The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
36
|
sequence length |
170
|
structure length |
170
|
Chain Sequence |
SINNVNLADGNYVVNRGDGWILSRQNQNLGGNISNNGCTAIVGDLRIRETATPYYYPTASFNEEYIKNNVQNVFANFTEASEIPIGFEFSKTAPSNKSLYMYLQYTYIRYEIIKVLQNTVTERAVLYVPSLGYVKSIEFNSEEQIDKNFYFTSQDKCILNEKFIYKKIDD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Carbohydrate recognition mechanism of HA70 from Clostridium botulinum deduced from X-ray structures in complexes with sialylated oligosaccharides
pubmed doi rcsb |
| molecule keywords |
Hemagglutinin components HA-22/23/53
|
| molecule tags |
Sugar binding protein
|
| source organism |
Clostridium botulinum
|
| total genus |
36
|
| structure length |
170
|
| sequence length |
170
|
| ec nomenclature | |
| pdb deposition date | 2012-04-12 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | hemolytic lectin cel-iii, domain 3 | hemolytic lectin cel-iii, domain 3 |
#chains in the Genus database with same CATH superfamily 4LO6 A; 4LO6 B; 4LO4 B; 4LO4 A; 4LO5 A; 4EN6 A; 4EN6 B; 4EN9 B; 4LO5 B; 4EN9 A; 4P5H A; 2XH6 A; 2ZS6 B; 2ZS6 A; 3WIN E; 3WIN D; 4EN8 B; 4EN8 A; 4EN7 A; 4EN7 B; 2ZOE A; 2ZOE B; 3AM2 A; 3ZIX A; 3ZIW A; 2YHJ A; #chains in the Genus database with same CATH topology 4LO6 A; 4LO6 B; 4LO4 B; 4LO4 A; 4LO5 A; 4EN6 A; 4EN6 B; 4EN9 B; 4LO5 B; 4EN9 A; 4P5H A; 2XH6 A; 2ZS6 B; 2ZS6 A; 3WIN E; 3WIN D; 4EN8 B; 4EN8 A; 4EN7 A; 1VCL A; 4EN7 B; 2ZOE A; 3W9T A; 2ZOE B; 2Z49 A; 3AM2 A; 3ZIX A; 3ZIW A; 2YHJ A; 2Z48 A; #chains in the Genus database with same CATH homology 4LO6 A; 4LO6 B; 4LO4 B; 4LO4 A; 4LO5 A; 4EN6 A; 4EN6 B; 4EN9 B; 4LO5 B; 4EN9 A; 4P5H A; 2XH6 A; 2ZS6 B; 2ZS6 A; 3WIN E; 3WIN D; 4EN8 B; 4EN8 A; 4EN7 A; 4EN7 B; 2ZOE A; 2ZOE B; 3AM2 A; 3ZIX A; 3ZIW A; 2YHJ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...