4ENOA

Crystal structure of oxidized human nm23-h1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
151
structure length
151
Chain Sequence
MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase A
publication title Structure of Nm23-H1 under oxidative conditions
doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 47
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4enoA00
3FBCA 4O0NA 3G2XA 1BE4A 2HURA 3VGSA 3EICA 3NGRA 1K44A 2AZ1A 3B6BA 1NUEA 3BBBA 1NSPA 4S0MA 3ZTOA 4ANCA 1W7WA 4DUTA 3ZTSA 1XQIA 1NDPA 1NSQA 3EMTA 2DY9A 5CAAA 1HHQA 5CABA 3NGSA 3VGTA 2B8QA 4F36A 4F4AA 1S59A 3Q8VA 3Q8YA 3VGUA 3ZTPA 3ZTQA 2DXDA 2HVDA 1S57A 3FKBA 2HVEA 3FC9A 4UOHA 4FKYA 1NDCA 2DYAA 3B54A 3EVWA 3Q86A 3FCVA 3FBBA 1U8WA 1B99A 1NHKL 1NDKA 3PJ9A 3GPAA 5IOLA 3JS9A 3EVMA 3Q83A 3VVTA 4UOGA 1LWXA 1NB2A 3BH6B 4KPCA 1PKUA 4C6AA 1NLKL 3EM1A 1WKJA 1BHNA 2BX6A 4W98A 3ELHA 3R9LA 2B8PA 2DXFA 1EHWA 2DXEA 4FKXA 5C7PA 3ETMA 3EVOA 3FBFA 1F3FA 1MN9A 4WBFA 1ZS6A 4EK2A 1NCLA 3BBFA 3FCWA 1LEOA 2ZUAA 1NDLA 4HR2A 1F6TA 3DDIA 3VVUA 2AZ3A 3BBCA 1WKKA 4DI6A 3FBEA 2CWKA 3WX8A 3EE3A 1XIQA 1PAEX 3PRVA 3Q8UA 3MPDA 3DKDA 3NGUA 2NCKL 3NGTA 4UOFA 3ENAA 1HIYA 1HLWA 1NSKL 1NPKA 3L7UA 3EJMA 1VYAA 3Q89A 4CP5A 4ANDA 5BXIA 1UCNA 3BH7B 3VGVA 1KDNA 1B4SA 4ENOA 2BEFA 1S5ZA 1JXVA 1WKLA 2VU5A 4DZ6A 3ZTRA 3GP9A 1MN7A 4ANEA 1BUXA
chains in the Genus database with same CATH superfamily
1LW2A 2F9JA 2RT3A 4OZNA 1K44A 2CQBA 4RW7A 4Q2MA 3F73A 1KQFB 1DFDA 5F8LA 1OSCA 1SJFA 3CC7S 4LF4J 2Y9HA 5AXLA 1S1XA 4ILLA 4QYZJ 2RNEA 2VPZB 4DSJA 4EO8A 1VRTB 1U8WA 3D6FB 4WFNQ 4EZ9A 1WC0A 1U1KA 1XEZA 4URQU 3AA8A 4IRDA 4LQ3A 1MW7A 5CHCB 2OSQA 2DR7A 1VQ8S 2FVSA 1GX5A 4WKYA 4KH0B 3ZZTA 3HT0A 3MEDA 4DR3J 5LMUJ 1T95A 4PG7A 1YVFA 4ER8A 1QAXA 1T3NA 2PFFB 2K7KA 1VC6A 3OVSA 2KHCA 4OYMA 3QSIA 5HVFA 3I55S 4DV0J 3THVA 1S6QB 3O44A 5HMYA 1UVLA 4DL4A 1NJZA 2RHSB 2OLWA 2B51A 1EQ0A 3GIIA 5RUBA 3GIMA 3R5CA 5KT7A 4I68A 1KHWA 3U02A 2BOAA 2A1BA 2OJ3A 4LSLA 4DR1F 5DM7Q 4DCPB 4DXLA 2YKMA 1UEVA 2NPIA 3OJUA 2P8IA 1NMEB 4Q7AA 3NEKA 4GMKA 2YBVA 3HD1A 2RILA 2ZHOA 2VV5A 3K7RA 1DAXA 5KFLA 1N54B 2QYCA 5KFDA 3VAMA 4L76A 3CO0P 4FF4A 1C4CA 3M30B 1FXRA 2G2OA 1S1VA 2H5EA 1LWXA 3J80U 3W60A 4ZK7M 3CCLS 1N5QA 1N33J 4IRKA 1C0TA 3BYRA 5IT9U 2HLUA 4QW9A 1HW8A 2VDHA 5EHHA 1IQTA 4AQYF 2RQMA 1O51A 2DIVA 1AFIA 1PAEX 2L9NA 4IQMA 1WACA 2BXJA 3M8PA 2HWTA 3CDWA 4BS2A 4NLGA 5F8HA 1JJCB 2UU9F 2PDAA 3D3BJ 1S1UB 2Z2MA 4K4UA 4MK9A 3OR1A 2W7AA 2VKRA 4M95A 3I9ZA 1C2PA 2CQIA 4LFBF 2XS7A 3QFWA 4LR7A 4X4TA 3GFHA 3M8SA 1ZM4A 3M2UB 4LVNP 2BANB 4KFBB 3T9ZA 1CPZA 4MAKA 1VISA 5DZ7A 3ENVA 2NXCA 1J5EJ 4CLUA 2A6OA 3G87A 1TL3A 2HZAA 1C1CB 4YR0A 3V6KA 2FLPA 3ILLA 3UO0A 2UVVA 5HI7A 2F4VJ 4CTAA 4ATNA 3M32B 1RU1A 4YUDA 4P6QA 5KFCA 1GTEA 3RW7A 1NSAA 4E0DA 1SKRA 5G4DA 1U6BA 3HVWA 2ZD1B 1YZ7A 2ALZA 3TAMA 1LXJA 2HQIA 3E2EA 4IUFA 4ZKAA 1IKWA 2GW8A 1HBOB 2WBMA 3H7HB 1I1GA 3JSBA 4J5OA 4G1QA 3Q8PB 3GV5B 5J1EA 3OUYB 1PYSB 4V1Ak 2YKQA 2Y1IA 3IG1B 1FVQA 3OL9A 1XQIA 4WK3A 3D54A 1HQ2A 4NCGB 3QGIA 4OYXA 1JXEA 3DRPA 2XLKA 1FRLA 2J6TA 4HL9A 3HLUA 4LF4F 2OAUA 1OQ3A 2KM8B 2E1CA 1SBRA 3R7SB 4DX5A 5KFQA 1U0SA 4QW8A 3L7PA 1K0TA 2VZ9A 2DKOB 4I7FB 3R2CJ 3BR8A 1WF0A 4YHHF 2C2EA 2BUNA 1OWXA 1WF2A 5IOLA 4LFCF 3G6XA 3L4BC 1UEUA 2ERRA 5HK4A 3DRRB 1TUVA 1YBAA 3I96A 3CT9A 2VKZG 4RW8B 5LMUF 3A4TA 5K8PA 2ZE2B 3V4IB 4WK1A 1BQMB 2BBEA 2CRLA 4WFYA 1LW0B 2OH2A 2DD8S 5KFHA 3QYYA 4OI1A 4CH7A 5HQLA 3BPDA 1AW0A 2ROPA 1C0UB 2HHHF 3VGSA 5H1SV 2OPSA 3J7YU 5JMNA 3MMAA 3PVXA 3ZZYA 4L6V3 4QJVA 1VQSA 5DDQC 1NHKL 3DRXA 4MYTA 2DNOA 3UDLA 8AT1B 3T1HF 4L74A 2MZRA 1N33F 4F02A 4IH7A 5HQMA 1F6TA 2ZZMA 1WNEA 1S1WB 7AT1B 3HF5A 4DR6J 3BR9A 1VDHA 4CM2A 1OMSA 4I6YA 1IN0A 4DV1J 1QY7A 4ICLB 4ZJOA 1KONA 2VODA 4NLOA 5KFSA 4RBUA 4ZHRB 3TA0A 4O44A 3QAUA 4DSLA 3EICA 5SUHA 3J81Y 5KFNA 1B0PA 3R5BA 3H98A 2H65B 3DMJB 1HKAA 3SYZA 3SQGA 3FEYB 4HDHA 4I1TA 3IXQA 2HMIB 4DS5A 2HFNA 4QIWD 5I42A 3MM6B 1VQNS 2V94A 2IM3A 2DT9A 4LF9F 3DDNA 5K14B 2FJXA 2JEIA 2PGCA 2DNMA 1Q86T 3OD2A 3M9NB 4RW9A 4TU9A 3FEXB 4OMFG 4NYZA 1HA1A 1TKZB 3VWSA 2EFQA 2XMMA 1NJYA 1O8BA 1RI7A 3R5DA 1N52B 4OV6A 4RNOA 4O4GA 1RTHA 2W1BA 2QFIA 4UQTA 3WX4A 2VDIA 4JP8A 1GFWB 1YJWS 2NXEA 1FKOB 3TUPA 5KT6A 1YWXA 2DGQA 1PILA 2BV3A 3SDEA 1IJEB 2AJQA 4WFZA 4CO5A 4X4SA 2R8KA 5DJBA 1B3TA 3TEGA 2LDIA 3IGNA 1SH3A 4M5NA 2JC1A 1GEHA 4UTGA 5C42B 4DSIA 6AT1B 2DXDA 4DFMA 2WBRA 1V5VA 2FJBB 4NI2A 2AGPA 3JXOA 2HFUA 3DI6B 1BQNA 1T03A 2JVOA 4R5PB 2M8DB 2YKNB 3IR5B 2VA2A 2CNNB 4GC7A 4BDPA 3BBFA 1R43A 1ZA1B 3JQKA 3U27A 2XCAA 2HYIB 2H5JB 3L3CA 4KIAA 4OZLA 3PO5A 1KP6A 1R31A 4OZ0A 2W2QP 1APSA 1CJKB 2VG5A 3A3PB 2POKA 2C3PA 2WVBA 1QVGR 3SCLE 1R3NA 2C28A 2ZNZA 2C3UA 4EWTA 5HMXA 2J9EA 1BMQB 1TK5A 2GCFA 3DGPB 4PRFA 3R5AA 4P10A 5H9FJ 3HFZB 3I6PA 2R2UA 2Z2YB 4PWWA 4K2JA 5CABA 2FC9A 1NKCA 2XG8A 2M2BA 3ZTQA 4AXIA 3DU6A 3CIMA 3UE2A 3MECB 1U1NA 3HSGA 4B3OA 4YY3F 2A2CA 1SC3B 2R7WA 4OX8A 3MMCA 2AYBA 1RWKB 4LJMA 4O3OA 3RAXA 3EM1A 4ED7A 2KZZA 4DF8A 2ATLA 4B9UA 3FMWA 2M3DA 5LMNF 2IYIA 4M5JA 1Q8IA 1T7PA 3H4DA 3K8WA 2L9WA 4DR6F 4OX9J 2PFDA 4OHZA 3RZAA 1FJGJ 2MLYA 3W64A 3PACA 2EWHA 1N48A 4EGLA 4C7QA 1FDDA 2E5HA 4H4MB 1KLMA 2VC1A 2GC8A 3TANA 3QWUA 2QEXS 5C24B 3TUJC 2R8HA 1GMVA 3RU0A 2VG6A 3DXBA 4LR9A 2P6TA 4A8YA 1DLOA 2DNZA 3OJSA 5KFPA 1ZM3A 2MGZB 2CWXA 4ID5A 4WU3A 3K5NA 3G8TA 3PHTA 1X9SA 1RWVB 3H5XA 1YJVA 2Y1RI 2E1AA 1R6VA 5C2GA 3CDEA 4JV0A 3QRRA 2AEFA 2CPJA 3AD9C 3EX7B 3PRDA 2VL1A 4KPCA 2NSBA 4M1KA 2IIHA 1W26A 1GXUA 4RW6A 3PTWA 4J9OA 2E5JA 2GV1A 5JVHQ 1REVA 4LRFA 2CPIA 4JV2A 2JC0A 4YDDB 1SIZA 3I31A 2HK2A 4ETZA 2XSFA 3P6YC 2YX1A 3TVKA 2ZH3A 3HHLA 3TRGA 3HKWA 5F9NA 2OD6A 3N6MA 1N4LA 3L7UA 2N3OA 4CP5A 3H59A 2PA8D 3BH7B 2QZ8A 2K1RB 4ZN1A 4K5RA 1KEKA 3RR8A 4F0KA 3P96A 4AFFA 5DO2A 4ELUA 3KDOA 2R2RA 1S9EB 3BGFA 4V19J 2RVJA 1KBRA 4P2FA 4FBUA 3HVTB 3POTA 4DU7A 3IRXB 1XR5A 5KFWA 4OJGA 4J37A 1NU4A 2W01A 3FKBA 3HFKA 2KG1A 4AL6A 4FNIA 1XJWB 2IRUA 3QSYB 3OTCA 5LXYA 3UW1A 5KT4A 1SJQA 1HNXF 1RT4A 1AYEA 1Y9OA 3D0HE 1D9DA 4AUKA 4DS4A 2YX7A 1RZMA 4NMLA 1JWWA 2MXYA 2B4UA 1DRZA 4IDKB 1N5VA 3QJPA 3CDAA 1UEKA 4LF5J 2RU9A 3MR3A 2OD4A 3VF0B 3GWCA 4R25A 4NLUA 3LTOA 5E3RA 1BXNA 2QG9B 2X7IA 4QBUA 1MLAA 4N5SA 4ZCMA 4FPIA 2PC6A 4C48A 2RD5C 5ETNA 2E5GA 3TO8A 3A8EA 1FCAA 4MKYA 2CPZA 3ILOA 5LJ5Y 3KLVA 4LF6J 4IG0B 3RW6A 5GAGI 2YPYA 4USTA 2XGQA 1H3DA 1JIHA 4ANCA 3IN5A 1W7WA 2KT3A 1SL0A 1GAOA 5J2MB 3JYTB 4EMDA 2ROGA 1VQPS 3U7JA 3RRKA 3DLBA 2XNQA 2E7XA 1Y00A 2BJ7A 1R8CA 2YVSA 1T05B 1WD6A 2BW7A 3H5YA 2BJ9A 3EVMA 3DC2A 1S9FA 3KLFB 1C1BB 2ZOGA 4J7CA 1K1SA 2F40A 2UXBJ 2DO0A 3ETMA 2VICA 4P2SA 1D1UA 1NDLA 4DPWA 4RUHA 3BBCA 1UJ6A 2C2RA 1HMVB 3CB4A 1RAJA 4TYBA 3Q8UA 1A6LA 2ACYA 3TARA 4MJKA 1RABB 2D1CA 2JDJA 3KJNB 2XMVA 4USJC 3N5BA 2MB0B 1FJGF 5C25B 2WOMB 5BXIA 5BR8J 4I2QB 2DHSA 5HP1A 5HMZA 4N47A 2MSSA 1ZZFA 4P74A 4N8NA 2DCLA 4DPUA 2RUGA 1NH8A 5LXRA 4AE5A 3BO2A 3OR2B 3M2RA 1VQOS 2CJAA 2MY7A 3MCMA 3KUGA 3V81A 3WHIA 2AJ1A 4ZLLA 4OZJA 2Z4PA 1T9TA 3CJKA 5L46A 1VRUA 1VJWA 2W2MP 5GMKa 2YNFA 1IKYB 4KE5A 2W7OA 4WIQA 1IKXB 3H2UB 4N76A 2CG4A 1R8BA 2KU7A 2VA3A 1S0NA 5BJRA 2F63A 3PW7A 1TK8A 3R1HA 3H2LA 1MN9A 4I4BA 3JSYA 5A8WB 5CXTA 4J90A 1K73T 3AY0A 2I0XA 2XYHB 3G86A 4ZVFA 2YPZA 1FKPA 4DU8A 1VBZA 1L3SA 1NJXA 4ZPVR 5JUMA 4WU2A 1HHTP 1HWUA 2GO9A 2HHSA 1GT8A 3LALA 1TU0B 2DVIA 1IM6A 1SUQA 4ED2A 3G96A 4GKKJ 3A13A 4ZP7A 1YJRA 4J9SA 3G8QA 3BQ1A 4G65A 4WIIA 4YQWA 1K0VA 3UDCA 4WZQA 3BS9A 2ZH6A 3QO9B 5HVHA 1KSPA 2FJAB 5FDLB 1CJVB 5KFOA 4P7TA 3NXZA 2IBOA 4NOHA 4DUZJ 4DV7F 2W9CA 1JJHA 3ISZA 1FI4A 4DV6J 3RAQA 3MEGA 3ONQA 4M5KA 1F3FA 3NCQA 2AWZA 5DETA 3QGGA 4HLBA 1HBUB 2WRMA 3KLHB 3FJ2A 5GADU 1WI6A 2OGUA 2OEJA 3GIRA 3SFGA 3M8QA 3MF5A 4WXOA 4QYRA 3KNAA 3NBPB 2MZ1A 2ZUGA 4QIEA 5T41A 2QT7A 1DQ8A 1M5SA 3IM8A 1QSYA 3G6VA 3FFIB 2VC0A 3VAGA 5KFJA 4PQUA 4LF8J 4DL0C 4LF6F 1NK6A 3ITHA 4TYAA 1RTDA 2ZBIA 4RU2A 3PO4A 3KHRA 1B7FA 2HQ3A 2P5VA 3SZ2A 3WIVA 3H8YA 1SKWA 1X31C 2O67A 2ZNYA 4CO2A 2FLLA 3R7NB 5THWA 4UOHA 3CC4S 2O3DA 2YWHA 4I0WA 4QU6A 3MM5A 1AT1B 1J2VA 1DTTB 5L39A 1S7IA 3MTKA 4LBHA 1U0HA 2DO4A 4QOTA 2FYXA 1RKIA 1MWQA 5IT4A 5IQ6A 3PFOA 2CWKA 1CJTA 2W9BA 3BJYA 2E1MC 4KV8B 3D1OA 2UVRA 3OL8A 1VYAA 1EP4A 2CQGA 2XY6A 2H4YB 3W9IA 3N28A 3Q22A 2KXNB 1QAJA 2B56A 3K5OA 1N36F 1SJ3P 3WC2A 2MQQA 4MYUA 2XI3A 1BE4A 3LUYA 5GAGU 2WVEA 3W7BA 1RWXB 2O01C 3P49B 4YB5A 1HYSA 3UVJA 4YOEA 4H4KC 1VQYA 2XLJA 1HHQA 4XO0A 2MZSA 3ZNUA 2UXCJ 2ZWPA 1N0VC 2HIQA 2YWKA 2BOPA 5AJ3J 5HL7Q 2ZKTA 3JAMY 5F8GA 3QJLA 4OZ3A 3LP0B 2WONB 3UDEA 4P75A 3Q83A 1J5OA 1TUWA 4ZVPB 3CCES 1HQEB 2LXIA 1N5TA 4USMA 2R8JA 1I6JA 2QLJB 1PC5A 1ZH5A 4ES1A 1MROA 2Y0SD 3L95X 1G3OA 2MZTA 2EFGA 4CDIA 3D5MA 2VUGA 3BZQA 2V6AA 1AB8A 2IMOA 3CJSA 4F67A 1UWBA 2M0GB 3KK3B 1RADB 1VLYA 4B3RF 2RSQA 1Y10A 4FZVA 1SVDA 3HT3A 2NQPA 4NMXA 2KVIA 2BJ3A 1S1XB 1KVIA 3GFXA 4MK7A 1LXNA 1X4DA 4GKKF 1PCAA 1L3UA 2R7OA 1O0PA 3EMTA 3TW0A 4LF7J 1G4CA 3IBWA 1URNA 2LDYA 4DX8H 2EG1A 3NLCA 3EGZA 3Q86A 3B82A 1HPZA 4USKA 2HGMA 4L3NA 2I5JB 3VZIA 1QAIA 1PKUA 1JKHA 5T14A 1BGXT 1T9XA 3K57A 4DUZF 2LYVA 4FN5A 4BHQA 1NXIA 2DNNA 4DV3J 4CI0B 3X1LB 1OQ6A 3Q23A 2CVEA 1ZPWX 4DHVA 1ZOTA 2P9CA 3O5TB 4DLEA 2DHHA 1WC5A 1QLNA 4ZP9A 1HNVA 1GX6A 1S1TA 2OPQA 4X62F 4B9VA 2V69A 1FEEA 4NA3A 3MCSA 2KH9A 2KT5A 2CPYA 3PFEA 1Q53A 3AHPA 2GJ2A 1NRKA 1CLFA 3C6UA 1A0OB 2SXLA 2Y3YA 4Z7YA 1QTMA 1ZAXA 2FGOA 1Q8BA 3QLHB 2HNYA 2IM1A 4F7VA 3PR5B 4DJBA 2MKHA 1LKZA 1G2EA 1FJEB 1U1LA 2AF6A 4RW4A 4JOUA 4LUBA 2AU0A 2HNDB 4OV1A 1YJNS 2XMWA 4FXWA 4IQXA 5H9EJ 4P2XA 2IM0A 1H2VZ 1U24A 1FWLA 3H5SA 4PYDA 3I56S 2GHPA 4K59A 4NYOA 2KG0A 3LQVA 4MH8A 1SI9A 3W2WB 3BKUA 3A3NB 4KSEB 3MUVP 4ELTA 5MAOA 2OPRB 2JEJA 3UFCX 3C15A 1LFPA 4IFYB 2BYCA 1JLBA 1FFSB 3QFHA 3AA9A 2HQDA 3KKFA 2LU2A 4ZLNA 5ETPA 1E6VB 5HJXA 3PW4A 1WC1A 3T41A 1TAQA 3Q24A 1OYDA 1RQ0A 4NPOA 4ZPTR 2N82B 4ETXA 1RHQB 3W65A 3TQ1A 3CUNA 5AJ3F 5HANA 3MFHA 3B54A 2J7UA 3RRHA 4HHUA 3PKYA 1X7VA 1LWFB 3W66A 1YRUA 1UWAA 3EGNA 1RTZA 1N32F 4KGVB 4DQIA 3SEOA 3LPEA 1CC7A 1VK8A 2BM1A 5K20B 3SV3A 1WHXA 1T3OA 2HS3A 2MKJA 1S79A 3DYAA 2GGPA 2K06A 4DCOB 3T5JA 2AGQA 4NZ7A 2QTWA 4XK8C 2JX2A 4DFJA 4YS2A 1K47A 1MN7A 5D0RA 2B7BB 4AYBD 2FY1A 3TOQA 2MQ8A 5B08A 2B9YA 5DQGA 4ZDNA 3TZXA 1NDPA 4IFVB 1CQNA 3EPGA 4LF7F 4I6WA 4F3MA 3CNQP 3DNCA 3MM9A 4JI8J 3ICLA 2HFOA 2G1HA 1JJ4A 1S57A 5DM6Q 3HULA 1YDLA 4L73A 4OJHA 2XHWA 2F5GA 1S9GB 1TL1A 4B3SJ 1NZ8A 2YWEA 4NLYA 4AXJA 2RRAA 4MKVA 1VC0A 3IS9B 4I69A 4OX7A 4C6AA 3C8YA 3I5BA 2DRDA 1Q8LA 1EHWA 1X4CA 2VG7B 4OZ2A 3EZOA 4RUAA 2XWXA 2Z58B 3IBFB 3W62A 1SJRA 3OT9A 4IO1A 4DSEA 1WEXA 2CPHA 1JNZB 3T5LA 2HVZA 4QWAA 2GMHA 3DOKB 1SJ4P 2VQEJ 1HBMA 1N88A 2DPJA 2G0JA 5ETRA 2OPSB 1UJ4A 5E3PA 1SQEA 3P8BB 1Q7YT 2XGPA 1Y5IB 3KXDA 1RT5A 3SCJE 1VHIA 3KLIA 2CVIA 2EG2A 2QL5B 5HLFB 5KG2A 2CNLB 4QR2A 1JLQA 2G2YA 1M1HA 3OHAA 4OX6A 4Q0BB 1FNOA 1JLCB 4PG8A 1SC6A 2QL7B 2UUAJ 2ZM6J 4DN9A 3OTEA 4LBPA 3TX8A 4EO6A 3PIPQ 3HK2A 4F36A 3W2VA 1T9WA 4LSZB 1YI2S 2KRBA 2R7RA 2J9DA 4Q5VA 3SQOP 4UZCA 4W92B 1I94J 1XMQJ 1X9WA 3PW2A 4JI2F 4TY8B 3TJAA 4EZ6A 1ZA2B 3IFEA 2B9WA 3KHGA 3T5HA 2NS1B 1T8EA 1RBLA 1FJ7A 1FRXA 4ZN3A 1VLOA 1FVSA 1FF2A 4F0MA 3OL7A 2ZH1A 3PR4A 4DR4J 3FBEA 1YKWA 3RG6A 2IM2A 4QWEA 4IH6A 4J9LA 1R0AA 1UFLA 2MMYA 4ALZA 5M2RA 4PXBA 1N6QA 3HHKA 4FF3A 1U1QA 4IRCA 2AJFE 4LIRA 5D0GA 2I2YA 5HSPA 4L3KA 5ADZA 4TQRA 2N3LA 3MEKA 1HWIA 4DQPA 2UUWA 1PSDA 1NKEA 2DH8A 3K5LA 2QV6A 4B17A 5CYQA 3TJ8A 1HNZF 3EXCX 3V6HA 2J6SA 2NYIA 2C3MA 2LP4A 2D9PA 2JL9A 2VBYA 1LFWA 5B0FA 4URGA 4MIWA 4DQRA 1HW9A 1OO0B 2BM0A 2R7QA 2XY7A 1WKJA 2UZAA 1WC3A 4JBCA 4WXWA 1IKVA 1TV6A 2PI4A 1FDNA 2DNHA 3CDUA 2ZBQA 3KLEB 6FDRA 1MWZA 2C3YA 3DKDA 4D3HA 1TUGB 3CCTA 1X0PA 3SDEB 4JI4J 5KG6A 2XSJA 5I3QA 2GVZB 3AOBA 3PJWA 4DDFA 3DLGA 4BWMA 4QIVA 2R8IA 2BQ3A 2MHNA 2GO8A 2CAJA 2A0FB 3DN9A 4F04B 2V67A 1D09B 3DM2B 3V6DA 2JLEA 1F5BA 4JI5F 4NI2B 1YTYA 3ZFVA 4NLWA 3CVKA 3F44A 1VS3A 3I0SA 4E2FB 1SH2A 4ECWA 3C14A 2MDAA 4KHPJ 3WQPA 2XMKA 4B3SF 3I0RA 5DQHA 1KQSR 2R7SA 3HCXA 3UDVA 2GHWA 1SJ1A 3E3XA 4IR9A 4KKOA 1ZYQA 1JLEA 4DZDA 3NG8A 2HHVA 2JLFA 3OTDA 2FLNA 1U2RA 1TKDA 1KFSA 2DGWA 2PMWA 3KLGB 4PR6A 1RWNB 2R7VA 2W4DA 2ZHBA 3PZPA 3VGVA 1TKXB 3QJJA 4ENOA 1Z2ZA 4WE1B 2WVDA 2RS2A 4KO0B 2M52A 1JLFA 2OTJS 4M5MA 2ZZTA 2XCPA 4FXDA 1X8DA 3FQLA 4NLDA 3J7ZT 2W2PP 4B02A 3C16B 4ED1A 2F8HA 3MR7A 2ASYA 2UUAF 2L9DA 5D4OA 2ZM6F 4OYOA 1LWCB 4FS2A 4WZMA 1R8AA 4KGMA 5AE1A 2RKIA 3PW5A 4N77A 2EEYA 1I94F 2V68A 1HNIA 2ZZNA 1GTHA 5I3UA 2RF2B 1S6OA 4C0BA 4P7VA 4PWUA 4NA2A 2FJDB 1NPPA 2HHQA 3AB4B 4F4YA 3T1YJ 3OLAA 2L08A 1DBDA 2NZ4A 3HSZA 5DDOC 4LMZA 1VQMS 1V9OA 4MMOA 2YNIB 1KOHA 2R7UA 4O3SA 2UUCJ 3UN3A 3MPVA 1GH8A 4MKAA 3DLHA 3W8PA 2B0GA 2FB0A 3VZHA 2AKWB 2Y0BB 1UL3A 2FHMA 3M2VB 1Y3JA 5E0OA 4DL5A 4J9NA 4OQJA 2R7TA 1P1LA 1QAYA 2VFRA 2YX4A 3NRBA 4ZVSB 3NGSA 3BYPA 2CQHA 1U8SA 2WW4A 2DPIA 2R9LA 1QDUB 2KO1A 4CO4A 1NDCA 1GXLA 1S6QA 5EN1A 1GNKA 3HPOA 3CIZA 1LOUA 4Z7CA 1F2HA 1PJ7A 2L48A 2FVPA 1VQKS 2M9KA 4NRTA 3BB5A 4C3MA 2CJYB 3U1MA 4DV5J 3OXLA 2JSXA 5A8KA 3RB0A 1Y3KA 2CQCA 4ZP8A 1PAUB 1WI8A 3WX8A 4K4WA 3MCNA 2ZH7A 2CIMA 3ISND 4UOFA 1Y0HA 3M30A 4CLYA 2HWIA 3EZUA 3VV2B 3QZ7A 2GHVC 1GMUA 4WP3A 1T0TV 1SV5B 5HQ8A 3R5JB 2VQFF 4UY8T 5KG5A 1H6KX 4MTPA 2HFZA 3HHLD 2PIIA 3O6QA 4JV5J 1M5KC 5JVGQ 3F41A 4K8RA 1RT4B 4HT7A 3D1HA 1VBYA 5F3TA 4CLWA 5L9NA 2E9ZA 2EBEA 3ZZPA 1S1UA 2ILZA 2QA2A 5CQGA 3CE8A 1HQUA 1IM4A 5KFBA 1FFGB 4HH0A 2O1PA 4K5SA 1UVJA 1NK9A 2ZBPA 3EVOA 1RK8A 1LEOA 5LSLA 2HQGA 1VCTA 5CYMB 2RHQB 3NAHA 5K9FA 2LQJA 2BANA 4KFBA 2B6AB 5K8MA 4DR1J 1NSKL 2HRTA 1CS4B 4QPXA 2ZH4A 2IJFA 1C1CA 3M1VB 3BGUA 1U48A 3V6JA 5D0EA 4ECTA 2F8MA 4ZCKA 2AP6A 3CMQA 5M2UA 5KG1A 2GQ2A 5AXNA 3NMAA 4P52A 4WWSA 2XI2A 4CQ1A 3BSCA 3OLBA 2LMIA 3M32A 4S0MA 5J1PA 4WTYA 1QUVA 2AYEA 2J0SD 2ZD1A 2WZ1A 2RH3A 1NK5A 2B3TB 1N34F 1HBOA 2UV8A 5HROA 4DQQA 1D0EA 2C22A 3IRWP 1VQ7S 1FJCA 4OYPA 3ILIA 2HEKA 3UNYA 3OBIA 2DGXA 4X4RA 1NB7A 4NXMF 5KFEA 4OLPA 3GIKA 4FBTA 3IG1A 2UU9J 1IBMF 4YN3B 4IH5A 4R8UB 4NCGA 3CF5Q 4RKUC 3D7SB 2G0IA 3BDEA 2AIRB 1RUSA 1AXQA 1X4BA 4WP8A 2UUCF 3ETOA 1IBLF 4IOAQ 4I7FA 2IAJB 5D6GA 3Q89A 1TK0A 2ZVSA 1PC4A 1I5OB 3EZ5A 2COLA 3FGVA 3AQPA 2CYYA 4C0OC 2N4CA 2BKNA 4I56A 1RAEB 3PNIA 5FIIA 1H74A 2B7CB 2Y1LB 3CJ8A 3M6WA 2YNFB 3V4IA 3GYXB 1BQMA 2DY9A 4EEYA 4KC5A 1LW0A 3MM7A 2IDLA 4FKYA 3QNWB 1N5YB 3ET6B 5B7WA 4OI3A 1MG7A 4F50A 1YZ6A 1C0UA 2ALYB 2FGCA 2NUUG 4DV5F 1FKPB 4ZCLA 2E7WA 4XDDA 2NLWA 3B4MA 5L1LA 4X65F 3H90A 3NCRA 3BSNA 1CULB 4ILRA 4YB7A 1E6YB 3O1LA 3J7YI 2DJWA 5FJ4A 1SUQB 1LWEB 4Y2AA 1RTJA 5I3PA 5EWGA 5J1NA 2D7SA 1CSJA 4QWDA 3QGPA 4MT1A 3LANA 2AW0A 4KTQA 2AJ0A 3AXKA 4KGKA 4YHHJ 3H25A 4C8NA 1S0OA 2AT1B 4LFCJ 1HNWJ 5BYRA 4UW2A 4JV5F 1S1WA 3E51A 3CCMS 3R27A 1Q79A 1QD1A 4NEZA 1L3KA 4X2BA 2M7SA 4ICLA 2F8EX 3GFYA 3MEGB 2Q6BA 3ZO7A 1VC5A 4HDGA 4GVBB 4ZHRA 3Q8RB 3BSOA 1NM2A 3AAWB 1I51B 3UCUP 3M8QB 3TX0A 5BYQA 2FQQB 3LP1B 2R3VA 4CH1A 2R42A 2AZ3A 2YKAA 5FD1A 3F0NA 2HHHJ 2HMIA 5E5NA 3JSMB 3KWMA 3MPDA 3H40A 4YB1P 4U7UD 4U96A 3LAMA 2CQ0A 1P9QC 1NPKA 1KD1T 3ITHB 2D3O1 1M5HA 1RTDB 1RT7B 4EU0A 4W90B 3HD2A 5K14A 1RDRA 4OI6A 2OI2A 2HSEB 1Y7PA 5B0AA 2KN4A 4Y3CA 1VQ5S 3DRSB 1F0XA 2E5LF 4ID8A 3KJFB 1QM9A 1B0TA 1LK5A 1URRA 1TKZA 4PYAA 1ELOA 4FVMA 1EAYC 3T1HJ 1NPRA 5EX0A 1VHFA 3MM8B 5GMDA 3HX9A 1NHVA 1MMNA 3P4UB 1FKOA 3ULHA 2CDRB 2MKSA 5EX3A 1R8HA 3CCZA 4USHA 3BH6B 3E8OA 2HHPA 1WDDA 1CJTB 3DLKB 4XDCA 4DSFA 2BJ8A 1K8AT 1NCLA 4OYAA 1FDAA 3TYTA 3VTIA 2RB7A 5C42A 4MK8A 1X5SA 9ATCB 4CYUB 3GB0A 4OHXA 2B5JB 4NE9C 2AX0A 4C8KA 1Y5LB 3DI6A 2OFHX 1RE1B 3D0IE 4O3NA 2JHEA 4U9RA 4Q44A 1YK9A 4JI3F 4J9MA 1UKUA 1GMWA 2YKNA 3OFEA 1XK8A 4FYXB 3DLEA 3J7AN 1RTIB 1ROFA 4DN0A 2DK2A 3GSIA 1MU2B 4LF9J 2Q79A 2X1BA 3VR1A 5KFUA 5M2PA 4NZ0A 3TZYA 3WBZA 2HFSA 2ZHAA 2JOQA 1CJKA 2MHEA 1A9NB 4XIUA 1IBCB 2XZDB 4PXEA 3PYEA 3GPAA 5U47A 2NPFA 1I3OB 4F0HA 3BQ0A 4LF2A 1MROB 1U1RA 2EI5A 4X64F 2DR5A 2GJIA 4Y0FA 4LFAF 4YR3A 1ICEB 2KHDA 2KB2A 3DGPA 3AD8C 2HZVA 5IZHA 3HP6A 5LOQA 4LIWA 1KVJA 4DLGA 4HR2A 2EW9A 4QZVB 3AD7C 2DNLA 5EWEA 2QSFA 4AL5A 4Y6IA 3N6LA 7FDRA 1SQFA 1WJ9A 4RZRA 2VIHA 3J7Z5 4DMZA 1F2GA 2HS4A 1AUDA 2IPOB 3MECA 5D3GB 3HJFA 3EJMA 1IVZA 2ZJQQ 1XC9A 4KHRA 4A8WA 1FRKA 1EARA 4E98A 5DLGA 5C5JA 1EETB 2V8PA 4TU7A 3OV7A 2XM3A 5IC4B 2KJWA 3NGRA 4ZJLA 4O4RA 4EYIB 1HPZB 3AT1B 2V2ZA 4NLXA 1HNWF 4TXSA 1RBOB 4CLKA 1JMTA 3D3CJ 4KY3A 3K0JA 4A48A 4TU8A 3FC9A 3G8SA 2DY1A 4ZA1A 1UVKA 1FWPA 2QRRA 3D6HB 1QJHA 1IBKJ 3CCVS 5C24A 1IWAA 2E66A 3QRQA 3NCPA 4K4TA 3FDSA 2HIYA 2IYGA 4O3PA 2FDNA 4ZPDA 2Z2LA 4LREA 4ELVA 4RWWA 2HAFA 7FD1A 3LWLA 2AEMA 2NCKL 5AE3A 1AUSL 3UN5A 4M8LA 5LJ3Y 2YNHB 3C6UB 4KT0C 4KH1B 4RNFA 3BPSP 1P9YA 2F4FA 1ZETA 3PRBA 2FY8A 4M94A 1JB0C 2ZOFA 4YY3J 2VBZA 2MPUA 1FHTA 2JEGA 3ZTOA 1UAWA 4RW4B 4CLTA 3MOZA 4RU9A 3DLJA 3N4WA 2GMJA 5CCMA 3V2UC 1J27A 2V4QA 2MY8A 3Q8YA 2MJNA 5LMNJ 2QX0A 4KB7A 2DCUB 4B3TJ 4GO7X 1RAHB 3CDBA 3UPFA 5HVGA 2HBZB 1EKSA 1Q7LB 3Q0AA 4HYKA 1S9EA 4B9MA 1TL5A 1IUJA 1OIAA 3H4BA 1KOOA 4PUOB 2H48B 4FVCA 3M05A 2XQCA 4UY85 2V4JA 3M9OB 3HVTA 4PG4A 3VVUA 2UUBF 3PEJA 3G82B 1TKTB 1HI8A 3MHYA 2MYFA 4ECRA 4RJVA 3PHEA 6FD1A 3AJDA 2V8DA 2IRYA 3MGJA 1WTFA 3MEEB 5D0HA 3WC0A 2VU5A 4LSNB 2KRRA 3G2XA 2QC3A 5KFTA 4IDKA 1FRIA 4KR0B 2AYGA 3N79A 2QO3A 1R7IA 3DLLQ 4HACB 4XAKA 4K2XA 1XWLA 2IJNA 2HHXA 2PI5A 1ZPVA 2OPPB 1U6ZA 1CG2A 2HNZB 2LQ9A 3LPYA 2QIFA 1BD6A 2OMLA 2DR6A 2HQCA 4RL1A 1RGVA 5L1KA 5J2PA 3R97A 4HTJA 3PYFA 4DFPA 2ZDOA 4IG0A 3AJ1A 2RDJA 5SZTA 2NUHA 4DWIA 1RHRB 4C98A 3UD3P 3PXGa 4WBFA 2N7CA 5J2MA 3M8ZA 3FCWA 1Q1KA 1H38A 3QRPA 3JYTA 4FF1A 2H1YA 2K7JA 4DV2F 3EE3A 1XIQA 4B08A 1WUUA 5K5MA 3MMBB 4HHHA 3IM9A 1BWEA 1T05A 2XO7A 2KT2A 5ETVA 4CT8A 1QE1A 3D68A 4FYDA 3MD1A 5E3AA 5KFVA 3KLFA 1S5ZA 1C1BA 3CCQS 4Q2LA 2GA7A 1T9YA 3EUNA 2X1FA 2YH1A 3MM9B 4PG5A 2LEPA 1HNXJ 1F3VA 3FRZA 4IYQA 1BQXA 1TL1B 2XMUA 4U8VA 2ADBA 1R0BG 3IWLA 1S10A 4AL7A 1HR0J 4I2PB 3KG0A 1RT6B 5C25A 2WOMA 4I2QA 3M6XA 1VQLS 1RU2A 2B4OA 4HKQA 5CZVA 4HTIA 1IBKF 2F3JA 4NYPA 2CQ4A 3K58A 1VMBA 1MNEA 5B0GA 2WVFA 3HO1A 3OR2A 2UXDJ 4FYVB 1RT5B 2MQMA 4QQBA 3KLIB 3QZ8A 3JQJA 1H0HB 3R6GB 5IC6B 3CD0A 5B0CA 5DDPC 3TI0A 1SL2A 1RP5A 1R27B 3RJMB 4X4NA 1EX8A 1UCNA 2R4FA 1XR6A 5G0RA 4FXVA 4JI1F 4NXNF 4RLEA 2BQUA 3ZTRA 1HI1A 3AOCA 3BGRB 1CQMA 2BKOA 3MTJA 1U6FA 2QGFB 3HZGA 1WOPA 5A8WA 2GIRA 3EPIA 3MAAB 1GQEA 4HEA9 2CXEA 2GAHC 2ZVIA 4RBVA 3LGHA 3VGUA 2BA9A 2ZC3A 3BN7A 4CLLA 2JFDA 3DDKA 1Q82T 2BVZA 3W3SA 2RE1A 2ZDPA 4B3TF 4GKJF 4YEAA 1YQHA 2Q43A 2V9WA 2A2DA 2Q6CA 1U49A 5J2NB 1RACB 3WDOA 2V0NA 4DR2F 4N41A 3W5ZA 2C2KB 1X9MA 1IXKA 1N56A 4LVOP 4W4MA 4PEOA 3KJQB 1W2IA 2HBRB 3FNNA 5IXUA 2QLBB 2G1DA 1N6QB 3QO9A 2BDPA 4DL2A 5FDLA 1XNQF 2VOPA 2YWFA 2B43A 1CJVA 1DTQB 2M70A 4X66F 1H98A 4RPFA 3FCHA 3JTPA 5T7LB 4J9RA 1TFWA 2IVFB 4QWCA 3BO4A 4PXCA 2VPWB 4G1IA 2PE8A 5F8NA 3D6TB 1S4EA 4LF1A 3IBCB 4CNZA 1HBUA 3KLHA 3HZEA 2IVMA 4F4XA 2KI2A 1FT8A 2B8QA 2RQ4A 2C2MB 3PG9A 2HKEA 4A8KA 2EXUA 1MWYA 3FFIA 1IKVB 2G9OA 1F5AA 2DGVA 3VVTA 4CCHA 5GADI 2H3EB 4C8LA 5D77A 3GQCA 1VBXA 1D8YA 2FVCA 4M63A 1IWGA 2PEHA 4ZMMA 2HGNA 2OEMA 3UR0A 1Q95G 3DLGB 4BBYA 5A2QU 1RT3B 3OQ2A 1IR2A 3CPWR 2KFNA 4F2RA 2RDIA 1JK9B 2XC9A 1U2CA 5IS2A 1DTTA 4N56A 3SFUA 3KFWX 4ED5A 1FERA 1CJUB 3AODA 3TQEA 1D9FA 2FUG9 4U6PA 1RLCL 4DF4A 2V2VA 1GK8A 4DR7J 3MD3A 4H4OB 1FK9B 1OPIA 3CTRA 4Y65A 5HN0A 4DV7J 1NEEA 5KOXA 4X84A 4KHMA 4KV8A 3OSPA 4U7CA 2AYMA 3UCGA 3WIUA 1KKHA 1HR0F 1RHUB 2AEJA 2QA1A 2QA4S 2HQFA 2MKYA 3TVZA 1X4HA 1FE4A 3TAQA 3PCOB 4FS1A 4DV4F 1K9MT 2OELA 2KYXA 2UP1A 5JXSA 1WSVA 2B8PA 1PJ6A 4LRBA 2QJ3A 3CJ5A 2O5DA 3NWRA 4F26A 1H2TZ 3HM9A 3PEHA 1RWOB 2UXDF 3X3UA 1F60B 4Q8FA 1C4AA 3LP0A 3RB4A 4PABA 1JLFB 1T9VA 4NA1A 1HFEL 2J9DE 2MZJA 3GJSB 3MR6A 5ETMA 4PWDA 3MURP 2DGTA 4O3QA 4WFAQ 1HQEA 5DG7A 2CQ3A 3IA0A 1RCXB 3DOLA 2OHDA 1KN6A 3OFGA 1TL7B 1O6XA 3HMJG 1HNIB 1FESA 5K8NA 4J9VA 2KFYA 4ZVEA 4J9KA 2OKQA 1QUPA 3US5A 4DG1B 3M8YA 3KK3A 2AJ2A 3C6TB 2EK1A 3NOCA 5KT2A 1WC4A 2KTQA 3W5YA 2WW8A 1N36J 1REGX 1IR1A 2D41A 2ZH2A 4BWJA 1ZAWA 3E01B 1S0MA 1RT1A 4JI7F 2ZJPQ 4K4VA 3H0PA 2XULA 4K0KJ 4USUA 3T6BA 2GVDA 1UFWA 2I5JA 2YXLA 3HVAA 2EBGA 3KHLA 1FXDA 1BUXA 1RYRA 4Y28C 3RBZA 5HBMB 4F3QA 4ZPWR 5DGBA 2XBPA 3N6NA 2BMBA 3VQTA 1JX4A 4J9PA 1P8GA 2CKWA 3D0GE 3KNGA 1KNZA 2AD9A 2FVRA 1G7CB 2CZVC 2GFFA 2IC3A 2NZCA 1U02A 2WAQD 2W4CA 5HJYA 5A8KB 3CO9A 2X3GA 4X4VA 4FPRA 4OJ3A 3BQ2A 3SXLA 4F8RA 3LP2B 4P71A 4RNNA 3J81j 2OUGA 3OFHA 2WB1D 3M9MB 2DNYA 4M5IA 3QT7A 2M88A 3MPWA 4B3RJ 3IGVA 3M4XA 3QLHA 1WF1A 5KT3A 1FEHA 2BRKA 3QT6A 3SSSA 2CQ2A 4DOZA 3TWZA 4LRDA 1RHKB 3A3OB 2JNJA 2XZTB 2HNDA 4X4UA 4ZPAA 1UMJA 3GV7B 4Q43A 4IO9Q 2EKYA 5GAHU 3CCUS 5KFRA 3UQSA 4QWBA 4C2MA 4DR7F 5DLFA 1JLAB 1NNDA 1P6TA 4RNMA 2FC8A 2MQOA 3W2WA 2FJVA 3K59A 4M5DB 5KFAA 1HQUB 5J2QB 5A0YB 4RUBA 1OY9A 2OPRA 1WEYA 5F9LA 3CJRA 2WVCA 1VI7A 3OTOJ 3SCKE 4MIAA 4IFYA 1PBAA 4JI0F 4JYAF 4DUYJ 4JI6F 2PSZA 2CQPA 1E6VA 3NNHA 1S99A 2K3KA 1UA1A 4LQ9A 2XLIA 1VFJA 3OFFA 2V34A 3GG0A 2MQNA 4X62J 4M5GA 4FDFA 1M0SA 2YNGB 4ECXA 2E44A 3OW2R 3CC2S 3KUHA 3MXHP 1RT2B 3NMRA 3ENAA 2DHXA 2CUYA 3PJXA 3UR3C 4XPCA 1LWFA 4OYZA 1HD0A 4A8OA 4OYIA 4KQZA 5CCLA 3M8WA 4MIBA 2DBBA 1NJWA 2Q1LA 2FZCB 3DFEA 1R8PA 3CJ2A 2QMXA 4EFAC 5ETOA 4RBTA 9RUBA 5HROB 4I67A 4ECZA 4A8QA 3BGOP 1TTHB 3O8WA 3VHQA 1X4FA 5LSRA 4ZJQA 2GAGC 4CO3A 1SC1B 2APOA 1RHMB 2YH0A 5IM0B 2MLZA 1DHMA 1XR7A 2XHCA 2JJ4D 3JTOA 4MFBB 4J91A 1EIYB 2RDDA 2Q3PA 3QATA 1UETA 4A46A 4IFVA 3GCWP 5CD4A 5L1JA 3CCRS 2P6SA 1WDTA 2KYZA 3FZ2A 3W63A 1YG0A 1S9GA 2LVWA 5GMEA 2AJ4A 1S6PB 4C3LA 4K0KF 3IWXA 4DR3F 3GFZA 4KJIA 4XTTA 3IS9A 1TVRB 3C19A 1RKJA 1G1XA 4DBQA 3SSQA 2JFKA 3I4HX 4F4AA 4KPYA 2DITA 3MM7B 2VG7A 2BRLA 4DV0F 5L38A 1FKAF 5KFYA 3W9HA 2RRNA 4H4KA 1N32J 3PIOQ 5BYSA 5IWAJ 1B0VA 4FNHA 2I6WA 3DOKA 2BE2B 4GC6A 3AJ2A 1U26A 3HSDA 3GILA 2HVEA 1DZ5A 1KS2A 3I4PA 1CBKA 4OYWA 4EUVA 4YP3A 1LQ9A 1EB0A 3GU0A 2O66A 2D74B 4EI2A 4XPEA 3IR7B 4IG3B 3LH2S 2QMWA 3GJQB 3I32A 3G6YA 3KK1B 3JSRA 5HLFA 4PZVA 4WKRA 4Q0BA 2DXFA 1JLCA 1LW2B 4F4ZA 2C2DA 3MCOA 4BC7A 5AXKA 5C7PA 1S77D 4Y2CA 2U2FA 4RW7B 5F0WA 1Q4RA 5HAOA 4B9LA 1RTJB 4CWBA 2CZ9A 3D66A 3IMQJ 5KFKA 3DRYA 4DCJB 2HHTA 3UI3A 1FD2A 1UVNA 1RB0A 1NK0A 2FHJA 2D3UA 3CJ4A 1T94A 3PM9A 4E8UA 1B70B 2IJRA 2AHOB 2VFVA 4TY8A 3L09A 2DHAA 3RB6A 1JXVA 2WSFC 1DQAA 1EJ7L 2E1PA 4DPXA 2MKIA 2I1RA 2AX1A 1YBTA 2AZ1A 2ILYA 2OIHA 3L7OA 3MEDB 2FD2A 4UUWA 4PCQA 3MI7X 2RS8A 2PN6A 2VB6A 4NASA 5KG0A 3CXCR 1M90T 1FE0A 2XZWA 5ETLA 1LV5A 1UZHA 2L3MA 3RUBL 2HRUA 5AXMA 3OTOF 4DL6A 2LCWA 1NB2A 4DUYF 3J7A1 4DEZA 1TMMA 3UNGC 2FJWA 4K4YA 1QTNB 3GIJA 2KFZA 1RAGB 4LSLB 2YKMB 2CQDA 3CMES 1OS5A 1J5EF 1KR4A 1WOOA 2P9EA 5KFXA 4PG6A 3PY8A 3T9NA 1TZ0A 4LRAA 1KRPA 3NGDA 2F4VF 3NOGA 3HKZD 2QLWA 4KYZA 2CJ9A 4KAIA 3G4SS 4O0IA 3OXGA 1KDNA 2FHKA 2G2ZA 1S1VB 4MKBA 5KG4A 5DDRC 2UVUA 2XMJA 1UVIA 4JB8B 1C0TB 2J7WA 4JI2J 4OHVA 1Q0NA 1YRXA 3GMGA 3PYGA 3KLEA 4B3MJ 5CH7B 2WSEC 2CJXB 3S1TA 4PKDB 1UVMA 1PBUA 4RUCA 2FTRA 1IQZA 3M8PB 3KK2A 3EWGA 3CEDA 1PYOB 5DZ6A 1YSJA 5CD4H 2GVZA 1NDKA 1BC6A 4UOGA 3D6MB 1EQMA 4RX6A 2DH7A 2E5IA 1OYEA 2GIFA 3RBXA 3OR1B 4FKXA 1VRQC 5KOWA 3CCSS 2HHWA 3DM2A 1ZTTA 2QYGA 2DH9A 2ZUAA 5B0BA 1Y4ZB 1FXLA 1KQKA 2QN6B 3ZZOA 1VOMA 4DR5J 1KWMA 1HLWA 3KUEA 3ZZ0A 1FNXH 3TUZC 4ILMA 3DLEB 3K17A 4ES2A 2DHGA 5E7OB 1P27B 1TL3B 1HNZJ 1WEZA 2VFTA 2ACMA 2Z2ZA 1U25A 4Y2MA 3JQMA 4NLTA 4CTAB 2IMWP 5D4NA 1NSPA 3HVRA 4WJBA 4ED4A 2M4MA 5IWAF 3CD5A 3Q8VA 5KFFA 2W2NP 3BN4A 3ZZZA 5E33A 1S6UA 3OTBA 3TA2A 3KLGA 3TAMB 3O2IA 1S0VA 1GMWD 2MZQA 1WHYA 1IKWB 2ZH5A 3GTYX 1TKXA 4TNOA 5ETSA 4WE1A 5A8RA 3Q2TC 2MLXA 2CDQA 1NLKL 1BHNA 4ED3A 3LGMA 4TKTA 3Q2SC 4KO0A 3JTNA 4G1QB 1H7WA 5J1EB 4CM0A 1AZSA 3G6ES 3N0VA 3THPA 3KMQA 2BZ2A 3C16A 3KTQA 3RTVA 2R7XA 5LL6d 3DRPB 1M5PC 2ASDA 5A6WA 3NGUA 3ZZRA 2Z56B 4C8OA 4P2MA 1LWCA 3BV8A 2C42A 4I64A 4JI5J 2W25A 5F8MA 2E7VA 2JH3A 4C11A 2FLOA 1B4SA 4QIGA 3KOAA 2RF2A 2LQ5A 3FVYA 1SH0A 1ZM9A 4A4JA 2V9KA 4AT1B 4QIFA 4O0NA 3NKYA 2H4WB 4DV1F 4U67Q 1RHJB 3MAHA 4X4QA 5E41A 2YNIA 1NO8A 3GR0A 2EK6A 2ATCB 2E29A 2MJUA 2V8GA 2I9SA 2IHR1 3HJVA 5KG3A 1SCJB 4F4KA 2DYAA 1SKUB 4CH0S 2QSWA 3PJ9A 4H54A 1X5PA 4OZ5A 3ISNC 1KFDA 3M2VA 5KT5A 1L3VA 1RWMB 3PYDA 4NL5A 3R8YA 5JJBA 4CLPA 1UW9A 1T9UA 5HMWA 3MR2A 3MAQA 3MMAB 2WB4A 4NZ6A 2PO4A 3BKFA 4DI6A 5DRKA 3HHLC 2X51A 3HI9A 1CVJA 3QGHA 4UT4A 4L75A 4YMEA 3N5FA 4LT6A 2CJBA 3MUMP 1JJ2R 1ZAVA 4U8YA 4FF2A 2F1FA 2BE9B 2KZMA 3UD5A 1TR0A 4CLFA 4CT9A 1DARA 2WSCC 4UZBA 2BACA 4KGZB 4ECQA 3LF0A 1B7YB 2CPEA 4C4WA 4B3MF 3C3LA 1HL6A 3TNVA 2Z57B 2Q66A 5A76A 3QPIA 4ED0A 3KHHA 1S59A 3IC1A 1H73A 3VAJA 3D9BA 3FEZA 2YQ3A 1JNRB 2FHOB 4RR5A 1SV5A 2V4JB 3R6LB 3S01A 2HBYB 4O44B 1UJ5A 4TY9A 1D9AA 1YBUA 2IDEA 1DJ0A 2P9GA 4UQGA 1VJQA 1FWKA 3K5PA 1YJUA 3SQGB 2HVHA 3VAFA 3N9UC 1O5JA 5KFGA 3NGTA 4DR5F 5F8IA 2U1AA 5I42B 4O23A 1KTVA 1Z2LA 4OYBA 4M5LA 4KBIA 3RBEA 4Y34A 3DU5A 3G9CA 4RW9B 2BJEA 5GAEI 3R5GA 5CYMA 5J2PB 3KG4A 1MSWD 3QWPA 2B6AA 2HLTA 2NR0A 2W8LA 5F0UA 4WTOB 3ZTPA 1B64A 5IQQA 4O4GB 4FYWB 1RAOA 1RTHB 3FCVA 1CS4A 2KXHA 4EYHB 3M1VA 4RWXA 3B78A 1U09A 2LU1A 3EDQB 1HWLA 4UUXA 4QYZK 3SBMA 3DGVA 3EDRB 1FFWB 2DXEA 5KTQA 5ETQA 1JXLA 2RIJA 1V3RA 1QE1B 1FNMA 2ZOMA 2VQFJ 1DY3A 1VIXA 2IRXA 2ZEJA 3OL6A 4G1PA 2EC0A 3MMJA 2I38A 2G4BA 2B9XA 1RJJA 2OSRA 2EVZA 3GZ7A 1FRHA 1PJ5A 1WG5A 1BQNB 3QIPA 1T03B 3PW0A 1H2UX 2BR0A 4A8MP 4OX9F 4R8UA 1UA0A 2BQRA 2D3OR 4HHJA 3AFGA 3KJVA 1JLGA 2XMAA 3H5UA 3EVWA 2IAJA 3UN2A 2A18A 3ENWA 4B9NA 4Y2IA 2VG5B 3L9ZA 3M6UA 2C2NA 1YGYA 1PO6A 2R8GA 3QT8A 4OIXA 1G6BA 3NGKA 2QFJA 3T6JA 3FSIA 2F7VA 1TQLA 2PD1A 1HBNA 4X4PA 3R7BB 2HAIA 2YWGA 3I5CA 5G0RB 4CRJA 4O3RA 1SXLA 1NAQA 1WHWA 3J81U 1N5YA 2IY5B 3BM7A 2EFVA 3W61A 3ET6A 2GMLA 3SV4A 1AFJA 4URSA 4B3OB 1L3TA 5C2CA 3I5AA 3FZBA 1Q5VA 2VFSA 2E9TA 3MMCB 1WKLA 1N34J 4LRCA 2YQ0A 3DOMA 4YFUA 3PKMA 2W24A 3RAMA 3TUIC 3NP5A 2ZWOA 1V3ZA 4NXMJ 1CULA 3ZZUA 3EXYA 5CA5A 1E6YA 1IBMJ 3VAIA 1LWEA 1MMDA 4USIA 1FA0A 3IO1A 4QU7A 1KLMB 3LWMA 4BC9A 1IBLJ 1XERA 1VRTA 1BLUA 2VG6B 4CZCA 4WF9Q 3QT5A 4B9SA 1DLOB 4ZITA 4ECVA 2V8VA 2Y8WA 2HGLA 2FZGB 4ID5B 3NNAA 5HATA 2LQ8A 3DXSX 5LM7E 3VAHA 4BCAA 4PPDA 1PYTA 2PT0A 5KFMA 2IA6A 4OFZA 3VCDA 4OI0A 5E2QA 1D8ZA 1SB6A 4GVBA 2JLGA 2MKCA 4LF5F 4GRSA 5F3ZA 1ZTWA 2EFOA 2V50A 4B9TA 2H54B 3RR7A 1VQ9S 2HURA 2RJZA 4RW6B 1XMOJ 2ASLA 2DNGA 3C66A 3LP1A 1REVB 3TEHB 1OY6A 4G3IA 2C3OA 2LXUA 2J6UA 2CADA 4NLSA 1S72S 3JSMA 1T11A 2OTLS 3HHLB 2HVDA 2DGSA 1KHVA 4X65J 1VK3A 4G6VB 1B99A 1RT7A 2CPDA 2H51B 2FZKB 1A7GE 2E9RX 1W25A 3C2PA 3DRSA 2VFUA 4PQAA 2PEBA 2D9OA 1RA6A 4ZOSA 1N8RT 3P3DA 1RAFB 3FRYA 1UP1A 2CQ1A 3POTB 3MFIA 3OHBA 3NS7B 2CZ4A 3MM8A 2VH7A 1VQ6S 3CJQA 2UXBF 1TAUA 2GNKA 3SSRA 4YR2A 1UPPA 2VASA 1UTAA 3MPYA 3B4DA 5KFIA 1VGYA 1YLXA 4ECUA 3DLKA 3PX6A 4DX7A 3M6VA 3QAEA 4K7QA 3AQOA 2GX8A 2ABYA 3RGIA 2KDOA 5DG9A 5GAEU 2NXUA 3W9JA 5FLXY 2IFXA 2E1RA 5BR8F 2H9ZA 4ECSA 5MLCV 2HRYA 5ETKA 4CYUA 1U47A 3TP2A 2B5JA 1FTCA 5DGAA 3M2UA 3TVYA 1ZM2A 2F65A 3AH6A 4TLQA 2MEWA 3B8HA 3M7VA 4BLGA 3FK4A 1NK7A 1RTIA 3GSDA 5IT0A 1FRJA 1N0UA 5ITHA 1MU2A 1OJ4A 1VR6A 2KJVA 4A47A 1WKKA 3MDFA 2J0XA 1U1MA 4TN2A 2Z0GA 2EKNA 4A8SA 2Z30B 2E5LJ 4PWDB 2ADCA 1HIYA 3QQCD 2CPXA 3DOLB 2QMUB 4CLSA 3KMSA 3KDNA 2ZC4A 1FDBA 5LT5A 3GYNA 4USWA 3FSXA 2J0QD 2VD3A 2EFPA 2J8SA 3IAS9 3OUYA 4K4ZA 4ITSA 1ULRA 1R89A 1SKSA 1S7HA 2RQKA 4LR8A 2YQ1A 5D3GA 3CGIA 3OXFA 4F25A 3IR6B 2VF3A 1Q16B 1EETA 1ACMB 1X60A 2DISA 4ZVHA 2CPFA 2IA0A 5HP1B 2J9CA 1KQGB 3DHXA 4ED8A 2W9AA 4ZVOB 1RT1B 1S76D 1DQ9A 3A8JA 2GVDB 4JI3J 3M2RB 3DRRA 3V81B 3CJKB 5IV4A 1YJ9S 2BJ1A 4GO5X 1VRUB 1MMLA 4RW8A 4DV6F 2ZE2A 2LEAA 4U7UK 4EBEA 4OZ1A 2K2PA 1F5CA 2I8EA 1FO1A 3FBCA 4ZVGA 1IJFB 2IC3B 1EKRA 3B6BA 1FTRA 2DGUA 1XMOF 4NLRA 2VJUA 2RUSA 4X64J 4LFAJ 2X1GA 3UD4P 3EGVA 3VGTA 3HHNB 2JRSA 2ZH8A 1M5VC 1F9FA 1Q5YA 1FX4A 5HO4A 5D4PA 2CJQA 2BJDA 1YIJS 4LF8F 2YNHA 2R2TA 2BW2A 1WC6A 2FJEB 2UV8G 2BE7D 2KKHA 3CULA 3LGNA 2KL8A 5KFZA 2HW3A 1P1TA 2CNKB 1OPZA 3W5XA 3DDIA 2OO4A 2AV5A 2HBQB 1RAIB 4NLVA 4TQSA 2G13A 4EBCA 5AE2A 3P5BP 2V2KA 2M5YA 3PX0A 3OVAA 2QLXA 2PMZD 2FVQA 2XY5A 1TP7A 3NS6A 1OY8A 2W9CB 3H42A 4PUOA 4RNHA 2W7PA 2P2CB 3DHWC 3HDSA 4CO0A 3T5KA 2WK4A 1JQGA 3G82A 3I9V9 1YHQS 1U45A 1TKTA 1M1GA 1XNRJ 5H9FK 1XBWA 1Y11A 3LW5C 3DMJA 4P73A 4HT5A 4JV1A 1SL1A 3MEEA 3N01A 2XB2D 1X5OA 4PQUB 3MPUB 4LSNA 3BO3A 1L5UA 4TVAB 1WG4A 3CW2C 2UXCF 4C97A 4ECYA 2WHOA 2J5AA 2LFVA 3MM6A 4ZVRB 3MOJB 1ZS6A 4HACA 4DQSA 1SPBP 1QSLA 4J9UE 4DL7A 2OPPA 4OI4A 2HNZA 1WSRA 5EUHA 3SMZA 2JVRA 1RYSA 3VALA 2XS5A 4HVZA 2CJKA 3PV8A 1LK7A 1V5IB 2CG8A 4ZIVA 4OJ1A 4JUZA 3MM5B 3NAIA 3FMBA 3OPKA 5B09A 4ANEA 3MUTP 4CIOA 1ZZNA 2NSCA 2XYGB 3GV8B 3KYLA 5LSOA 3HHDA 4F4WA 1U0HB 3CJTA 1HD1A 2N4DA 4C0HA 1HHSA 2VPXB 2DRAA 1YJ7A 4GVLA 1KLNA 2V4RA 4IKAA 1GXTA 4ZIWA 1H7XA 3AOAA 2MTLA 4K50A 2W9BB 3MMBA 2LKZA 3BEGB 3TZZA 1EP4B 2UUBJ 2M8HA 2J8AA 4W98A 4C8MA 4Y2KA 2ASJA 5CZXA 2PMHA 1WELA 2QL9B 3UVJB 4ES3A 1HYSB 3R3TA 4R5PA 3G71S 1RXOB 2ZH9A 1Q81T 2YWWA 3VAKA 4I2PA 2W2OP 2EC2A 2OEKA 1RT6A 1NK4A 2HVIA 1S97A 1R6YA 4F3OA 4DV3F 1UPMB 4WYLA 3OSNA 2AGOA 1TMJA 3GYGA 2A10A 1J5OB 3UCZP 5A2QY 4OHWA 2DR8A 3EGWB 3K8VA 3MWBA 2DRBA 2ROEA 2DR9A 3CWJA 4AD6A 4F2SA 2HFVA 3CCWA 1S12A 1KTQA 2QLFB 2GIQA 2L41A 1X0FA 2MQLA 1UWBB 3RRGA 2JEFA 1RSCA 4OLOA 4DV2J 2OMOA 3P45B 4IR1A 2VHGA 3BKTA 3BGRA 1NBEB 4NLPA 2RMLA 4ZVQB 2V8HA 1YJTA 3MAAA 3ZC4A 2YKPA 3V5RA 4Z2XA 4FYYB 5B0DA 3THTA 2H5IB 3BF4A 4ZLPA 1M5OC 1Y5NB 3H2VE 4V19X 1RWPB 1RWUA 3PX4A 2DIUA 1F9EB 2MKKA 5J2NA 3GP9A 1JKHB 2JWNA 1KC8T 3ZXWA 5DG8A 3BBBA 1TFYA 4A8XA 2FHJD 4H4MA 8RUCA 1SC4B 1NSQA 4QR0A 4C3KA 2ZJRQ 3U1LA 2VBXA 5KG7A 2W8KA 5I4MA 3ZNJ1 2LECA 5L8RC 1FRMA 2BABA 8ATCB 5ETTA 1HNVB 3D1QA 1DTQA 1S1TB 1XNRF 2OPQB 3GG1A 2MGZA 3R2DJ 4ZP6A 2KXFA 4TLRA 3CD6S 5F8JA 5T7LA 2HPUA 1NZAA 2D3ZA 2XO6A 3R9LA 2LLZA 4ZS6A 4PPZA 1N5SA 2Y1JA 4JI1J 4NXNJ 5FLXU 2RQCA 2FPHX 2K3IA 2HNYB 1BWVA 1XN9A 5F41A 5AT1B 5IFMA 4NCAA 4A8FA 3TJ9A 2HHUA 2EPIA 1V6HA 3A1YG 1F9HA 3GJRB 2QE5A 3JAMU 4U95A 4GKJJ 4DUTA 3Q8SB 2DNKA 3GONA 3KK2B 2K1RA 4ED6A 3HSJA 2PA3A 5E3CA 3IP0A 1H72C 2B4PA 4DR2J 1TL4A 1TELA 3Q8QB 1RT3A 4IOBA 5CYJA 1RWWB 5EGYA 2VONA 5L1IA 1WTBA 3T1AA 3C15B 2VOOA 1JLBB 3IWNC 3T3FA 3IRXA 1XNQJ 2RRBA 2XEXA 3LA0A 1CJUA 1PIEA 1X4AA 4JI8F 3FSYA 3M8RA 3NWGA 4X66J 2IBKA 3D2WA 4H4OA 2C2OB 3ILJA 1FK9A 4EK2A 4NRUA 1VIOA 3O3LA 3RBDA 3PRVA 1UFKA 2LEBA 3BGLA 4DPOA 2DB1A 4QCLA 1U2FA 2DNRA 1NK8A 1WOSA 3AXMA 5D4LA 4OHYA 2J76E 3UWTA 3J80Y 2BKPA 2GQCA 4UF4A 4Q8EA 2WCXA 4WPAA 4Q45A 2CNOB 1HARA 4CO1A 2VQEF 1NUEA 5L9XA 2C2ZB 4UOCA 5IT9Y 4WFBQ 3C46A 1AA1B 3I82A 1WHVA 3S8SA 4J9QA 1U7LA 1XMBA 1X4EA 5A8RB 1YX2A 2W4PA 2UVWA 2XTJP 3QMQA 5IV3A 3A8KA 3DYAB 2GGPB 1AZSB 2NREA 1HWJA 3MR5A 4Z37A 2GS8A 4USVA 3SI8A 3NS5A 1UZDA 3GE9A 1Q8KA 1RA7A 1TL7A 1QVFR 4DPYA 1XMQF 4C11B 2YKOA 1YRTA 2B4VA 2HS0A 5D15A 4Y00A 1U4BA 3T19A 3GLJA 4DG1A 4DPTA 2C1EB 2LA6A 2B9EA 3C6TA 1X4GA 1S49A 1HMVA 1YITS 2HK3A 3OVBA 1PG5B 4N8OA 1M1KT 2DTJA 4DR4F 1RLDA 5KAKA 4C8ZA 4HI1A 4N7TA 2XMTA 4KRWA 4DV4J 3W1YC 4NEYA 1RBAA 2G0CA 3GCXP 4LBIA 2UUTA 3E01A 3CMAS 1OSDA 1WORA 2XNRA 1ITPA 1RCOB 3GJTB 4OI2A 1HBMB 3LO3A 2RU3A 1R0CB 3R1LA 3CSKA 4IOCQ 4YDXA 5DQIA 2MSTA 1ZBTA 4ZCIA 2DEIA 2DNPA 3ELHA 2K8GA 5K8OA 1JLQB 1IKYA 5HBMA 1IR0A 5D78A 3MZIA 3U1NA 1IKXA 2XYPB 1HWKA 3HXMA 3QBCA 1F1BB 2KVQE 2MQPA 4K4XA 1EZZB 2NYHA 1NKBA 3W2VB 2DEJA 2A6MA 4NLQA 3I87A 1RISA 3CJ0A 2DGOA 3LP2A 2HG4A 1Q78A 3TZWA 4R0EA 3D67A 3D4JA 3D28A 1RAAB 3ENQA 1QSSA 3S7RA 3GR1A 4ZLJA 2VBWA 3P5TL 2NXNA 1Z4UA 3NY0A 4P72A 2YY3A 4KGXB 4JI4F 5CAAA 2QA4G 2A3JA 4WP9A 2ZITA 3HFVA 2ZFHA 5DS7A 2NXJA 2F9DA 1R0AB 4X4OA 2J7KA 5EWFA 2HWHA 4JI7J 2CA9A 4ZVUB 1UW4A 1D3WA 2BX6A 3HHEA 2LXFA 4C8YA 2WTFA 1FX2A 3FBFA 4CNYA 2J0WA 3TR5A 1JLAA 4KHPF 4C9DA 3H20A 5E3QA 4DX6A 4ZVTB 4DL3A 4M5DA 3FQKA 4FP9A 2EFNA 3CCJS 5J2QA 5A0YA 2VPYB 2ZKUA 5CYQB 4DFKA 5GAHI 3A12A 2V63A 3CD7A 4QPTA 3SCIE 2V2QA 2AQ4A 5EDWA 3KG1A 3W8GA 5B0EA 4R0JA 2BEFA 1DURA 4NWBA 4DZ6A 2D69A 3NBPA 4P9SA 2OP5A 2XS2A 1V3SA 3S6EA 4WCEQ 1S48A 3ZTSA 1TV6B 2ZBRA 2HZCA 2YNGA 4WYWA 2X3DA 4K4SA 3JB9k 1W2BR 1RT2A 3CJ3A 2RAQA 2ZBCA 3IAM9 2AMCB 2IVYA 3FBBA 2LA4A 1CEZA 2X1AA 1Z1ZA 1NJIT 3BSAA 2XSJB 3V4MA 1HI0P 5GVQA 1U1PA 3NNCA 3WZ0A 1LNQA 4PAAA 2V5HG 3QIDA 4AQYJ 4RO0A 3SIPB 4L72B 3V6DB 3LOUA 3DCAA 3K89A 3BREA 3LAKA 3QIPB 2KM8C 1SIWB 2R2SA 3I0SB 1BY9A 3A8IA 4DSKA 3C14B 4WFXA 2YTCA 3T1YF 4ANDA 5IM0A 2VJVA 3RB3A 2DNQA 4CLZA 3BDPA 3I0RB 3ADAC 4MFBA 3KJVB 1WWHA 1JLGB 4LFBJ 4NX9A 4JI0J 4QR1A 4JYAJ 3AB2B 4JI6J 1K1QA 1VQ4S 4KKOB 1JLEB 1NHUA 3K5MA 1NH7A 3EYZA 2Z8QA 1T02A 3NL0A 1KVKA 1S6PA 1U1OA 1XTZA 2OFGX 4I6AA 4M5HA 3FUYA 1PGZA 1S4FA 4EBDA 1TVRA 1SQGA 1HBNB 3JS9A 3TAPA 2FIUA 2JZ5A 2N7YA 4ZPBA 3RYLA 3PDNA 4YB6A 5A6PA 2CFXA 4ERDA 2WONA 2GQQA 4PXDA 2GZOA 4HH1A 3VQSA 1AROP 2BE2A 5H9EK 2Y8YA 4ZPCA 4OL8A 5D8HB 3TA1A 2GJFA 4HI2A 3F56A 1VBKA 3DOMB 4NCBA 2RKIB 4IG3A 2XWYA 1WG1A 3KK1A 4D3GA 1FD8A 1X5TA 5I3UB 2LQBA 1CC8A 3K2YA
chains in the Genus database with same CATH topology
3FBCA 4O0NA 3G2XA 1BE4A 2HURA 3VGSA 3EICA 3NGRA 1K44A 2AZ1A 3B6BA 1NUEA 3BBBA 1NSPA 4S0MA 3ZTOA 4ANCA 1W7WA 4DUTA 3ZTSA 1XQIA 1NDPA 1NSQA 3EMTA 2DY9A 5CAAA 1HHQA 5CABA 3NGSA 3VGTA 2B8QA 4F36A 4F4AA 1S59A 3Q8VA 3Q8YA 3VGUA 3ZTPA 3ZTQA 2DXDA 2HVDA 1S57A 3FKBA 2HVEA 3FC9A 4UOHA 4FKYA 1NDCA 2DYAA 3B54A 3EVWA 3Q86A 3FCVA 3FBBA 1U8WA 1B99A 1NHKL 1NDKA 3PJ9A 3GPAA 5IOLA 3JS9A 3EVMA 3Q83A 3VVTA 4UOGA 1LWXA 1NB2A 3BH6B 4KPCA 1PKUA 4C6AA 1NLKL 3EM1A 1WKJA 1BHNA 2BX6A 4W98A 3ELHA 3R9LA 2B8PA 2DXFA 1EHWA 2DXEA 4FKXA 5C7PA 3ETMA 3EVOA 3FBFA 1F3FA 1MN9A 4WBFA 1ZS6A 4EK2A 1NCLA 3BBFA 3FCWA 1LEOA 2ZUAA 1NDLA 4HR2A 1F6TA 3DDIA 3VVUA 2AZ3A 3BBCA 1WKKA 4DI6A 3FBEA 2CWKA 3WX8A 3EE3A 1XIQA 1PAEX 3PRVA 3Q8UA 3MPDA 3DKDA 3NGUA 2NCKL 3NGTA 4UOFA 3ENAA 1HIYA 1HLWA 1NSKL 1NPKA 3L7UA 3EJMA 1VYAA 3Q89A 4CP5A 4ANDA 5BXIA 1UCNA 3BH7B 3VGVA 1KDNA 1B4SA 4ENOA 2BEFA 1S5ZA 1JXVA 1WKLA 2VU5A 4DZ6A 3ZTRA 3GP9A 1MN7A 4ANEA 1BUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FBC A;  4O0N A;  3G2X A;  1BE4 A;  2HUR A;  3VGS A;  3EIC A;  3NGR A;  1K44 A;  2AZ1 A;  3B6B A;  1NUE A;  3BBB A;  1NSP A;  4S0M A;  3ZTO A;  4ANC A;  1W7W A;  4DUT A;  3ZTS A;  1XQI A;  1NDP A;  1NSQ A;  3EMT A;  2DY9 A;  5CAA A;  1HHQ A;  5CAB A;  3NGS A;  3VGT A;  2B8Q A;  4F36 A;  4F4A A;  1S59 A;  3Q8V A;  3Q8Y A;  3VGU A;  3ZTP A;  3ZTQ A;  2DXD A;  2HVD A;  1S57 A;  3FKB A;  2HVE A;  3FC9 A;  4UOH A;  4FKY A;  1NDC A;  2DYA A;  3B54 A;  3EVW A;  3Q86 A;  3FCV A;  3FBB A;  1U8W A;  1B99 A;  1NHK L;  1NDK A;  3PJ9 A;  3GPA A;  5IOL A;  3JS9 A;  3EVM A;  3Q83 A;  3VVT A;  4UOG A;  1LWX A;  1NB2 A;  3BH6 B;  4KPC A;  1PKU A;  4C6A A;  1NLK L;  3EM1 A;  1WKJ A;  1BHN A;  2BX6 A;  4W98 A;  3ELH A;  3R9L A;  2B8P A;  2DXF A;  1EHW A;  2DXE A;  4FKX A;  5C7P A;  3ETM A;  3EVO A;  3FBF A;  1F3F A;  1MN9 A;  4WBF A;  1ZS6 A;  4EK2 A;  1NCL A;  3BBF A;  3FCW A;  1LEO A;  2ZUA A;  1NDL A;  4HR2 A;  1F6T A;  3DDI A;  3VVU A;  2AZ3 A;  3BBC A;  1WKK A;  4DI6 A;  3FBE A;  2CWK A;  3WX8 A;  3EE3 A;  1XIQ A;  1PAE X;  3PRV A;  3Q8U A;  3MPD A;  3DKD A;  3NGU A;  2NCK L;  3NGT A;  4UOF A;  3ENA A;  1HIY A;  1HLW A;  1NSK L;  1NPK A;  3L7U A;  3EJM A;  1VYA A;  3Q89 A;  4CP5 A;  4AND A;  5BXI A;  1UCN A;  3BH7 B;  3VGV A;  1KDN A;  1B4S A;  4ENO A;  2BEF A;  1S5Z A;  1JXV A;  1WKL A;  2VU5 A;  4DZ6 A;  3ZTR A;  3GP9 A;  1MN7 A;  4ANE A;  1BUX A; 
#chains in the Genus database with same CATH topology
 1LW2 A;  2F9J A;  2RT3 A;  4OZN A;  1K44 A;  2CQB A;  4RW7 A;  4Q2M A;  3F73 A;  1KQF B;  1DFD A;  5F8L A;  1OSC A;  1SJF A;  3CC7 S;  4LF4 J;  2Y9H A;  5AXL A;  1S1X A;  4ILL A;  4QYZ J;  2RNE A;  2VPZ B;  4DSJ A;  4EO8 A;  1VRT B;  1U8W A;  3D6F B;  4WFN Q;  4EZ9 A;  1WC0 A;  1U1K A;  1XEZ A;  4URQ U;  3AA8 A;  4IRD A;  4LQ3 A;  1MW7 A;  5CHC B;  2OSQ A;  2DR7 A;  1VQ8 S;  2FVS A;  1GX5 A;  4WKY A;  4KH0 B;  3ZZT A;  3HT0 A;  3MED A;  4DR3 J;  5LMU J;  1T95 A;  4PG7 A;  1YVF A;  4ER8 A;  1QAX A;  1T3N A;  2PFF B;  2K7K A;  1VC6 A;  3OVS A;  2KHC A;  4OYM A;  3QSI A;  5HVF A;  3I55 S;  4DV0 J;  3THV A;  1S6Q B;  3O44 A;  5HMY A;  1UVL A;  4DL4 A;  1NJZ A;  2RHS B;  2OLW A;  2B51 A;  1EQ0 A;  3GII A;  5RUB A;  3GIM A;  3R5C A;  5KT7 A;  4I68 A;  1KHW A;  3U02 A;  2BOA A;  2A1B A;  2OJ3 A;  4LSL A;  4DR1 F;  5DM7 Q;  4DCP B;  4DXL A;  2YKM A;  1UEV A;  2NPI A;  3OJU A;  2P8I A;  1NME B;  4Q7A A;  3NEK A;  4GMK A;  2YBV A;  3HD1 A;  2RIL A;  2ZHO A;  2VV5 A;  3K7R A;  1DAX A;  5KFL A;  1N54 B;  2QYC A;  5KFD A;  3VAM A;  4L76 A;  3CO0 P;  4FF4 A;  1C4C A;  3M30 B;  1FXR A;  2G2O A;  1S1V A;  2H5E A;  1LWX A;  3J80 U;  3W60 A;  4ZK7 M;  3CCL S;  1N5Q A;  1N33 J;  4IRK A;  1C0T A;  3BYR A;  5IT9 U;  2HLU A;  4QW9 A;  1HW8 A;  2VDH A;  5EHH A;  1IQT A;  4AQY F;  2RQM A;  1O51 A;  2DIV A;  1AFI A;  1PAE X;  2L9N A;  4IQM A;  1WAC A;  2BXJ A;  3M8P A;  2HWT A;  3CDW A;  4BS2 A;  4NLG A;  5F8H A;  1JJC B;  2UU9 F;  2PDA A;  3D3B J;  1S1U B;  2Z2M A;  4K4U A;  4MK9 A;  3OR1 A;  2W7A A;  2VKR A;  4M95 A;  3I9Z A;  1C2P A;  2CQI A;  4LFB F;  2XS7 A;  3QFW A;  4LR7 A;  4X4T A;  3GFH A;  3M8S A;  1ZM4 A;  3M2U B;  4LVN P;  2BAN B;  4KFB B;  3T9Z A;  1CPZ A;  4MAK A;  1VIS A;  5DZ7 A;  3ENV A;  2NXC A;  1J5E J;  4CLU A;  2A6O A;  3G87 A;  1TL3 A;  2HZA A;  1C1C B;  4YR0 A;  3V6K A;  2FLP A;  3ILL A;  3UO0 A;  2UVV A;  5HI7 A;  2F4V J;  4CTA A;  4ATN A;  3M32 B;  1RU1 A;  4YUD A;  4P6Q A;  5KFC A;  1GTE A;  3RW7 A;  1NSA A;  4E0D A;  1SKR A;  5G4D A;  1U6B A;  3HVW A;  2ZD1 B;  1YZ7 A;  2ALZ A;  3TAM A;  1LXJ A;  2HQI A;  3E2E A;  4IUF A;  4ZKA A;  1IKW A;  2GW8 A;  1HBO B;  2WBM A;  3H7H B;  1I1G A;  3JSB A;  4J5O A;  4G1Q A;  3Q8P B;  3GV5 B;  5J1E A;  3OUY B;  1PYS B;  4V1A k;  2YKQ A;  2Y1I A;  3IG1 B;  1FVQ A;  3OL9 A;  1XQI A;  4WK3 A;  3D54 A;  1HQ2 A;  4NCG B;  3QGI A;  4OYX A;  1JXE A;  3DRP A;  2XLK A;  1FRL A;  2J6T A;  4HL9 A;  3HLU A;  4LF4 F;  2OAU A;  1OQ3 A;  2KM8 B;  2E1C A;  1SBR A;  3R7S B;  4DX5 A;  5KFQ A;  1U0S A;  4QW8 A;  3L7P A;  1K0T A;  2VZ9 A;  2DKO B;  4I7F B;  3R2C J;  3BR8 A;  1WF0 A;  4YHH F;  2C2E A;  2BUN A;  1OWX A;  1WF2 A;  5IOL A;  4LFC F;  3G6X A;  3L4B C;  1UEU A;  2ERR A;  5HK4 A;  3DRR B;  1TUV A;  1YBA A;  3I96 A;  3CT9 A;  2VKZ G;  4RW8 B;  5LMU F;  3A4T A;  5K8P A;  2ZE2 B;  3V4I B;  4WK1 A;  1BQM B;  2BBE A;  2CRL A;  4WFY A;  1LW0 B;  2OH2 A;  2DD8 S;  5KFH A;  3QYY A;  4OI1 A;  4CH7 A;  5HQL A;  3BPD A;  1AW0 A;  2ROP A;  1C0U B;  2HHH F;  3VGS A;  5H1S V;  2OPS A;  3J7Y U;  5JMN A;  3MMA A;  3PVX A;  3ZZY A;  4L6V 3;  4QJV A;  1VQS A;  5DDQ C;  1NHK L;  3DRX A;  4MYT A;  2DNO A;  3UDL A;  8AT1 B;  3T1H F;  4L74 A;  2MZR A;  1N33 F;  4F02 A;  4IH7 A;  5HQM A;  1F6T A;  2ZZM A;  1WNE A;  1S1W B;  7AT1 B;  3HF5 A;  4DR6 J;  3BR9 A;  1VDH A;  4CM2 A;  1OMS A;  4I6Y A;  1IN0 A;  4DV1 J;  1QY7 A;  4ICL B;  4ZJO A;  1KON A;  2VOD A;  4NLO A;  5KFS A;  4RBU A;  4ZHR B;  3TA0 A;  4O44 A;  3QAU A;  4DSL A;  3EIC A;  5SUH A;  3J81 Y;  5KFN A;  1B0P A;  3R5B A;  3H98 A;  2H65 B;  3DMJ B;  1HKA A;  3SYZ A;  3SQG A;  3FEY B;  4HDH A;  4I1T A;  3IXQ A;  2HMI B;  4DS5 A;  2HFN A;  4QIW D;  5I42 A;  3MM6 B;  1VQN S;  2V94 A;  2IM3 A;  2DT9 A;  4LF9 F;  3DDN A;  5K14 B;  2FJX A;  2JEI A;  2PGC A;  2DNM A;  1Q86 T;  3OD2 A;  3M9N B;  4RW9 A;  4TU9 A;  3FEX B;  4OMF G;  4NYZ A;  1HA1 A;  1TKZ B;  3VWS A;  2EFQ A;  2XMM A;  1NJY A;  1O8B A;  1RI7 A;  3R5D A;  1N52 B;  4OV6 A;  4RNO A;  4O4G A;  1RTH A;  2W1B A;  2QFI A;  4UQT A;  3WX4 A;  2VDI A;  4JP8 A;  1GFW B;  1YJW S;  2NXE A;  1FKO B;  3TUP A;  5KT6 A;  1YWX A;  2DGQ A;  1PIL A;  2BV3 A;  3SDE A;  1IJE B;  2AJQ A;  4WFZ A;  4CO5 A;  4X4S A;  2R8K A;  5DJB A;  1B3T A;  3TEG A;  2LDI A;  3IGN A;  1SH3 A;  4M5N A;  2JC1 A;  1GEH A;  4UTG A;  5C42 B;  4DSI A;  6AT1 B;  2DXD A;  4DFM A;  2WBR A;  1V5V A;  2FJB B;  4NI2 A;  2AGP A;  3JXO A;  2HFU A;  3DI6 B;  1BQN A;  1T03 A;  2JVO A;  4R5P B;  2M8D B;  2YKN B;  3IR5 B;  2VA2 A;  2CNN B;  4GC7 A;  4BDP A;  3BBF A;  1R43 A;  1ZA1 B;  3JQK A;  3U27 A;  2XCA A;  2HYI B;  2H5J B;  3L3C A;  4KIA A;  4OZL A;  3PO5 A;  1KP6 A;  1R31 A;  4OZ0 A;  2W2Q P;  1APS A;  1CJK B;  2VG5 A;  3A3P B;  2POK A;  2C3P A;  2WVB A;  1QVG R;  3SCL E;  1R3N A;  2C28 A;  2ZNZ A;  2C3U A;  4EWT A;  5HMX A;  2J9E A;  1BMQ B;  1TK5 A;  2GCF A;  3DGP B;  4PRF A;  3R5A A;  4P10 A;  5H9F J;  3HFZ B;  3I6P A;  2R2U A;  2Z2Y B;  4PWW A;  4K2J A;  5CAB A;  2FC9 A;  1NKC A;  2XG8 A;  2M2B A;  3ZTQ A;  4AXI A;  3DU6 A;  3CIM A;  3UE2 A;  3MEC B;  1U1N A;  3HSG A;  4B3O A;  4YY3 F;  2A2C A;  1SC3 B;  2R7W A;  4OX8 A;  3MMC A;  2AYB A;  1RWK B;  4LJM A;  4O3O A;  3RAX A;  3EM1 A;  4ED7 A;  2KZZ A;  4DF8 A;  2ATL A;  4B9U A;  3FMW A;  2M3D A;  5LMN F;  2IYI A;  4M5J A;  1Q8I A;  1T7P A;  3H4D A;  3K8W A;  2L9W A;  4DR6 F;  4OX9 J;  2PFD A;  4OHZ A;  3RZA A;  1FJG J;  2MLY A;  3W64 A;  3PAC A;  2EWH A;  1N48 A;  4EGL A;  4C7Q A;  1FDD A;  2E5H A;  4H4M B;  1KLM A;  2VC1 A;  2GC8 A;  3TAN A;  3QWU A;  2QEX S;  5C24 B;  3TUJ C;  2R8H A;  1GMV A;  3RU0 A;  2VG6 A;  3DXB A;  4LR9 A;  2P6T A;  4A8Y A;  1DLO A;  2DNZ A;  3OJS A;  5KFP A;  1ZM3 A;  2MGZ B;  2CWX A;  4ID5 A;  4WU3 A;  3K5N A;  3G8T A;  3PHT A;  1X9S A;  1RWV B;  3H5X A;  1YJV A;  2Y1R I;  2E1A A;  1R6V A;  5C2G A;  3CDE A;  4JV0 A;  3QRR A;  2AEF A;  2CPJ A;  3AD9 C;  3EX7 B;  3PRD A;  2VL1 A;  4KPC A;  2NSB A;  4M1K A;  2IIH A;  1W26 A;  1GXU A;  4RW6 A;  3PTW A;  4J9O A;  2E5J A;  2GV1 A;  5JVH Q;  1REV A;  4LRF A;  2CPI A;  4JV2 A;  2JC0 A;  4YDD B;  1SIZ A;  3I31 A;  2HK2 A;  4ETZ A;  2XSF A;  3P6Y C;  2YX1 A;  3TVK A;  2ZH3 A;  3HHL A;  3TRG A;  3HKW A;  5F9N A;  2OD6 A;  3N6M A;  1N4L A;  3L7U A;  2N3O A;  4CP5 A;  3H59 A;  2PA8 D;  3BH7 B;  2QZ8 A;  2K1R B;  4ZN1 A;  4K5R A;  1KEK A;  3RR8 A;  4F0K A;  3P96 A;  4AFF A;  5DO2 A;  4ELU A;  3KDO A;  2R2R A;  1S9E B;  3BGF A;  4V19 J;  2RVJ A;  1KBR A;  4P2F A;  4FBU A;  3HVT B;  3POT A;  4DU7 A;  3IRX B;  1XR5 A;  5KFW A;  4OJG A;  4J37 A;  1NU4 A;  2W01 A;  3FKB A;  3HFK A;  2KG1 A;  4AL6 A;  4FNI A;  1XJW B;  2IRU A;  3QSY B;  3OTC A;  5LXY A;  3UW1 A;  5KT4 A;  1SJQ A;  1HNX F;  1RT4 A;  1AYE A;  1Y9O A;  3D0H E;  1D9D A;  4AUK A;  4DS4 A;  2YX7 A;  1RZM A;  4NML A;  1JWW A;  2MXY A;  2B4U A;  1DRZ A;  4IDK B;  1N5V A;  3QJP A;  3CDA A;  1UEK A;  4LF5 J;  2RU9 A;  3MR3 A;  2OD4 A;  3VF0 B;  3GWC A;  4R25 A;  4NLU A;  3LTO A;  5E3R A;  1BXN A;  2QG9 B;  2X7I A;  4QBU A;  1MLA A;  4N5S A;  4ZCM A;  4FPI A;  2PC6 A;  4C48 A;  2RD5 C;  5ETN A;  2E5G A;  3TO8 A;  3A8E A;  1FCA A;  4MKY A;  2CPZ A;  3ILO A;  5LJ5 Y;  3KLV A;  4LF6 J;  4IG0 B;  3RW6 A;  5GAG I;  2YPY A;  4UST A;  2XGQ A;  1H3D A;  1JIH A;  4ANC A;  3IN5 A;  1W7W A;  2KT3 A;  1SL0 A;  1GAO A;  5J2M B;  3JYT B;  4EMD A;  2ROG A;  1VQP S;  3U7J A;  3RRK A;  3DLB A;  2XNQ A;  2E7X A;  1Y00 A;  2BJ7 A;  1R8C A;  2YVS A;  1T05 B;  1WD6 A;  2BW7 A;  3H5Y A;  2BJ9 A;  3EVM A;  3DC2 A;  1S9F A;  3KLF B;  1C1B B;  2ZOG A;  4J7C A;  1K1S A;  2F40 A;  2UXB J;  2DO0 A;  3ETM A;  2VIC A;  4P2S A;  1D1U A;  1NDL A;  4DPW A;  4RUH A;  3BBC A;  1UJ6 A;  2C2R A;  1HMV B;  3CB4 A;  1RAJ A;  4TYB A;  3Q8U A;  1A6L A;  2ACY A;  3TAR A;  4MJK A;  1RAB B;  2D1C A;  2JDJ A;  3KJN B;  2XMV A;  4USJ C;  3N5B A;  2MB0 B;  1FJG F;  5C25 B;  2WOM B;  5BXI A;  5BR8 J;  4I2Q B;  2DHS A;  5HP1 A;  5HMZ A;  4N47 A;  2MSS A;  1ZZF A;  4P74 A;  4N8N A;  2DCL A;  4DPU A;  2RUG A;  1NH8 A;  5LXR A;  4AE5 A;  3BO2 A;  3OR2 B;  3M2R A;  1VQO S;  2CJA A;  2MY7 A;  3MCM A;  3KUG A;  3V81 A;  3WHI A;  2AJ1 A;  4ZLL A;  4OZJ A;  2Z4P A;  1T9T A;  3CJK A;  5L46 A;  1VRU A;  1VJW A;  2W2M P;  5GMK a;  2YNF A;  1IKY B;  4KE5 A;  2W7O A;  4WIQ A;  1IKX B;  3H2U B;  4N76 A;  2CG4 A;  1R8B A;  2KU7 A;  2VA3 A;  1S0N A;  5BJR A;  2F63 A;  3PW7 A;  1TK8 A;  3R1H A;  3H2L A;  1MN9 A;  4I4B A;  3JSY A;  5A8W B;  5CXT A;  4J90 A;  1K73 T;  3AY0 A;  2I0X A;  2XYH B;  3G86 A;  4ZVF A;  2YPZ A;  1FKP A;  4DU8 A;  1VBZ A;  1L3S A;  1NJX A;  4ZPV R;  5JUM A;  4WU2 A;  1HHT P;  1HWU A;  2GO9 A;  2HHS A;  1GT8 A;  3LAL A;  1TU0 B;  2DVI A;  1IM6 A;  1SUQ A;  4ED2 A;  3G96 A;  4GKK J;  3A13 A;  4ZP7 A;  1YJR A;  4J9S A;  3G8Q A;  3BQ1 A;  4G65 A;  4WII A;  4YQW A;  1K0V A;  3UDC A;  4WZQ A;  3BS9 A;  2ZH6 A;  3QO9 B;  5HVH A;  1KSP A;  2FJA B;  5FDL B;  1CJV B;  5KFO A;  4P7T A;  3NXZ A;  2IBO A;  4NOH A;  4DUZ J;  4DV7 F;  2W9C A;  1JJH A;  3ISZ A;  1FI4 A;  4DV6 J;  3RAQ A;  3MEG A;  3ONQ A;  4M5K A;  1F3F A;  3NCQ A;  2AWZ A;  5DET A;  3QGG A;  4HLB A;  1HBU B;  2WRM A;  3KLH B;  3FJ2 A;  5GAD U;  1WI6 A;  2OGU A;  2OEJ A;  3GIR A;  3SFG A;  3M8Q A;  3MF5 A;  4WXO A;  4QYR A;  3KNA A;  3NBP B;  2MZ1 A;  2ZUG A;  4QIE A;  5T41 A;  2QT7 A;  1DQ8 A;  1M5S A;  3IM8 A;  1QSY A;  3G6V A;  3FFI B;  2VC0 A;  3VAG A;  5KFJ A;  4PQU A;  4LF8 J;  4DL0 C;  4LF6 F;  1NK6 A;  3ITH A;  4TYA A;  1RTD A;  2ZBI A;  4RU2 A;  3PO4 A;  3KHR A;  1B7F A;  2HQ3 A;  2P5V A;  3SZ2 A;  3WIV A;  3H8Y A;  1SKW A;  1X31 C;  2O67 A;  2ZNY A;  4CO2 A;  2FLL A;  3R7N B;  5THW A;  4UOH A;  3CC4 S;  2O3D A;  2YWH A;  4I0W A;  4QU6 A;  3MM5 A;  1AT1 B;  1J2V A;  1DTT B;  5L39 A;  1S7I A;  3MTK A;  4LBH A;  1U0H A;  2DO4 A;  4QOT A;  2FYX A;  1RKI A;  1MWQ A;  5IT4 A;  5IQ6 A;  3PFO A;  2CWK A;  1CJT A;  2W9B A;  3BJY A;  2E1M C;  4KV8 B;  3D1O A;  2UVR A;  3OL8 A;  1VYA A;  1EP4 A;  2CQG A;  2XY6 A;  2H4Y B;  3W9I A;  3N28 A;  3Q22 A;  2KXN B;  1QAJ A;  2B56 A;  3K5O A;  1N36 F;  1SJ3 P;  3WC2 A;  2MQQ A;  4MYU A;  2XI3 A;  1BE4 A;  3LUY A;  5GAG U;  2WVE A;  3W7B A;  1RWX B;  2O01 C;  3P49 B;  4YB5 A;  1HYS A;  3UVJ A;  4YOE A;  4H4K C;  1VQY A;  2XLJ A;  1HHQ A;  4XO0 A;  2MZS A;  3ZNU A;  2UXC J;  2ZWP A;  1N0V C;  2HIQ A;  2YWK A;  2BOP A;  5AJ3 J;  5HL7 Q;  2ZKT A;  3JAM Y;  5F8G A;  3QJL A;  4OZ3 A;  3LP0 B;  2WON B;  3UDE A;  4P75 A;  3Q83 A;  1J5O A;  1TUW A;  4ZVP B;  3CCE S;  1HQE B;  2LXI A;  1N5T A;  4USM A;  2R8J A;  1I6J A;  2QLJ B;  1PC5 A;  1ZH5 A;  4ES1 A;  1MRO A;  2Y0S D;  3L95 X;  1G3O A;  2MZT A;  2EFG A;  4CDI A;  3D5M A;  2VUG A;  3BZQ A;  2V6A A;  1AB8 A;  2IMO A;  3CJS A;  4F67 A;  1UWB A;  2M0G B;  3KK3 B;  1RAD B;  1VLY A;  4B3R F;  2RSQ A;  1Y10 A;  4FZV A;  1SVD A;  3HT3 A;  2NQP A;  4NMX A;  2KVI A;  2BJ3 A;  1S1X B;  1KVI A;  3GFX A;  4MK7 A;  1LXN A;  1X4D A;  4GKK F;  1PCA A;  1L3U A;  2R7O A;  1O0P A;  3EMT A;  3TW0 A;  4LF7 J;  1G4C A;  3IBW A;  1URN A;  2LDY A;  4DX8 H;  2EG1 A;  3NLC A;  3EGZ A;  3Q86 A;  3B82 A;  1HPZ A;  4USK A;  2HGM A;  4L3N A;  2I5J B;  3VZI A;  1QAI A;  1PKU A;  1JKH A;  5T14 A;  1BGX T;  1T9X A;  3K57 A;  4DUZ F;  2LYV A;  4FN5 A;  4BHQ A;  1NXI A;  2DNN A;  4DV3 J;  4CI0 B;  3X1L B;  1OQ6 A;  3Q23 A;  2CVE A;  1ZPW X;  4DHV A;  1ZOT A;  2P9C A;  3O5T B;  4DLE A;  2DHH A;  1WC5 A;  1QLN A;  4ZP9 A;  1HNV A;  1GX6 A;  1S1T A;  2OPQ A;  4X62 F;  4B9V A;  2V69 A;  1FEE A;  4NA3 A;  3MCS A;  2KH9 A;  2KT5 A;  2CPY A;  3PFE A;  1Q53 A;  3AHP A;  2GJ2 A;  1NRK A;  1CLF A;  3C6U A;  1A0O B;  2SXL A;  2Y3Y A;  4Z7Y A;  1QTM A;  1ZAX A;  2FGO A;  1Q8B A;  3QLH B;  2HNY A;  2IM1 A;  4F7V A;  3PR5 B;  4DJB A;  2MKH A;  1LKZ A;  1G2E A;  1FJE B;  1U1L A;  2AF6 A;  4RW4 A;  4JOU A;  4LUB A;  2AU0 A;  2HND B;  4OV1 A;  1YJN S;  2XMW A;  4FXW A;  4IQX A;  5H9E J;  4P2X A;  2IM0 A;  1H2V Z;  1U24 A;  1FWL A;  3H5S A;  4PYD A;  3I56 S;  2GHP A;  4K59 A;  4NYO A;  2KG0 A;  3LQV A;  4MH8 A;  1SI9 A;  3W2W B;  3BKU A;  3A3N B;  4KSE B;  3MUV P;  4ELT A;  5MAO A;  2OPR B;  2JEJ A;  3UFC X;  3C15 A;  1LFP A;  4IFY B;  2BYC A;  1JLB A;  1FFS B;  3QFH A;  3AA9 A;  2HQD A;  3KKF A;  2LU2 A;  4ZLN A;  5ETP A;  1E6V B;  5HJX A;  3PW4 A;  1WC1 A;  3T41 A;  1TAQ A;  3Q24 A;  1OYD A;  1RQ0 A;  4NPO A;  4ZPT R;  2N82 B;  4ETX A;  1RHQ B;  3W65 A;  3TQ1 A;  3CUN A;  5AJ3 F;  5HAN A;  3MFH A;  3B54 A;  2J7U A;  3RRH A;  4HHU A;  3PKY A;  1X7V A;  1LWF B;  3W66 A;  1YRU A;  1UWA A;  3EGN A;  1RTZ A;  1N32 F;  4KGV B;  4DQI A;  3SEO A;  3LPE A;  1CC7 A;  1VK8 A;  2BM1 A;  5K20 B;  3SV3 A;  1WHX A;  1T3O A;  2HS3 A;  2MKJ A;  1S79 A;  3DYA A;  2GGP A;  2K06 A;  4DCO B;  3T5J A;  2AGQ A;  4NZ7 A;  2QTW A;  4XK8 C;  2JX2 A;  4DFJ A;  4YS2 A;  1K47 A;  1MN7 A;  5D0R A;  2B7B B;  4AYB D;  2FY1 A;  3TOQ A;  2MQ8 A;  5B08 A;  2B9Y A;  5DQG A;  4ZDN A;  3TZX A;  1NDP A;  4IFV B;  1CQN A;  3EPG A;  4LF7 F;  4I6W A;  4F3M A;  3CNQ P;  3DNC A;  3MM9 A;  4JI8 J;  3ICL A;  2HFO A;  2G1H A;  1JJ4 A;  1S57 A;  5DM6 Q;  3HUL A;  1YDL A;  4L73 A;  4OJH A;  2XHW A;  2F5G A;  1S9G B;  1TL1 A;  4B3S J;  1NZ8 A;  2YWE A;  4NLY A;  4AXJ A;  2RRA A;  4MKV A;  1VC0 A;  3IS9 B;  4I69 A;  4OX7 A;  4C6A A;  3C8Y A;  3I5B A;  2DRD A;  1Q8L A;  1EHW A;  1X4C A;  2VG7 B;  4OZ2 A;  3EZO A;  4RUA A;  2XWX A;  2Z58 B;  3IBF B;  3W62 A;  1SJR A;  3OT9 A;  4IO1 A;  4DSE A;  1WEX A;  2CPH A;  1JNZ B;  3T5L A;  2HVZ A;  4QWA A;  2GMH A;  3DOK B;  1SJ4 P;  2VQE J;  1HBM A;  1N88 A;  2DPJ A;  2G0J A;  5ETR A;  2OPS B;  1UJ4 A;  5E3P A;  1SQE A;  3P8B B;  1Q7Y T;  2XGP A;  1Y5I B;  3KXD A;  1RT5 A;  3SCJ E;  1VHI A;  3KLI A;  2CVI A;  2EG2 A;  2QL5 B;  5HLF B;  5KG2 A;  2CNL B;  4QR2 A;  1JLQ A;  2G2Y A;  1M1H A;  3OHA A;  4OX6 A;  4Q0B B;  1FNO A;  1JLC B;  4PG8 A;  1SC6 A;  2QL7 B;  2UUA J;  2ZM6 J;  4DN9 A;  3OTE A;  4LBP A;  3TX8 A;  4EO6 A;  3PIP Q;  3HK2 A;  4F36 A;  3W2V A;  1T9W A;  4LSZ B;  1YI2 S;  2KRB A;  2R7R A;  2J9D A;  4Q5V A;  3SQO P;  4UZC A;  4W92 B;  1I94 J;  1XMQ J;  1X9W A;  3PW2 A;  4JI2 F;  4TY8 B;  3TJA A;  4EZ6 A;  1ZA2 B;  3IFE A;  2B9W A;  3KHG A;  3T5H A;  2NS1 B;  1T8E A;  1RBL A;  1FJ7 A;  1FRX A;  4ZN3 A;  1VLO A;  1FVS A;  1FF2 A;  4F0M A;  3OL7 A;  2ZH1 A;  3PR4 A;  4DR4 J;  3FBE A;  1YKW A;  3RG6 A;  2IM2 A;  4QWE A;  4IH6 A;  4J9L A;  1R0A A;  1UFL A;  2MMY A;  4ALZ A;  5M2R A;  4PXB A;  1N6Q A;  3HHK A;  4FF3 A;  1U1Q A;  4IRC A;  2AJF E;  4LIR A;  5D0G A;  2I2Y A;  5HSP A;  4L3K A;  5ADZ A;  4TQR A;  2N3L A;  3MEK A;  1HWI A;  4DQP A;  2UUW A;  1PSD A;  1NKE A;  2DH8 A;  3K5L A;  2QV6 A;  4B17 A;  5CYQ A;  3TJ8 A;  1HNZ F;  3EXC X;  3V6H A;  2J6S A;  2NYI A;  2C3M A;  2LP4 A;  2D9P A;  2JL9 A;  2VBY A;  1LFW A;  5B0F A;  4URG A;  4MIW A;  4DQR A;  1HW9 A;  1OO0 B;  2BM0 A;  2R7Q A;  2XY7 A;  1WKJ A;  2UZA A;  1WC3 A;  4JBC A;  4WXW A;  1IKV A;  1TV6 A;  2PI4 A;  1FDN A;  2DNH A;  3CDU A;  2ZBQ A;  3KLE B;  6FDR A;  1MWZ A;  2C3Y A;  3DKD A;  4D3H A;  1TUG B;  3CCT A;  1X0P A;  3SDE B;  4JI4 J;  5KG6 A;  2XSJ A;  5I3Q A;  2GVZ B;  3AOB A;  3PJW A;  4DDF A;  3DLG A;  4BWM A;  4QIV A;  2R8I A;  2BQ3 A;  2MHN A;  2GO8 A;  2CAJ A;  2A0F B;  3DN9 A;  4F04 B;  2V67 A;  1D09 B;  3DM2 B;  3V6D A;  2JLE A;  1F5B A;  4JI5 F;  4NI2 B;  1YTY A;  3ZFV A;  4NLW A;  3CVK A;  3F44 A;  1VS3 A;  3I0S A;  4E2F B;  1SH2 A;  4ECW A;  3C14 A;  2MDA A;  4KHP J;  3WQP A;  2XMK A;  4B3S F;  3I0R A;  5DQH A;  1KQS R;  2R7S A;  3HCX A;  3UDV A;  2GHW A;  1SJ1 A;  3E3X A;  4IR9 A;  4KKO A;  1ZYQ A;  1JLE A;  4DZD A;  3NG8 A;  2HHV A;  2JLF A;  3OTD A;  2FLN A;  1U2R A;  1TKD A;  1KFS A;  2DGW A;  2PMW A;  3KLG B;  4PR6 A;  1RWN B;  2R7V A;  2W4D A;  2ZHB A;  3PZP A;  3VGV A;  1TKX B;  3QJJ A;  4ENO A;  1Z2Z A;  4WE1 B;  2WVD A;  2RS2 A;  4KO0 B;  2M52 A;  1JLF A;  2OTJ S;  4M5M A;  2ZZT A;  2XCP A;  4FXD A;  1X8D A;  3FQL A;  4NLD A;  3J7Z T;  2W2P P;  4B02 A;  3C16 B;  4ED1 A;  2F8H A;  3MR7 A;  2ASY A;  2UUA F;  2L9D A;  5D4O A;  2ZM6 F;  4OYO A;  1LWC B;  4FS2 A;  4WZM A;  1R8A A;  4KGM A;  5AE1 A;  2RKI A;  3PW5 A;  4N77 A;  2EEY A;  1I94 F;  2V68 A;  1HNI A;  2ZZN A;  1GTH A;  5I3U A;  2RF2 B;  1S6O A;  4C0B A;  4P7V A;  4PWU A;  4NA2 A;  2FJD B;  1NPP A;  2HHQ A;  3AB4 B;  4F4Y A;  3T1Y J;  3OLA A;  2L08 A;  1DBD A;  2NZ4 A;  3HSZ A;  5DDO C;  4LMZ A;  1VQM S;  1V9O A;  4MMO A;  2YNI B;  1KOH A;  2R7U A;  4O3S A;  2UUC J;  3UN3 A;  3MPV A;  1GH8 A;  4MKA A;  3DLH A;  3W8P A;  2B0G A;  2FB0 A;  3VZH A;  2AKW B;  2Y0B B;  1UL3 A;  2FHM A;  3M2V B;  1Y3J A;  5E0O A;  4DL5 A;  4J9N A;  4OQJ A;  2R7T A;  1P1L A;  1QAY A;  2VFR A;  2YX4 A;  3NRB A;  4ZVS B;  3NGS A;  3BYP A;  2CQH A;  1U8S A;  2WW4 A;  2DPI A;  2R9L A;  1QDU B;  2KO1 A;  4CO4 A;  1NDC A;  1GXL A;  1S6Q A;  5EN1 A;  1GNK A;  3HPO A;  3CIZ A;  1LOU A;  4Z7C A;  1F2H A;  1PJ7 A;  2L48 A;  2FVP A;  1VQK S;  2M9K A;  4NRT A;  3BB5 A;  4C3M A;  2CJY B;  3U1M A;  4DV5 J;  3OXL A;  2JSX A;  5A8K A;  3RB0 A;  1Y3K A;  2CQC A;  4ZP8 A;  1PAU B;  1WI8 A;  3WX8 A;  4K4W A;  3MCN A;  2ZH7 A;  2CIM A;  3ISN D;  4UOF A;  1Y0H A;  3M30 A;  4CLY A;  2HWI A;  3EZU A;  3VV2 B;  3QZ7 A;  2GHV C;  1GMU A;  4WP3 A;  1T0T V;  1SV5 B;  5HQ8 A;  3R5J B;  2VQF F;  4UY8 T;  5KG5 A;  1H6K X;  4MTP A;  2HFZ A;  3HHL D;  2PII A;  3O6Q A;  4JV5 J;  1M5K C;  5JVG Q;  3F41 A;  4K8R A;  1RT4 B;  4HT7 A;  3D1H A;  1VBY A;  5F3T A;  4CLW A;  5L9N A;  2E9Z A;  2EBE A;  3ZZP A;  1S1U A;  2ILZ A;  2QA2 A;  5CQG A;  3CE8 A;  1HQU A;  1IM4 A;  5KFB A;  1FFG B;  4HH0 A;  2O1P A;  4K5S A;  1UVJ A;  1NK9 A;  2ZBP A;  3EVO A;  1RK8 A;  1LEO A;  5LSL A;  2HQG A;  1VCT A;  5CYM B;  2RHQ B;  3NAH A;  5K9F A;  2LQJ A;  2BAN A;  4KFB A;  2B6A B;  5K8M A;  4DR1 J;  1NSK L;  2HRT A;  1CS4 B;  4QPX A;  2ZH4 A;  2IJF A;  1C1C A;  3M1V B;  3BGU A;  1U48 A;  3V6J A;  5D0E A;  4ECT A;  2F8M A;  4ZCK A;  2AP6 A;  3CMQ A;  5M2U A;  5KG1 A;  2GQ2 A;  5AXN A;  3NMA A;  4P52 A;  4WWS A;  2XI2 A;  4CQ1 A;  3BSC A;  3OLB A;  2LMI A;  3M32 A;  4S0M A;  5J1P A;  4WTY A;  1QUV A;  2AYE A;  2J0S D;  2ZD1 A;  2WZ1 A;  2RH3 A;  1NK5 A;  2B3T B;  1N34 F;  1HBO A;  2UV8 A;  5HRO A;  4DQQ A;  1D0E A;  2C22 A;  3IRW P;  1VQ7 S;  1FJC A;  4OYP A;  3ILI A;  2HEK A;  3UNY A;  3OBI A;  2DGX A;  4X4R A;  1NB7 A;  4NXM F;  5KFE A;  4OLP A;  3GIK A;  4FBT A;  3IG1 A;  2UU9 J;  1IBM F;  4YN3 B;  4IH5 A;  4R8U B;  4NCG A;  3CF5 Q;  4RKU C;  3D7S B;  2G0I A;  3BDE A;  2AIR B;  1RUS A;  1AXQ A;  1X4B A;  4WP8 A;  2UUC F;  3ETO A;  1IBL F;  4IOA Q;  4I7F A;  2IAJ B;  5D6G A;  3Q89 A;  1TK0 A;  2ZVS A;  1PC4 A;  1I5O B;  3EZ5 A;  2COL A;  3FGV A;  3AQP A;  2CYY A;  4C0O C;  2N4C A;  2BKN A;  4I56 A;  1RAE B;  3PNI A;  5FII A;  1H74 A;  2B7C B;  2Y1L B;  3CJ8 A;  3M6W A;  2YNF B;  3V4I A;  3GYX B;  1BQM A;  2DY9 A;  4EEY A;  4KC5 A;  1LW0 A;  3MM7 A;  2IDL A;  4FKY A;  3QNW B;  1N5Y B;  3ET6 B;  5B7W A;  4OI3 A;  1MG7 A;  4F50 A;  1YZ6 A;  1C0U A;  2ALY B;  2FGC A;  2NUU G;  4DV5 F;  1FKP B;  4ZCL A;  2E7W A;  4XDD A;  2NLW A;  3B4M A;  5L1L A;  4X65 F;  3H90 A;  3NCR A;  3BSN A;  1CUL B;  4ILR A;  4YB7 A;  1E6Y B;  3O1L A;  3J7Y I;  2DJW A;  5FJ4 A;  1SUQ B;  1LWE B;  4Y2A A;  1RTJ A;  5I3P A;  5EWG A;  5J1N A;  2D7S A;  1CSJ A;  4QWD A;  3QGP A;  4MT1 A;  3LAN A;  2AW0 A;  4KTQ A;  2AJ0 A;  3AXK A;  4KGK A;  4YHH J;  3H25 A;  4C8N A;  1S0O A;  2AT1 B;  4LFC J;  1HNW J;  5BYR A;  4UW2 A;  4JV5 F;  1S1W A;  3E51 A;  3CCM S;  3R27 A;  1Q79 A;  1QD1 A;  4NEZ A;  1L3K A;  4X2B A;  2M7S A;  4ICL A;  2F8E X;  3GFY A;  3MEG B;  2Q6B A;  3ZO7 A;  1VC5 A;  4HDG A;  4GVB B;  4ZHR A;  3Q8R B;  3BSO A;  1NM2 A;  3AAW B;  1I51 B;  3UCU P;  3M8Q B;  3TX0 A;  5BYQ A;  2FQQ B;  3LP1 B;  2R3V A;  4CH1 A;  2R42 A;  2AZ3 A;  2YKA A;  5FD1 A;  3F0N A;  2HHH J;  2HMI A;  5E5N A;  3JSM B;  3KWM A;  3MPD A;  3H40 A;  4YB1 P;  4U7U D;  4U96 A;  3LAM A;  2CQ0 A;  1P9Q C;  1NPK A;  1KD1 T;  3ITH B;  2D3O 1;  1M5H A;  1RTD B;  1RT7 B;  4EU0 A;  4W90 B;  3HD2 A;  5K14 A;  1RDR A;  4OI6 A;  2OI2 A;  2HSE B;  1Y7P A;  5B0A A;  2KN4 A;  4Y3C A;  1VQ5 S;  3DRS B;  1F0X A;  2E5L F;  4ID8 A;  3KJF B;  1QM9 A;  1B0T A;  1LK5 A;  1URR A;  1TKZ A;  4PYA A;  1ELO A;  4FVM A;  1EAY C;  3T1H J;  1NPR A;  5EX0 A;  1VHF A;  3MM8 B;  5GMD A;  3HX9 A;  1NHV A;  1MMN A;  3P4U B;  1FKO A;  3ULH A;  2CDR B;  2MKS A;  5EX3 A;  1R8H A;  3CCZ A;  4USH A;  3BH6 B;  3E8O A;  2HHP A;  1WDD A;  1CJT B;  3DLK B;  4XDC A;  4DSF A;  2BJ8 A;  1K8A T;  1NCL A;  4OYA A;  1FDA A;  3TYT A;  3VTI A;  2RB7 A;  5C42 A;  4MK8 A;  1X5S A;  9ATC B;  4CYU B;  3GB0 A;  4OHX A;  2B5J B;  4NE9 C;  2AX0 A;  4C8K A;  1Y5L B;  3DI6 A;  2OFH X;  1RE1 B;  3D0I E;  4O3N A;  2JHE A;  4U9R A;  4Q44 A;  1YK9 A;  4JI3 F;  4J9M A;  1UKU A;  1GMW A;  2YKN A;  3OFE A;  1XK8 A;  4FYX B;  3DLE A;  3J7A N;  1RTI B;  1ROF A;  4DN0 A;  2DK2 A;  3GSI A;  1MU2 B;  4LF9 J;  2Q79 A;  2X1B A;  3VR1 A;  5KFU A;  5M2P A;  4NZ0 A;  3TZY A;  3WBZ A;  2HFS A;  2ZHA A;  2JOQ A;  1CJK A;  2MHE A;  1A9N B;  4XIU A;  1IBC B;  2XZD B;  4PXE A;  3PYE A;  3GPA A;  5U47 A;  2NPF A;  1I3O B;  4F0H A;  3BQ0 A;  4LF2 A;  1MRO B;  1U1R A;  2EI5 A;  4X64 F;  2DR5 A;  2GJI A;  4Y0F A;  4LFA F;  4YR3 A;  1ICE B;  2KHD A;  2KB2 A;  3DGP A;  3AD8 C;  2HZV A;  5IZH A;  3HP6 A;  5LOQ A;  4LIW A;  1KVJ A;  4DLG A;  4HR2 A;  2EW9 A;  4QZV B;  3AD7 C;  2DNL A;  5EWE A;  2QSF A;  4AL5 A;  4Y6I A;  3N6L A;  7FDR A;  1SQF A;  1WJ9 A;  4RZR A;  2VIH A;  3J7Z 5;  4DMZ A;  1F2G A;  2HS4 A;  1AUD A;  2IPO B;  3MEC A;  5D3G B;  3HJF A;  3EJM A;  1IVZ A;  2ZJQ Q;  1XC9 A;  4KHR A;  4A8W A;  1FRK A;  1EAR A;  4E98 A;  5DLG A;  5C5J A;  1EET B;  2V8P A;  4TU7 A;  3OV7 A;  2XM3 A;  5IC4 B;  2KJW A;  3NGR A;  4ZJL A;  4O4R A;  4EYI B;  1HPZ B;  3AT1 B;  2V2Z A;  4NLX A;  1HNW F;  4TXS A;  1RBO B;  4CLK A;  1JMT A;  3D3C J;  4KY3 A;  3K0J A;  4A48 A;  4TU8 A;  3FC9 A;  3G8S A;  2DY1 A;  4ZA1 A;  1UVK A;  1FWP A;  2QRR A;  3D6H B;  1QJH A;  1IBK J;  3CCV S;  5C24 A;  1IWA A;  2E66 A;  3QRQ A;  3NCP A;  4K4T A;  3FDS A;  2HIY A;  2IYG A;  4O3P A;  2FDN A;  4ZPD A;  2Z2L A;  4LRE A;  4ELV A;  4RWW A;  2HAF A;  7FD1 A;  3LWL A;  2AEM A;  2NCK L;  5AE3 A;  1AUS L;  3UN5 A;  4M8L A;  5LJ3 Y;  2YNH B;  3C6U B;  4KT0 C;  4KH1 B;  4RNF A;  3BPS P;  1P9Y A;  2F4F A;  1ZET A;  3PRB A;  2FY8 A;  4M94 A;  1JB0 C;  2ZOF A;  4YY3 J;  2VBZ A;  2MPU A;  1FHT A;  2JEG A;  3ZTO A;  1UAW A;  4RW4 B;  4CLT A;  3MOZ A;  4RU9 A;  3DLJ A;  3N4W A;  2GMJ A;  5CCM A;  3V2U C;  1J27 A;  2V4Q A;  2MY8 A;  3Q8Y A;  2MJN A;  5LMN J;  2QX0 A;  4KB7 A;  2DCU B;  4B3T J;  4GO7 X;  1RAH B;  3CDB A;  3UPF A;  5HVG A;  2HBZ B;  1EKS A;  1Q7L B;  3Q0A A;  4HYK A;  1S9E A;  4B9M A;  1TL5 A;  1IUJ A;  1OIA A;  3H4B A;  1KOO A;  4PUO B;  2H48 B;  4FVC A;  3M05 A;  2XQC A;  4UY8 5;  2V4J A;  3M9O B;  3HVT A;  4PG4 A;  3VVU A;  2UUB F;  3PEJ A;  3G82 B;  1TKT B;  1HI8 A;  3MHY A;  2MYF A;  4ECR A;  4RJV A;  3PHE A;  6FD1 A;  3AJD A;  2V8D A;  2IRY A;  3MGJ A;  1WTF A;  3MEE B;  5D0H A;  3WC0 A;  2VU5 A;  4LSN B;  2KRR A;  3G2X A;  2QC3 A;  5KFT A;  4IDK A;  1FRI A;  4KR0 B;  2AYG A;  3N79 A;  2QO3 A;  1R7I A;  3DLL Q;  4HAC B;  4XAK A;  4K2X A;  1XWL A;  2IJN A;  2HHX A;  2PI5 A;  1ZPV A;  2OPP B;  1U6Z A;  1CG2 A;  2HNZ B;  2LQ9 A;  3LPY A;  2QIF A;  1BD6 A;  2OML A;  2DR6 A;  2HQC A;  4RL1 A;  1RGV A;  5L1K A;  5J2P A;  3R97 A;  4HTJ A;  3PYF A;  4DFP A;  2ZDO A;  4IG0 A;  3AJ1 A;  2RDJ A;  5SZT A;  2NUH A;  4DWI A;  1RHR B;  4C98 A;  3UD3 P;  3PXG a;  4WBF A;  2N7C A;  5J2M A;  3M8Z A;  3FCW A;  1Q1K A;  1H38 A;  3QRP A;  3JYT A;  4FF1 A;  2H1Y A;  2K7J A;  4DV2 F;  3EE3 A;  1XIQ A;  4B08 A;  1WUU A;  5K5M A;  3MMB B;  4HHH A;  3IM9 A;  1BWE A;  1T05 A;  2XO7 A;  2KT2 A;  5ETV A;  4CT8 A;  1QE1 A;  3D68 A;  4FYD A;  3MD1 A;  5E3A A;  5KFV A;  3KLF A;  1S5Z A;  1C1B A;  3CCQ S;  4Q2L A;  2GA7 A;  1T9Y A;  3EUN A;  2X1F A;  2YH1 A;  3MM9 B;  4PG5 A;  2LEP A;  1HNX J;  1F3V A;  3FRZ A;  4IYQ A;  1BQX A;  1TL1 B;  2XMU A;  4U8V A;  2ADB A;  1R0B G;  3IWL A;  1S10 A;  4AL7 A;  1HR0 J;  4I2P B;  3KG0 A;  1RT6 B;  5C25 A;  2WOM A;  4I2Q A;  3M6X A;  1VQL S;  1RU2 A;  2B4O A;  4HKQ A;  5CZV A;  4HTI A;  1IBK F;  2F3J A;  4NYP A;  2CQ4 A;  3K58 A;  1VMB A;  1MNE A;  5B0G A;  2WVF A;  3HO1 A;  3OR2 A;  2UXD J;  4FYV B;  1RT5 B;  2MQM A;  4QQB A;  3KLI B;  3QZ8 A;  3JQJ A;  1H0H B;  3R6G B;  5IC6 B;  3CD0 A;  5B0C A;  5DDP C;  3TI0 A;  1SL2 A;  1RP5 A;  1R27 B;  3RJM B;  4X4N A;  1EX8 A;  1UCN A;  2R4F A;  1XR6 A;  5G0R A;  4FXV A;  4JI1 F;  4NXN F;  4RLE A;  2BQU A;  3ZTR A;  1HI1 A;  3AOC A;  3BGR B;  1CQM A;  2BKO A;  3MTJ A;  1U6F A;  2QGF B;  3HZG A;  1WOP A;  5A8W A;  2GIR A;  3EPI A;  3MAA B;  1GQE A;  4HEA 9;  2CXE A;  2GAH C;  2ZVI A;  4RBV A;  3LGH A;  3VGU A;  2BA9 A;  2ZC3 A;  3BN7 A;  4CLL A;  2JFD A;  3DDK A;  1Q82 T;  2BVZ A;  3W3S A;  2RE1 A;  2ZDP A;  4B3T F;  4GKJ F;  4YEA A;  1YQH A;  2Q43 A;  2V9W A;  2A2D A;  2Q6C A;  1U49 A;  5J2N B;  1RAC B;  3WDO A;  2V0N A;  4DR2 F;  4N41 A;  3W5Z A;  2C2K B;  1X9M A;  1IXK A;  1N56 A;  4LVO P;  4W4M A;  4PEO A;  3KJQ B;  1W2I A;  2HBR B;  3FNN A;  5IXU A;  2QLB B;  2G1D A;  1N6Q B;  3QO9 A;  2BDP A;  4DL2 A;  5FDL A;  1XNQ F;  2VOP A;  2YWF A;  2B43 A;  1CJV A;  1DTQ B;  2M70 A;  4X66 F;  1H98 A;  4RPF A;  3FCH A;  3JTP A;  5T7L B;  4J9R A;  1TFW A;  2IVF B;  4QWC A;  3BO4 A;  4PXC A;  2VPW B;  4G1I A;  2PE8 A;  5F8N A;  3D6T B;  1S4E A;  4LF1 A;  3IBC B;  4CNZ A;  1HBU A;  3KLH A;  3HZE A;  2IVM A;  4F4X A;  2KI2 A;  1FT8 A;  2B8Q A;  2RQ4 A;  2C2M B;  3PG9 A;  2HKE A;  4A8K A;  2EXU A;  1MWY A;  3FFI A;  1IKV B;  2G9O A;  1F5A A;  2DGV A;  3VVT A;  4CCH A;  5GAD I;  2H3E B;  4C8L A;  5D77 A;  3GQC A;  1VBX A;  1D8Y A;  2FVC A;  4M63 A;  1IWG A;  2PEH A;  4ZMM A;  2HGN A;  2OEM A;  3UR0 A;  1Q95 G;  3DLG B;  4BBY A;  5A2Q U;  1RT3 B;  3OQ2 A;  1IR2 A;  3CPW R;  2KFN A;  4F2R A;  2RDI A;  1JK9 B;  2XC9 A;  1U2C A;  5IS2 A;  1DTT A;  4N56 A;  3SFU A;  3KFW X;  4ED5 A;  1FER A;  1CJU B;  3AOD A;  3TQE A;  1D9F A;  2FUG 9;  4U6P A;  1RLC L;  4DF4 A;  2V2V A;  1GK8 A;  4DR7 J;  3MD3 A;  4H4O B;  1FK9 B;  1OPI A;  3CTR A;  4Y65 A;  5HN0 A;  4DV7 J;  1NEE A;  5KOX A;  4X84 A;  4KHM A;  4KV8 A;  3OSP A;  4U7C A;  2AYM A;  3UCG A;  3WIU A;  1KKH A;  1HR0 F;  1RHU B;  2AEJ A;  2QA1 A;  2QA4 S;  2HQF A;  2MKY A;  3TVZ A;  1X4H A;  1FE4 A;  3TAQ A;  3PCO B;  4FS1 A;  4DV4 F;  1K9M T;  2OEL A;  2KYX A;  2UP1 A;  5JXS A;  1WSV A;  2B8P A;  1PJ6 A;  4LRB A;  2QJ3 A;  3CJ5 A;  2O5D A;  3NWR A;  4F26 A;  1H2T Z;  3HM9 A;  3PEH A;  1RWO B;  2UXD F;  3X3U A;  1F60 B;  4Q8F A;  1C4A A;  3LP0 A;  3RB4 A;  4PAB A;  1JLF B;  1T9V A;  4NA1 A;  1HFE L;  2J9D E;  2MZJ A;  3GJS B;  3MR6 A;  5ETM A;  4PWD A;  3MUR P;  2DGT A;  4O3Q A;  4WFA Q;  1HQE A;  5DG7 A;  2CQ3 A;  3IA0 A;  1RCX B;  3DOL A;  2OHD A;  1KN6 A;  3OFG A;  1TL7 B;  1O6X A;  3HMJ G;  1HNI B;  1FES A;  5K8N A;  4J9V A;  2KFY A;  4ZVE A;  4J9K A;  2OKQ A;  1QUP A;  3US5 A;  4DG1 B;  3M8Y A;  3KK3 A;  2AJ2 A;  3C6T B;  2EK1 A;  3NOC A;  5KT2 A;  1WC4 A;  2KTQ A;  3W5Y A;  2WW8 A;  1N36 J;  1REG X;  1IR1 A;  2D41 A;  2ZH2 A;  4BWJ A;  1ZAW A;  3E01 B;  1S0M A;  1RT1 A;  4JI7 F;  2ZJP Q;  4K4V A;  3H0P A;  2XUL A;  4K0K J;  4USU A;  3T6B A;  2GVD A;  1UFW A;  2I5J A;  2YXL A;  3HVA A;  2EBG A;  3KHL A;  1FXD A;  1BUX A;  1RYR A;  4Y28 C;  3RBZ A;  5HBM B;  4F3Q A;  4ZPW R;  5DGB A;  2XBP A;  3N6N A;  2BMB A;  3VQT A;  1JX4 A;  4J9P A;  1P8G A;  2CKW A;  3D0G E;  3KNG A;  1KNZ A;  2AD9 A;  2FVR A;  1G7C B;  2CZV C;  2GFF A;  2IC3 A;  2NZC A;  1U02 A;  2WAQ D;  2W4C A;  5HJY A;  5A8K B;  3CO9 A;  2X3G A;  4X4V A;  4FPR A;  4OJ3 A;  3BQ2 A;  3SXL A;  4F8R A;  3LP2 B;  4P71 A;  4RNN A;  3J81 j;  2OUG A;  3OFH A;  2WB1 D;  3M9M B;  2DNY A;  4M5I A;  3QT7 A;  2M88 A;  3MPW A;  4B3R J;  3IGV A;  3M4X A;  3QLH A;  1WF1 A;  5KT3 A;  1FEH A;  2BRK A;  3QT6 A;  3SSS A;  2CQ2 A;  4DOZ A;  3TWZ A;  4LRD A;  1RHK B;  3A3O B;  2JNJ A;  2XZT B;  2HND A;  4X4U A;  4ZPA A;  1UMJ A;  3GV7 B;  4Q43 A;  4IO9 Q;  2EKY A;  5GAH U;  3CCU S;  5KFR A;  3UQS A;  4QWB A;  4C2M A;  4DR7 F;  5DLF A;  1JLA B;  1NND A;  1P6T A;  4RNM A;  2FC8 A;  2MQO A;  3W2W A;  2FJV A;  3K59 A;  4M5D B;  5KFA A;  1HQU B;  5J2Q B;  5A0Y B;  4RUB A;  1OY9 A;  2OPR A;  1WEY A;  5F9L A;  3CJR A;  2WVC A;  1VI7 A;  3OTO J;  3SCK E;  4MIA A;  4IFY A;  1PBA A;  4JI0 F;  4JYA F;  4DUY J;  4JI6 F;  2PSZ A;  2CQP A;  1E6V A;  3NNH A;  1S99 A;  2K3K A;  1UA1 A;  4LQ9 A;  2XLI A;  1VFJ A;  3OFF A;  2V34 A;  3GG0 A;  2MQN A;  4X62 J;  4M5G A;  4FDF A;  1M0S A;  2YNG B;  4ECX A;  2E44 A;  3OW2 R;  3CC2 S;  3KUH A;  3MXH P;  1RT2 B;  3NMR A;  3ENA A;  2DHX A;  2CUY A;  3PJX A;  3UR3 C;  4XPC A;  1LWF A;  4OYZ A;  1HD0 A;  4A8O A;  4OYI A;  4KQZ A;  5CCL A;  3M8W A;  4MIB A;  2DBB A;  1NJW A;  2Q1L A;  2FZC B;  3DFE A;  1R8P A;  3CJ2 A;  2QMX A;  4EFA C;  5ETO A;  4RBT A;  9RUB A;  5HRO B;  4I67 A;  4ECZ A;  4A8Q A;  3BGO P;  1TTH B;  3O8W A;  3VHQ A;  1X4F A;  5LSR A;  4ZJQ A;  2GAG C;  4CO3 A;  1SC1 B;  2APO A;  1RHM B;  2YH0 A;  5IM0 B;  2MLZ A;  1DHM A;  1XR7 A;  2XHC A;  2JJ4 D;  3JTO A;  4MFB B;  4J91 A;  1EIY B;  2RDD A;  2Q3P A;  3QAT A;  1UET A;  4A46 A;  4IFV A;  3GCW P;  5CD4 A;  5L1J A;  3CCR S;  2P6S A;  1WDT A;  2KYZ A;  3FZ2 A;  3W63 A;  1YG0 A;  1S9G A;  2LVW A;  5GME A;  2AJ4 A;  1S6P B;  4C3L A;  4K0K F;  3IWX A;  4DR3 F;  3GFZ A;  4KJI A;  4XTT A;  3IS9 A;  1TVR B;  3C19 A;  1RKJ A;  1G1X A;  4DBQ A;  3SSQ A;  2JFK A;  3I4H X;  4F4A A;  4KPY A;  2DIT A;  3MM7 B;  2VG7 A;  2BRL A;  4DV0 F;  5L38 A;  1FKA F;  5KFY A;  3W9H A;  2RRN A;  4H4K A;  1N32 J;  3PIO Q;  5BYS A;  5IWA J;  1B0V A;  4FNH A;  2I6W A;  3DOK A;  2BE2 B;  4GC6 A;  3AJ2 A;  1U26 A;  3HSD A;  3GIL A;  2HVE A;  1DZ5 A;  1KS2 A;  3I4P A;  1CBK A;  4OYW A;  4EUV A;  4YP3 A;  1LQ9 A;  1EB0 A;  3GU0 A;  2O66 A;  2D74 B;  4EI2 A;  4XPE A;  3IR7 B;  4IG3 B;  3LH2 S;  2QMW A;  3GJQ B;  3I32 A;  3G6Y A;  3KK1 B;  3JSR A;  5HLF A;  4PZV A;  4WKR A;  4Q0B A;  2DXF A;  1JLC A;  1LW2 B;  4F4Z A;  2C2D A;  3MCO A;  4BC7 A;  5AXK A;  5C7P A;  1S77 D;  4Y2C A;  2U2F A;  4RW7 B;  5F0W A;  1Q4R A;  5HAO A;  4B9L A;  1RTJ B;  4CWB A;  2CZ9 A;  3D66 A;  3IMQ J;  5KFK A;  3DRY A;  4DCJ B;  2HHT A;  3UI3 A;  1FD2 A;  1UVN A;  1RB0 A;  1NK0 A;  2FHJ A;  2D3U A;  3CJ4 A;  1T94 A;  3PM9 A;  4E8U A;  1B70 B;  2IJR A;  2AHO B;  2VFV A;  4TY8 A;  3L09 A;  2DHA A;  3RB6 A;  1JXV A;  2WSF C;  1DQA A;  1EJ7 L;  2E1P A;  4DPX A;  2MKI A;  2I1R A;  2AX1 A;  1YBT A;  2AZ1 A;  2ILY A;  2OIH A;  3L7O A;  3MED B;  2FD2 A;  4UUW A;  4PCQ A;  3MI7 X;  2RS8 A;  2PN6 A;  2VB6 A;  4NAS A;  5KG0 A;  3CXC R;  1M90 T;  1FE0 A;  2XZW A;  5ETL A;  1LV5 A;  1UZH A;  2L3M A;  3RUB L;  2HRU A;  5AXM A;  3OTO F;  4DL6 A;  2LCW A;  1NB2 A;  4DUY F;  3J7A 1;  4DEZ A;  1TMM A;  3UNG C;  2FJW A;  4K4Y A;  1QTN B;  3GIJ A;  2KFZ A;  1RAG B;  4LSL B;  2YKM B;  2CQD A;  3CME S;  1OS5 A;  1J5E F;  1KR4 A;  1WOO A;  2P9E A;  5KFX A;  4PG6 A;  3PY8 A;  3T9N A;  1TZ0 A;  4LRA A;  1KRP A;  3NGD A;  2F4V F;  3NOG A;  3HKZ D;  2QLW A;  4KYZ A;  2CJ9 A;  4KAI A;  3G4S S;  4O0I A;  3OXG A;  1KDN A;  2FHK A;  2G2Z A;  1S1V B;  4MKB A;  5KG4 A;  5DDR C;  2UVU A;  2XMJ A;  1UVI A;  4JB8 B;  1C0T B;  2J7W A;  4JI2 J;  4OHV A;  1Q0N A;  1YRX A;  3GMG A;  3PYG A;  3KLE A;  4B3M J;  5CH7 B;  2WSE C;  2CJX B;  3S1T A;  4PKD B;  1UVM A;  1PBU A;  4RUC A;  2FTR A;  1IQZ A;  3M8P B;  3KK2 A;  3EWG A;  3CED A;  1PYO B;  5DZ6 A;  1YSJ A;  5CD4 H;  2GVZ A;  1NDK A;  1BC6 A;  4UOG A;  3D6M B;  1EQM A;  4RX6 A;  2DH7 A;  2E5I A;  1OYE A;  2GIF A;  3RBX A;  3OR1 B;  4FKX A;  1VRQ C;  5KOW A;  3CCS S;  2HHW A;  3DM2 A;  1ZTT A;  2QYG A;  2DH9 A;  2ZUA A;  5B0B A;  1Y4Z B;  1FXL A;  1KQK A;  2QN6 B;  3ZZO A;  1VOM A;  4DR5 J;  1KWM A;  1HLW A;  3KUE A;  3ZZ0 A;  1FNX H;  3TUZ C;  4ILM A;  3DLE B;  3K17 A;  4ES2 A;  2DHG A;  5E7O B;  1P27 B;  1TL3 B;  1HNZ J;  1WEZ A;  2VFT A;  2ACM A;  2Z2Z A;  1U25 A;  4Y2M A;  3JQM A;  4NLT A;  4CTA B;  2IMW P;  5D4N A;  1NSP A;  3HVR A;  4WJB A;  4ED4 A;  2M4M A;  5IWA F;  3CD5 A;  3Q8V A;  5KFF A;  2W2N P;  3BN4 A;  3ZZZ A;  5E33 A;  1S6U A;  3OTB A;  3TA2 A;  3KLG A;  3TAM B;  3O2I A;  1S0V A;  1GMW D;  2MZQ A;  1WHY A;  1IKW B;  2ZH5 A;  3GTY X;  1TKX A;  4TNO A;  5ETS A;  4WE1 A;  5A8R A;  3Q2T C;  2MLX A;  2CDQ A;  1NLK L;  1BHN A;  4ED3 A;  3LGM A;  4TKT A;  3Q2S C;  4KO0 A;  3JTN A;  4G1Q B;  1H7W A;  5J1E B;  4CM0 A;  1AZS A;  3G6E S;  3N0V A;  3THP A;  3KMQ A;  2BZ2 A;  3C16 A;  3KTQ A;  3RTV A;  2R7X A;  5LL6 d;  3DRP B;  1M5P C;  2ASD A;  5A6W A;  3NGU A;  3ZZR A;  2Z56 B;  4C8O A;  4P2M A;  1LWC A;  3BV8 A;  2C42 A;  4I64 A;  4JI5 J;  2W25 A;  5F8M A;  2E7V A;  2JH3 A;  4C11 A;  2FLO A;  1B4S A;  4QIG A;  3KOA A;  2RF2 A;  2LQ5 A;  3FVY A;  1SH0 A;  1ZM9 A;  4A4J A;  2V9K A;  4AT1 B;  4QIF A;  4O0N A;  3NKY A;  2H4W B;  4DV1 F;  4U67 Q;  1RHJ B;  3MAH A;  4X4Q A;  5E41 A;  2YNI A;  1NO8 A;  3GR0 A;  2EK6 A;  2ATC B;  2E29 A;  2MJU A;  2V8G A;  2I9S A;  2IHR 1;  3HJV A;  5KG3 A;  1SCJ B;  4F4K A;  2DYA A;  1SKU B;  4CH0 S;  2QSW A;  3PJ9 A;  4H54 A;  1X5P A;  4OZ5 A;  3ISN C;  1KFD A;  3M2V A;  5KT5 A;  1L3V A;  1RWM B;  3PYD A;  4NL5 A;  3R8Y A;  5JJB A;  4CLP A;  1UW9 A;  1T9U A;  5HMW A;  3MR2 A;  3MAQ A;  3MMA B;  2WB4 A;  4NZ6 A;  2PO4 A;  3BKF A;  4DI6 A;  5DRK A;  3HHL C;  2X51 A;  3HI9 A;  1CVJ A;  3QGH A;  4UT4 A;  4L75 A;  4YME A;  3N5F A;  4LT6 A;  2CJB A;  3MUM P;  1JJ2 R;  1ZAV A;  4U8Y A;  4FF2 A;  2F1F A;  2BE9 B;  2KZM A;  3UD5 A;  1TR0 A;  4CLF A;  4CT9 A;  1DAR A;  2WSC C;  4UZB A;  2BAC A;  4KGZ B;  4ECQ A;  3LF0 A;  1B7Y B;  2CPE A;  4C4W A;  4B3M F;  3C3L A;  1HL6 A;  3TNV A;  2Z57 B;  2Q66 A;  5A76 A;  3QPI A;  4ED0 A;  3KHH A;  1S59 A;  3IC1 A;  1H73 A;  3VAJ A;  3D9B A;  3FEZ A;  2YQ3 A;  1JNR B;  2FHO B;  4RR5 A;  1SV5 A;  2V4J B;  3R6L B;  3S01 A;  2HBY B;  4O44 B;  1UJ5 A;  4TY9 A;  1D9A A;  1YBU A;  2IDE A;  1DJ0 A;  2P9G A;  4UQG A;  1VJQ A;  1FWK A;  3K5P A;  1YJU A;  3SQG B;  2HVH A;  3VAF A;  3N9U C;  1O5J A;  5KFG A;  3NGT A;  4DR5 F;  5F8I A;  2U1A A;  5I42 B;  4O23 A;  1KTV A;  1Z2L A;  4OYB A;  4M5L A;  4KBI A;  3RBE A;  4Y34 A;  3DU5 A;  3G9C A;  4RW9 B;  2BJE A;  5GAE I;  3R5G A;  5CYM A;  5J2P B;  3KG4 A;  1MSW D;  3QWP A;  2B6A A;  2HLT A;  2NR0 A;  2W8L A;  5F0U A;  4WTO B;  3ZTP A;  1B64 A;  5IQQ A;  4O4G B;  4FYW B;  1RAO A;  1RTH B;  3FCV A;  1CS4 A;  2KXH A;  4EYH B;  3M1V A;  4RWX A;  3B78 A;  1U09 A;  2LU1 A;  3EDQ B;  1HWL A;  4UUX A;  4QYZ K;  3SBM A;  3DGV A;  3EDR B;  1FFW B;  2DXE A;  5KTQ A;  5ETQ A;  1JXL A;  2RIJ A;  1V3R A;  1QE1 B;  1FNM A;  2ZOM A;  2VQF J;  1DY3 A;  1VIX A;  2IRX A;  2ZEJ A;  3OL6 A;  4G1P A;  2EC0 A;  3MMJ A;  2I38 A;  2G4B A;  2B9X A;  1RJJ A;  2OSR A;  2EVZ A;  3GZ7 A;  1FRH A;  1PJ5 A;  1WG5 A;  1BQN B;  3QIP A;  1T03 B;  3PW0 A;  1H2U X;  2BR0 A;  4A8M P;  4OX9 F;  4R8U A;  1UA0 A;  2BQR A;  2D3O R;  4HHJ A;  3AFG A;  3KJV A;  1JLG A;  2XMA A;  3H5U A;  3EVW A;  2IAJ A;  3UN2 A;  2A18 A;  3ENW A;  4B9N A;  4Y2I A;  2VG5 B;  3L9Z A;  3M6U A;  2C2N A;  1YGY A;  1PO6 A;  2R8G A;  3QT8 A;  4OIX A;  1G6B A;  3NGK A;  2QFJ A;  3T6J A;  3FSI A;  2F7V A;  1TQL A;  2PD1 A;  1HBN A;  4X4P A;  3R7B B;  2HAI A;  2YWG A;  3I5C A;  5G0R B;  4CRJ A;  4O3R A;  1SXL A;  1NAQ A;  1WHW A;  3J81 U;  1N5Y A;  2IY5 B;  3BM7 A;  2EFV A;  3W61 A;  3ET6 A;  2GML A;  3SV4 A;  1AFJ A;  4URS A;  4B3O B;  1L3T A;  5C2C A;  3I5A A;  3FZB A;  1Q5V A;  2VFS A;  2E9T A;  3MMC B;  1WKL A;  1N34 J;  4LRC A;  2YQ0 A;  3DOM A;  4YFU A;  3PKM A;  2W24 A;  3RAM A;  3TUI C;  3NP5 A;  2ZWO A;  1V3Z A;  4NXM J;  1CUL A;  3ZZU A;  3EXY A;  5CA5 A;  1E6Y A;  1IBM J;  3VAI A;  1LWE A;  1MMD A;  4USI A;  1FA0 A;  3IO1 A;  4QU7 A;  1KLM B;  3LWM A;  4BC9 A;  1IBL J;  1XER A;  1VRT A;  1BLU A;  2VG6 B;  4CZC A;  4WF9 Q;  3QT5 A;  4B9S A;  1DLO B;  4ZIT A;  4ECV A;  2V8V A;  2Y8W A;  2HGL A;  2FZG B;  4ID5 B;  3NNA A;  5HAT A;  2LQ8 A;  3DXS X;  5LM7 E;  3VAH A;  4BCA A;  4PPD A;  1PYT A;  2PT0 A;  5KFM A;  2IA6 A;  4OFZ A;  3VCD A;  4OI0 A;  5E2Q A;  1D8Z A;  1SB6 A;  4GVB A;  2JLG A;  2MKC A;  4LF5 F;  4GRS A;  5F3Z A;  1ZTW A;  2EFO A;  2V50 A;  4B9T A;  2H54 B;  3RR7 A;  1VQ9 S;  2HUR A;  2RJZ A;  4RW6 B;  1XMO J;  2ASL A;  2DNG A;  3C66 A;  3LP1 A;  1REV B;  3TEH B;  1OY6 A;  4G3I A;  2C3O A;  2LXU A;  2J6U A;  2CAD A;  4NLS A;  1S72 S;  3JSM A;  1T11 A;  2OTL S;  3HHL B;  2HVD A;  2DGS A;  1KHV A;  4X65 J;  1VK3 A;  4G6V B;  1B99 A;  1RT7 A;  2CPD A;  2H51 B;  2FZK B;  1A7G E;  2E9R X;  1W25 A;  3C2P A;  3DRS A;  2VFU A;  4PQA A;  2PEB A;  2D9O A;  1RA6 A;  4ZOS A;  1N8R T;  3P3D A;  1RAF B;  3FRY A;  1UP1 A;  2CQ1 A;  3POT B;  3MFI A;  3OHB A;  3NS7 B;  2CZ4 A;  3MM8 A;  2VH7 A;  1VQ6 S;  3CJQ A;  2UXB F;  1TAU A;  2GNK A;  3SSR A;  4YR2 A;  1UPP A;  2VAS A;  1UTA A;  3MPY A;  3B4D A;  5KFI A;  1VGY A;  1YLX A;  4ECU A;  3DLK A;  3PX6 A;  4DX7 A;  3M6V A;  3QAE A;  4K7Q A;  3AQO A;  2GX8 A;  2ABY A;  3RGI A;  2KDO A;  5DG9 A;  5GAE U;  2NXU A;  3W9J A;  5FLX Y;  2IFX A;  2E1R A;  5BR8 F;  2H9Z A;  4ECS A;  5MLC V;  2HRY A;  5ETK A;  4CYU A;  1U47 A;  3TP2 A;  2B5J A;  1FTC A;  5DGA A;  3M2U A;  3TVY A;  1ZM2 A;  2F65 A;  3AH6 A;  4TLQ A;  2MEW A;  3B8H A;  3M7V A;  4BLG A;  3FK4 A;  1NK7 A;  1RTI A;  3GSD A;  5IT0 A;  1FRJ A;  1N0U A;  5ITH A;  1MU2 A;  1OJ4 A;  1VR6 A;  2KJV A;  4A47 A;  1WKK A;  3MDF A;  2J0X A;  1U1M A;  4TN2 A;  2Z0G A;  2EKN A;  4A8S A;  2Z30 B;  2E5L J;  4PWD B;  2ADC A;  1HIY A;  3QQC D;  2CPX A;  3DOL B;  2QMU B;  4CLS A;  3KMS A;  3KDN A;  2ZC4 A;  1FDB A;  5LT5 A;  3GYN A;  4USW A;  3FSX A;  2J0Q D;  2VD3 A;  2EFP A;  2J8S A;  3IAS 9;  3OUY A;  4K4Z A;  4ITS A;  1ULR A;  1R89 A;  1SKS A;  1S7H A;  2RQK A;  4LR8 A;  2YQ1 A;  5D3G A;  3CGI A;  3OXF A;  4F25 A;  3IR6 B;  2VF3 A;  1Q16 B;  1EET A;  1ACM B;  1X60 A;  2DIS A;  4ZVH A;  2CPF A;  2IA0 A;  5HP1 B;  2J9C A;  1KQG B;  3DHX A;  4ED8 A;  2W9A A;  4ZVO B;  1RT1 B;  1S76 D;  1DQ9 A;  3A8J A;  2GVD B;  4JI3 J;  3M2R B;  3DRR A;  3V81 B;  3CJK B;  5IV4 A;  1YJ9 S;  2BJ1 A;  4GO5 X;  1VRU B;  1MML A;  4RW8 A;  4DV6 F;  2ZE2 A;  2LEA A;  4U7U K;  4EBE A;  4OZ1 A;  2K2P A;  1F5C A;  2I8E A;  1FO1 A;  3FBC A;  4ZVG A;  1IJF B;  2IC3 B;  1EKR A;  3B6B A;  1FTR A;  2DGU A;  1XMO F;  4NLR A;  2VJU A;  2RUS A;  4X64 J;  4LFA J;  2X1G A;  3UD4 P;  3EGV A;  3VGT A;  3HHN B;  2JRS A;  2ZH8 A;  1M5V C;  1F9F A;  1Q5Y A;  1FX4 A;  5HO4 A;  5D4P A;  2CJQ A;  2BJD A;  1YIJ S;  4LF8 F;  2YNH A;  2R2T A;  2BW2 A;  1WC6 A;  2FJE B;  2UV8 G;  2BE7 D;  2KKH A;  3CUL A;  3LGN A;  2KL8 A;  5KFZ A;  2HW3 A;  1P1T A;  2CNK B;  1OPZ A;  3W5X A;  3DDI A;  2OO4 A;  2AV5 A;  2HBQ B;  1RAI B;  4NLV A;  4TQS A;  2G13 A;  4EBC A;  5AE2 A;  3P5B P;  2V2K A;  2M5Y A;  3PX0 A;  3OVA A;  2QLX A;  2PMZ D;  2FVQ A;  2XY5 A;  1TP7 A;  3NS6 A;  1OY8 A;  2W9C B;  3H42 A;  4PUO A;  4RNH A;  2W7P A;  2P2C B;  3DHW C;  3HDS A;  4CO0 A;  3T5K A;  2WK4 A;  1JQG A;  3G82 A;  3I9V 9;  1YHQ S;  1U45 A;  1TKT A;  1M1G A;  1XNR J;  5H9F K;  1XBW A;  1Y11 A;  3LW5 C;  3DMJ A;  4P73 A;  4HT5 A;  4JV1 A;  1SL1 A;  3MEE A;  3N01 A;  2XB2 D;  1X5O A;  4PQU B;  3MPU B;  4LSN A;  3BO3 A;  1L5U A;  4TVA B;  1WG4 A;  3CW2 C;  2UXC F;  4C97 A;  4ECY A;  2WHO A;  2J5A A;  2LFV A;  3MM6 A;  4ZVR B;  3MOJ B;  1ZS6 A;  4HAC A;  4DQS A;  1SPB P;  1QSL A;  4J9U E;  4DL7 A;  2OPP A;  4OI4 A;  2HNZ A;  1WSR A;  5EUH A;  3SMZ A;  2JVR A;  1RYS A;  3VAL A;  2XS5 A;  4HVZ A;  2CJK A;  3PV8 A;  1LK7 A;  1V5I B;  2CG8 A;  4ZIV A;  4OJ1 A;  4JUZ A;  3MM5 B;  3NAI A;  3FMB A;  3OPK A;  5B09 A;  4ANE A;  3MUT P;  4CIO A;  1ZZN A;  2NSC A;  2XYG B;  3GV8 B;  3KYL A;  5LSO A;  3HHD A;  4F4W A;  1U0H B;  3CJT A;  1HD1 A;  2N4D A;  4C0H A;  1HHS A;  2VPX B;  2DRA A;  1YJ7 A;  4GVL A;  1KLN A;  2V4R A;  4IKA A;  1GXT A;  4ZIW A;  1H7X A;  3AOA A;  2MTL A;  4K50 A;  2W9B B;  3MMB A;  2LKZ A;  3BEG B;  3TZZ A;  1EP4 B;  2UUB J;  2M8H A;  2J8A A;  4W98 A;  4C8M A;  4Y2K A;  2ASJ A;  5CZX A;  2PMH A;  1WEL A;  2QL9 B;  3UVJ B;  4ES3 A;  1HYS B;  3R3T A;  4R5P A;  3G71 S;  1RXO B;  2ZH9 A;  1Q81 T;  2YWW A;  3VAK A;  4I2P A;  2W2O P;  2EC2 A;  2OEK A;  1RT6 A;  1NK4 A;  2HVI A;  1S97 A;  1R6Y A;  4F3O A;  4DV3 F;  1UPM B;  4WYL A;  3OSN A;  2AGO A;  1TMJ A;  3GYG A;  2A10 A;  1J5O B;  3UCZ P;  5A2Q Y;  4OHW A;  2DR8 A;  3EGW B;  3K8V A;  3MWB A;  2DRB A;  2ROE A;  2DR9 A;  3CWJ A;  4AD6 A;  4F2S A;  2HFV A;  3CCW A;  1S12 A;  1KTQ A;  2QLF B;  2GIQ A;  2L41 A;  1X0F A;  2MQL A;  1UWB B;  3RRG A;  2JEF A;  1RSC A;  4OLO A;  4DV2 J;  2OMO A;  3P45 B;  4IR1 A;  2VHG A;  3BKT A;  3BGR A;  1NBE B;  4NLP A;  2RML A;  4ZVQ B;  2V8H A;  1YJT A;  3MAA A;  3ZC4 A;  2YKP A;  3V5R A;  4Z2X A;  4FYY B;  5B0D A;  3THT A;  2H5I B;  3BF4 A;  4ZLP A;  1M5O C;  1Y5N B;  3H2V E;  4V19 X;  1RWP B;  1RWU A;  3PX4 A;  2DIU A;  1F9E B;  2MKK A;  5J2N A;  3GP9 A;  1JKH B;  2JWN A;  1KC8 T;  3ZXW A;  5DG8 A;  3BBB A;  1TFY A;  4A8X A;  2FHJ D;  4H4M A;  8RUC A;  1SC4 B;  1NSQ A;  4QR0 A;  4C3K A;  2ZJR Q;  3U1L A;  2VBX A;  5KG7 A;  2W8K A;  5I4M A;  3ZNJ 1;  2LEC A;  5L8R C;  1FRM A;  2BAB A;  8ATC B;  5ETT A;  1HNV B;  3D1Q A;  1DTQ A;  1S1T B;  1XNR F;  2OPQ B;  3GG1 A;  2MGZ A;  3R2D J;  4ZP6 A;  2KXF A;  4TLR A;  3CD6 S;  5F8J A;  5T7L A;  2HPU A;  1NZA A;  2D3Z A;  2XO6 A;  3R9L A;  2LLZ A;  4ZS6 A;  4PPZ A;  1N5S A;  2Y1J A;  4JI1 J;  4NXN J;  5FLX U;  2RQC A;  2FPH X;  2K3I A;  2HNY B;  1BWV A;  1XN9 A;  5F41 A;  5AT1 B;  5IFM A;  4NCA A;  4A8F A;  3TJ9 A;  2HHU A;  2EPI A;  1V6H A;  3A1Y G;  1F9H A;  3GJR B;  2QE5 A;  3JAM U;  4U95 A;  4GKJ J;  4DUT A;  3Q8S B;  2DNK A;  3GON A;  3KK2 B;  2K1R A;  4ED6 A;  3HSJ A;  2PA3 A;  5E3C A;  3IP0 A;  1H72 C;  2B4P A;  4DR2 J;  1TL4 A;  1TEL A;  3Q8Q B;  1RT3 A;  4IOB A;  5CYJ A;  1RWW B;  5EGY A;  2VON A;  5L1I A;  1WTB A;  3T1A A;  3C15 B;  2VOO A;  1JLB B;  3IWN C;  3T3F A;  3IRX A;  1XNQ J;  2RRB A;  2XEX A;  3LA0 A;  1CJU A;  1PIE A;  1X4A A;  4JI8 F;  3FSY A;  3M8R A;  3NWG A;  4X66 J;  2IBK A;  3D2W A;  4H4O A;  2C2O B;  3ILJ A;  1FK9 A;  4EK2 A;  4NRU A;  1VIO A;  3O3L A;  3RBD A;  3PRV A;  1UFK A;  2LEB A;  3BGL A;  4DPO A;  2DB1 A;  4QCL A;  1U2F A;  2DNR A;  1NK8 A;  1WOS A;  3AXM A;  5D4L A;  4OHY A;  2J76 E;  3UWT A;  3J80 Y;  2BKP A;  2GQC A;  4UF4 A;  4Q8E A;  2WCX A;  4WPA A;  4Q45 A;  2CNO B;  1HAR A;  4CO1 A;  2VQE F;  1NUE A;  5L9X A;  2C2Z B;  4UOC A;  5IT9 Y;  4WFB Q;  3C46 A;  1AA1 B;  3I82 A;  1WHV A;  3S8S A;  4J9Q A;  1U7L A;  1XMB A;  1X4E A;  5A8R B;  1YX2 A;  2W4P A;  2UVW A;  2XTJ P;  3QMQ A;  5IV3 A;  3A8K A;  3DYA B;  2GGP B;  1AZS B;  2NRE A;  1HWJ A;  3MR5 A;  4Z37 A;  2GS8 A;  4USV A;  3SI8 A;  3NS5 A;  1UZD A;  3GE9 A;  1Q8K A;  1RA7 A;  1TL7 A;  1QVF R;  4DPY A;  1XMQ F;  4C11 B;  2YKO A;  1YRT A;  2B4V A;  2HS0 A;  5D15 A;  4Y00 A;  1U4B A;  3T19 A;  3GLJ A;  4DG1 A;  4DPT A;  2C1E B;  2LA6 A;  2B9E A;  3C6T A;  1X4G A;  1S49 A;  1HMV A;  1YIT S;  2HK3 A;  3OVB A;  1PG5 B;  4N8O A;  1M1K T;  2DTJ A;  4DR4 F;  1RLD A;  5KAK A;  4C8Z A;  4HI1 A;  4N7T A;  2XMT A;  4KRW A;  4DV4 J;  3W1Y C;  4NEY A;  1RBA A;  2G0C A;  3GCX P;  4LBI A;  2UUT A;  3E01 A;  3CMA S;  1OSD A;  1WOR A;  2XNR A;  1ITP A;  1RCO B;  3GJT B;  4OI2 A;  1HBM B;  3LO3 A;  2RU3 A;  1R0C B;  3R1L A;  3CSK A;  4IOC Q;  4YDX A;  5DQI A;  2MST A;  1ZBT A;  4ZCI A;  2DEI A;  2DNP A;  3ELH A;  2K8G A;  5K8O A;  1JLQ B;  1IKY A;  5HBM A;  1IR0 A;  5D78 A;  3MZI A;  3U1N A;  1IKX A;  2XYP B;  1HWK A;  3HXM A;  3QBC A;  1F1B B;  2KVQ E;  2MQP A;  4K4X A;  1EZZ B;  2NYH A;  1NKB A;  3W2V B;  2DEJ A;  2A6M A;  4NLQ A;  3I87 A;  1RIS A;  3CJ0 A;  2DGO A;  3LP2 A;  2HG4 A;  1Q78 A;  3TZW A;  4R0E A;  3D67 A;  3D4J A;  3D28 A;  1RAA B;  3ENQ A;  1QSS A;  3S7R A;  3GR1 A;  4ZLJ A;  2VBW A;  3P5T L;  2NXN A;  1Z4U A;  3NY0 A;  4P72 A;  2YY3 A;  4KGX B;  4JI4 F;  5CAA A;  2QA4 G;  2A3J A;  4WP9 A;  2ZIT A;  3HFV A;  2ZFH A;  5DS7 A;  2NXJ A;  2F9D A;  1R0A B;  4X4O A;  2J7K A;  5EWF A;  2HWH A;  4JI7 J;  2CA9 A;  4ZVU B;  1UW4 A;  1D3W A;  2BX6 A;  3HHE A;  2LXF A;  4C8Y A;  2WTF A;  1FX2 A;  3FBF A;  4CNY A;  2J0W A;  3TR5 A;  1JLA A;  4KHP F;  4C9D A;  3H20 A;  5E3Q A;  4DX6 A;  4ZVT B;  4DL3 A;  4M5D A;  3FQK A;  4FP9 A;  2EFN A;  3CCJ S;  5J2Q A;  5A0Y A;  2VPY B;  2ZKU A;  5CYQ B;  4DFK A;  5GAH I;  3A12 A;  2V63 A;  3CD7 A;  4QPT A;  3SCI E;  2V2Q A;  2AQ4 A;  5EDW A;  3KG1 A;  3W8G A;  5B0E A;  4R0J A;  2BEF A;  1DUR A;  4NWB A;  4DZ6 A;  2D69 A;  3NBP A;  4P9S A;  2OP5 A;  2XS2 A;  1V3S A;  3S6E A;  4WCE Q;  1S48 A;  3ZTS A;  1TV6 B;  2ZBR A;  2HZC A;  2YNG A;  4WYW A;  2X3D A;  4K4S A;  3JB9 k;  1W2B R;  1RT2 A;  3CJ3 A;  2RAQ A;  2ZBC A;  3IAM 9;  2AMC B;  2IVY A;  3FBB A;  2LA4 A;  1CEZ A;  2X1A A;  1Z1Z A;  1NJI T;  3BSA A;  2XSJ B;  3V4M A;  1HI0 P;  5GVQ A;  1U1P A;  3NNC A;  3WZ0 A;  1LNQ A;  4PAA A;  2V5H G;  3QID A;  4AQY J;  4RO0 A;  3SIP B;  4L72 B;  3V6D B;  3LOU A;  3DCA A;  3K89 A;  3BRE A;  3LAK A;  3QIP B;  2KM8 C;  1SIW B;  2R2S A;  3I0S B;  1BY9 A;  3A8I A;  4DSK A;  3C14 B;  4WFX A;  2YTC A;  3T1Y F;  4AND A;  5IM0 A;  2VJV A;  3RB3 A;  2DNQ A;  4CLZ A;  3BDP A;  3I0R B;  3ADA C;  4MFB A;  3KJV B;  1WWH A;  1JLG B;  4LFB J;  4NX9 A;  4JI0 J;  4QR1 A;  4JYA J;  3AB2 B;  4JI6 J;  1K1Q A;  1VQ4 S;  4KKO B;  1JLE B;  1NHU A;  3K5M A;  1NH7 A;  3EYZ A;  2Z8Q A;  1T02 A;  3NL0 A;  1KVK A;  1S6P A;  1U1O A;  1XTZ A;  2OFG X;  4I6A A;  4M5H A;  3FUY A;  1PGZ A;  1S4F A;  4EBD A;  1TVR A;  1SQG A;  1HBN B;  3JS9 A;  3TAP A;  2FIU A;  2JZ5 A;  2N7Y A;  4ZPB A;  3RYL A;  3PDN A;  4YB6 A;  5A6P A;  2CFX A;  4ERD A;  2WON A;  2GQQ A;  4PXD A;  2GZO A;  4HH1 A;  3VQS A;  1ARO P;  2BE2 A;  5H9E K;  2Y8Y A;  4ZPC A;  4OL8 A;  5D8H B;  3TA1 A;  2GJF A;  4HI2 A;  3F56 A;  1VBK A;  3DOM B;  4NCB A;  2RKI B;  4IG3 A;  2XWY A;  1WG1 A;  3KK1 A;  4D3G A;  1FD8 A;  1X5T A;  5I3U B;  2LQB A;  1CC8 A;  3K2Y A; 
#chains in the Genus database with same CATH homology
 3FBC A;  4O0N A;  3G2X A;  1BE4 A;  2HUR A;  3VGS A;  3EIC A;  3NGR A;  1K44 A;  2AZ1 A;  3B6B A;  1NUE A;  3BBB A;  1NSP A;  4S0M A;  3ZTO A;  4ANC A;  1W7W A;  4DUT A;  3ZTS A;  1XQI A;  1NDP A;  1NSQ A;  3EMT A;  2DY9 A;  5CAA A;  1HHQ A;  5CAB A;  3NGS A;  3VGT A;  2B8Q A;  4F36 A;  4F4A A;  1S59 A;  3Q8V A;  3Q8Y A;  3VGU A;  3ZTP A;  3ZTQ A;  2DXD A;  2HVD A;  1S57 A;  3FKB A;  2HVE A;  3FC9 A;  4UOH A;  4FKY A;  1NDC A;  2DYA A;  3B54 A;  3EVW A;  3Q86 A;  3FCV A;  3FBB A;  1U8W A;  1B99 A;  1NHK L;  1NDK A;  3PJ9 A;  3GPA A;  5IOL A;  3JS9 A;  3EVM A;  3Q83 A;  3VVT A;  4UOG A;  1LWX A;  1NB2 A;  3BH6 B;  4KPC A;  1PKU A;  4C6A A;  1NLK L;  3EM1 A;  1WKJ A;  1BHN A;  2BX6 A;  4W98 A;  3ELH A;  3R9L A;  2B8P A;  2DXF A;  1EHW A;  2DXE A;  4FKX A;  5C7P A;  3ETM A;  3EVO A;  3FBF A;  1F3F A;  1MN9 A;  4WBF A;  1ZS6 A;  4EK2 A;  1NCL A;  3BBF A;  3FCW A;  1LEO A;  2ZUA A;  1NDL A;  4HR2 A;  1F6T A;  3DDI A;  3VVU A;  2AZ3 A;  3BBC A;  1WKK A;  4DI6 A;  3FBE A;  2CWK A;  3WX8 A;  3EE3 A;  1XIQ A;  1PAE X;  3PRV A;  3Q8U A;  3MPD A;  3DKD A;  3NGU A;  2NCK L;  3NGT A;  4UOF A;  3ENA A;  1HIY A;  1HLW A;  1NSK L;  1NPK A;  3L7U A;  3EJM A;  1VYA A;  3Q89 A;  4CP5 A;  4AND A;  5BXI A;  1UCN A;  3BH7 B;  3VGV A;  1KDN A;  1B4S A;  4ENO A;  2BEF A;  1S5Z A;  1JXV A;  1WKL A;  2VU5 A;  4DZ6 A;  3ZTR A;  3GP9 A;  1MN7 A;  4ANE A;  1BUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...