODA 2DKQA 3HW2B 4OT1A 1Q67A 3SNHA 2UZSA 2YS3A 5DH9B 1XODA 2P8VA 3WA0A 2QKLA 4K17A 1NTYA 4IFSA 2GCJA 3UZTA 4GMVA 1FHXA 3PP2A 4QJ5B 1GC7A 5J3QA 4MK0A 3TFMA 3D8EA 1FGZA 2ZPYA 1J0WA 3NSUA 2YF0A 3VIAA 4A6KA 2EMTA 3D8FA 5JLJB 2JP2A 1WJ1A 3QBVB 2DHIA 2X18A 2V76A 2HE7A 1KZGA 1ISNA 4Z2NA 4HAXB 2IYBA 2ADZA 1XD4A 2Z59A 2Z0OA 4QXAB 1PMSA 4NY0A 3BINA 2YS1A 3PG7A 1DDWA 4KAXB 1I7AA 1NTVA 3NWFA 5C5BA 3T06A 3SUZA 5FI0A 1ZYIA 1V89A 1U27A 4IAPA 2DA0A 1WJMA 3SYXA 1FB8A 1V5MA 2PZ1A 1ZSQA 2K2UA 4F7HA 5JHGA 1MPHA 2H7EA 1SHCA 1W1GA 2D4QA 1U5FA 1QC6A 1DYNA 1MIZB 2IFSA 1TJ6A 2L2IA 3SV1A 3O96A 3NWAA 3P7ZA 2LYDA 4DBBA 2RGNB 1MK9B 3TO1A 2KGXB 1BWNA 1SGHA 2Z0PA 2J59M 3M1IB 4D6WA 3U7DA 2VKIA 2KCJA 1WGQA 1UPRA 1ZC4B 2DHJA 2E2XA 1FOEA 2XQNM 3ULCA 2GJYA 2Y7BA 2YSZA 1K5DB 1IRSA 4WSFA 3NWDA 1XX0A 1U5GA 4D0NB 2M38A 1TQZA 4F7GA 1H10A 2W2XD 2COAA 1LW3A 1KI1B 4GNKB 5GOWB 3LJUX 1UNRA 4NSWA 1P3RA 1ZC3B 2RUKB 4F7UP 2MFQA 2YT1A 3KSYA 2L1CA 2HTHB 5I2MA 2YS5A 2K00A 4TYZA 2KUPA 1X11A 2LKOA 3VOQA 3IVFA 2EJ8A 3X23A 3CIKA 1UNQA 2W2XC 2EMSA 3MDBC 3ODOA 4HDQA 2MWNB 5HE2A 1NI2A 5D3WA 1ZM0A 3DXEA 3ZVRA 1N3HA 3PVWA 4ZRKA 4HAYB 4K2PA 3U8ZA 2ELBA 3TW1A 4KHBA 1PFJA 4HHVA 4CSQA 3N7CA 5JHHA 2VSZA 5I2SA 4HATB 1UNPA 4KHOA 5IRSA 5KCVA 3A58A 5HE3A 5DIFB 4PQ0A 3F0WA 4A6HA 5KQ4A 1B55A 1P6SA 2AEHA 2P0FA 2M14A 4KHBB 5C5BB 3U12A 1M7EA 1PLSA 1DDMA 4HAZB 2D9VA 1NU2A 2I5CA 2DKPA 5L81A 2Z13A 2N23A 2AL6A 2GS0A 4YONA 4QJ4B 5FI1A 1FAOA 2OTXA 4DX90 3PSCA 1W1DA 2DN6A 5KQ1A 1BTNA 3PEGA 2KIGA 2P0DA 2YT2A 5DI9B 2DTCA 2R0DA 2R09A 3KZ1A 2YT0A 1W1HA 2K49A 3A8QA 1K5GB 3GYPA 3TVVA 5C6RA 1UEFA 1UPQA 1EVHA 2P0HA 1DROA 2Y8FA 5D27A 2RRFA 1WI1A 4KHAA 3RCPA 3DCXA 1MI1A 1V5UA 2Q13A 2NBVA 5LONB 2DX5A 1Z87A 1V88A 2H7DA 3ML4A 3DXDA 3G9WA 3NW8A 4EKUA 5C16A 1DBHA 3OHMB 3QWMA 1AQCA 3OANA 4IOYX 3F5RA 4HB2B 2YRYA 4H8SA 5JP4A 3KRWA 2Z14A 4QJ3B 5HE0A 4GOUA 2D2QA
chains in the Genus database with same CATH topology
1X1FA 4ZRJA 1U29A 3ZDTA 1WVHA 4L6EA 4HAVB 4MT7A 4KVGB 3D8DA 4EMOA 1FGYA 2MKRA 5D3VA 1X86A 2UZRA 4DX8A 1X1GA 4HDOA 1V5PA 4GZUA 3BJIA 4ZRIA 2J0JA 4GXBA 1H4RA 4A6FB 1DDVA 3FM8C 5EFXA 3FEHA 4GMXB 1RRPB 1TXDA 5LOPB 1U2BA 3KRXA 2K2JA 3ODXA 5CLQB 1XR0B 1EGXA 2DFKA 2Z0QA 1EF1A 3HK0A 3P6AA 2VRWB 2D9ZA 1MAIA 4CYEA 4Z2MB 2BCJA 2DX1A 3SO6A 3DXCA 2DHKA 4GN1A 1P5TA 5C79A 1OQNA 1QQGA 1WG7A 2I1KA 4A5KA 3PZDA 3MPXA 5J3YA 1BTKA 3KY9A 1E5WA 2QKMA 2I1JA 1LB1A 4K2OA 3HQCA 1ZVRA 4BBKA 4YL8A 4XWXA 3AU5A 2D9WA 4A6FA 3A98B 1XKEA 3A8PA 5DHAB 1RJ2A 5CLLB 1U5DA 2DYQA 1EAZA 4B6HA 3ODWA 4K81A 2D10A 2OQBA 2W2WA 2I5FA 1MIXA 1MKEA 2LULA 2MDXA 1I2HA 1Y5OA 2J0KA 2D9YA 2ROVA 2D11A 5J3TA 2RLOA 1MK7B 2CY4A 2CRFA 2LOXA 1FHOA 2LG1A 4GPTB 1AWEA 4HAUB 2NMBA 2ROZB 2COCA 3AJ4A 1OMWA 1FHWA 2CY5A 2EC1A 5DHFB 1XCGA 2DYNA 1GG3A 4HB4B 4CHMA 5D3YA 4HB3B 2YVCA 5D3XA 4C0AA 2Y8GA 1J19A 2G35A 2RNRB 2RSGA 1Y19B 4HAWB 5HE1A 2LOZA 1X05A 2UVMA 2N0YA 2ELAA 2FJLA 4Y94A 1BAKA 2RVBB 2COFA 4MY6A 4TKNA 1OY2A 3PVUA 1WGUA 4PNKA 3PVLA 2D9XA 1GC6A 4HB0B 3V5WA 3CXBB 1KZ7A 3WYFB 3GYOA 4EJNA 3ULBA 2GCLA 3FSSA 2NZ8B 1U5EA 4WVFB 4CHJA 2J0MA 4P7IA 2DLWA 3TCAA 2CAYA 3AU4A 1V61A 4WJ7A 4DXAB 1M7RA 3QIJA 2CODA 2DKQA 3HW2B 1Q67A 3SNHA 2UZSA 2YS3A 5DH9B 1XODA 2P8VA 3WA0A 2QKLA 4K17A 1NTYA 4IFSA 2GCJA 3UZTA 4GMVA 1FHXA 3PP2A 1GC7A 5J3QA 4MK0A 3TFMA 3D8EA 1FGZA 2ZPYA 1J0WA 3NSUA 2YF0A 3VIAA 4A6KA 2EMTA 3D8FA 5JLJB 2JP2A 1WJ1A 3QBVB 2DHIA 2X18A 2V76A 2HE7A 1KZGA 1ISNA 4Z2NA 4HAXB 2IYBA 2ADZA 1XD4A 2Z0OA 1PMSA 4NY0A 3BINA 2YS1A 3PG7A 1DDWA 4KAXB 1I7AA 1NTVA 5C5BA 3T06A 3SUZA 5FI0A 1V89A 1U27A 4IAPA 2DA0A 1WJMA 3SYXA 1FB8A 1V5MA 2PZ1A 1ZSQA 2K2UA 4F7HA 5JHGA 1MPHA 2H7EA 1SHCA 1W1GA 2D4QA 1U5FA 1QC6A 1DYNA 1MIZB 2IFSA 1TJ6A 2L2IA 3SV1A 3O96A 3P7ZA 2LYDA 4DBBA 2RGNB 1MK9B 3TO1A 2KGXB 1BWNA 1SGHA 2Z0PA 2J59M 3M1IB 3U7DA 2VKIA 2KCJA 1WGQA 1UPRA 1ZC4B 2DHJA 2E2XA 1FOEA 2XQNM 3ULCA 2GJYA 2Y7BA 2YSZA 1K5DB 1IRSA 4WSFA 1XX0A 1U5GA 4D0NB 2M38A 1TQZA 4F7GA 1H10A 2W2XD 2COAA 1LW3A 1KI1B 5GOWB 3LJUX 1UNRA 4NSWA 1P3RA 1ZC3B 2RUKB 4F7UP 2MFQA 2YT1A 3KSYA 2L1CA 2HTHB 2YS5A 2K00A 4TYZA 2KUPA 1X11A 2LKOA 3VOQA 3IVFA 2EJ8A 3X23A 3CIKA 1UNQA 2W2XC 2EMSA 3MDBC 3ODOA 4HDQA 2MWNB 5HE2A 1NI2A 5D3WA 1ZM0A 3DXEA 3ZVRA 1N3HA 3PVWA 4ZRKA 4HAYB 4K2PA 3U8ZA 2ELBA 3TW1A 1PFJA 4HHVA 3N7CA 5JHHA 2VSZA 4HATB 1UNPA 4KHOA 5KCVA 5HE3A 5DIFB 4PQ0A 3F0WA 4A6HA 5KQ4A 1B55A 1P6SA 2AEHA 2P0FA 2M14A 4KHBB 5C5BB 1M7EA 1PLSA 1DDMA 4HAZB 2D9VA 1NU2A 2I5CA 2DKPA 5L81A 2N23A 2AL6A 2GS0A 4YONA 5FI1A 1FAOA 2OTXA 4DX90 3PSCA 1W1DA 2DN6A 5KQ1A 1BTNA 3PEGA 2P0DA 5DI9B 2DTCA 2R0DA 2R09A 3KZ1A 2YT0A 1W1HA 3A8QA 1K5GB 3GYPA 3TVVA 5C6RA 1UEFA 1UPQA 1EVHA 2P0HA 1DROA 2Y8FA 5D27A 1WI1A 4KHAA 3RCPA 1V5UA 2Q13A 5LONB 2DX5A 1Z87A 1V88A 2H7DA 3ML4A 3DXDA 3G9WA 4EKUA 5C16A 1DBHA 3QWMA 1AQCA 3OANA 4IOYX 3F5RA 4HB2B 2YRYA 4H8SA 5JP4A 3KRWA 5HE0A 2D2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1F A;  4ZRJ A;  1U29 A;  3ZDT A;  1WVH A;  4L6E A;  4HAV B;  4MT7 A;  4KVG B;  3D8D A;  4EMO A;  1FGY A;  2MKR A;  5D3V A;  1X86 A;  2UZR A;  4DX8 A;  1X1G A;  4HDO A;  1V5P A;  4GZU A;  3BJI A;  4ZRI A;  2J0J A;  4GXB A;  1H4R A;  4A6F B;  1DDV A;  3FM8 C;  5EFX A;  3FEH A;  4GMX B;  1RRP B;  1TXD A;  5LOP B;  1U2B A;  3KRX A;  2K2J A;  3ODX A;  5CLQ B;  1XR0 B;  1EGX A;  2DFK A;  2Z0Q A;  1EF1 A;  3HK0 A;  3P6A A;  2VRW B;  2D9Z A;  1MAI A;  4CYE A;  4Z2M B;  2BCJ A;  2DX1 A;  3SO6 A;  3DXC A;  2DHK A;  4GN1 A;  1P5T A;  5C79 A;  1OQN A;  1QQG A;  1WG7 A;  2I1K A;  4A5K A;  3PZD A;  3MPX A;  5J3Y A;  1BTK A;  3KY9 A;  1E5W A;  2QKM A;  2I1J A;  1LB1 A;  4K2O A;  3HQC A;  1ZVR A;  4BBK A;  4YL8 A;  4XWX A;  3AU5 A;  2D9W A;  4A6F A;  3A98 B;  1XKE A;  3A8P A;  5DHA B;  1RJ2 A;  5CLL B;  1U5D A;  2DYQ A;  1EAZ A;  4B6H A;  3ODW A;  4K81 A;  2D10 A;  2OQB A;  2W2W A;  2I5F A;  1MIX A;  1MKE A;  2LUL A;  2MDX A;  1I2H A;  1Y5O A;  2J0K A;  2D9Y A;  2ROV A;  2D11 A;  5J3T A;  2RLO A;  1MK7 B;  2CY4 A;  2CRF A;  2LOX A;  1FHO A;  2LG1 A;  4GPT B;  1AWE A;  4HAU B;  2NMB A;  2ROZ B;  2COC A;  3AJ4 A;  1OMW A;  1FHW A;  2CY5 A;  2EC1 A;  5DHF B;  1XCG A;  2DYN A;  1GG3 A;  4HB4 B;  4CHM A;  5D3Y A;  4HB3 B;  2YVC A;  5D3X A;  4C0A A;  2Y8G A;  1J19 A;  2G35 A;  2RNR B;  2RSG A;  1Y19 B;  4HAW B;  5HE1 A;  2LOZ A;  1X05 A;  2UVM A;  2N0Y A;  2ELA A;  2FJL A;  4Y94 A;  1BAK A;  2RVB B;  2COF A;  4MY6 A;  4TKN A;  1OY2 A;  3PVU A;  1WGU A;  4PNK A;  3PVL A;  2D9X A;  1GC6 A;  4HB0 B;  3V5W A;  3CXB B;  1KZ7 A;  3WYF B;  3GYO A;  4EJN A;  3ULB A;  2GCL A;  3FSS A;  2NZ8 B;  1U5E A;  4WVF B;  4CHJ A;  2J0M A;  4P7I A;  2DLW A;  3TCA A;  2CAY A;  3AU4 A;  1V61 A;  4WJ7 A;  4DXA B;  1M7R A;  3QIJ A;  2COD A;  2DKQ A;  3HW2 B;  1Q67 A;  3SNH A;  2UZS A;  2YS3 A;  5DH9 B;  1XOD A;  2P8V A;  3WA0 A;  2QKL A;  4K17 A;  1NTY A;  4IFS A;  2GCJ A;  3UZT A;  4GMV A;  1FHX A;  3PP2 A;  1GC7 A;  5J3Q A;  4MK0 A;  3TFM A;  3D8E A;  1FGZ A;  2ZPY A;  1J0W A;  3NSU A;  2YF0 A;  3VIA A;  4A6K A;  2EMT A;  3D8F A;  5JLJ B;  2JP2 A;  1WJ1 A;  3QBV B;  2DHI A;  2X18 A;  2V76 A;  2HE7 A;  1KZG A;  1ISN A;  4Z2N A;  4HAX B;  2IYB A;  2ADZ A;  1XD4 A;  2Z0O A;  1PMS A;  4NY0 A;  3BIN A;  2YS1 A;  3PG7 A;  1DDW A;  4KAX B;  1I7A A;  1NTV A;  5C5B A;  3T06 A;  3SUZ A;  5FI0 A;  1V89 A;  1U27 A;  4IAP A;  2DA0 A;  1WJM A;  3SYX A;  1FB8 A;  1V5M A;  2PZ1 A;  1ZSQ A;  2K2U A;  4F7H A;  5JHG A;  1MPH A;  2H7E A;  1SHC A;  1W1G A;  2D4Q A;  1U5F A;  1QC6 A;  1DYN A;  1MIZ B;  2IFS A;  1TJ6 A;  2L2I A;  3SV1 A;  3O96 A;  3P7Z A;  2LYD A;  4DBB A;  2RGN B;  1MK9 B;  3TO1 A;  2KGX B;  1BWN A;  1SGH A;  2Z0P A;  2J59 M;  3M1I B;  3U7D A;  2VKI A;  2KCJ A;  1WGQ A;  1UPR A;  1ZC4 B;  2DHJ A;  2E2X A;  1FOE A;  2XQN M;  3ULC A;  2GJY A;  2Y7B A;  2YSZ A;  1K5D B;  1IRS A;  4WSF A;  1XX0 A;  1U5G A;  4D0N B;  2M38 A;  1TQZ A;  4F7G A;  1H10 A;  2W2X D;  2COA A;  1LW3 A;  1KI1 B;  5GOW B;  3LJU X;  1UNR A;  4NSW A;  1P3R A;  1ZC3 B;  2RUK B;  4F7U P;  2MFQ A;  2YT1 A;  3KSY A;  2L1C A;  2HTH B;  2YS5 A;  2K00 A;  4TYZ A;  2KUP A;  1X11 A;  2LKO A;  3VOQ A;  3IVF A;  2EJ8 A;  3X23 A;  3CIK A;  1UNQ A;  2W2X C;  2EMS A;  3MDB C;  3ODO A;  4HDQ A;  2MWN B;  5HE2 A;  1NI2 A;  5D3W A;  1ZM0 A;  3DXE A;  3ZVR A;  1N3H A;  3PVW A;  4ZRK A;  4HAY B;  4K2P A;  3U8Z A;  2ELB A;  3TW1 A;  1PFJ A;  4HHV A;  3N7C A;  5JHH A;  2VSZ A;  4HAT B;  1UNP A;  4KHO A;  5KCV A;  5HE3 A;  5DIF B;  4PQ0 A;  3F0W A;  4A6H A;  5KQ4 A;  1B55 A;  1P6S A;  2AEH A;  2P0F A;  2M14 A;  4KHB B;  5C5B B;  1M7E A;  1PLS A;  1DDM A;  4HAZ B;  2D9V A;  1NU2 A;  2I5C A;  2DKP A;  5L81 A;  2N23 A;  2AL6 A;  2GS0 A;  4YON A;  5FI1 A;  1FAO A;  2OTX A;  4DX9 0;  3PSC A;  1W1D A;  2DN6 A;  5KQ1 A;  1BTN A;  3PEG A;  2P0D A;  5DI9 B;  2DTC A;  2R0D A;  2R09 A;  3KZ1 A;  2YT0 A;  1W1H A;  3A8Q A;  1K5G B;  3GYP A;  3TVV A;  5C6R A;  1UEF A;  1UPQ A;  1EVH A;  2P0H A;  1DRO A;  2Y8F A;  5D27 A;  1WI1 A;  4KHA A;  3RCP A;  1V5U A;  2Q13 A;  5LON B;  2DX5 A;  1Z87 A;  1V88 A;  2H7D A;  3ML4 A;  3DXD A;  3G9W A;  4EKU A;  5C16 A;  1DBH A;  3QWM A;  1AQC A;  3OAN A;  4IOY X;  3F5R A;  4HB2 B;  2YRY A;  4H8S A;  5JP4 A;  3KRW A;  5HE0 A;  2D2Q A; 
#chains in the Genus database with same CATH topology
 1X1F A;  2KUQ A;  4ZRJ A;  1U29 A;  1T77 A;  3ZDT A;  1WVH A;  4L6E A;  4HAV B;  4MT7 A;  4KVG B;  3D8D A;  4EMO A;  1FGY A;  2MKR A;  5D3V A;  1X86 A;  2UZR A;  4DX8 A;  1X1G A;  4OSN A;  4HDO A;  1V5P A;  4GZU A;  3BJI A;  4ZRI A;  2J0J A;  4GXB A;  1H4R A;  4A6F B;  1DDV A;  3FM8 C;  5EFX A;  4L1R A;  3FEH A;  4GMX B;  4DIX A;  1RRP B;  1TXD A;  5LOP B;  1U2B A;  3KRX A;  2K2J A;  3ODX A;  5CLQ B;  1XR0 B;  1EGX A;  2DFK A;  2Z0Q A;  2R2Y A;  1EF1 A;  3HK0 A;  3P6A A;  2VRW B;  2D9Z A;  1MAI A;  4CYE A;  4Z2M B;  2BCJ A;  2DX1 A;  3SO6 A;  3DXC A;  2DHK A;  4GN1 A;  1P5T A;  2KR0 A;  2GUM A;  5C79 A;  1OQN A;  1QQG A;  1WG7 A;  2I1K A;  4A5K A;  3PZD A;  3MPX A;  5J3Y A;  1BTK A;  3KY9 A;  1E5W A;  5M4Y B;  2QKM A;  2I1J A;  1LB1 A;  4K2O A;  3HQC A;  1ZVR A;  4BBK A;  4YL8 A;  4XWX A;  3AU5 A;  2D9W A;  4A6F A;  3A98 B;  1XKE A;  3A8P A;  5DHA B;  1RJ2 A;  5CLL B;  1U5D A;  2DYQ A;  1EAZ A;  4B6H A;  3ODW A;  4K81 A;  2D10 A;  2OQB A;  2W2W A;  2I5F A;  1MIX A;  1MKE A;  2LUL A;  2MDX A;  1I2H A;  1Y5O A;  2J0K A;  2D9Y A;  2ROV A;  2D11 A;  5J3T A;  2RLO A;  1MK7 B;  2CY4 A;  2CRF A;  2LOX A;  1FHO A;  2LG1 A;  4GPT B;  1AWE A;  4HAU B;  2NMB A;  2ROZ B;  2COC A;  3AJ4 A;  1OMW A;  4HSI A;  1FHW A;  2CY5 A;  2EC1 A;  5DHF B;  2ZKM X;  1XCG A;  2DYN A;  1GG3 A;  4HB4 B;  4CHM A;  5D3Y A;  4HB3 B;  2YVC A;  3B77 A;  5D3X A;  2K8E A;  3HSA A;  4C0A A;  5LG4 B;  2Y8G A;  1J19 A;  2G35 A;  2RNR B;  2RSG A;  1Y19 B;  4HAW B;  5HE1 A;  3HIE A;  2LOZ A;  1X05 A;  2UVM A;  2N0Y A;  2Z4D A;  2ELA A;  2FJL A;  4Y94 A;  1BAK A;  2RVB B;  2COF A;  4MY6 A;  4TKN A;  1OY2 A;  3PVU A;  1WGU A;  4PNK A;  3PVL A;  2KIE A;  2D9X A;  1GC6 A;  4HB0 B;  3V5W A;  2FJU B;  3CXB B;  1KZ7 A;  3WYF B;  3GYO A;  4EJN A;  3ULB A;  2GCL A;  3FSS A;  2NZ8 B;  1U5E A;  4WVF B;  4CHJ A;  2J0M A;  4P7I A;  2DLW A;  3TCA A;  2CAY A;  3AU4 A;  1V61 A;  4WJ7 A;  4DXA B;  1M7R A;  3QIJ A;  3FVC A;  2COD A;  2DKQ A;  3HW2 B;  4OT1 A;  1Q67 A;  3SNH A;  2UZS A;  2YS3 A;  5DH9 B;  1XOD A;  2P8V A;  3WA0 A;  2QKL A;  4K17 A;  1NTY A;  4IFS A;  2GCJ A;  3UZT A;  4GMV A;  1FHX A;  3PP2 A;  4QJ5 B;  1GC7 A;  5J3Q A;  4MK0 A;  3TFM A;  3D8E A;  1FGZ A;  2ZPY A;  1J0W A;  3NSU A;  2YF0 A;  3VIA A;  4A6K A;  2EMT A;  3D8F A;  5JLJ B;  2JP2 A;  1WJ1 A;  3QBV B;  2DHI A;  2X18 A;  2V76 A;  2HE7 A;  1KZG A;  1ISN A;  4Z2N A;  4HAX B;  2IYB A;  2ADZ A;  1XD4 A;  2Z59 A;  2Z0O A;  4QXA B;  1PMS A;  4NY0 A;  3BIN A;  2YS1 A;  3PG7 A;  1DDW A;  4KAX B;  1I7A A;  1NTV A;  3NWF A;  5C5B A;  3T06 A;  3SUZ A;  5FI0 A;  1ZYI A;  1V89 A;  1U27 A;  4IAP A;  2DA0 A;  1WJM A;  3SYX A;  1FB8 A;  1V5M A;  2PZ1 A;  1ZSQ A;  2K2U A;  4F7H A;  5JHG A;  1MPH A;  2H7E A;  1SHC A;  1W1G A;  2D4Q A;  1U5F A;  1QC6 A;  1DYN A;  1MIZ B;  2IFS A;  1TJ6 A;  2L2I A;  3SV1 A;  3O96 A;  3NWA A;  3P7Z A;  2LYD A;  4DBB A;  2RGN B;  1MK9 B;  3TO1 A;  2KGX B;  1BWN A;  1SGH A;  2Z0P A;  2J59 M;  3M1I B;  4D6W A;  3U7D A;  2VKI A;  2KCJ A;  1WGQ A;  1UPR A;  1ZC4 B;  2DHJ A;  2E2X A;  1FOE A;  2XQN M;  3ULC A;  2GJY A;  2Y7B A;  2YSZ A;  1K5D B;  1IRS A;  4WSF A;  3NWD A;  1XX0 A;  1U5G A;  4D0N B;  2M38 A;  1TQZ A;  4F7G A;  1H10 A;  2W2X D;  2COA A;  1LW3 A;  1KI1 B;  4GNK B;  5GOW B;  3LJU X;  1UNR A;  4NSW A;  1P3R A;  1ZC3 B;  2RUK B;  4F7U P;  2MFQ A;  2YT1 A;  3KSY A;  2L1C A;  2HTH B;  5I2M A;  2YS5 A;  2K00 A;  4TYZ A;  2KUP A;  1X11 A;  2LKO A;  3VOQ A;  3IVF A;  2EJ8 A;  3X23 A;  3CIK A;  1UNQ A;  2W2X C;  2EMS A;  3MDB C;  3ODO A;  4HDQ A;  2MWN B;  5HE2 A;  1NI2 A;  5D3W A;  1ZM0 A;  3DXE A;  3ZVR A;  1N3H A;  3PVW A;  4ZRK A;  4HAY B;  4K2P A;  3U8Z A;  2ELB A;  3TW1 A;  4KHB A;  1PFJ A;  4HHV A;  4CSQ A;  3N7C A;  5JHH A;  2VSZ A;  5I2S A;  4HAT B;  1UNP A;  4KHO A;  5IRS A;  5KCV A;  3A58 A;  5HE3 A;  5DIF B;  4PQ0 A;  3F0W A;  4A6H A;  5KQ4 A;  1B55 A;  1P6S A;  2AEH A;  2P0F A;  2M14 A;  4KHB B;  5C5B B;  3U12 A;  1M7E A;  1PLS A;  1DDM A;  4HAZ B;  2D9V A;  1NU2 A;  2I5C A;  2DKP A;  5L81 A;  2Z13 A;  2N23 A;  2AL6 A;  2GS0 A;  4YON A;  4QJ4 B;  5FI1 A;  1FAO A;  2OTX A;  4DX9 0;  3PSC A;  1W1D A;  2DN6 A;  5KQ1 A;  1BTN A;  3PEG A;  2KIG A;  2P0D A;  2YT2 A;  5DI9 B;  2DTC A;  2R0D A;  2R09 A;  3KZ1 A;  2YT0 A;  1W1H A;  2K49 A;  3A8Q A;  1K5G B;  3GYP A;  3TVV A;  5C6R A;  1UEF A;  1UPQ A;  1EVH A;  2P0H A;  1DRO A;  2Y8F A;  5D27 A;  2RRF A;  1WI1 A;  4KHA A;  3RCP A;  3DCX A;  1MI1 A;  1V5U A;  2Q13 A;  2NBV A;  5LON B;  2DX5 A;  1Z87 A;  1V88 A;  2H7D A;  3ML4 A;  3DXD A;  3G9W A;  3NW8 A;  4EKU A;  5C16 A;  1DBH A;  3OHM B;  3QWM A;  1AQC A;  3OAN A;  4IOY X;  3F5R A;  4HB2 B;  2YRY A;  4H8S A;  5JP4 A;  3KRW A;  2Z14 A;  4QJ3 B;  5HE0 A;  4GOU A;  2D2Q A; 
#chains in the Genus database with same CATH homology
 1X1F A;  4ZRJ A;  1U29 A;  3ZDT A;  1WVH A;  4L6E A;  4HAV B;  4MT7 A;  4KVG B;  3D8D A;  4EMO A;  1FGY A;  2MKR A;  5D3V A;  1X86 A;  2UZR A;  4DX8 A;  1X1G A;  4HDO A;  1V5P A;  4GZU A;  3BJI A;  4ZRI A;  2J0J A;  4GXB A;  1H4R A;  4A6F B;  1DDV A;  3FM8 C;  5EFX A;  3FEH A;  4GMX B;  1RRP B;  1TXD A;  5LOP B;  1U2B A;  3KRX A;  2K2J A;  3ODX A;  5CLQ B;  1XR0 B;  1EGX A;  2DFK A;  2Z0Q A;  1EF1 A;  3HK0 A;  3P6A A;  2VRW B;  2D9Z A;  1MAI A;  4CYE A;  4Z2M B;  2BCJ A;  2DX1 A;  3SO6 A;  3DXC A;  2DHK A;  4GN1 A;  1P5T A;  5C79 A;  1OQN A;  1QQG A;  1WG7 A;  2I1K A;  4A5K A;  3PZD A;  3MPX A;  5J3Y A;  1BTK A;  3KY9 A;  1E5W A;  2QKM A;  2I1J A;  1LB1 A;  4K2O A;  3HQC A;  1ZVR A;  4BBK A;  4YL8 A;  4XWX A;  3AU5 A;  2D9W A;  4A6F A;  3A98 B;  1XKE A;  3A8P A;  5DHA B;  1RJ2 A;  5CLL B;  1U5D A;  2DYQ A;  1EAZ A;  4B6H A;  3ODW A;  4K81 A;  2D10 A;  2OQB A;  2W2W A;  2I5F A;  1MIX A;  1MKE A;  2LUL A;  2MDX A;  1I2H A;  1Y5O A;  2J0K A;  2D9Y A;  2ROV A;  2D11 A;  5J3T A;  2RLO A;  1MK7 B;  2CY4 A;  2CRF A;  2LOX A;  1FHO A;  2LG1 A;  4GPT B;  1AWE A;  4HAU B;  2NMB A;  2ROZ B;  2COC A;  3AJ4 A;  1OMW A;  1FHW A;  2CY5 A;  2EC1 A;  5DHF B;  1XCG A;  2DYN A;  1GG3 A;  4HB4 B;  4CHM A;  5D3Y A;  4HB3 B;  2YVC A;  5D3X A;  4C0A A;  2Y8G A;  1J19 A;  2G35 A;  2RNR B;  2RSG A;  1Y19 B;  4HAW B;  5HE1 A;  2LOZ A;  1X05 A;  2UVM A;  2N0Y A;  2ELA A;  2FJL A;  4Y94 A;  1BAK A;  2RVB B;  2COF A;  4MY6 A;  4TKN A;  1OY2 A;  3PVU A;  1WGU A;  4PNK A;  3PVL A;  2D9X A;  1GC6 A;  4HB0 B;  3V5W A;  3CXB B;  1KZ7 A;  3WYF B;  3GYO A;  4EJN A;  3ULB A;  2GCL A;  3FSS A;  2NZ8 B;  1U5E A;  4WVF B;  4CHJ A;  2J0M A;  4P7I A;  2DLW A;  3TCA A;  2CAY A;  3AU4 A;  1V61 A;  4WJ7 A;  4DXA B;  1M7R A;  3QIJ A;  2COD A;  2DKQ A;  3HW2 B;  1Q67 A;  3SNH A;  2UZS A;  2YS3 A;  5DH9 B;  1XOD A;  2P8V A;  3WA0 A;  2QKL A;  4K17 A;  1NTY A;  4IFS A;  2GCJ A;  3UZT A;  4GMV A;  1FHX A;  3PP2 A;  1GC7 A;  5J3Q A;  4MK0 A;  3TFM A;  3D8E A;  1FGZ A;  2ZPY A;  1J0W A;  3NSU A;  2YF0 A;  3VIA A;  4A6K A;  2EMT A;  3D8F A;  5JLJ B;  2JP2 A;  1WJ1 A;  3QBV B;  2DHI A;  2X18 A;  2V76 A;  2HE7 A;  1KZG A;  1ISN A;  4Z2N A;  4HAX B;  2IYB A;  2ADZ A;  1XD4 A;  2Z0O A;  1PMS A;  4NY0 A;  3BIN A;  2YS1 A;  3PG7 A;  1DDW A;  4KAX B;  1I7A A;  1NTV A;  5C5B A;  3T06 A;  3SUZ A;  5FI0 A;  1V89 A;  1U27 A;  4IAP A;  2DA0 A;  1WJM A;  3SYX A;  1FB8 A;  1V5M A;  2PZ1 A;  1ZSQ A;  2K2U A;  4F7H A;  5JHG A;  1MPH A;  2H7E A;  1SHC A;  1W1G A;  2D4Q A;  1U5F A;  1QC6 A;  1DYN A;  1MIZ B;  2IFS A;  1TJ6 A;  2L2I A;  3SV1 A;  3O96 A;  3P7Z A;  2LYD A;  4DBB A;  2RGN B;  1MK9 B;  3TO1 A;  2KGX B;  1BWN A;  1SGH A;  2Z0P A;  2J59 M;  3M1I B;  3U7D A;  2VKI A;  2KCJ A;  1WGQ A;  1UPR A;  1ZC4 B;  2DHJ A;  2E2X A;  1FOE A;  2XQN M;  3ULC A;  2GJY A;  2Y7B A;  2YSZ A;  1K5D B;  1IRS A;  4WSF A;  1XX0 A;  1U5G A;  4D0N B;  2M38 A;  1TQZ A;  4F7G A;  1H10 A;  2W2X D;  2COA A;  1LW3 A;  1KI1 B;  5GOW B;  3LJU X;  1UNR A;  4NSW A;  1P3R A;  1ZC3 B;  2RUK B;  4F7U P;  2MFQ A;  2YT1 A;  3KSY A;  2L1C A;  2HTH B;  2YS5 A;  2K00 A;  4TYZ A;  2KUP A;  1X11 A;  2LKO A;  3VOQ A;  3IVF A;  2EJ8 A;  3X23 A;  3CIK A;  1UNQ A;  2W2X C;  2EMS A;  3MDB C;  3ODO A;  4HDQ A;  2MWN B;  5HE2 A;  1NI2 A;  5D3W A;  1ZM0 A;  3DXE A;  3ZVR A;  1N3H A;  3PVW A;  4ZRK A;  4HAY B;  4K2P A;  3U8Z A;  2ELB A;  3TW1 A;  1PFJ A;  4HHV A;  3N7C A;  5JHH A;  2VSZ A;  4HAT B;  1UNP A;  4KHO A;  5KCV A;  5HE3 A;  5DIF B;  4PQ0 A;  3F0W A;  4A6H A;  5KQ4 A;  1B55 A;  1P6S A;  2AEH A;  2P0F A;  2M14 A;  4KHB B;  5C5B B;  1M7E A;  1PLS A;  1DDM A;  4HAZ B;  2D9V A;  1NU2 A;  2I5C A;  2DKP A;  5L81 A;  2N23 A;  2AL6 A;  2GS0 A;  4YON A;  5FI1 A;  1FAO A;  2OTX A;  4DX9 0;  3PSC A;  1W1D A;  2DN6 A;  5KQ1 A;  1BTN A;  3PEG A;  2P0D A;  5DI9 B;  2DTC A;  2R0D A;  2R09 A;  3KZ1 A;  2YT0 A;  1W1H A;  3A8Q A;  1K5G B;  3GYP A;  3TVV A;  5C6R A;  1UEF A;  1UPQ A;  1EVH A;  2P0H A;  1DRO A;  2Y8F A;  5D27 A;  1WI1 A;  4KHA A;  3RCP A;  1V5U A;  2Q13 A;  5LON B;  2DX5 A;  1Z87 A;  1V88 A;  2H7D A;  3ML4 A;  3DXD A;  3G9W A;  4EKU A;  5C16 A;  1DBH A;  3QWM A;  1AQC A;  3OAN A;  4IOY X;  3F5R A;  4HB2 B;  2YRY A;  4H8S A;  5JP4 A;  3KRW A;  5HE0 A;  2D2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...