4EN4A

Crystal structure of the ternary human pl kinase-ginkgotoxin-mgatp complex
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
310
structure length
310
Chain Sequence
EECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human pyridoxal kinase in complex with the neurotoxins, ginkgotoxin and theophylline: insights into pyridoxal kinase inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Pyridoxal kinase
total genus 104
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 4en4A00
3B3LA 3IE7A 3KZHA 3NM1A 3RO4A 2AJRA 3HPDA 1JXHA 3B1PA 4LBXA 1WYEA 2ABSA 1UA4A 2I6BA 3I3YA 3B1OA 3DZVA 3RPZA 3RTCA 2C49A 3CQDA 4E84A 2ABQA 3IH0A 5B6AA 2PKMA 4S1IB 3NBWA 3PZSA 2NWHA 4C5MA 2I5BA 3BF5A 2AFBA 3RTDA 1EKKA 3RRBA 3GBUA 4EUMA 1LIKA 1TD2A 3LHXA 2Q5RA 3NM3A 4JKUA 3RTEA 4EN4A 3UQ6A 4C5LA 2F02A 4O1GA 2DCNA 3RPHA 2JG1A 3RTAA 4DU5A 4JKSA 3RSGA 3RY7A 5BYEA 1GC5A 1L2LA 4S1HA 1VK4A 2AWDA 3NBVA 4X8FA 1RFUA 3FHXA 2PKNA 3IN1A 4LC4A 3H49A 4K8CA 4LBGA 1RFTA 2AA0A 3RQ8A 3LKIA 2HQQA 4XF6A 4O1LA 4KALA 1VI9A 2AB8A 1LIJA 2DDOA 1C3QA 2DDWA 3RU2A 2HLZA 4YWRA 3RRFA 2JGVA 4GM6A 3KTNA 4B8RA 3VASA 1DGMA 3OTXA 2A9ZA 5CM5A 3RRJA 1LHPA 3PL2A 2DDMA 3K5WA 2A9YA 3RT7A 2QHPA 3Q1YA 3RQQA 3UMPA 5F0ZA 3EWMA 5F11A 3RU3A 3H74A 3RQHA 1LIOA 4E8WA 3RSSA 3HYOA 3UBOA 1RKSA 3BGKA 3FHYA 4E3AA 3RQ5A 4E8YA 3JULA 1TZ6A 4XF7A 4E8ZA 1V1SA 2AX3A 1GQTA 4S1IA 3RSQA 4B8SA 5BYDA 3NC9A 2C4EA 1VM7A 4U7XA 1EKQA 3RQ6A 3RQXA 3RS8A 3NL6A 1YHJA 3RTBA 1YGJA 3KD6A 1RK2A 4UBEA 2FV7A 4LCAA 5COJA 1ESQA 2AJPA 3RT9A 3NL3A 3B1NA 4XDAA 3KEUA 4C5JA 3NL2A 4K9IA 4K8TA 4PVVA 4XCKA 3RQ2A 3QA2A 5CGEA 1V1BA 2YXTA 3QAIA 1TZ3A 4S1MA 4KANA 2PKFA 3RM5A 2R3BA 3DRWA 5C40A 3K9EA 5TQIA 3B1QA 1UB0A 4DC3A 5C3ZA 1RFVA 3NL5A 3IKHA 3NCAA 5TRWA 5EYNA 1TYYA 4C5KA 4EOHA 1LIIA 1ESJA 3UQ9A 3UMOA 3RREA 2QCVA 3MBJA 3RTGA 1KYHA 1V19A 2I6AA 3IQ0A 5BYCA 5C41A 2V78A 3UQDA 3NC2A 4KAHA 2F7KA 3Q92A 2VARA 4K8PA 3UQEA 5CGAA 3GO6A 4C5NA 1U2XA 3MBHA 1RKAA 2RBCA 3IBQA 3RSFA 1V1AA 3VAQA 2YXUA 2JG5A 2XTBA 3W4SA 1LHRA 3LOOA 4K8KA 4EBUA 4E69A 2PKKA 3GO7A 3RS9A 1BX4A 3LJSA 5EY7A 1YGKA 2R3EA 4K93A 3ZS7A 1JXIA 4N09A 4YL5A 3B1RA 3HICA 5BYFA 4N08A 4KADA 1RKDA 4JJPA 4KBEA 2HW1A 4WJMA 4K9CA 5C3YA 3N1CA
chains in the Genus database with same CATH superfamily
3B3LA 3IE7A 3KZHA 3LK7A 3NM1A 3RO4A 2AJRA 4CVKA 1J6UA 3HPDA 2F00A 1JXHA 2AM1A 3B1PA 4LBXA 1WYEA 2ABSA 1UA4A 2I6BA 3I3YA 3B1OA 3DZVA 3RPZA 3RTCA 2C49A 3CQDA 4E84A 2ABQA 3IH0A 5B6AA 2PKMA 4S1IB 3NBWA 3PZSA 1W78A 2NWHA 4C5MA 2I5BA 3BF5A 2AFBA 3RTDA 5C40A 1EKKA 3RRBA 3GBUA 2GC5A 4EUMA 1LIKA 1TD2A 4UAGA 2GCAA 4CVLA 1GQQA 2VORA 3EAGA 3LHXA 2Q5RA 3NM3A 4JKUA 3RTEA 4EN4A 3UQ6A 2JFGA 4C5LA 2F02A 4O1GA 2DCNA 3RPHA 2JG1A 3RTAA 4DU5A 4JKSA 1W7KA 1P3DA 1EEHA 3QCZA 3RSGA 3RY7A 3ZM6A 1GC5A 1L2LA 2VTDA 1VK4A 2AWDA 3N2AA 3NBVA 1RFUA 3FHXA 2PKNA 3IN1A 4LC4A 3H49A 4K8CA 4LBGA 4C13A 1RFTA 2AA0A 4QF5A 3LKIA 2HQQA 4XF6A 4O1LA 3RQ8A 4KALA 5BYEA 1O5ZA 1VI9A 2AB8A 1LIJA 2DDOA 1C3QA 2DDWA 3RU2A 4HV4A 2HLZA 4YWRA 3RRFA 2JGVA 4GM6A 2XPCA 3KTNA 4B8RA 3VASA 1DGMA 3OTXA 2A9ZA 5CM5A 3RRJA 1LHPA 3PL2A 2DDMA 2JFHA 2A9YA 3K5WA 3RT7A 2QHPA 3Q1YA 3RQQA 2GCBA 3UMPA 3EWMA 5F0ZA 5F11A 3RU3A 3H74A 3RQHA 1LIOA 4E8WA 3RSSA 3HYOA 3UBOA 1RKSA 3BGKA 2Y68A 3FHYA 4E3AA 1GG4A 3RQ5A 2VTEA 4E8YA 4WJMA 3JULA 1TZ6A 2Y66A 4XF7A 4E8ZA 1V1SA 2AX3A 1GQTA 4S1IA 3RSQA 4B8SA 4CVMA 3NC9A 5BYDA 2C4EA 1VM7A 4U7XA 1EKQA 3RQ6A 3RQXA 3RS8A 3NL6A 1YHJA 3RTBA 1YGJA 3KD6A 1RK2A 4UBEA 2FV7A 4LCAA 5COJA 5A5EA 1ESQA 2AJPA 3RT9A 3NL3A 3B1NA 4XDAA 3KEUA 4C5JA 5A5FA 3NL2A 4K9IA 4K8TA 4PVVA 4XCKA 3RQ2A 4BUBA 2UUOA 2UAGA 3QA2A 1V1BA 2YXTA 2AM2A 1TZ3A 3QAIA 1E8CA 3NRSA 4S1HA 4KANA 2PKFA 4S1MA 2R3BA 3DRWA 3RM5A 3K9EA 5TQIA 4BUCA 5BYFA 2WJPA 1UB0A 3B1QA 4X8FA 4DC3A 1RFVA 3NL5A 5C3ZA 3IKHA 3NCAA 5TRWA 1JBWA 5EYNA 1TYYA 4C5KA 4EOHA 1LIIA 1ESJA 3UQ9A 3UMOA 3RREA 2QCVA 3HJ6A 3HN7A 3MBJA 3RTGA 1KYHA 1V19A 2I6AA 5CGEA 3IQ0A 5BYCA 5C41A 4ZIYA 2VOSA 2V78A 3UQDA 3NC2A 4KAHA 2F7KA 3Q92A 2VARA 2X5OA 4K8PA 3UQEA 3GO6A 4C5NA 1U2XA 3MBHA 5CGAA 1RKAA 2RBCA 3IBQA 3PYZA 1V1AA 3RSFA 1E0DA 1FGSA 3VAQA 2YXUA 2JG5A 2XTBA 2Y1OA 2JFFA 3W4SA 1LHRA 3LOOA 1P31A 4K8KA 4EBUA 1GQYA 4E69A 3UAGA 2XJAA 2PKKA 4C12A 2GC6A 3GO7A 3RS9A 1BX4A 3LJSA 5EY7A 1YGKA 2Y67A 2R3EA 2WTZA 4K93A 4QDIA 1JXIA 4N09A 4YL5A 3B1RA 3HICA 3ZS7A 4N08A 4KADA 1JBVA 1RKDA 4JJPA 2UUPA 3ZL8A 3ZM5A 4KBEA 2HW1A 1UAGA 4K9CA 5C3YA 3N1CA
chains in the Genus database with same CATH topology
3B3LA 3IE7A 3KZHA 3NM1A 3RO4A 2AJRA 3HPDA 1JXHA 3B1PA 4LBXA 1WYEA 2ABSA 1UA4A 2I6BA 3I3YA 3B1OA 3DZVA 3RPZA 3RTCA 2C49A 3CQDA 4E84A 2ABQA 3IH0A 5B6AA 2PKMA 4S1IB 3NBWA 3PZSA 2NWHA 4C5MA 2I5BA 3BF5A 2AFBA 3RTDA 1EKKA 3RRBA 3GBUA 4EUMA 1LIKA 1TD2A 3LHXA 2Q5RA 3NM3A 4JKUA 3RTEA 4EN4A 3UQ6A 4C5LA 2F02A 4O1GA 2DCNA 3RPHA 2JG1A 3RTAA 4DU5A 4JKSA 3RSGA 3RY7A 5BYEA 1GC5A 1L2LA 4S1HA 1VK4A 2AWDA 3NBVA 4X8FA 1RFUA 3FHXA 2PKNA 3IN1A 4LC4A 3H49A 4K8CA 4LBGA 1RFTA 2AA0A 3RQ8A 3LKIA 2HQQA 4XF6A 4O1LA 4KALA 1VI9A 2AB8A 1LIJA 2DDOA 1C3QA 2DDWA 3RU2A 2HLZA 4YWRA 3RRFA 2JGVA 4GM6A 3KTNA 4B8RA 3VASA 1DGMA 3OTXA 2A9ZA 5CM5A 3RRJA 1LHPA 3PL2A 2DDMA 3K5WA 2A9YA 3RT7A 2QHPA 3Q1YA 3RQQA 3UMPA 5F0ZA 3EWMA 5F11A 3RU3A 3H74A 3RQHA 1LIOA 4E8WA 3RSSA 3HYOA 3UBOA 1RKSA 3BGKA 3FHYA 4E3AA 3RQ5A 4E8YA 3JULA 1TZ6A 4XF7A 4E8ZA 1V1SA 2AX3A 1GQTA 4S1IA 3RSQA 4B8SA 5BYDA 3NC9A 2C4EA 1VM7A 4U7XA 1EKQA 3RQ6A 3RQXA 3RS8A 3NL6A 1YHJA 3RTBA 1YGJA 3KD6A 1RK2A 4UBEA 2FV7A 4LCAA 5COJA 1ESQA 2AJPA 3RT9A 3NL3A 3B1NA 4XDAA 3KEUA 4C5JA 3NL2A 4K9IA 4K8TA 4PVVA 4XCKA 3RQ2A 3QA2A 5CGEA 1V1BA 2YXTA 3QAIA 1TZ3A 4S1MA 4KANA 2PKFA 3RM5A 2R3BA 3DRWA 5C40A 3K9EA 5TQIA 3B1QA 1UB0A 4DC3A 5C3ZA 1RFVA 3NL5A 3IKHA 3NCAA 5TRWA 5EYNA 1TYYA 4C5KA 4EOHA 1LIIA 1ESJA 3UQ9A 3UMOA 3RREA 2QCVA 3HJ6A 3MBJA 3RTGA 1KYHA 1V19A 2I6AA 3IQ0A 5BYCA 5C41A 2V78A 3UQDA 3NC2A 4KAHA 2F7KA 3Q92A 2VARA 4K8PA 3UQEA 5CGAA 3GO6A 4C5NA 1U2XA 3MBHA 1RKAA 2RBCA 3IBQA 3RSFA 1V1AA 3VAQA 2YXUA 2JG5A 2XTBA 3W4SA 1LHRA 3LOOA 4K8KA 4EBUA 4E69A 2PKKA 3GO7A 3RS9A 1BX4A 3LJSA 5EY7A 1YGKA 2R3EA 4K93A 3ZS7A 1JXIA 4N09A 4YL5A 3B1RA 3HICA 5BYFA 4N08A 4KADA 1RKDA 4JJPA 4KBEA 2HW1A 4WJMA 4K9CA 5C3YA 3N1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B3L A;  3IE7 A;  3KZH A;  3NM1 A;  3RO4 A;  2AJR A;  3HPD A;  1JXH A;  3B1P A;  4LBX A;  1WYE A;  2ABS A;  1UA4 A;  2I6B A;  3I3Y A;  3B1O A;  3DZV A;  3RPZ A;  3RTC A;  2C49 A;  3CQD A;  4E84 A;  2ABQ A;  3IH0 A;  5B6A A;  2PKM A;  4S1I B;  3NBW A;  3PZS A;  2NWH A;  4C5M A;  2I5B A;  3BF5 A;  2AFB A;  3RTD A;  1EKK A;  3RRB A;  3GBU A;  4EUM A;  1LIK A;  1TD2 A;  3LHX A;  2Q5R A;  3NM3 A;  4JKU A;  3RTE A;  4EN4 A;  3UQ6 A;  4C5L A;  2F02 A;  4O1G A;  2DCN A;  3RPH A;  2JG1 A;  3RTA A;  4DU5 A;  4JKS A;  3RSG A;  3RY7 A;  5BYE A;  1GC5 A;  1L2L A;  4S1H A;  1VK4 A;  2AWD A;  3NBV A;  4X8F A;  1RFU A;  3FHX A;  2PKN A;  3IN1 A;  4LC4 A;  3H49 A;  4K8C A;  4LBG A;  1RFT A;  2AA0 A;  3RQ8 A;  3LKI A;  2HQQ A;  4XF6 A;  4O1L A;  4KAL A;  1VI9 A;  2AB8 A;  1LIJ A;  2DDO A;  1C3Q A;  2DDW A;  3RU2 A;  2HLZ A;  4YWR A;  3RRF A;  2JGV A;  4GM6 A;  3KTN A;  4B8R A;  3VAS A;  1DGM A;  3OTX A;  2A9Z A;  5CM5 A;  3RRJ A;  1LHP A;  3PL2 A;  2DDM A;  3K5W A;  2A9Y A;  3RT7 A;  2QHP A;  3Q1Y A;  3RQQ A;  3UMP A;  5F0Z A;  3EWM A;  5F11 A;  3RU3 A;  3H74 A;  3RQH A;  1LIO A;  4E8W A;  3RSS A;  3HYO A;  3UBO A;  1RKS A;  3BGK A;  3FHY A;  4E3A A;  3RQ5 A;  4E8Y A;  3JUL A;  1TZ6 A;  4XF7 A;  4E8Z A;  1V1S A;  2AX3 A;  1GQT A;  4S1I A;  3RSQ A;  4B8S A;  5BYD A;  3NC9 A;  2C4E A;  1VM7 A;  4U7X A;  1EKQ A;  3RQ6 A;  3RQX A;  3RS8 A;  3NL6 A;  1YHJ A;  3RTB A;  1YGJ A;  3KD6 A;  1RK2 A;  4UBE A;  2FV7 A;  4LCA A;  5COJ A;  1ESQ A;  2AJP A;  3RT9 A;  3NL3 A;  3B1N A;  4XDA A;  3KEU A;  4C5J A;  3NL2 A;  4K9I A;  4K8T A;  4PVV A;  4XCK A;  3RQ2 A;  3QA2 A;  5CGE A;  1V1B A;  2YXT A;  3QAI A;  1TZ3 A;  4S1M A;  4KAN A;  2PKF A;  3RM5 A;  2R3B A;  3DRW A;  5C40 A;  3K9E A;  5TQI A;  3B1Q A;  1UB0 A;  4DC3 A;  5C3Z A;  1RFV A;  3NL5 A;  3IKH A;  3NCA A;  5TRW A;  5EYN A;  1TYY A;  4C5K A;  4EOH A;  1LII A;  1ESJ A;  3UQ9 A;  3UMO A;  3RRE A;  2QCV A;  3MBJ A;  3RTG A;  1KYH A;  1V19 A;  2I6A A;  3IQ0 A;  5BYC A;  5C41 A;  2V78 A;  3UQD A;  3NC2 A;  4KAH A;  2F7K A;  3Q92 A;  2VAR A;  4K8P A;  3UQE A;  5CGA A;  3GO6 A;  4C5N A;  1U2X A;  3MBH A;  1RKA A;  2RBC A;  3IBQ A;  3RSF A;  1V1A A;  3VAQ A;  2YXU A;  2JG5 A;  2XTB A;  3W4S A;  1LHR A;  3LOO A;  4K8K A;  4EBU A;  4E69 A;  2PKK A;  3GO7 A;  3RS9 A;  1BX4 A;  3LJS A;  5EY7 A;  1YGK A;  2R3E A;  4K93 A;  3ZS7 A;  1JXI A;  4N09 A;  4YL5 A;  3B1R A;  3HIC A;  5BYF A;  4N08 A;  4KAD A;  1RKD A;  4JJP A;  4KBE A;  2HW1 A;  4WJM A;  4K9C A;  5C3Y A;  3N1C A; 
#chains in the Genus database with same CATH topology
 3B3L A;  3IE7 A;  3KZH A;  3LK7 A;  3NM1 A;  3RO4 A;  2AJR A;  4CVK A;  1J6U A;  3HPD A;  2F00 A;  1JXH A;  2AM1 A;  3B1P A;  4LBX A;  1WYE A;  2ABS A;  1UA4 A;  2I6B A;  3I3Y A;  3B1O A;  3DZV A;  3RPZ A;  3RTC A;  2C49 A;  3CQD A;  4E84 A;  2ABQ A;  3IH0 A;  5B6A A;  2PKM A;  4S1I B;  3NBW A;  3PZS A;  1W78 A;  2NWH A;  4C5M A;  2I5B A;  3BF5 A;  2AFB A;  3RTD A;  5C40 A;  1EKK A;  3RRB A;  3GBU A;  2GC5 A;  4EUM A;  1LIK A;  1TD2 A;  4UAG A;  2GCA A;  4CVL A;  1GQQ A;  2VOR A;  3EAG A;  3LHX A;  2Q5R A;  3NM3 A;  4JKU A;  3RTE A;  4EN4 A;  3UQ6 A;  2JFG A;  4C5L A;  2F02 A;  4O1G A;  2DCN A;  3RPH A;  2JG1 A;  3RTA A;  4DU5 A;  4JKS A;  1W7K A;  1P3D A;  1EEH A;  3QCZ A;  3RSG A;  3RY7 A;  3ZM6 A;  1GC5 A;  1L2L A;  2VTD A;  1VK4 A;  2AWD A;  3N2A A;  3NBV A;  1RFU A;  3FHX A;  2PKN A;  3IN1 A;  4LC4 A;  3H49 A;  4K8C A;  4LBG A;  4C13 A;  1RFT A;  2AA0 A;  4QF5 A;  3LKI A;  2HQQ A;  4XF6 A;  4O1L A;  3RQ8 A;  4KAL A;  5BYE A;  1O5Z A;  1VI9 A;  2AB8 A;  1LIJ A;  2DDO A;  1C3Q A;  2DDW A;  3RU2 A;  4HV4 A;  2HLZ A;  4YWR A;  3RRF A;  2JGV A;  4GM6 A;  2XPC A;  3KTN A;  4B8R A;  3VAS A;  1DGM A;  3OTX A;  2A9Z A;  5CM5 A;  3RRJ A;  1LHP A;  3PL2 A;  2DDM A;  2JFH A;  2A9Y A;  3K5W A;  3RT7 A;  2QHP A;  3Q1Y A;  3RQQ A;  2GCB A;  3UMP A;  3EWM A;  5F0Z A;  5F11 A;  3RU3 A;  3H74 A;  3RQH A;  1LIO A;  4E8W A;  3RSS A;  3HYO A;  3UBO A;  1RKS A;  3BGK A;  2Y68 A;  3FHY A;  4E3A A;  1GG4 A;  3RQ5 A;  2VTE A;  4E8Y A;  4WJM A;  3JUL A;  1TZ6 A;  2Y66 A;  4XF7 A;  4E8Z A;  1V1S A;  2AX3 A;  1GQT A;  4S1I A;  3RSQ A;  4B8S A;  4CVM A;  3NC9 A;  5BYD A;  2C4E A;  1VM7 A;  4U7X A;  1EKQ A;  3RQ6 A;  3RQX A;  3RS8 A;  3NL6 A;  1YHJ A;  3RTB A;  1YGJ A;  3KD6 A;  1RK2 A;  4UBE A;  2FV7 A;  4LCA A;  5COJ A;  5A5E A;  1ESQ A;  2AJP A;  3RT9 A;  3NL3 A;  3B1N A;  4XDA A;  3KEU A;  4C5J A;  5A5F A;  3NL2 A;  4K9I A;  4K8T A;  4PVV A;  4XCK A;  3RQ2 A;  4BUB A;  2UUO A;  2UAG A;  3QA2 A;  1V1B A;  2YXT A;  2AM2 A;  1TZ3 A;  3QAI A;  1E8C A;  3NRS A;  4S1H A;  4KAN A;  2PKF A;  4S1M A;  2R3B A;  3DRW A;  3RM5 A;  3K9E A;  5TQI A;  4BUC A;  5BYF A;  2WJP A;  1UB0 A;  3B1Q A;  4X8F A;  4DC3 A;  1RFV A;  3NL5 A;  5C3Z A;  3IKH A;  3NCA A;  5TRW A;  1JBW A;  5EYN A;  1TYY A;  4C5K A;  4EOH A;  1LII A;  1ESJ A;  3UQ9 A;  3UMO A;  3RRE A;  2QCV A;  3HJ6 A;  3HN7 A;  3MBJ A;  3RTG A;  1KYH A;  1V19 A;  2I6A A;  5CGE A;  3IQ0 A;  5BYC A;  5C41 A;  4ZIY A;  2VOS A;  2V78 A;  3UQD A;  3NC2 A;  4KAH A;  2F7K A;  3Q92 A;  2VAR A;  2X5O A;  4K8P A;  3UQE A;  3GO6 A;  4C5N A;  1U2X A;  3MBH A;  5CGA A;  1RKA A;  2RBC A;  3IBQ A;  3PYZ A;  1V1A A;  3RSF A;  1E0D A;  1FGS A;  3VAQ A;  2YXU A;  2JG5 A;  2XTB A;  2Y1O A;  2JFF A;  3W4S A;  1LHR A;  3LOO A;  1P31 A;  4K8K A;  4EBU A;  1GQY A;  4E69 A;  3UAG A;  2XJA A;  2PKK A;  4C12 A;  2GC6 A;  3GO7 A;  3RS9 A;  1BX4 A;  3LJS A;  5EY7 A;  1YGK A;  2Y67 A;  2R3E A;  2WTZ A;  4K93 A;  4QDI A;  1JXI A;  4N09 A;  4YL5 A;  3B1R A;  3HIC A;  3ZS7 A;  4N08 A;  4KAD A;  1JBV A;  1RKD A;  4JJP A;  2UUP A;  3ZL8 A;  3ZM5 A;  4KBE A;  2HW1 A;  1UAG A;  4K9C A;  5C3Y A;  3N1C A; 
#chains in the Genus database with same CATH homology
 3B3L A;  3IE7 A;  3KZH A;  3NM1 A;  3RO4 A;  2AJR A;  3HPD A;  1JXH A;  3B1P A;  4LBX A;  1WYE A;  2ABS A;  1UA4 A;  2I6B A;  3I3Y A;  3B1O A;  3DZV A;  3RPZ A;  3RTC A;  2C49 A;  3CQD A;  4E84 A;  2ABQ A;  3IH0 A;  5B6A A;  2PKM A;  4S1I B;  3NBW A;  3PZS A;  2NWH A;  4C5M A;  2I5B A;  3BF5 A;  2AFB A;  3RTD A;  1EKK A;  3RRB A;  3GBU A;  4EUM A;  1LIK A;  1TD2 A;  3LHX A;  2Q5R A;  3NM3 A;  4JKU A;  3RTE A;  4EN4 A;  3UQ6 A;  4C5L A;  2F02 A;  4O1G A;  2DCN A;  3RPH A;  2JG1 A;  3RTA A;  4DU5 A;  4JKS A;  3RSG A;  3RY7 A;  5BYE A;  1GC5 A;  1L2L A;  4S1H A;  1VK4 A;  2AWD A;  3NBV A;  4X8F A;  1RFU A;  3FHX A;  2PKN A;  3IN1 A;  4LC4 A;  3H49 A;  4K8C A;  4LBG A;  1RFT A;  2AA0 A;  3RQ8 A;  3LKI A;  2HQQ A;  4XF6 A;  4O1L A;  4KAL A;  1VI9 A;  2AB8 A;  1LIJ A;  2DDO A;  1C3Q A;  2DDW A;  3RU2 A;  2HLZ A;  4YWR A;  3RRF A;  2JGV A;  4GM6 A;  3KTN A;  4B8R A;  3VAS A;  1DGM A;  3OTX A;  2A9Z A;  5CM5 A;  3RRJ A;  1LHP A;  3PL2 A;  2DDM A;  3K5W A;  2A9Y A;  3RT7 A;  2QHP A;  3Q1Y A;  3RQQ A;  3UMP A;  5F0Z A;  3EWM A;  5F11 A;  3RU3 A;  3H74 A;  3RQH A;  1LIO A;  4E8W A;  3RSS A;  3HYO A;  3UBO A;  1RKS A;  3BGK A;  3FHY A;  4E3A A;  3RQ5 A;  4E8Y A;  3JUL A;  1TZ6 A;  4XF7 A;  4E8Z A;  1V1S A;  2AX3 A;  1GQT A;  4S1I A;  3RSQ A;  4B8S A;  5BYD A;  3NC9 A;  2C4E A;  1VM7 A;  4U7X A;  1EKQ A;  3RQ6 A;  3RQX A;  3RS8 A;  3NL6 A;  1YHJ A;  3RTB A;  1YGJ A;  3KD6 A;  1RK2 A;  4UBE A;  2FV7 A;  4LCA A;  5COJ A;  1ESQ A;  2AJP A;  3RT9 A;  3NL3 A;  3B1N A;  4XDA A;  3KEU A;  4C5J A;  3NL2 A;  4K9I A;  4K8T A;  4PVV A;  4XCK A;  3RQ2 A;  3QA2 A;  5CGE A;  1V1B A;  2YXT A;  3QAI A;  1TZ3 A;  4S1M A;  4KAN A;  2PKF A;  3RM5 A;  2R3B A;  3DRW A;  5C40 A;  3K9E A;  5TQI A;  3B1Q A;  1UB0 A;  4DC3 A;  5C3Z A;  1RFV A;  3NL5 A;  3IKH A;  3NCA A;  5TRW A;  5EYN A;  1TYY A;  4C5K A;  4EOH A;  1LII A;  1ESJ A;  3UQ9 A;  3UMO A;  3RRE A;  2QCV A;  3HJ6 A;  3MBJ A;  3RTG A;  1KYH A;  1V19 A;  2I6A A;  3IQ0 A;  5BYC A;  5C41 A;  2V78 A;  3UQD A;  3NC2 A;  4KAH A;  2F7K A;  3Q92 A;  2VAR A;  4K8P A;  3UQE A;  5CGA A;  3GO6 A;  4C5N A;  1U2X A;  3MBH A;  1RKA A;  2RBC A;  3IBQ A;  3RSF A;  1V1A A;  3VAQ A;  2YXU A;  2JG5 A;  2XTB A;  3W4S A;  1LHR A;  3LOO A;  4K8K A;  4EBU A;  4E69 A;  2PKK A;  3GO7 A;  3RS9 A;  1BX4 A;  3LJS A;  5EY7 A;  1YGK A;  2R3E A;  4K93 A;  3ZS7 A;  1JXI A;  4N09 A;  4YL5 A;  3B1R A;  3HIC A;  5BYF A;  4N08 A;  4KAD A;  1RKD A;  4JJP A;  4KBE A;  2HW1 A;  4WJM A;  4K9C A;  5C3Y A;  3N1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...