4EN4A

Crystal structure of the ternary human pl kinase-ginkgotoxin-mgatp complex
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
310
structure length
310
Chain Sequence
EECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human pyridoxal kinase in complex with the neurotoxins, ginkgotoxin and theophylline: insights into pyridoxal kinase inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Pyridoxal kinase
total genus 104
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 4en4A00
3I3YA 4C5LA 3UQ9A 2YXTA 3CQDA 1RKAA 2A9ZA 3RTAA 3UMPA 3BF5A 5BYDA 1LIJA 3IN1A 3RQ6A 4C5JA 1VK4A 3H49A 2FV7A 4B8RA 4KBEA 5C3ZA 4K8KA 4C5KA 4E8YA 3VASA 3EWMA 3RM5A 3BGKA 1YGJA 1RFUA 3RSSA 4EN4A 5F11A 2HQQA 2I6BA 3RTDA 3KZHA 4DU5A 4LCAA 3RQHA 3PZSA 1V19A 4DC3A 3RQ2A 3RO4A 2AJPA 3MBJA 3RT9A 5C40A 5BYCA 1RFTA 1UB0A 2DDWA 2C49A 1YGKA 4LC4A 4E3AA 1V1BA 3RTBA 4EUMA 2R3BA 4UBEA 4U7XA 1ESJA 4E84A 2Q5RA 3VAQA 3K5WA 3RTCA 2DDMA 2QCVA 2PKFA 5TRWA 1VI9A 1LHPA 4XDAA 1TZ3A 2VARA 1JXHA 3RQ5A 1GC5A 1RKDA 2PKMA 3B1NA 3N1CA 4K9IA 4S1HA 1ESQA 2ABQA 1VM7A 4GM6A 3KEUA 1TZ6A 3W4SA 2DDOA 3RRFA 1LIIA 2XTBA 4JJPA 3NM3A 3NBVA 4XF7A 5BYEA 5C41A 3H74A 3UQDA 4WJMA 3RSFA 3GO7A 4S1MA 4EBUA 3OTXA 3KTNA 1LIKA 3HPDA 5CM5A 3HICA 3LKIA 5C3YA 1JXIA 1RK2A 2YXUA 3IQ0A 1TD2A 4LBXA 3RS9A 2DCNA 2AA0A 3NL5A 3PL2A 3B1QA 3RU3A 3RQQA 2PKKA 4KADA 2JGVA 2R3EA 4EOHA 4KAHA 4E8ZA 2A9YA 3MBHA 4YL5A 2AB8A 3B1RA 2I6AA 3UQEA 3GBUA 1LIOA 3KD6A 3RTEA 5TQIA 3UMOA 4S1IA 2AJRA 3K9EA 5F0ZA 2AX3A 1RFVA 2JG1A 3JULA 2HLZA 4XCKA 3RU2A 2NWHA 3FHYA 4N08A 3Q1YA 4JKUA 4C5NA 3NC9A 3NBWA 4X8FA 3B3LA 5BYFA 1YHJA 3RPZA 3B1OA 4JKSA 3RT7A 1V1AA 1TYYA 4PVVA 4E8WA 3LHXA 2C4EA 3RY7A 4B8SA 4KANA 3LOOA 4LBGA 2JG5A 3NC2A 3DRWA 4O1LA 5EY7A 1RKSA 3QA2A 4O1GA 4S1IB 1GQTA 3QAIA 2QHPA 3GO6A 3HYOA 1EKQA 3IE7A 1C3QA 2V78A 3LJSA 3RPHA 3FHXA 3RREA 3ZS7A 1LHRA 3IKHA 5CGEA 1EKKA 2AFBA 2HW1A 4K8CA 1BX4A 1KYHA 3NL6A 4K93A 4K9CA 3Q92A 4K8PA 3UBOA 3RRBA 4E69A 2ABSA 1V1SA 4K8TA 1L2LA 2I5BA 3RQ8A 3B1PA 2RBCA 1UA4A 4N09A 5CGAA 3DZVA 1WYEA 4KALA 2PKNA 3RTGA 5EYNA 1U2XA 2AWDA 3NL3A 3NCAA 4YWRA 1DGMA 3RS8A 4C5MA 3NL2A 5B6AA 5COJA 3RSQA 3IBQA 3UQ6A 4XF6A 3RQXA 3RSGA 3RRJA 2F02A 3NM1A 2F7KA 3IH0A
chains in the Genus database with same CATH superfamily
3LK7A 3I3YA 4C5LA 4C13A 3UQ9A 2YXTA 3CQDA 1RKAA 2A9ZA 3RTAA 1W7KA 3UMPA 3BF5A 5BYDA 3ZM6A 1LIJA 3IN1A 4C12A 3RQ6A 4C5JA 2UAGA 1VK4A 3H49A 2FV7A 1JBVA 1JBWA 4KBEA 4ZIYA 4B8RA 4CVMA 4K8KA 5C3ZA 4C5KA 4E8YA 1GQYA 1W78A 3VASA 3EWMA 4UAGA 2VTDA 1YGJA 1RFUA 3BGKA 3RM5A 3RSSA 2HQQA 2I6BA 3RTDA 4EN4A 2GC6A 3KZHA 4CVLA 4DU5A 4LCAA 4QDIA 2X5OA 3PZSA 3RQHA 1P31A 1V19A 4DC3A 3RQ2A 3RO4A 2AJPA 3MBJA 2UUOA 3RT9A 5C40A 4QF5A 5BYCA 1RFTA 1UB0A 2DDWA 2C49A 1YGKA 4LC4A 4E3AA 1V1BA 3RTBA 4EUMA 1EEHA 2R3BA 4UBEA 1J6UA 4U7XA 1ESJA 1FGSA 2VOSA 2Q5RA 4E84A 3QCZA 3VAQA 3K5WA 3RTCA 2DDMA 2QCVA 2PKFA 2VORA 5TRWA 1GQQA 1LHPA 1VI9A 4XDAA 1TZ3A 1P3DA 1JXHA 2VARA 1GC5A 3RQ5A 1RKDA 2PKMA 3B1NA 2JFGA 3N1CA 4K9IA 1ESQA 2ABQA 1VM7A 4GM6A 3KEUA 1TZ6A 4S1HA 2DDOA 3RRFA 1LIIA 2XTBA 4JJPA 3NM3A 3NBVA 4XF7A 5BYEA 5C41A 3H74A 3UQDA 4BUCA 4WJMA 2GCAA 3RSFA 3EAGA 3GO7A 4S1MA 2WJPA 4EBUA 3OTXA 2AM2A 1LIKA 2Y67A 3HPDA 3HICA 3KTNA 3LKIA 5CM5A 1JXIA 5C3YA 4HV4A 1RK2A 2YXUA 3IQ0A 1TD2A 4LBXA 3RS9A 2DCNA 2AA0A 2Y1OA 3NL5A 3PL2A 3B1QA 3NRSA 3RU3A 3RQQA 2PKKA 4KADA 2JGVA 2R3EA 4EOHA 4KAHA 4E8ZA 2A9YA 3MBHA 4YL5A 2AB8A 3B1RA 4BUBA 2I6AA 3UQEA 3GBUA 1LIOA 2F00A 2XPCA 3KD6A 5TQIA 3RTEA 3UMOA 4S1IA 2AJRA 3K9EA 2JFFA 1O5ZA 2AX3A 2XJAA 5F0ZA 1RFVA 2JG1A 3JULA 2HLZA 4XCKA 5F11A 3RU2A 2NWHA 3FHYA 4N08A 3Q1YA 2JFHA 4JKUA 3NC9A 3NBWA 3PYZA 3B3LA 1GG4A 4X8FA 3ZM5A 2UUPA 5BYFA 3W4SA 1YHJA 3RPZA 3B1OA 4JKSA 3RT7A 1V1AA 1TYYA 4PVVA 4E8WA 2AM1A 2C4EA 3LHXA 3RY7A 4B8SA 4KANA 3LOOA 4LBGA 2JG5A 3NC2A 3DRWA 4O1LA 5EY7A 1RKSA 1UAGA 3QA2A 4O1GA 4S1IB 1GQTA 3QAIA 2QHPA 2Y66A 3GO6A 1EKQA 3HYOA 1C3QA 2V78A 3IE7A 3LJSA 2GCBA 3FHXA 3RPHA 3RREA 3ZS7A 1LHRA 3IKHA 5A5FA 5CGEA 1EKKA 2AFBA 2HW1A 4K8CA 3RS8A 1BX4A 1KYHA 3NL6A 2GC5A 4K93A 3N2AA 4K9CA 3Q92A 4K8PA 3UBOA 1E0DA 3RRBA 4C5NA 2VTEA 4CVKA 4E69A 2ABSA 1V1SA 4K8TA 3ZL8A 1E8CA 3UAGA 1L2LA 2I5BA 3RQ8A 3B1PA 2RBCA 1UA4A 4N09A 5CGAA 3DZVA 1WYEA 4KALA 2PKNA 3HJ6A 3RTGA 5EYNA 1U2XA 2AWDA 2WTZA 3NCAA 2Y68A 1DGMA 3NL3A 4YWRA 3NL2A 4C5MA 5COJA 3RSQA 3IBQA 5A5EA 5B6AA 3UQ6A 3HN7A 4XF6A 3RQXA 3RSGA 3RRJA 2F02A 3NM1A 2F7KA 3IH0A
chains in the Genus database with same CATH topology
3I3YA 4C5LA 3UQ9A 2YXTA 3CQDA 1RKAA 2A9ZA 3RTAA 3UMPA 3BF5A 5BYDA 1LIJA 3IN1A 3RQ6A 4C5JA 1VK4A 3H49A 2FV7A 4B8RA 4KBEA 5C3ZA 4K8KA 4C5KA 4E8YA 3VASA 3EWMA 3RM5A 3BGKA 1YGJA 1RFUA 3RSSA 4EN4A 5F11A 2HQQA 2I6BA 3RTDA 3KZHA 4DU5A 4LCAA 3RQHA 3PZSA 1V19A 4DC3A 3RQ2A 3RO4A 2AJPA 3MBJA 3RT9A 5C40A 5BYCA 1RFTA 1UB0A 2DDWA 2C49A 1YGKA 4LC4A 4E3AA 1V1BA 3RTBA 4EUMA 2R3BA 4UBEA 4U7XA 1ESJA 4E84A 2Q5RA 3VAQA 3K5WA 3RTCA 2DDMA 2QCVA 2PKFA 5TRWA 1VI9A 1LHPA 4XDAA 1TZ3A 2VARA 1JXHA 3RQ5A 1GC5A 1RKDA 2PKMA 3B1NA 3N1CA 4K9IA 4S1HA 1ESQA 2ABQA 1VM7A 4GM6A 3KEUA 1TZ6A 3W4SA 2DDOA 3RRFA 1LIIA 2XTBA 4JJPA 3NM3A 3NBVA 4XF7A 5BYEA 5C41A 3H74A 3UQDA 4WJMA 3RSFA 3GO7A 4S1MA 4EBUA 3OTXA 3KTNA 1LIKA 3HPDA 5CM5A 3HICA 3LKIA 5C3YA 1JXIA 1RK2A 2YXUA 3IQ0A 1TD2A 4LBXA 3RS9A 2DCNA 2AA0A 3NL5A 3PL2A 3B1QA 3RU3A 3RQQA 2PKKA 4KADA 2JGVA 2R3EA 4EOHA 4KAHA 4E8ZA 2A9YA 3MBHA 4YL5A 2AB8A 3B1RA 2I6AA 3UQEA 3GBUA 1LIOA 3KD6A 3RTEA 5TQIA 3UMOA 4S1IA 2AJRA 3K9EA 5F0ZA 2AX3A 1RFVA 2JG1A 3JULA 2HLZA 4XCKA 3RU2A 2NWHA 3FHYA 4N08A 3Q1YA 4JKUA 4C5NA 3NC9A 3NBWA 4X8FA 3B3LA 5BYFA 1YHJA 3RPZA 3B1OA 4JKSA 3RT7A 1V1AA 1TYYA 4PVVA 4E8WA 3LHXA 2C4EA 3RY7A 4B8SA 4KANA 3LOOA 4LBGA 2JG5A 3NC2A 3DRWA 4O1LA 5EY7A 1RKSA 3QA2A 4O1GA 4S1IB 1GQTA 3QAIA 2QHPA 3GO6A 3HYOA 1EKQA 3IE7A 1C3QA 2V78A 3LJSA 3RPHA 3FHXA 3RREA 3ZS7A 1LHRA 3IKHA 5CGEA 1EKKA 2AFBA 2HW1A 4K8CA 1BX4A 1KYHA 3NL6A 4K93A 4K9CA 3Q92A 4K8PA 3UBOA 3RRBA 4E69A 2ABSA 1V1SA 4K8TA 1L2LA 2I5BA 3RQ8A 3B1PA 2RBCA 1UA4A 4N09A 5CGAA 3DZVA 1WYEA 4KALA 2PKNA 3HJ6A 3RTGA 5EYNA 1U2XA 2AWDA 3NL3A 3NCAA 4YWRA 1DGMA 3RS8A 4C5MA 3NL2A 5B6AA 5COJA 3RSQA 3IBQA 3UQ6A 4XF6A 3RQXA 3RSGA 3RRJA 2F02A 3NM1A 2F7KA 3IH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3Y A;  4C5L A;  3UQ9 A;  2YXT A;  3CQD A;  1RKA A;  2A9Z A;  3RTA A;  3UMP A;  3BF5 A;  5BYD A;  1LIJ A;  3IN1 A;  3RQ6 A;  4C5J A;  1VK4 A;  3H49 A;  2FV7 A;  4B8R A;  4KBE A;  5C3Z A;  4K8K A;  4C5K A;  4E8Y A;  3VAS A;  3EWM A;  3RM5 A;  3BGK A;  1YGJ A;  1RFU A;  3RSS A;  4EN4 A;  5F11 A;  2HQQ A;  2I6B A;  3RTD A;  3KZH A;  4DU5 A;  4LCA A;  3RQH A;  3PZS A;  1V19 A;  4DC3 A;  3RQ2 A;  3RO4 A;  2AJP A;  3MBJ A;  3RT9 A;  5C40 A;  5BYC A;  1RFT A;  1UB0 A;  2DDW A;  2C49 A;  1YGK A;  4LC4 A;  4E3A A;  1V1B A;  3RTB A;  4EUM A;  2R3B A;  4UBE A;  4U7X A;  1ESJ A;  4E84 A;  2Q5R A;  3VAQ A;  3K5W A;  3RTC A;  2DDM A;  2QCV A;  2PKF A;  5TRW A;  1VI9 A;  1LHP A;  4XDA A;  1TZ3 A;  2VAR A;  1JXH A;  3RQ5 A;  1GC5 A;  1RKD A;  2PKM A;  3B1N A;  3N1C A;  4K9I A;  4S1H A;  1ESQ A;  2ABQ A;  1VM7 A;  4GM6 A;  3KEU A;  1TZ6 A;  3W4S A;  2DDO A;  3RRF A;  1LII A;  2XTB A;  4JJP A;  3NM3 A;  3NBV A;  4XF7 A;  5BYE A;  5C41 A;  3H74 A;  3UQD A;  4WJM A;  3RSF A;  3GO7 A;  4S1M A;  4EBU A;  3OTX A;  3KTN A;  1LIK A;  3HPD A;  5CM5 A;  3HIC A;  3LKI A;  5C3Y A;  1JXI A;  1RK2 A;  2YXU A;  3IQ0 A;  1TD2 A;  4LBX A;  3RS9 A;  2DCN A;  2AA0 A;  3NL5 A;  3PL2 A;  3B1Q A;  3RU3 A;  3RQQ A;  2PKK A;  4KAD A;  2JGV A;  2R3E A;  4EOH A;  4KAH A;  4E8Z A;  2A9Y A;  3MBH A;  4YL5 A;  2AB8 A;  3B1R A;  2I6A A;  3UQE A;  3GBU A;  1LIO A;  3KD6 A;  3RTE A;  5TQI A;  3UMO A;  4S1I A;  2AJR A;  3K9E A;  5F0Z A;  2AX3 A;  1RFV A;  2JG1 A;  3JUL A;  2HLZ A;  4XCK A;  3RU2 A;  2NWH A;  3FHY A;  4N08 A;  3Q1Y A;  4JKU A;  4C5N A;  3NC9 A;  3NBW A;  4X8F A;  3B3L A;  5BYF A;  1YHJ A;  3RPZ A;  3B1O A;  4JKS A;  3RT7 A;  1V1A A;  1TYY A;  4PVV A;  4E8W A;  3LHX A;  2C4E A;  3RY7 A;  4B8S A;  4KAN A;  3LOO A;  4LBG A;  2JG5 A;  3NC2 A;  3DRW A;  4O1L A;  5EY7 A;  1RKS A;  3QA2 A;  4O1G A;  4S1I B;  1GQT A;  3QAI A;  2QHP A;  3GO6 A;  3HYO A;  1EKQ A;  3IE7 A;  1C3Q A;  2V78 A;  3LJS A;  3RPH A;  3FHX A;  3RRE A;  3ZS7 A;  1LHR A;  3IKH A;  5CGE A;  1EKK A;  2AFB A;  2HW1 A;  4K8C A;  1BX4 A;  1KYH A;  3NL6 A;  4K93 A;  4K9C A;  3Q92 A;  4K8P A;  3UBO A;  3RRB A;  4E69 A;  2ABS A;  1V1S A;  4K8T A;  1L2L A;  2I5B A;  3RQ8 A;  3B1P A;  2RBC A;  1UA4 A;  4N09 A;  5CGA A;  3DZV A;  1WYE A;  4KAL A;  2PKN A;  3RTG A;  5EYN A;  1U2X A;  2AWD A;  3NL3 A;  3NCA A;  4YWR A;  1DGM A;  3RS8 A;  4C5M A;  3NL2 A;  5B6A A;  5COJ A;  3RSQ A;  3IBQ A;  3UQ6 A;  4XF6 A;  3RQX A;  3RSG A;  3RRJ A;  2F02 A;  3NM1 A;  2F7K A;  3IH0 A; 
#chains in the Genus database with same CATH topology
 3LK7 A;  3I3Y A;  4C5L A;  4C13 A;  3UQ9 A;  2YXT A;  3CQD A;  1RKA A;  2A9Z A;  3RTA A;  1W7K A;  3UMP A;  3BF5 A;  5BYD A;  3ZM6 A;  1LIJ A;  3IN1 A;  4C12 A;  3RQ6 A;  4C5J A;  2UAG A;  1VK4 A;  3H49 A;  2FV7 A;  1JBV A;  1JBW A;  4KBE A;  4ZIY A;  4B8R A;  4CVM A;  4K8K A;  5C3Z A;  4C5K A;  4E8Y A;  1GQY A;  1W78 A;  3VAS A;  3EWM A;  4UAG A;  2VTD A;  1YGJ A;  1RFU A;  3BGK A;  3RM5 A;  3RSS A;  2HQQ A;  2I6B A;  3RTD A;  4EN4 A;  2GC6 A;  3KZH A;  4CVL A;  4DU5 A;  4LCA A;  4QDI A;  2X5O A;  3PZS A;  3RQH A;  1P31 A;  1V19 A;  4DC3 A;  3RQ2 A;  3RO4 A;  2AJP A;  3MBJ A;  2UUO A;  3RT9 A;  5C40 A;  4QF5 A;  5BYC A;  1RFT A;  1UB0 A;  2DDW A;  2C49 A;  1YGK A;  4LC4 A;  4E3A A;  1V1B A;  3RTB A;  4EUM A;  1EEH A;  2R3B A;  4UBE A;  1J6U A;  4U7X A;  1ESJ A;  1FGS A;  2VOS A;  2Q5R A;  4E84 A;  3QCZ A;  3VAQ A;  3K5W A;  3RTC A;  2DDM A;  2QCV A;  2PKF A;  2VOR A;  5TRW A;  1GQQ A;  1LHP A;  1VI9 A;  4XDA A;  1TZ3 A;  1P3D A;  1JXH A;  2VAR A;  1GC5 A;  3RQ5 A;  1RKD A;  2PKM A;  3B1N A;  2JFG A;  3N1C A;  4K9I A;  1ESQ A;  2ABQ A;  1VM7 A;  4GM6 A;  3KEU A;  1TZ6 A;  4S1H A;  2DDO A;  3RRF A;  1LII A;  2XTB A;  4JJP A;  3NM3 A;  3NBV A;  4XF7 A;  5BYE A;  5C41 A;  3H74 A;  3UQD A;  4BUC A;  4WJM A;  2GCA A;  3RSF A;  3EAG A;  3GO7 A;  4S1M A;  2WJP A;  4EBU A;  3OTX A;  2AM2 A;  1LIK A;  2Y67 A;  3HPD A;  3HIC A;  3KTN A;  3LKI A;  5CM5 A;  1JXI A;  5C3Y A;  4HV4 A;  1RK2 A;  2YXU A;  3IQ0 A;  1TD2 A;  4LBX A;  3RS9 A;  2DCN A;  2AA0 A;  2Y1O A;  3NL5 A;  3PL2 A;  3B1Q A;  3NRS A;  3RU3 A;  3RQQ A;  2PKK A;  4KAD A;  2JGV A;  2R3E A;  4EOH A;  4KAH A;  4E8Z A;  2A9Y A;  3MBH A;  4YL5 A;  2AB8 A;  3B1R A;  4BUB A;  2I6A A;  3UQE A;  3GBU A;  1LIO A;  2F00 A;  2XPC A;  3KD6 A;  5TQI A;  3RTE A;  3UMO A;  4S1I A;  2AJR A;  3K9E A;  2JFF A;  1O5Z A;  2AX3 A;  2XJA A;  5F0Z A;  1RFV A;  2JG1 A;  3JUL A;  2HLZ A;  4XCK A;  5F11 A;  3RU2 A;  2NWH A;  3FHY A;  4N08 A;  3Q1Y A;  2JFH A;  4JKU A;  3NC9 A;  3NBW A;  3PYZ A;  3B3L A;  1GG4 A;  4X8F A;  3ZM5 A;  2UUP A;  5BYF A;  3W4S A;  1YHJ A;  3RPZ A;  3B1O A;  4JKS A;  3RT7 A;  1V1A A;  1TYY A;  4PVV A;  4E8W A;  2AM1 A;  2C4E A;  3LHX A;  3RY7 A;  4B8S A;  4KAN A;  3LOO A;  4LBG A;  2JG5 A;  3NC2 A;  3DRW A;  4O1L A;  5EY7 A;  1RKS A;  1UAG A;  3QA2 A;  4O1G A;  4S1I B;  1GQT A;  3QAI A;  2QHP A;  2Y66 A;  3GO6 A;  1EKQ A;  3HYO A;  1C3Q A;  2V78 A;  3IE7 A;  3LJS A;  2GCB A;  3FHX A;  3RPH A;  3RRE A;  3ZS7 A;  1LHR A;  3IKH A;  5A5F A;  5CGE A;  1EKK A;  2AFB A;  2HW1 A;  4K8C A;  3RS8 A;  1BX4 A;  1KYH A;  3NL6 A;  2GC5 A;  4K93 A;  3N2A A;  4K9C A;  3Q92 A;  4K8P A;  3UBO A;  1E0D A;  3RRB A;  4C5N A;  2VTE A;  4CVK A;  4E69 A;  2ABS A;  1V1S A;  4K8T A;  3ZL8 A;  1E8C A;  3UAG A;  1L2L A;  2I5B A;  3RQ8 A;  3B1P A;  2RBC A;  1UA4 A;  4N09 A;  5CGA A;  3DZV A;  1WYE A;  4KAL A;  2PKN A;  3HJ6 A;  3RTG A;  5EYN A;  1U2X A;  2AWD A;  2WTZ A;  3NCA A;  2Y68 A;  1DGM A;  3NL3 A;  4YWR A;  3NL2 A;  4C5M A;  5COJ A;  3RSQ A;  3IBQ A;  5A5E A;  5B6A A;  3UQ6 A;  3HN7 A;  4XF6 A;  3RQX A;  3RSG A;  3RRJ A;  2F02 A;  3NM1 A;  2F7K A;  3IH0 A; 
#chains in the Genus database with same CATH homology
 3I3Y A;  4C5L A;  3UQ9 A;  2YXT A;  3CQD A;  1RKA A;  2A9Z A;  3RTA A;  3UMP A;  3BF5 A;  5BYD A;  1LIJ A;  3IN1 A;  3RQ6 A;  4C5J A;  1VK4 A;  3H49 A;  2FV7 A;  4B8R A;  4KBE A;  5C3Z A;  4K8K A;  4C5K A;  4E8Y A;  3VAS A;  3EWM A;  3RM5 A;  3BGK A;  1YGJ A;  1RFU A;  3RSS A;  4EN4 A;  5F11 A;  2HQQ A;  2I6B A;  3RTD A;  3KZH A;  4DU5 A;  4LCA A;  3RQH A;  3PZS A;  1V19 A;  4DC3 A;  3RQ2 A;  3RO4 A;  2AJP A;  3MBJ A;  3RT9 A;  5C40 A;  5BYC A;  1RFT A;  1UB0 A;  2DDW A;  2C49 A;  1YGK A;  4LC4 A;  4E3A A;  1V1B A;  3RTB A;  4EUM A;  2R3B A;  4UBE A;  4U7X A;  1ESJ A;  4E84 A;  2Q5R A;  3VAQ A;  3K5W A;  3RTC A;  2DDM A;  2QCV A;  2PKF A;  5TRW A;  1VI9 A;  1LHP A;  4XDA A;  1TZ3 A;  2VAR A;  1JXH A;  3RQ5 A;  1GC5 A;  1RKD A;  2PKM A;  3B1N A;  3N1C A;  4K9I A;  4S1H A;  1ESQ A;  2ABQ A;  1VM7 A;  4GM6 A;  3KEU A;  1TZ6 A;  3W4S A;  2DDO A;  3RRF A;  1LII A;  2XTB A;  4JJP A;  3NM3 A;  3NBV A;  4XF7 A;  5BYE A;  5C41 A;  3H74 A;  3UQD A;  4WJM A;  3RSF A;  3GO7 A;  4S1M A;  4EBU A;  3OTX A;  3KTN A;  1LIK A;  3HPD A;  5CM5 A;  3HIC A;  3LKI A;  5C3Y A;  1JXI A;  1RK2 A;  2YXU A;  3IQ0 A;  1TD2 A;  4LBX A;  3RS9 A;  2DCN A;  2AA0 A;  3NL5 A;  3PL2 A;  3B1Q A;  3RU3 A;  3RQQ A;  2PKK A;  4KAD A;  2JGV A;  2R3E A;  4EOH A;  4KAH A;  4E8Z A;  2A9Y A;  3MBH A;  4YL5 A;  2AB8 A;  3B1R A;  2I6A A;  3UQE A;  3GBU A;  1LIO A;  3KD6 A;  3RTE A;  5TQI A;  3UMO A;  4S1I A;  2AJR A;  3K9E A;  5F0Z A;  2AX3 A;  1RFV A;  2JG1 A;  3JUL A;  2HLZ A;  4XCK A;  3RU2 A;  2NWH A;  3FHY A;  4N08 A;  3Q1Y A;  4JKU A;  4C5N A;  3NC9 A;  3NBW A;  4X8F A;  3B3L A;  5BYF A;  1YHJ A;  3RPZ A;  3B1O A;  4JKS A;  3RT7 A;  1V1A A;  1TYY A;  4PVV A;  4E8W A;  3LHX A;  2C4E A;  3RY7 A;  4B8S A;  4KAN A;  3LOO A;  4LBG A;  2JG5 A;  3NC2 A;  3DRW A;  4O1L A;  5EY7 A;  1RKS A;  3QA2 A;  4O1G A;  4S1I B;  1GQT A;  3QAI A;  2QHP A;  3GO6 A;  3HYO A;  1EKQ A;  3IE7 A;  1C3Q A;  2V78 A;  3LJS A;  3RPH A;  3FHX A;  3RRE A;  3ZS7 A;  1LHR A;  3IKH A;  5CGE A;  1EKK A;  2AFB A;  2HW1 A;  4K8C A;  1BX4 A;  1KYH A;  3NL6 A;  4K93 A;  4K9C A;  3Q92 A;  4K8P A;  3UBO A;  3RRB A;  4E69 A;  2ABS A;  1V1S A;  4K8T A;  1L2L A;  2I5B A;  3RQ8 A;  3B1P A;  2RBC A;  1UA4 A;  4N09 A;  5CGA A;  3DZV A;  1WYE A;  4KAL A;  2PKN A;  3HJ6 A;  3RTG A;  5EYN A;  1U2X A;  2AWD A;  3NL3 A;  3NCA A;  4YWR A;  1DGM A;  3RS8 A;  4C5M A;  3NL2 A;  5B6A A;  5COJ A;  3RSQ A;  3IBQ A;  3UQ6 A;  4XF6 A;  3RQX A;  3RSG A;  3RRJ A;  2F02 A;  3NM1 A;  2F7K A;  3IH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...