4EO5A

Yeast asf1 bound to h3/h4g94p mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
164
structure length
161
Chain Sequence
SSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNGDLYPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone ASF1
publication title The conformational flexibility of the C-terminus of histone H4 promotes histone octamer and nucleosome stability and yeast viability.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein/chaperone
total genus 29
structure length 161
sequence length 164
ec nomenclature
pdb deposition date 2012-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 4eo5A00
2Z3FA 2HUEA 2I32A 1TEYA 3AADB 2CU9A 4EO5A 4RRPM 5C3IA 4ZBJA 5EIIG 1ROCA 2IIJA 2IDCA 5BO0D 2DZEA 1WG3A 5BNXD 2YGVA 2IO5A 2Z34A
chains in the Genus database with same CATH superfamily
5F96H 3FTGA 2WC7A 3GMQA 1IBFA 1AO7B 4BA0A 4OFVA 4MA3A 1P5UA 4NN6B 4AEFA 3CJJA 3SDDD 2HT3C 2ZOOA 3MRKB 1NM9A 5FF6A 1DQJB 2AI0H 3LZRA 3QCVH 3RIAK 1A7RL 4G80B 1GXEA 2Q5BA 3MU3A 3ME0A 3UJJL 2Q9OA 3KBEA 1ZK9A 3CLEH 3GMPA 1KPVA 2UY6A 5FYJD 4UV4L 3U7YH 3ASNB 3P02A 5EO9B 4XGZA 5D70H 4HOWA 3IAQA 4X80H 3A22A 1J12A 3HZ3A 4UOW1 1B0GA 3MODL 5M7QA 3MO1B 5DWPA 1S5IH 3QUML 3EO0B 2OMVA 2Q76B 1T0MB 3KD4A 1U8CB 4JHZA 4MAYC 4NJAL 4ZUUB 3CHPA 1M7XA 3SO3C 1L0XA 3TO4B 2YWYA 3ECBA 3MRDA 1QSEB 4KJPD 4R2GC 2H7WA 2XG4B 4ZPTB 3CFEB 4K0OA 3BSGA 4EI5D 1YMHB 3MBEA 2BZDA 2ZKWA 5IVXB 3BKJL 4FNQA 2VUYA 1D7FA 3KMDA 3DUUB 4L1LA 5E2JA 3V4VL 3GI8H 1YY8A 1F3DH 3NFPB 3VXTB 5GRUL 3SYQA 3FU0A 4LHUA 1MJ7H 5FYJU 4QTHB 4W9JC 1RZIB 2CALA 1PVHA 2AJXL 3RWJB 3EO9L 3U4BL 1BGXH 3VFPB 5AKVA 2ICWI 4UQ2B 1SJEA 2W94A 1UM5H 1ZS2A 5ITBH 1XXFC 3GGWA 3QEQB 4UQCA 2MCG1 2R2BB 3TZVB 5DK3A 1D7DA 2X6CA 2CJUL 3DC0A 4XCYB 3ZT6A 5I16A 1FVEB 1ZHLA 4JG1L 3BRDA 4M6OL 5IHBA 4U6VL 5C70A 2R4SH 1YEIL 4WQOA 2HJKB 2YXWA 4WSGA 2D0HA 1JD7A 3L13A 1WD9A 1EGJL 4JFOB 4FA7B 2F74B 5GS0H 3IGKA 4AIZA 1M05B 1AY1H 2O93L 5G4NA 2QADB 3C5ZD 3MYJA 3B2VH 3KH3A 3PREA 2FIKA 2HUHA 1MWAB 2XWRA 1WHOA 2D9CA 4NM8H 4IOSD 1GCFA 2LHAA 4G42B 4JREC 5I6XC 4F80A 5HYQA 1SQ2N 2FAUA 4PV9A 1VGKB 4FFWC 2VXVL 4IJ3B 1U8OB 4LDCA 2ZG2A 4GKSA 4MVBD 4PJ8A 5HY9A 4BFJA 4I5BB 2XPZA 3VFUB 4IK7A 2EDXA 3VO0A 1MZZA 4HCFA 2WTPA 1QR1A 3O3BB 4LNRA 4BZ2A 5CBEB 3NJMA 2IANB 1KFAL 1WAAE 3HE6D 3TEUA 4NI6A 1QX1A 3KPQA 5DJ0B 4S1SL 4TOYL 2FEEI 3QG7L 4J3WA 1AOZA 4Z7UE 1V3JA 4OKVB 5EU6D 4KDTC 1OF2B 2F2HA 1YAZA 3RWFA 4PGCB 4C54A 3ILPB 2G5BA 1IKNC 4QJ4B 1DZ0A 1CI3M 1CL7I 1KB5H 2XQYG 3PAUA 1WWBX 2YA1A 2XY2A 4HX1A 4Y16D 2CMRL 4UYQA 2PO6C 3FQ4A 1X5KA 3BAEH 2C3GA 3MTXA 3LQAC 1OM9A 4QNPE 3LMJL 4KQ3H 4NQDB 1N68A 4K5LA 4DP0X 3AS1A 3QUHA 5CINL 4Y4FD 4E5XG 4QGTA 2LAAA 4UILH 3GJFH 3PL6B 1PTZA 4MNGE 1FO0B 4LK4A 1NEZA 1IFHL 1F3DJ 2P80D 4NSKA 4XP9H 4FJZA 5IW6B 2BO0A 3AUWB 4R3SA 1DN2A 1KGIA 3GJFK 1FNEA 2XWEA 4PRAA 5TH2B 4JRWA 3SDDC 1WZKA 1ZA6B 3WLWD 5I1GL 1AHKA 4YWGL 1OQOA 1NTDA 3PWLB 5DJAA 1I3VA 3DV4B 4PJBA 3N43F 1RPUA 4IRZL 5HYSB 2N0MA 2V5MA 4QXTB 5EIQA 4BHUI 3EOTH 1OGAD 4DQOL 2Y6SC 4O9HH 5KS9E 4C47A 3NSJA 2D31B 5A16A 4G8IB 1ZAGA 1KYUA 1FHNA 4WLCA 4UOJA 3ROLA 5PCYA 2G3ZA 3SPIA 1RJLA 2V7NA 4Q9QL 5EDXA 4ZX5A 4KJPC 1A02N 3HA0A 1XDTT 2OCCB 3D4ZA 2DAVA 2X0WA 4UNIA 4BYHA 1YA5A 3H9ZA 5C0CB 3KPPB 4PJCB 3HW7A 4P5TA 4WO0A 5D72L 3DX7A 1UH4A 4AVHA 2YAHA 4WEBL 4M48H 4I2XB 2DF3A 3UL4A 1H3PH 1PZ2A 1AS8A 4YLCA 2Y5EA 1HCFX 3KPMA 1DQLH 3P2DA 1X7TA 1EDYA 4UIKL 2AGJH 2PCPA 3H1ZA 4APXB 4DP7X 1UVQB 1Q9WB 2Q1EA 3A67L 3WHXB 1ML0A 2EVIA 4XXWC 1MQKL 3DO7A 1RZPA 2EVJA 4GB9A 4KO9A 1AZUA 3IMWA 4PJBF 4GRWH 3F2LA 4E2OA 4H8QA 2AK1H 4IM8A 2ZOTA 2JELH 1GYUA 3UC2A 3C6LA 3IN0A 3MNVB 4GG6A 4MFHA 1I7RA 4QD2E 3KZ8A 1QFPA 4ISVB 3QWOB 1WFIA 1YEGL 1T0NB 1E7UA 5DVNA 2JMRA 3T3MB 3K6FA 3UZEA 5T1KD 1QMUA 3HN3A 4U6YB 3TBWB 3ZTNH 4Q9RH 3KVDD 3C5ZC 4JKMA 3V55A 2C3VB 3IYLW 4IHOB 5DUJA 1CVRA 4UIMB 3ZRFC 1DQTA 1QQDB 3PGFL 1QOKA 1K8DA 3CFUA 2ZYSA 3Q2CA 4FI6A 4G43B 3ELQA 4A6YL 4HIIB 2XVBA 4XPGL 1OP4A 1R5VA 3HBPA 4UAOB 4WCYL 1F1DA 4MVBC 3EW3B 4PTTB 5CP3H 4HISA 4PV1C 2YEZB 3ISWA 2QMJA 1O7DE 2CDEB 4BSWA 3KM2A 2CPUA 3HRPA 2D2CC 1OP5H 4QRQA 2XTJD 4IKJA 1H3UA 1P6AB 2CO7A 1OGAE 2BIHA 2GITB 1YUKB 2ID5A 3LEXA 4ZTPH 4DPAX 4J12A 3QPXH 1I7ZB 4J6RL 3A6BL 3STZA 3UPCA 3NESA 4GKNB 5I1JH 5IM7B 3BZEB 5FM8A 1T04A 4N9GB 4WWKB 3HE7A 4RMVA 1EA9C 4KVCL 4XOBA 4MD4B 5E2VH 1CXKA 1OP5K 4BKLA 4CVXB 4QUOA 4UUJA 4GG6F 4Y16C 5D2LB 1CU4L 4BELD 4U6XA 3LS5H 1O7SA 3ARDA 5EFIA 1KXTA 3O8XA 3OGOE 4FNRA 1A5FL 2XFGB 4AIEA 4Y4FC 5ECGA 3QEHB 4OF8A 4JVWA 1KJ2B 4JUSA 1XF2B 4A67A 4HAGA 1U6AH 1BZQK 4KK8C 4JPSA 3LN4B 1TTFA 4NENA 4ZK8A 4I0CC 5DMJB 2ZSVB 2Z65C 4FFYL 3MX0A 3WFDH 4JPKL 3WLWC 3OAYH 1F13A 1QSFD 1UKSA 3BGMB 3IJSB 5DJ6A 3G08A 1P4IH 2QPUA 3BVDB 1LK3H 3WXVL 2WWKT 3Q05A 1CE1L 2VN5A 3UTSA 2NX5D 5GRVL 5I18H 3OAYK 4FADA 5BQDA 1A3LL 2A83B 2VSKB 2WBWB 5LBSA 3HAEA 4PJIB 4U7MA 3CVHB 3MRJA 5GSVB 3TX4A 4B9FA 1A4AA 2J5WA 3FQRB 3Q8FA 1RZKH 4Q89A 2DBJA 1B0RA 4LARL 1PBYA 5B1BB 1QFWM 2EE9A 2F53B 7PAZA 4MDRA 5CWSA 3IDUA 4XMVA 1MW2A 4GXUN 2DLEA 2EIMB 1RU9L 2OTPA 5ID0A 5DRNB 2Z9TA 5FA4A 2GK0B 3DJZA 2ZWNA 1MXGA 3U0PB 3W9EA 5KW9L 2VIRA 1MNUH 1MCOH 1SDYA 1GA2A 3FFDA 1V5JA 1J0YA 3LJ3A 2WN3A 2ZCKH 1T22A 1DEDA 3BP6B 1EFXD 3ZDYB 1MFNA 1NFIB 3FZUC 3N41B 1OK0A 1MFEL 3FO1A 4LZKA 4QKXB 4NQVB 1HC1A 2F18A 2WWMD 3H9SD 4A2DA 1HXMA 4EVNA 5EIIG 1J8HA 3TURA 2EEFA 5LCVA 3THMH 4M3HA 4QT5A 3OGCA 1QKZL 4RAVB 3VXRA 4OZHA 4G11A 3KPOA 2EZ0D 4JFED 1PIFA 2EXWD 2FHBA 2WXIA 3RHWF 4Z0BL 4F57H 5BZWA 1T2QH 4NDMA 1U58B 3DLQR 5AW4B 1RJZB 5IFAH 4HKZB 4QTFA 4F1ZA 2HFEB 3CMOH 4PJGA 1JPSL 5DS8A 4Z3GA 1ASQA 3SJVB 1KLUB 4DKEL 4QRSB 1CF8H 5T3XH 3FMGL 4A6YB 1BFOB 4LSPL 2EEAA 1TO4A 4BSJA 3ETTA 4NGHH 3WFCL 4YSQA 1MCPH 4NNYB 5HYIA 2GTWB 2PYEB 1QTPA 1I31A 2RQ8A 3NQKA 4DO4A 1KGXA 1P6WA 1CG9A 1QSFE 5F72S 3T0VA 5JXED 4IKIA 5BNXD 4Z7NF 4P23D 1XGYH 5HHXL 1F02I 1XCQA 4OZFG 1QHPA 2XTJC 4BH8B 2G5UA 3S6CA 4BQBA 4HCRH 3S3JA 4X7DC 2WSKA 4JNXA 1M53A 1RUQL 1AXSA 3LNGA 4FN0A 2X88A 3LIZA 4PRHE 1UWEL 2EIDA 3HG1A 2D03L 4ABWA 3HC3L 1E9QB 2RD0A 1ORSA 3M8OL 3P4MB 4LO9A 2YQGA 4X4MA 5HVGB 3TYFA 4XP1L 5AW6B 2O61A 4OZHF 4Z3IA 3VYOA 1TU2A 1RULH 4TNGA 3FSOA 2XUWA 4NO3A 3TO2A 4G6KL 4P5KA 5E1QA 1F56A 2H1LM 2QQNL 4NC1E 5IJVB 1Z9SB 1QW9A 3DTDA 5D1QA 5IGXL 1R5WB 3CZNA 5L7XH 4APQC 1AG6A 4PJGF 4U2ZA 1QRNB 5G5DB 5C0GA 3PCYA 2XFXA 3A4EA 3ABKB 3CN3A 4DFIA 5LLIC 3OHMB 3PAYA 5HSFA 2VL4A 5I1IH 5I19H 1ORQA 3KDMB 1BFVL 4OF5A 2Q7AA 1AMYA 1NMAH 5CJBA 2ZUTA 3SGJC 4BFIB 4BZ1L 5IQOA 4NJ9L 1W0WB 1CTMA 2BNUA 5SWQB 3GBNH 2JKJA 1LD9B 5F7DB 2RAMA 3H9SE 2E74C 1E4XL 4TPRL 5E2TH 1ZLUH 1JHLH 3NPSC 1JI1A 3MUY1 3DJSA 4A63A 1YNTB 2OR7A 4JKPL 4JFEE 3C2SA 5DQDH 1ZLUK 3D8MA 4L37B 3NJIA 2ZAHA 4Q0XH 1ONQA 3Q44A 3LQZB 4KMTL 2L3BA 4LCVA 3MFGB 1MJJB 4XPFH 4AQZA 4M1DH 1SFHA 1RI8A 3WIFA 5F1OB 4GP4B 2VDQL 5DJDB 2BVOB 3QNXB 3WXWL 3BW9A 5EUOE 5C86A 2IPUG 2QSCH 4FG6D 3GXDA 5DMKA 3HFMH 3WL9B 1EXHA 1AZCA 2YGQA 2X4NA 3BVVA 1YN7A 3BZFB 5IHUL 3UTTE 1KIUB 3INUL 1AP2B 1IL1B 1E30A 1HCVA 2Z3FA 1NMCC 3BWUF 4R4BA 1OPGH 3EYOB 3MOAL 3IFLH 1A9BB 4PBXA 4PGBB 1ZLSL 3RAJL 2YLHA 1GRWA 2WWMC 4Q2ZB 4ZW6A 1RK0A 3IWUA 2WXKA 4A39A 4MYPA 1MJ8L 3K6SB 1OAZL 4XTRC 5F3BB 1BVNP 3LQAH 4BFOA 1IKOP 2DL9A 2ZX8A 2EXWC 4I0KA 1DQMH 5EBMB 2ADJB 1IT9L 1N7MH 1XGPB 4NUGH 4NZTH 3SBRA 5IB1A 3RWDB 3MN8A 1QWUA 3AUVA 3K6DA 4IRJD 3ABLB 2IH3B 3P3SA 3GXTA 2VC2B 3MR9A 3JV4B 4Q6YA 4AQ1B 1UUSA 3UC0H 3BPLB 2FNWA 1Y0LB 1QBBA 3ZTEA 1QVOA 3VYPA 3O6KH 2BH0A 1JV5B 2VGLM 3BDYH 5DRWA 4X4YB 1ADQA 2XV3A 1HXKA 1UJ3C 3V10A 3QNZA 4TNWK 1U91A 4P3DB 2DM2A 1VFAB 4N4YB 5JXEC 4RFNC 5C9KA 4MXVE 4P23C 2ICWA 2YN5A 4LAJH 4OCNC 1XF3A 2N7AA 4I1PA 3CBJB 3L3GB 3EJSA 1MY5A 2Z4QA 2HPTA 3BO8A 1JRHL 3BAWA 3U82B 3VAEA 3JV0A 3BUYB 2O5XL 3WV0A 3HCVB 2PETA 5C92A 3BPNC 1G9NC 1N64H 4GIOA 3HMWL 3PHOB 5AVTB 5F7KC 5I5JA 3LPFA 1EAPB 3TVMA 1G7LA 2YRLA 1CN4A 4BFKA 2DQIL 2LGNA 3MROB 4Y5YA 4TNFA 4Q4IA 1JF1A 2H32A 4XNZC 1IBHA 4FQIH 4XNMB 4PJ6A 1MCCA 1PZSA 3AREB 1E5CA 2BSTA 1ETA1 4MMZB 3SO5A 2WYIA 3FAWA 3QR2A 3RY5A 4PS3A 4YR6B 2XXCB 5GJTH 1IM9B 1J1XL 3CPLA 2A6IA 1RUPH 3AFLA 2E9JA 1OGTA 3B43A 1IZKA 1NMBL 1B9KA 3QPQD 3NIFE 4OY9A 4GW5B 1PQZA 2VM4A 4KTYA 3FUHA 4ZUWA 1NJ9A 2X1PA 5FWRA 3QO0A 4FEIA 4RFEB 2PPEA 2VITA 2PXYB 5ILTH 3MUGB 4DTGL 1YEWA 2A4EA 2IALA 3RVTD 4F15B 3HMXL 1GAFH 5LGKA 1IGFH 4IU3A 3LKOB 2MTPA 3UJTH 4X6CE 3PABB 5J57B 1QFUL 4LSQL 4GMTL 2AQRA 1NCHA 2OMTB 1NEPA 4TSAL 1S7RB 3EYFB 4XNYL 1K72A 5KBNC 5B39B 5CCGE 2ZXGA 1RK1A 2CWRA 4HIJA 3KR3H 5F96L 3KWWA 4EJ1C 3PNRB 3A0OA 1DQQA 4LCUB 1WA2X 3PP3H 1MW0A 2R8SH 4N6RB 2VTFA 3RJQB 4FXLA 2M83A 4PJ9B 3MOBH 5ANMA 1FP5A 3ERXA 4DKAA 4G8GB 4FG6C 4I1NB 4H2AA 3C8KB 5M95B 5D6DA 3SKNA 2GJ6E 1IBDA 5CLTA 2AI0L 1FF5A 3QCVL 4N0RA 5D7IB 2WWNA 4K9EH 1N6UA 3PP3K 1XF4A 3CLEL 2DJMA 3RTQB 4J2QA 2XIIA 1W9XA 2E59A 3U7YL 2EO9A 4LVHB 2HLFD 5CILH 2XNAB 4ZMQA 4X80L 1NUDA 4BHUA 4UBDD 1QUNA 3O4LB 3TBSB 1S5IL 4Q14A 5AW7B 1FL3B 4G6JH 3H54A 2DWDB 4WEUD 5HGGS 3RX8A 3S4SB 5KYUB 3L5JA 3AITA 4XCFH 5ESVB 3X1BA 1NPNA 2MHAB 2XDHA 4JZJB 2XXMB 3V5KA 4PJHA 4GUCA 2BWIA 1TCMA 2OJ1A 5I66A 1IGJB 2VLKD 4GBXB 1OSYA 3EBHA 4ZMVA 3QUXD 1QI4A 5GHWH 4IRJC 3DX0A 4LCWD 4XN4A 5L2KA 4HCGA 4OM1L 2VMJA 1VPOL 1MH5A 3IFNL 4W9HC 5K69A 5ETUB 1DUYB 3B3IA 1OW0C 1UH3A 3GI8L 4K23L 2DYPD 2VAAA 3DRTB 1LEKA 4GSUA 2YPLE 1MJ7L 4HK3N 2R29A 3SDAD 2BNQD 2TSBA 3ARYA 1T1XB 1IB5A 3LEVL 1UWFA 5A3ID 2X4UA 1BGXL 1WWCA 2X4PB 3QORA 4LU5H 1BF8A 5E0FA 4AH2A 5CD3B 4HFWB 3DRQB 4G82A 5T33H 1UM5L 3LRSA 3D18B 1AZNA 4K7FA 3VE0A 5TTRA 1NDGA 5EEUA 5TPWH 3VDBA 2J3SA 4QAWA 4FULA 1QZNA 3KM1A 4PBDA 5MP6H 5IB2B 3MRBA 2IAAC 4EZMA 3SE8L 5MHSE 2R4SL 4ONOA 1NC2A 3ZTDC 1UXWA 4DPBX 4GSQA 3V6OC 5GS0L 3I6KB 1A1OB 3GSWB 4P57B 2NNFA 3FPXA 4OIIL 2NY6B 3AG1B 4WV1A 4PJHF 4NUJB 1DZBA 2CRIA 3W3BA 4NM8L 1N26A 2IAMD 4M8QB 2PWHA 4L5FE 4N2HA 5I71B 3RDTB 4OJCA 3OZLA 3VI4E 1PYWA 1FYTD 5CP7A 4QXGH 2EINB 4XPBH 1PX4A 3T3PF 3AGVA 5FYKE 3P54A 3CXDH 1N19A 1EHXA 4G1MA 3QPQC 2E5EA 4HIEA 3FTYA 4M8UA 2P9RA 4XN9A 1RSFA 4BXSV 1MHHB 4MDJB 3BQVA 1M6OB 4QKTA 5CF3A 4Y89A 2DPKA 1OXYA 1LO3L 4JFVA 4X6EA 5IIEA 2Y7NA 3F3HA 5EU4A 1KB5L 3ZBMA 3RVTC 2ICEA 2EKJA 1TJXA 3CX5K 3BVXA 5JIMA 3KDPB 4LDLB 4FCHA 4PG9A 4A66A 2VLKE 4KKQA 4R97B 2XWTA 4LCWE 4N68A 4HJJH 4X7SL 2YGOA 1SVZA 2J1YA 3EH5B 5JQ6H 2OX5A 3VU2A 2EDMA 4EEEA 4UILL 3UBGA 2H26A 4N2FA 3JUYA 3JWOC 4K2UH 4MCYB 1TTRA 2ARWA 3VD0A 1Q1PA 3O81A 1L3NA 4MNHA 5F0LB 4DN3H 2WWOA 4XP9L 1DANU 3CVBA 1C08A 3DBXA 1SJMA 1UXMA 2BNQE 3EFOB 3M86A 4G9FA 1XR8B 1ZGLA 2L8AA 4AV0A 1K5NA 4YXLH 4H8HA 4JG5A 3P73A 4Y4HB 4LP4A 4GRMB 4G7YH 3DHUA 2XACC 2VDPH 5I0YA 2Z7UA 1S9KC 3UMNA 2HLFC 3QUYD 4WWPA 5I5MA 3EOTL 4I4WB 2FL5A 4FDWA 2Z0BA 1TEYA 4O9HL 4UBDC 4KV5F 3TP4A 5FC9A 4PLJC 4F58H 5DFWH 4X5LA 2WQWA 4Q74A 1AR1D 3U4AA 1CD1B 2R59A 2H3NA 3TCXA 2ZWZA 5DQJA 2BVPB 5CN2A 1NGWB 4E9TA 2FJFB 4OZFH 1UCTA 2MCPL 2G4GA 3GO1H 3L9RA 4ERSL 3EYVA 3BPOC 1DJSA 3FT4B 1UWYA 3TBTB 3L7EB 4XAKD 1RV6X 4PWEA 2JLLA 3SPGA 1E40A 4GQQA 4M48L 3QFDB 5F97E 4YHYB 1AO7A 3FB6B 1H3PL 1BMWA 4J3OD 1CDHA 1IGTB 1UUNA 3AADB 1P1ZB 5MEND 4KJYB 4Y19B 3MRKA 3GFUA 1DQJA 3BGAA 2AGJL 5LNGA 2OYKA 4G80A 4Z7WF 5A3IC 5DYOB 2XC8A 3U9WA 2XI9A 5EO9A 1DJZA 3I6SA 2D4DA 3BZDA 5JZ7C 1TETH 4L9DA 4OIBA 3CX5J 3EHBD 3LH8A 3MO1A 2AK1L 4NZRH 3EO0A 2Q76A 1T0MA 4ZUUA 1U8CA 5ISZB 2P8PB 4KUZH 4ELMB 5FGSA 2VDLH 1MELA 3QWRA 3TO4A 1EEUA 2X38A 4H8PA 5EF3A 1QSEA 4ZPTA 2XG4A 1HL9A 3CFEA 3MGAA 3ZTNL 4JMNA 2Y6TE 1YMHA 4L1HA 4Q9RL 1NUFA 3L4ZA 1XGUB 5IVXA 3IMBA 3UTQB 4NM4H 3DUUA 5EZLB 1RP9A 1RHHB 2OSYA 3NFPA 3VXTA 3ZHFA 3VGEA 4WW2C 4OF0A 3MGOB 2HJLB 4QTHA 1RZIA 1MHEB 3BFOA 2BNRB 4RESB 3RWJA 3OJVC 3CFMA 4LGRB 3VFPA 2CHNA 4UQ2A 3D6GA 5J7CC 1KIRB 1G0YR 3QEQA 2WVTA 2R2BA 2V33A 4HS3B 4LF3B 3TZVA 4ZTPL 1YCSA 3QPXL 5KJ4A 4XCYA 1FVEA 2DMBA 5I1JL 3HS8A 4P5MB 5J12B 5E2VL 4LL9A 3WUWB 1KB5B 2HJKA 2V7HB 5AG9A 2B1AH 5BS0D 3A4AA 3KJ6H 1R1CA 5K59F 4JFOA 2F74A 1I7UB 1M05A 3KGUA 4AX3A 3LHAA 4JRFA 1E8YA 2IPUK 4U1NB 1MWAA 1DVFD 2AFNA 5J13B 5KBPA 4G42A 4G8FB 5ENWB 3GJFB 1VGKA 4XAKE 1IAOB 2WZPD 2DW5A 3WNLA 5IVXF 1AHMA 3MFFB 1U8OA 3D48R 3NP3A 1U6AL 2NY0D 4I5BA 3EGDB 3U0TB 3VFUA 4BE6A 1WAPA 3MOQA 4YLQT 4G1EB 5AVQB 1W91A 3O3BA 4XNXH 5CBEA 2FCBA 3LNIA 2IANA 1BM7A 3ZHKA 5BUPA 2C4FT 1RIUH 4QRRD 5I9QC 2OR8A 5DJ0A 5E0QA 1J7VR 5SWSD 3K6IA 5HYFA 1P4IL 4OKVA 1NFAA 2MQ3A 3FQUB 1LK3L 1GGYA 5AOMA 4KPHH 3QUYC 4GPVA 1OF2A 1P53A 1QBLH 3A47A 3M6DA 4PGCA 5I18L 3ILPA 4H7VA 2NLJB 4JO2H 1GGCL 1G9NH 1NL0H 3PHQB 3WMPA 2ODHA 3IT8D 4HC1A 4J3OG 3IF1B 4YDKH 3DOHA 3FS9A 5CJ8A 4H44C 1RZKL 1YYCA 4KXZH 4UOZA 1P9MA 4NQDA 3X12B 5B3JF 4L4VE 4JGJA 2OFQA 2EDNA 4FG4A 3J27A 2XG5B 3GNMH 4RQQB 1AXIB 4BCYA 1AQMA 3MXWH 3PL6A 4JM2C 1FO0A 1KBBA 3QNFA 2P7TB 2YD3A 3A4FA 3GM0A 2OCFD 2A7BA 3T2QA 5IW6A 3P0YL 3RZCB 2P4AB 2BHYA 2NXYB 1GYAA 5HJ3B 4U0RB 5TH2A 1MNUL 1JVOA 1MCOL 1ZA6A 4J3UA 2EACA 4UM9B 3H9YA 1BQHG 5HGDB 2ZCKL 3PWLA 3DV4A 1FAIH 3QSKB 1BFTA 1UHVA 3QZWG 3MZTA 1DJGA 4C59B 5HYSA 4QXTA 3T4AB 3P4LA 2N01B 2YAFA 4QLRA 2FGZA 2KKQA 4YHKH 1FAKT 4G71B 3X2QB 2D31A 2Q20A 3T6WA 4JRYD 4KFZC 3THML 4G8IA 1N4XH 1BECA 3FONB 1EXGA 5F9WB 5BS0E 5TF1H 3AU1B 3TCLB 1TFPA 1XSIA 1XF5B 4WGVB 1HKLH 1NM4A 4F57L 4M56A 1T2QL 1CDBA 3N0AA 4B27A 4IRSD 5C0CA 1TZHB 3KPPA 3WKNA 2K9UA 4PJCA 4BV1A 1X5FA 3CMOL 2GEQA 4KY1H 5JW4N 5T1LB 4HWUA 4I2XA 1CF8L 4ZAKD 5T3XL 4L3CB 4EIZC 3FNKA 4NGHL 1MCPL 1JG9A 1AOHA 4QRRE 4APXA 5E9DB 3GHPA 1EJOH 1UVQA 2GSMB 1Q9WA 4MLSA 5SWSE 1OCCB 3WHXA 5IW1B 3EZ8A 2UVEA 1XGYL 1XV8A 1GOGA 2YRBA 4HCRL 3L2MA 1NWOA 4TSBH 3FSAA 1JRHI 4K3JH 1JZEA 3MNVA 3FL7A 3ARGB 3NVQA 4ISVA 1BV8A 3QWOA 3ARBD 1T0NA 4JO4H 2ZG3A 5J5EA 1MCEA 2C9UA 2ZAIA 3EF4A 2P28B 3IDGB 4JFDB 4U6YA 3CPUA 2Y7QB 4WUUE 1WK0A 2YSTA 3TBWA 2LVCA 2WQVA 2CH8A 1RULL 1FZMB 3U36B 2C3VA 2B4CC 4IHOA 3QDMB 3TEYA 4UIMA 2YZ1A 1QQDA 2Q3ZA 4F33B 3GUFA 4G43A 5L7XL 4HIIA 4PJCF 1IBBA 3EJZD 3MV8B 5BRZE 3LPWA 4YHOL 3MBED 1CS6A 4PTTA 1IFRA 4MA8H 2HXAA 3FQYA 2YEZA 1FFTB 1WFUA 1P7BA 4F8PA 1DO6A 2CDEA 2OMNA 5I19L 1GS8A 1B4TA 4OR1A 4KFMA 1WCBB 2R4RH 1CFNB 5I8KH 1NMAL 4HWNA 6TAAA 2D4FA 2VW4A 2GITA 3VJ6B 5FKPB 5ELIA 2BY0A 1I7ZA 4GKNA 5I75B 2C26A 5IM7A 3BZEA 1WZLA 1JHLL 4JRYE 2ZYIA 4WWKA 4N9GA 3FHAA 3L3IB 2H3KA 1G7HB 4MD4A 1PLBA 3V79C 4CVXA 1FLRH 1SLUA 1HINL 4YPGB 5JIHA 3UZVB 4PGJA 4CU7A 4Q6IB 5D2LA 3SY6A 2GJRA 5DQDL 3VRLF 2GC7C 4HJSA 3T3MF 2YD6A 1WBYB 1FHGA 4Q0XL 2A6JB 1IKFH 3EO1B 1UT9A 2OR9H 2B5IC 1FNSH 4UQAA 3QEHA 2YPVA 4M7ZC 4XPFL 1U21A 5B1CA 1KJ2A 3UPRB 1XF2A 2VDOH 1W8NA 2KUTA 3NTCH 5BW7C 1UCBH 3LN4A 2ZSVA 2AZAA 2MQCA 3VG9C 1W6WA 2EDOA 3M46A 4A55A 2QSCL 3MV7B 2AC0A 1H3TA 4ABVA 3D06A 2ORBL 3BGMA 3IJSA 1JZ5A 1HYRC 4Z95H 2NUTB 3QB7C 4LBEB 4QJ3B 3O4OB 1ROCA 1V7NL 4IRZA 1OPGL 2TAAA 3WIAA 4JQXA 5F6HJ 3HIZA 4D94A 1NAKH 3B5TA 1OP9A 2A83A 4PJDB 4CVWA 3LD8C 4PJIA 5GSVA 3CVHA 1MCSA 2R7EB 3O3AB 3FQRA 3LQAL 4YNYB 1DQML 4Y7MA 4NZTL 3NACH 1I8UA 4NQUA 3VSQA 4WTWA 5D2LF 1BQUA 2F53A 4TSCH 5CIPH 3ZDZB 3DYOA 4IRSC 1RLBA 2Z35B 3IS0X 3JWOH 5BRPA 4X7FC 3D1MC 4L5FH 1JGVH 5DRNA 3TJHD 3UC0L 2GK0A 1GZQB 4ZAKC 3VXME 3U0PA 2ZYRA 3SOBL 1T7WA 5F7EH 4GEJA 1MLCB 1MW3A 1AVAA 1QBMH 3BDYL 2K9FB 1NZRA 1JFHA 2YRPA 2PR9A 1G5AA 1ZANH 3IRCA 3OJ2C 5FYKH 3BP6A 1NFIA 5FYJL 1SXSA 3UCQA 3VXQB 4ZOCA 1YC7A 4NQVA 2OSWA 4KC3B 1P5UC 2ZOWA 2IMNA 3N9GH 3T0EB 2WCSA 2DQEH 3G5ZB 1KXVA 2KDGA 3PWPE 1RJYB 1ES0B 4JJHA 3BYYA 1JHKH 1MCBA 4N2CA 5HYJE 4RAVA 5SV3A 4UWQB 3CHSA 2E7LA 2Y1YA 5EB9A 4YPJA 3K8KA 4PJIF 4TTDD 1N64L 3GS0A 1FNHA 4LLVB 1U58A 5FXCH 1G1OA 1NIFA 1N67A 1RJZA 4OFDA 3Q1SL 4HKZA 2ETWA 1T66D 2HFEA 4LHUG 5JLZB 2Y1AA 4TVSa 3SJVA 1KLUA 3OSVA 1HKFA 4QRSA 4ZTOH 3II1A 4ZI8A 4A6YA 1BFOA 2CO6B 3EJZC 5HD8D 3MBEC 4NNYA 2E8ZA 1N0XH 5G2NA 1XD1A 2GTWA 2PYEA 3MNWB 5CN1A 4WFED 2BC4B 3S37H 2I25N 5GJTL 4RGMB 5GZOA 4OJYA 1RUPL 4MX7B 1LJMA 3RGBA 3ATBA 4MA7L 3WNJA 5SX4I 4BH8A 3G6DH 1KOAA 3ZDYF 2Z8VC 3N41F 4C4BA 4ZMXA 3CAFA 5L0QC 4WZ9A 1TXKA 3CFDB 2NY4B 2H2PD 43C9B 5DUBB 2QPSA 3QHFH 4IBTA 2G9KA 4MD0B 5ILTL 5E2WL 1E9QA 3P4MA 4MTMA 4C58B 1GAFL 3WIHH 1SN2A 1IGFL 3P9WB 3C6LD 1QO3B 3UJTL 2BK8A 1OO2A 1ND0B 3AM8A 4Z7VB 1U8IB 3LKPB 2EVFA 3RKDD 1ZVSB 5IJVA 1NLBH 1Z9SA 4X9BA 1YAIA 1QPXA 1R5WA 4FI8A 3SOTA 2JI1A 3S88H 4XX5A 5DD0L 3CFJB 4FMKA 1QRNA 5G5DA 3EXLA 2FECL 1TVBB 1KGUA 1YNLH 1PJWA 3QXUA 4FFYA 4NUPA 2KL6A 3MOBL 3KPRE 2X87A 4NIKB 2X5PA 3KDMA 4AYFB 3B34A 3VTTA 3CZGA 2EYSB 7PCYA 4BFIA 1W0WA 4PJ8C 4M7JH 4K9EL 4DOHB 5SWQA 2BFVH 1LD9A 5F7DA 1EH9A 4HUMB 1ZE3C 4M03A 4PJBE 3LQMA 5DGQA 3SODB 1YNTA 4P59H 4G6JL 1WH0A 4Z7IA 1MFVA 1NEZG 4L37A 4K5MA 4XCFL 2OI9C 3AS0A 3F5WB 4P2RB 3V4PH 4Q52A 4X98B 1KEGH 3LQZA 1N5YH 2FEDD 4JFQB 3OKLB 3FUIA 4HGMA 1B6UA 1TVHB 1MJJA 2YJQA 3OZ9H 2X3CA 4PVNA 5GRJL 3RVWC 5GHWL 2IJ0C 1A9EB 1PNDA 1U92B 3JTTB 5TE6L 2QLYA 5DJDA 3SGKA 3TJHC 2BVOA 3QNXA 3O8XD 3O6FB 1HNGA 4WRLA 3UTOA 4HP5A 4NRYB 4WFEE 3WL9A 3P0GB 2G2RB 3BZFA 4DZBB 5EDSA 3HC2A 4K3DH 3SQBB 4BWTA 1KIUA 2A9MH 4JDTH 1AP2A 1IL1A 1KGJA 3EYOA 4LU5L 3TNMB 1A9BA 4PGBA 4U7SA 5F3FA 3N04A 4Z7UB 1WT5A 5T33L 4Q2ZA 1TTGA 2O1AA 3CFIC 3GLAA 3JTBA 4M5ZH 5TPWL 5AVUB 3WSQL 1WFTA 2RR3A 4HD5A 3WI9A 3K6SA 4B9GA 5AAWA 4BCXA 3AXHA 5E51A 5MP6L 3B2UD 5F3BA 3UTSD 1T80A 5EBMA 2ADJA 4GS7C 3JT2A 1XGPA 4N0FB 4TTDC 4GG6E 1TLMA 2YSSB 3O45B 3RWDA 1X5MA 1QATA 2I24N 1NKOA 2IH3A 1T66C 3KLQA 2E27H 2VRAA 3ILDA 2XN2A 3JV4A 4AQ1A 2W9LA 2C7FA 4MNGB 2KT6A 1Y0LA 2J7LA 4AM0Q 2A4CA 4HIHB 4J3OH 2UX7A 4DK5A 1B6DA 3VH8B 5HD8C 1JV5A 4X4YA 5CS7A 4P5TC 4L3FA 2FQEA 3GD1C 3SGEH 4QXGL 4HJ0D 1F11B 4XPBL 4YSCA 4P3DA 3UBXB 1BFSA 1VFAA 4N2BA 4PWFA 5DFTA 1JZ8A 3CXDL 3RI5F 2YAMA 3A6OA 2WKOA 1L9OA 3L3GA 3AB0C 3M1CA 3O41B 3QFJD 5KS9B 2V37A 5C3TA 4HAKA 4PWIA 2NTSP 2G9HB 3DI3B 3NCEB 3BUYA 3P3TA 2EVGA 3HCVA 3GUTB 3IPFA 3JYBA 3PHOA 2HLEB 1J8HD 5K5YA 1XZ0B 2GY7B 4FXKB 3MLZH 4FABH 1EAPA 3C6LC 1ET7A 3IMUA 2WCGA 3HHSB 3VXRD 3WFBH 4P3WA 3MROA 3CN4A 4RMRA 3RKDC 1S2EA 4HJTA 3UZEC 5H8DA 1MIMH 4HJJL 1A7PL 1AI1H 1MCNA 3FOLB 5JQ6L 4XNMA 1LK2B 2R2CA 1YQVH 3AREA 4AEIH 4K2UL 2WO2B 4MMZA 4DN3L 2H3XC 4MB4A 5KBLA 1EHLH 1G6VK 2WBKA 4YR6A 3ROOB 1HK6A 4XPTL 3HE6B 4X42A 4AGNA 4BZ1A 4JJOA 4GW5A 5E1GA 2QTVA 3F62A 3DPDA 4G7YL 3NOIA 2VDPL 4IBUA 1QHQA 2VE6B 1ZTMA 4RFEA 4XWOC 2V2XB 2PXYA 3PP4H 3MUGA 2Y7SA 2VDML 3P9LB 1BZ7B 4F58L 1KULA 2ISDA 3T9WA 2OYMA 3APNA 2F08A 3LKOA 4LCIH 4K55A 5BXFB 3BEWB 3PABA 1FA4A 2OMTA 3HG1D 5GRZA 3HE7C 1IC0A 1S7RA 2FEDC 3DSFH 3DXAB 3EYFA 3MGTB 4X5WB 5B39A 2FR4B 2C9RA 1R5IB 1HN1A 3GO1L 4NBXB 2A3TA 2DL2A 2OCJA 3MLTB 2MCAA 1CGVA 1YQ2A 3GSQB 4JPIB 1DJIA 2V9QA 3P3UA 4LCUA 3ARDC 3WY2A 1TZIB 3O8XC 4N6RA 3NCCB 4PJ9A 2MNJB 4G8GA 4BFGA 2NXZD 1H6TA 3C8KA 3O11B 3L4YA 1EZVX 2WXQA 3MA9H 3ZE2E 2V5RA 5D7IA 3FSZA 4HOZA 3HAEG 2ZX9A 4NIYE 3FCGA 3RTQA 4CDHA 5IEHB 2XNAA 5HHMD 2BS9A 3RFRA 4WU5B 1TETL 3QFJE 2IQ9H 3DWTA 3MMEB 5F21B 1YC8A 3NFNB 2APSA 3O4LA 4JPQA 3FBQA 1FL3A 3TBSA 3IVKB 3AWFA 1IU1A 3S4SA 2DWDA 4KUZL 4EQ2A 3B2UC 5KYUA 2VDLL 4P9HH 3T4YB 2VW7A 4B9PA 1J8HE 5ESVA 2MHAA 4JZJA 1FZJB 3SD2A 3GSVB 3MKGA 2IWKA 2DQTH 3VXRE 1IGJA 3RPKA 4GBXA 2EICA 4CDGC 3WEOA 4EZKA 2GBUA 3JV5A 4ENZA 1IAMA 1JGLH 2YMOA 4FTDA 4XE0A 5ETUA 1DUYA 1E8WA 1CK0H 1FL5B 3MRGB 2J72A 4FL4C 1CFMA 3DRTA 1CI5A 3I6LE 2WO4A 2CK0L 4J5VA 1T1XA 4KDVA 2EXTA 4U1IB 2FK9A 1NDTA 2GUOB 3GZKA 4HJ0C 1ZGLP 2X4PA 4OLUH 1HZKA 2WLNA 3J8F7 5CD3A 2YAQA 4HFWA 1H3XA 3DRQA 1KCSH 3D18A 3Q5YA 1JTOA 5D7IF 2V9UA 1L6PA 1I9RH 5H94B 3SE3A 3ETSA 2XX0A 1TMCB 3WEMA 3BCFA 4I77H 3D4YA 5IB2A 2ZXAA 3HG4A 2CGZA 2MTAA 3BJLA 3W38A 4OFKA 4J23A 5F7FA 5C0RH 3KXFD 2QLVB 2B1AL 2ZXBA 3KJ6L 3HG1E 2QSQA 1A1OA 3I6KA 4URTB 2AQNA 4X9IA 3GSWA 1OVZA 4P57A 4QRUB 4NQEB 4M4PA 4LHJB 2X4QB 3NSCA 4DP6X 4NUJA 1WVZA 2CM5A 2WN2A 1T7VA 4M8QA 1INQB 3RDTA 4LL4A 3SE6A 3LX9A 3SCMB 3AZUA 5IFHH 2YC1B 3QZBA 4QHKI 5A2AA 4WI4A 2MIZA 1ASPA 1QHOA 1KY6A 3I3BA 2BHUA 4XNXL 4TXVB 1YLBB 2VR3A 5L8JB 2G5RA 1RIUL 3J07A 1LO2H 3BRFA 1M7IB 2DH2A 2OMWB 4JN2B 5L9DH 2XJLA 1MHHA 4ZBJA 4MQXC 3HN8A 3OV6A 4EUPH 5K9OB 1M6OA 3FT1A 3GMRB 3KBPA 4GRLB 5E5MB 1QBLL 5D1ZB 3T08A 4JO2L 1JVLA 1G9NL 1NL0L 2IEPA 5AB1A 3MRMB 4YSSA 3QUGA 1ZLWH 2I27N 3LHPH 3ZSSA 5IHWA 3W9DB 1DLHB 3Q01A 2NY2B 3K6NA 3LXAA 4OSUH 3IE9A 2Z92B 5DZOA 4H8WH 4ZPVB 4AW7A 2D3VA 1TVDA 3MXWL 7FABH 4W4NA 1AS6A 4OIAA 4MCYA 3RGVD 1ZLWK 3GRWH 4A2LA 3T0WA 2VOTA 3N5AA 5D4HA 3IMSA 2UY7B 4KTEL 3EFOA 5D1QC 1JP5A 2NXZC 1XR8A 4R7XA 1QSFB 4Y4HA 2Y2WA 1OAQL 2BHZA 4GRMA 1OIOA 1TTBA 1FAIL 4PU2A 2CKBB 3BWUC 3EAKA 4I4WA 3RILA 1KB9K 5CAYB 2B7DT 4YHKL 1EJ8A 2QT6A 3L81A 4ZW7A 4PRHB 4RMTA 4HS8L 3ZRSA 2MQGA 1N4XL 3V0WH 3N2JA 5FW7A 4WK0B 1CD1A 2GUYA 3KXFE 4MQTB 4BIKA 4JRXB 5TF1L 1MAMH 1SMAA 3NRFA 1U33A 4CN6A 4JFZH 2BVPA 4DVBB 1HKLL 2FBJH 1NGWA 2FJFA 1CIUA 2K6ZA 1UB6B 1UD8A 1T0OA 3CHXA 3FT4A 2I69A 1BG1A 3TBTA 1LWRA 1N0LB 3L7EA 3U7WL 4QGYA 4KY1L 2X41A 2XZZA 1D2OA 3QFDA 4ZODA 3EXJA 1CLCA 3LN5B 2XWBB 2I9TB 1IGTA 5I26A 1P1ZA 3RIAF 4KJYA 4Y19A 5ACLA 5IVOA 3EOBB 3QS3A 3DVNB 1KIPB 1FH5H 4PIBA 4JVUA 1IC7L 2VDKL 4TUJB 1EFXB 3OLDA 3NJLA 5DYOA 4URKA 4GUOA 1EJOL 2JSFA 5EO1B 1ZE3H 1LGVA 3GTNA 1JZ7A 1HILB 3Q8BA 4X7EC 4U3CA 1PKOA 4TUOB 2XA8L 2IFGA 1N70A 1XR9B 2B1HH 4RVBA 3HHRB 6PCYA 4RGNC 2V5YA 5FFLA 5ISZA 2P8PA 1XGRB 4FQLH 4X9HA 4ELMA 1SXAA 3I9AA 1JL8A 4JFEB 4JO4L 5ALBH 3S9DB 1YYMH 1HNFA 2H6UA 4MNQE 1E5ZA 4M4RB 4JO5A 2D2OA 3HVNA 3N85H 3WO4C 1RZJC 2BY2A 1QR4A 2N7SA 1Z2KA 4TVUA 3SYPA 2CCWA 2OSXA 2CD0A 1XGUA 1OEZW 3UTQA 4WEMB 2A9DA 5DHYB 5EZLA 3VX0A 1Z32X 1RHHA 3RIKA 2HCZX 2FBRA 2QTEA 3RB5A 3BUPA 4HOMA 3MGOA 4DEUA 2HJLA 5L2KD 1I53A 5EUOB 4UV7H 5IOKA 1MHEA 4S1RL 2BNRA 4MA8L 4KZDH 2VWEC 1I3GH 2E6QA 1KB9J 4JRLA 3UTTB 4JG0H 1KIRA 4BK8A 3N50A 1W6LA 2FX9H 2R4RL 5I8KL 2WXOA 3GBDA 4PRPD 5CEXB 1JXGA 2XIDA 1SF5A 4LF3A 4HS3A 3ULVE 3L45A 3BKCH 3QZMA 5F9OH 5IKCB 1OB1B 3QORD 3SHSA 5IVNA 3UTPD 4P5MA 1G6RH 2EDJA 2J1XA 1N10A 4UM8B 2JB6B 1VFBB 3WUWA 1KB5A 1FLRL 2V7HA 2Y3AA 1FV1B 2XVGA 4ELMF 1BDYA 2XICA 3AGWA 1AQDB 3L5HA 1I7UA 3DVFA 4LSDA 5IQLA 1C5CH 1XX9C 1J11A 5IJCC 2X1WL 4U1NA 3ZZ1A 1AC0A 1IKFL 3VXOB 4HU2A 4F8OA 4OGXH 1NC2D 2OR9L 3Q9QA 3CH1B 4G8FA 5ENWA 1VFMA 2EE3A 3GJFA 1OV8A 3QK0A 1IAOA 2FECI 3MFFA 3TVMC 1OAKL 5EOTB 3R06B 3H53A 3EGDA 3U0TA 5F0JB 1UCBL 4Y5YC 1RUKH 5C0FB 3F7LA 4G1EA 3REWB 2UYLB 1B4RA 1MKFA 4Z95L 3QNYB 4XBPB 3CFBB 4FZ8H 2J5LC 1XQ4A 3FQUA 4WNJA 1YEDB 3NABH 2IWFA 4XP6L 1QPPA 4MQ7B 3BISA 1NAKL 2NLJA 2J55A 3PHQA 1ZGLM 2KI6A 1CGXA 4N3TA 4XCEB 3TONA 3IF1A 3PXHA 1FNGB 4WHYG 3R1GH 3NACL 3QARA 3X12A 4YHZL 1JFQL 2N59A 1HXYB 1OWRM 3NRPA 2XG5A 4RQQA 4TSCL 5CSZB 5LNDA 1SFDA 3JWOL 4E42B 2P7TA 1QG3A 3APMA 4L5FL 1JGVL 1MDAA 3R7RA 2F1AA 3AMKA 3RZCA 3BGFC 3R18A 1BOGB 3KL0A 3AY2A 1EHNA 3WGUB 2IV8A 5HJ3A 5DO2C 5F7EL 3TIEB 5CXPA 1QBML 4UM9A 2IWGA 5HGDA 1DBKH 1ZANL 2A9BA 2EAEA 4U1JB 3T3PE 3GEWB 1D7BA 1BBDH 4PRPE 3WAKA 1S7WB 3NIFB 2HN7B 4GQ9H 4MQSB 5E4EB 4EOWH 3T4AA 1L6ZA 3N9GL 4NQCD 4U3XA 4G9FD 4YXKH 2JJTA 2R0LH 2DQEL 2YFOA 4LAQL 5D6DC 1CDJA 1HAWA 2F1BA 3CHRA 5AD0B 2VZOA 3UTPE 2YMTA 4HA1A 4PHZA 3FONA 4N8PA 1JHKL 3B2XA 1K85A 3WYRA 3C5XA 2YD7A 3AU1A 3TCLA 1XF5A 1G0XA 3N0PB 3FRUB 1EUTA 5LDSA 3MKKA 1JPEA 4EI6B 3V7AG 5I15H 1TZHA 3V5HB 5INCB 2ZP8A 5T1LA 1SLVA 5AOKA 4G6MH 1WSST 4ZTOL 2R23B 4L3CA 3U48A 3WTTA 5FWQA 2BVQB 1EEYB 1UB5B 1N0XL 5CP3A 5JW5B 5E9DA 2GJ6B 4XX1E 3S37L 3ML9A 3GPEA 4M6NH 4OM0H 4OLVH 5IW1A 4W9LC 1BW8A 4LT7A 3G6DL 2DS4A 5F1NB 3ZK0A 2VKWA 5BV7C 2F7PA 3LIUA 1NFDB 3ARGA 3QORC 2Y7OA 4OD1H 3Q6GH 3QHFL 5J06A 5FOBB 1IBGH 4JFDA 1IEBB 3IDGA 4HH8A 4YDVB 4YK4C 1INEL 3DDFA 3FTWA 5DURB 2Y7QA 5LBSH 3HAEH 3WIHL 4WIQA 3QJHB 4WFFD 1FZMA 2PCYA 3U36A 3L9BA 5GIRB 3QDMA 4JFHD 1XSKA 3Q6FB 5F2FA 1NLBL 4F33A 3B37A 5KUMA 1QSED 4WNQB 5ITFB 3S88L 3MV8A 2VDOB 4ZOBA 4AJ0A 4HMEA 1ZDQA 1SYSB 4HT1H 5HI5D 1QLEH 1TQVA 4WV1C 3IAGC 2EH8H 2YPLB 1YNLL 4KOBA 5LBGA 4L3EB 5I1LB 4D3CL 4RNRB 2XKUA 3TBVB 2V2TB 3AT8A 1WCBA 1CFNA 5ALCH 4M7JL 4ANVA 3FBKA 1UQSB 5IHZB 4NQCE 3VJ6A 5FKPA 1NANH 4G9FE 2NW3B 4QWWD 1THAA 3E1ZA 2C8NA 4RZKA 1EZVY 1MEXH 4XBMA 1XAKA 4LSRH 2WQXA 1IGCL 3L3IA 1G7HA 3QEQD 1QACA 3FQXB 3HPLB 4P59L 4UDTB 4N90D 1NBQA 2OP4H 4YPGA 3UZVA 4AYDC 3BVNB 4Q6IA 2VO8A 5LCVH 3CTTA 2YEQA 3K72B 4DP9X 5IEKB 4HALA 5DVKA 1WBYA 1NCDH 3V4PL 2A6JA 3ESPA 2JVUA 1HQRB 3EO1A 5F9JB 3NCJH 5I1EH 5DRXB 3ZQWA 2NY3B 3OZ9L 2ICEC 5CIPB 4AC2A 3AWGA 3UPRA 1RUAH 4GLRI 2QADD 4B0MM 1HL4A 5F6IC 4ZX6A 3VI4B 2QJDA 3G3LA 4L0YA 3MV7A 3DOIA 3WJJA 3KCWA 5HHNB 3QDHA 5I73B 4K3DL 4LBEA 2NUTA 4JDTL 2A9ML 4YE0A 3QQ9D 3KAAA 2IOMA 1G9MC 4WENB 1UC6A 1XF1A 1XGTB 4PJDA 3MLUH 5AAMA 5I82A 4OCWH 2EIJB 1JXDA 2R7EA 1PG7H 3O3AA 3NA4A 1M3JA 3LIZH 4YNYA 2NYYD 2CO2A 3NT0A 1WIPA 1TENA 1SY6A 4WFFE 2DQHH 2XLLA 2VLKB 2B59B 1JSYA 4JFHE 3QUXB 5EZJB 4LCWB 4B3VA 2Z35A 2WXPA 3V6FB 2E27L 2J8UB 2CLRB 3U4KA 4NQDD 4WVRA 3CWGA 3IDYC 4LVOC 5IVXE 1MLCA 3PL6D 2WSPA 3MBWB 3SDAB 2BNQB 4XAWH 4NUQA 3VB9A 1B2WH 5F93C 4LOVA 1J05B 4GMSH 4CVUA 3GMOB 3VG0H 1YEFL 3VXQA 4DUWA 1V54B 4MWFB 4NN6C 3UIYA 1OALA 3T0EA 3G5ZA 2EXSA 4HCRA 4P5SA 3JV6B 5AB9A 1RJYA 3VGGA 1ES0A 2QPDB 4AMWA 5DSCB 4N90E 2PW1B 2UXVA 4PJDF 1V05A 1F8TH 1YYLH 2KLRA 3AQYA 2I7SA 1WEJH 1KTRL 3X3FL 1LNUB 2G2NA 1KF9B 3MLZL 4FABL 2FDBP 4TUUA 2AEWA 3WFBL 5JLZA 4HUCA 5GGSY 3TO4C 3BCDA 3FYEB 4CN1A 1AI1L 1XGZA 2IAMB 3QIBB 2D0FA 3ZDZF 2VRQA 3D33A 4WJG3 2CO6A 1YQVL 1NH6A 1DYZA 3NDYE 4KOCA 4WHDA 5C0CD 1JZIA 4YSTA 5HI5C 4Z18A 3MNWA 2BC4A 4DF9A 4MX7A 4D7PA 3BAKA 5GJSH 3WKPA 1NCBH 3DSNB 3KWVA 4KVNH 3N40P 4CKQA 3OR6B 3CFDA 43C9A 2VERA 2NZIA 5DUBA 1P2CB 3KGTA 4MD0A 3BP7B 5AAPA 4WWNA 4GAGH 3F58H 5C07B 3D85D 3GS4A 4LSVH 3AQDA 2X89D 4AENB 3TZVC 1LEGB 4UQIM 3HZMB 1QO3A 4LCIL 4Q97A 1DFBH 1ND0A 3FXIC 3V4PB 4Z7VA 1U8IA 3LKPA 5I6LA 3ESUF 1ZVSA 2YGNA 3DSFL 3KG5A 3OF6D 3QJFB 3DI2B 1A6PA 4XODA 4TLTA 4D8OA 1NBZB 2WXHA 4NQDE 2EE2A 2QADC 2QBWA 1TVBA 3VXUE 5J6GB 4JUTA 3F7QA 3NPZB 1XEDA 2DIEA 4AYFA 4YUEH 3GSXB 3FU3A 3MRQB 4I9XA 3SY0B 4G70B 2A9NH 2EYSA 4IJ3C 3MA9L 2VMEA 2H4EA 2ITDB 4X8GA 4MKMA 1ADQH 4JL1A 4AITA 5E03A 1JYWA 3QQ9C 3DURB 4K73A 2IQ9L 3ZSTA 4K8RC 1SRDA 1AR1B 4ONFL 4X8XA 2COVD 3PFUA 4Y5VB 2BERA 3CSTA 2ZXWB 4P9HL 2K45A 5BUAA 3F5WA 4P2RA 4CA4A 4QF1B 4X98A 2L7UA 2NYYC 4WWKD 4R7NB 3MDJA 4KJQD 4JFQA 1TJIH 3OKLA 1QTSA 4ANUA 3L9YA 1TVHA 2DQTL 3P1VA 1MCWM 4FYSA 3BD4A 4AE1A 3F7KA 1A9EA 4Z7VF 3VFVB 1U92A 1JGLL 3JTTA 3VI3B 4RMWA 4FMFA 1P9MC 1CK0L 3O6FA 2GT9B 1FC1A 2G3MA 4PJCE 5HYSG 4NRYA 2LR4A 3O2DH 3PL6C 3ULSB 2G2RA 2NW2B 5DUPH 4DZBA 1A47A 1BVLB 3NP4A 4NX0A 5DT1H 1TDQA 3SQBA 5C3LD 4OLUL 5A6LA 2F0CA 3TNMA 2G2PA 1SBBA 3D4CA 4Z7UA 2ADGB 3ULVH 3D05A 1RLWA 1KCSL 1I9RL 5F6HI 2IQAB 3EHBB 4X50A 3GHBH 1F1GA 1IC4H 5BMFH 4OB5L 4NKIH 1I3UA 2DTMH 1G1KA 3GMLB 5BJTB 4W9GC 4N0FA 4ODTH 1SQMA 3SE4A 2YSSA 3O45A 3IJ8A 5F9AC 5L6YH 4FA8A 4FQHB 3EBIA 2FQFA 4Z3FA 3T3ME 4JKNA 4L4VB 4B9JA 1MCKA 5BVJB 1F90L 2C9PA 4MNGA 4EZJA 4KBPA 4J3VA 4NOBA 4DO6A 4HIHA 2F53D 4MMXB 1IC5H 2WQSA 2X05A 4Z7QE 3VH8A 5IFHL 4TNWF 1RHFA 3V0GA 1QFOA 4WTZA 5CJOH 2OA9A 1F11A 3WMQA 4XHQA 3X1EA 1KELH 5D7JD 3UBXA 1F2QA 3TBYB 1IGYB 2I5YH 5GGQH 1E2VA 3NQIA 2MOVA 5AYQA 4L8CB 1H19A 5L9DL 1LO0L 4Z7UF 3O41A 5KS9A 2G9HA 3C6EA 5IMLB 2GBVA 4M7KH 1VFOA 3GUTA 3H0TB 4DETA 2VL5B 5BS0B 1U3ZA 4YDIH 2A38A 1XZ0A 4FXKA 3UXFA 4JFTA 3KEHA 3HHSA 1ICTA 4GO6B 1IE5A 1HIMH 3LHPL 4HS6B 4UB0H 5EIVA 4DEPB 2GI7A 1DVFB 4QNPF 3N1QC 5DGRA 1KCLA 4OSUL 1NICA 5GGSB 4KI5D 3ZT7A 4B7IA 3FOLA 2IDSA 4H8WL 5C2BH 1JYVA 2ESVB 1LK2A 5CBAB 1WICA 7FABL 1G7PB 3VVVA 1I1YB 1R6VA 3HB3B 4E68A 2IPTH 2NY0B 4L8SB 1MFMA 5J3HD 1CICB 3TA3B 5I0ZA 2DB8A 5HXMA 2BSSB 2AW2A 2ZONA 3ROOA 3SJVD 2Y4SA 3HE6A 3FTUA 4Y8AA 4R83A 4QRRB 4A2HA 1U3JA 7CGTA 4KI1A 4TM9A 4UAOC 2OXHB 3EJRA 3MTRA 4I7ZC 2KZKA 2VT0A 3D25B 1AGBB 1BA9A 3IRPX 2VE6A 3UAJD 2Q8BH 1KDIA 2V2XA 4NWUH 1NUGA 4WKZB 3P9LA 4KKAD 1BZ7A 3ZW3A 5KS9F 1XCWA 4EDWH 3CV5A 3V0WL 2MPVA 1TQTA 3BDXA 1ZMYA 4G6FB 2F6AA 1DL7H 5BXFA 3BEWA 1MF2H 1MAML 2Q2EB 4FFVD 4G7QB 4WUUB 4WWKC 2FBJL 4KJQC 3DXAA 3S2CA 3MGTA 3KWUA 4X5WA 4PYHA 5DJ8B 2FR4A 1R5IA 4OCSH 4GKLA 3UYOD 1FL6B 2C9VA 3LYRA 2DH3A 2ZF9A 3DOSB 3MLTA 4PJXE 5CZVH 4P3CH 3GSQA 4JPIA 2XSKA 3E1F1 5TQ0H 3N55A 1F4XH 2YZ8A 3LNHA 1TZIA 4YFDB 3FH7A 5BRZB 3RGHA 1IILE 3ES6B 4KHXL 4TVPD 3NCXA 4DSYA 3KYNB 3N6YA 3O11A 1S4IA 5C0DB 3FT9A 1QRND 4G8EB 1CLZH 1FH5L 4F24A 1KYAA 1NFKA 1UM6L 3IPEA 2DQFB 2XA3A 5TJWK 4AKPA 4BZ2L 5JQHC 5IEHA 1U2HA 2WINB 2DLHA 4N22A 4WU5A 3ZDYE 2D7TH 4U7KA 4HETA 3TC9A 2MWCA 2JF1A 2J8HA 3MMEA 2B1HL 3NFNA 1CXLA 3X1GA 2A5UA 4UTAH 3IVKA 3CH8A 2X6BA 5CUSH 5ECJE 4W81A 4OLEA 2ITFA 4FQLL 1OTTD 3T4YA 1J87A 2QVMA 1R19A 5ALBL 4CRPA 1YYML 4JQXC 1FZJA 1UACH 1MAKA 4DUVA 3IE4A 2FJGB 2WNGA 3GSVA 4UT9H 5I5IA 1WFMA 1BJMA 4GI8A 4R4ND 4B96A 5TK2A 4KI5E 2HX8A 5LN8A 2LQRA 1O5PA 4UQ3B 3OXSB 3MQIA 1FZOB 1FL5A 2WVSA 3MRGA 1Y6KR 4FYTA 4ZO7A 3SJVE 4UV7L 2ZXQA 3POCA 1LILA 4KMLB 4XNUH 1R3HB 4JHBA 4U1IA 5AKTA 4KZDL 2GUOA 4K71C 1I3GL 2NPLX 2WVUA 2GSGB 3AABA 2FIRT 5FV2A 1OOWA 2VR6A 2IGTA 2GIYA 1QFHA 1JS4A 2FX9L 5KEZA 5H94A 3UG4A 3EJUA 4R96B 4U33A 3GLZA 5MEPB 3BKCL 5LGHH 2NSQA 4E9LA 4DEWA 4LSSL 4EUPB 2MFNA 3ARBB 3F7PC 4B9CA 1G6RL 5GGTH 3GDCA 3TOPA 4X7CC 1KXVC 4H40A 4B95C 3PDGA 5EC2B 1SLWA 4QRUA 4NQEA 5F7LB 1C5CL 1UT2A 5EBGA 2X4QA 4RBPH 2E7LC 3NUKA 2W0LA 3ZE1B 3DPBB 4OGXL 5FA3B 3PWNB 5C7XL 1INQA 3EJYD 1EJFA 3SCMA 3X11B 5F7NC 3F64A 1KNOB 4WHTB 3VXMB 2YC1A 4RBPK 4TVPE 4PP1D 4Z6AT 3MLSH 5B1KA 1BD2E 1RUKL 3D9AH 5CFAA 3VCLB 2AJUH 4PWJA 3FT3B 1PFCA 3RWIB 4XVUC 4XN8A 1ZSHA 5AVXB 1P7HL 2NNAB 1H8OA 1M7IA 4FZ8L 1VEOA 2OMWA 2ZCLH 3ATFA 4JN2A 3PS6A 2V4LA 2C1PB 2E47A 3J7HA 3EDFA 1E4JA 1IO4C 5K9OA 2F68X 3GMRA 1EO5A 3PWPB 4GRLA 5DVPA 5E5MA 5GZOC 2ATAA 1CDGA 5D1ZA 3T0AA 1LP9E 1CGSL 2ZE0A 4OGYH 5HYJB 4FAAB 3ZIYA 1ACXA 3QQXA 4XP4H 2VW6A 3MRMA 2W38A 4NHCH 3U0WH 2JE8A 1YNKH 4FFVC 1BP3B 1DLHA 1S9VB 3W9DA 4MCNA 1GC1H 3R1GL 3BPCB 5DYFA 5CSGA 2Z92A 3F7YB 4ZPVA 1PLAA 2X6UA 2PP9A 4C83B 3CZSA 4E0RB 2WQ8A 3AM8C 5SWZB 4FNUA 2UY7A 4MS8D 5AW5B 1PL3A 2JLPA 3K7UA 2WP3T 3ARED 3S7GA 3SSGA 1QSFA 5FUOH 1DBKL 3OKKB 4RWYH 2LU7A 3QPKA 4PVBA 1J48A 4KO6A 1BBDL 4GQRA 3S35X 1JDDA 1P4BL 2CKBA 4GQ9L 4EOWL 1UGKA 4WJKB 3T5WA 2EH7H 3MJ8B 4YXKL 2R0LL 1X9LA 2LU3A 3U46B 2JIXD 3FU8A 4PRHA 3ECUA 2I07B 2HWZH 4YQXH 1OTTC 4JRXA 5CJQH 2PXYD 4DVBA 4Y1TA 1PSKH 3GT6A 1NCAL 1PEWA 1UB6A 3AG4B 4R4NC 4BM7A 4AKQA 2CHXA 5I15L 5CN3A 4JO1H 4M29A 4JY6B 1N0LA 2VYRE 1MWAH 1NSNH 2X4RB 4G6ML 3LN5A 2XWBA 5D7HA 2I9TA 2BVTA 3QJOA 4BE5A 3SGEI 3OR7B 1HZHL 3IETB 3EOBA 3KPRB 3U79A 3DVNA 4D8PB 3SGKC 1KIPA 3CQPA 3WD5H 2CLZB 4P2QB 4TUJA 1EFXA 1YN6B 2W1NA 1XH0A 5EO1A 1O9VA 4PJ9D 5I6NA 2I9LB 4M6NL 4OLVL 2RBLA 4G8GD 1HILA 4GAJH 1E9OB 2FVNA 4TUOA 3H9HB 2ZT9C 1XR9A 1JE6A 4FKEA 2VR4A 3PWVB 1XGRA 4OD1L 4JFFD 4JFPB 3Q6GL 1G6RB 1I8LA 4L2LA 4JFEA 1WT5C 1XSJA 5DRZB 4Y88A 1IBGL 1KLFB 5KAQG 1HEZB 2BVEA 4M4RA 1FCGA 4RA3A 1C8PA 2FHFA 4IBVA 5LBSL 1FBIH 5AAWC 3OM3B 2UV3A 2QV2A 3P9MB 1K3IA 2QR0B 3DECA 2WB7A 1O0VA 1COBA 1TZ8A 2YKKA 3L4CA 1RZ8B 4HBQA 4LMQI 4O2FB 4XC1L 5DHYA 3SPVB 5ADPH 1Q0EA 3EJYC 4XZUB 3F12B 4GBXD 2AABL 2DY2A 5EUOA 4HT1L 4KHTH 1QLEL 1KBWA 1WFJA 3EZJB 4AQ1C 4JFWA 3ZIMA 2EH8L 5C0NC 3BPLC 5FB8B 2BIOA 2YPKB 2KLTA 2P5EE 3UTTA 4DK6A 1XL6A 4C55A 5D7EA 5ALCL 5CEXA 1I9IH 3AS3A 3H6AA 1AG0A 1BYOA 2J6EA 2VLMD 4HHAB 2IFFH 5IKCA 1OB1A 3FW6A 4AYBA 4A04A 4MRBA 1MEXL 1PY4A 5EMYA 2D7PA 4UM8A 2JB6A 1VFBA 1FV1A 2HVKB 2OP4L 1Y7VA 2UUDH 5KJ7E 2E9WA 1AQDA 5LCVL 4AGMA 2ZX7A 3L5IA 3BAIA 1NCDL 3KGSA 3VXOA 5DFVC 1IC1A 3NCJL 3CH1A 3L1OH 5I1EL 2UUDK 2F58H 2JKTM 2W91A 3IDJB 4L8DB 4JZNB 1FFNB 1RUAL 3OKNB 5EOTA 3MLRH 1SYVB 3R06A 1UWGH 2NY6D 3WE6B 3IAPA 5C0FA 3REWA 5E6RB 2UYLA 5EUOF 1O9ZA 1MRCL 3RDTD 3AREC 4XNBA 3T1WA 4KTDL 2GSIB 1IARB 3CFBA 3QNYA 4XBPA 4LLMB 4MMZC 4G8GE 2R2EB 1QEXA 4UTBA 1NCGA 1J8KA 1YEDA 4MQ7A 1VGEH 4J1UB 4XN1A 3WLBA 3KNBB 3MLUL 4JFFE 5B39G 1E3XA 3MRPB 4DHLA 1Z6JT 2D7QA 4OCWL 5EZOH 3SQRA 4XCEA 1YEEH 1PG7L 2IWEA 2QEJA 1OE2A 1TZGH 3TN0D 1FNGA 3L2NA 3LIZL 1JK9B 2PXYC 2YD5A 1H3VA 1JTTA 4UCFA 2BDNH 4CC4A 1HXYA 4TNVF 2DQHL 1A6AB 2YOAA 4F15C 5CSZA 3I74A 5CNHA 1LE5B 2X2UA 3TA4D 5JMOC 4CSZA 2FX8H 4I89A 1T4KB 4E42A 1UA3A 3E9UA 1XB3A 1Z9MA 4FKKA 4JQIH 3RWCB 3MZGB 3GZOA 1BOGA 4FS0A 2WK2A 4OD3H 3F6LA 3TIEA 2CUMA 3FYIB 3VDCA 4XAWL 2VM9A 1B2WL 3AACA 3CIAA 1UZ6E 1Z5HA 4U1JA 4GMSL 1D5BB 5DUMH 3VG0L 3S4SG 4OBRA 1S7WA 1GOFA 2HN7A 4PJ9C 2CHWA 1IE4A 2VLME 4JCLA 2X53A 1LWHA 2D9QB 2XWJB 5AVRB 5JYLA 1A0QL 4CAGA 3MC0A 1DCEA 2W88A 5E1IA 5LQBH 1CFQB 2D8KA 5AD0A 4Y4HD 4B5EA 1RKRA 5J56B 4MDIB 4O00A 3U4EB 1WITA 3RTQC 3TNNB 3QAQA 4BFEA 4LVHC 4P46B 5ESAB 4HMDA 2Q86B 1F8TL 1YYLL 3R19A 1ID5I 3O6MH 4PP2B 3LZFL 3FRUA 1UD3A 4OLWL 3SYCA 1WEJL 1A14H 4AQAB 6CGTA 4EI6A 1URLA 3BEVB 3V5HA 5ES4B 5INCA 2WQAA 4DP2X 2ZP0T 2JV6A 2CGRH 4JZJC 2R23A 5I76B 4GBXC 2YPVH 1X4YA 3HR6A 2BVQA 2VO5A 1EEYA 1KJ2H 2YARA 4GNKB 1QLEB 1UB5A 3OMNB 4S2SB 3M88A 5EBWB 2E8YA 3B6SB 2WGNB 5JW5A 3UX9B 2GJ6A 1JGDB 2YGVA 3ZE2B 2LLNA 4NKOB 1UH2A 2R0ZH 1ROWA 5DZJA 4Y19D 1FDLL 5GJSL 1NCBL 1G4MA 4ZSOB 5F1NA 4KVNL 4EI0A 4TQHA 3NIFF 2IMMA 3FOMB 2R39A 1NFDA 3CDYA 3QFJB 3G5XB 2VSDA 4J27A 4GAGL 3F58L 5FOBA 1PX3A 2WSDA 3SE3C 1IEBA 4LSVL 4YDVA 1K9TA 1PZDA 1WGVA 1VERA 4LGPB 3V0JA 2PNDA 3V0FA 5T5NF 1X5AA 4HUVB 3QJHA 1DFBL 4ZMWA 3QZNA 5GIRA 4X6CF 1NGPL 5E8EB 3Q6FA 5HP5A 1S9XB 3DMMB 3UEQA 2CZNA 1BEYH 2GCYB 1DTUA 1PX8A 2K78A 4WNQA 5ITFA 3GXMA 3T0XA 5F7BA 2G3NA 3TFBA 1JYXA 1SYSA 3DK2A 3VGAB 1RY7B 3NH7L 2NY6C 2BIIA 2YPLA 2JKNA 1KJVB 4L3EA 4NRZB 4UT7H 5I1LA 1PFOA 2BZ7A 1MFAH 1VZGA 5I71C 3DX9B 4RNRA 4YUEL 3RDTC 5AVVB 3AY4A 3STLB 3TBVA 4ANXA 5I1CH 2A9NL 5IJDC 3WUZA 5LUMA 2NY5H 2COQA 4OGZA 1ADQL 1UQSA 4XVOA 5IHZA 1HHHB 4HEPA 4IMLB 2HKHL 2NW3A 4N5EC 5LB1A 4ENED 4GO8A 3BYTA 1KEMH 5F44A 4GQZA 4Y9GA 4GI9A 4GSXA 3FQXA 3HPLA 4UDTA 1NFDF 1SGKA 1G7QB 4PJ7E 4CSSA 5E24E 2BSDA 3BD3A 3BVNA 1VZIA 5C09E 1N9PA 5FUZH 4X0KB 3K72A 4JO8A 5IEKA 1TTUA 5LWYH 1DR9A 2RA1A 1JERA 1MI5E 1BVOA 4IJTA 1HQRA 3PUUA 1TJIL 5F9JA 3CVIL 4PVMA 5PAZA 1BAGA 5DRXA 4NNXB 5CIPA 2BIMA 4KXDA 5INDB 4TKWA 1KC5H 4RA0C 4KU1A 4R97C 1MFCH 3VI4A 1WISA 3NCYS 1YMMB 1RZQA 4HBCH 1DANT 2FO1A 4XO3A 2VSMB 2QMKA 1YSOA 5DEZA 4A68A 5FV1L 5DLMH 5HHNA 5DUPL 1RERA 3OB8A 4O02B 4TUKH 2CDGB 5JOEA 3QP3A 4OBSA 4Q56A 1FFRA 2IADB 2X4OB 1NBVH 3OSKA 5EULV 2OYPA 1SUHA 3RJOA 3ULVL 1WIUA 1CGTA 3L4UA 4M7LH 4R84A 1XGTA 1MHPH 3GHBL 1IC4L 4CMHB 5BMFL 2O6EA 2DWYA 4Y4HC 4WSKA 3DIFB 1N6VA 3TFKD 2DTML 4LOUD 1LQSR 4ODTL 4CC1A 2VLKA 1GZPB 1EFQA 2B59A 5L6YL 3QUXA 2DQGH 5EZJA 3AAZB 2DQMA 4LCWA 5I8EB 3V6FA 5L4MA 2J8UA 2CLRA 4IBQA 1WUNT 1EJ6A 2P5PA 5E6ZA 5F8QC 3M07A 2H1XA 4Y2DB 4S1QH 1JV2B 2RTTA 4TVPH 2Z91B 3Q43A 1IC5L 3RFZB 3MBWA 2VRKA 2BNQA 1L9PA 2H8PB 3SDAA 3VI4F 5FKAB 2G3XA 2BJML 5CJOL 1J05A 1NUNB 1TLKA 3GMOA 5DMYA 3RZCD 4YHYC 4MWFA 2FSDA 4LVEA 3ZLQC 3KLDA 2I5YL 5GGQL 4UM9D 3JV6A 3PV7A 4OH2A 4YXHH 1HWWA 3OL2A 2CNZA 4A38A 3BH8B 5DSCA 1F5WA 4FP8H 4N2NA 2AF2A 2NQCA 3SKJH 3B3BA 2PW1A 3TH2T 5JIPA 3ARUA 3KXFB 2X9YA 1N12A 1ED3B 1Z5YD 3ZGIA 4YDIL 1BVNT 1LNUA 1PCSA 2PWEA 3UERA 3T04D 4KKCD 1HIML 1G9HA 1ETB1 1MOEA 4LLWB 3SN6N 1MAJA 1T1ZB 3QIBA 2IAMA 2ENSA 5C2BL 3BP5B 3LZQA 3LKRB 2IPTL 3BT2H 1L9NA 1O7VA 2Q2LA 3QHTC 1GYVA 1TQBB 5FFOA 4ZW8A 4YL9A 2G75B 5T1LD 3RWGB 2M26A 3CFTA 1YO4A 3NJJA 3HI6L 4HUKB 3ZX1A 2OJEB 3WUWG 3DSNA 4X7TB 4JDVB 2RQEA 3OR6A 3K80A 5E9DD 2QKIB 4ENEC 1P2CA 2Q8BL 3BP7A 5C07A 4NWUL 1L9SA 4FQCH 1KN2L 1OD7A 4HEME 3V0EA 4EIUA 4BQCA 3BT0A 3C8DA 1QNIA 3GIZH 4AENA 4G83A 2NZ1A 1LEGA 4EDWL 3D2TA 2IOOA 3HZMA 3QR0A 4MNQB 3W0WA 1DL7L 4DWHA 3ARGD 4N1CA 3V4PA 2PW2B 3RNQB 5EF1A 1VESA 5J12C 1U42A 3NDZE 1WZAA 1OAJA 4MBRA 4JFDD 2AANA 3QJFA 5LG6A 4OCSL 1PDKB 4HXBL 1D9KB 1NBZA 3PWJB 1BWWA 5CZVL 3RGVB 2CQVA 4P3CL 1YEHH 1Z9OA 5T1MB 2OPCA 3EJPA 5HTSA 3TT1H 3C9NB 4V11A 5LKNA 1QLRB 2VC2H 3QDMD 5J13C 3GKZA 5J6GA 5JORB 1G1YA 1D5MB 3GSXA 3QBTB 3SY0A 3MRQA 5C0BB 2X12A 2ITDA 1NGXB 4DT2A 1CLZL 3L5XL 4ETQB 4UAHA 1SEBB 5IMOB 3L3KB 4XMLH 3DURA 4O58H 4Z9KB 3DUHA 4RFOL 2D7TL 4POZD 2Q3AA 4UTAL 1Z1WA 1I8MB 1IUZA 5CUSL 5KVEL 2LV4A 4Y5VA 4ZMTA 3TFKC 5JHDD 4PW3A 4QF1A 4AGQA 3B7RL 1UACL 4R7NA 4UMGA 1SNRA 3GB7B 1TSHA 4UT9L 1KY7A 5E2UL 4WSJA 3WNOA 3WN5B 4RSYA 3VFVA 3GS7A 3VI3A 3ARSA 1J5DA 2B9AA 5BVPH 1MQ8A 2GT9A 4J2XA 4HH9B 1AZZC 3QDGB 3I2CH 1KJMB 4HZLB 3ULSA 2GTQA 2I26N 3FB7B 4ZMPA 2NW2A 4XNUL 1BLIA 1BVLA 2VXTH 3LPGA 1NOLA 2DWXA 1FZKB 5AQ0A 1GR7A 1DSFH 3RZCC 2NXYC 4QHNB 3S36H 2ADGA 4U0RC 2X9WA 2IQAA 4DQAA 5JOPD 1J5OH 3GMLA 5BJTA 4EAEA 2FZ3B 3T4AC 5GGTL 4BFNA 2V0AA 4EO5A 4YX2H 2JJTC 4NKMB 5HGBB 4R0LB 1BMGA 3ZKND 3U9UB 4FQHA 4LLUB 3H4HA 4XB7A 4L4VA 1BQLH 4ZRGA 3NFSL 5F9WC 5GRWA 5BVJA 5D7LB 1BOYA 2F5BH 3MRCB 1HAUA 4IOFD 3IPBA 4MMXA 2BINA 3BFQG 2V3FA 4LHQB 2EIEA 2BSBA 3ZUCA 1X9QA 5A43C 4KROD 5T5FH 2BOCB 3KVQA 2AJVL 3MLSL 3D9AL 1CD0A 4J3OF 3ZN6A 2AJUL 2Z1PA 2BS71 3TBYA 2EVHA 2XX1A 1KUMA 1IGYA 2GIMA 3WNPA 4PRPB 1NANI 2EDLA 2MH4A 4L8CA 3DNKA 2ZCLL 5JIDA 4Z3EA 1HHIB 2JJSA 1QD0A 1KJ3H 2BFGA 4X5RA 1T4WA 3PG2A 5IMLA 3CBKB 2AQ1A 5B21A 2NSXA 1J1OH 4OGYL 2ZXCA 3T0ED 2QVKA 2W9DH 3H0TA 2VL5A 2DJUA 5GGRY 5BS0A 2CHDA 1C12B 5JHDE 4M7LT 3SB3A 4NHCL 3U0WL 1M1SA 4PJAB 3ARGC 4HS6A 5IK3B 1YNKL 2O5YH 4PMEA 5IHLB 1DVFA 1GC1L 1CD9B 5LHDA 1XIWD 2Y2YA 1K2DB 5GGSA 3H42H 5A2JH 2EIBA 2YQ3A 4QOKB 4IHBA 2ESVA 5KZCD 2GJJA 4F7KA 5CBAA 5IP4A 1G7PA 2GYSA 1KGCD 5GS1B 1I1YA 3WFHB 2EUVA 2V2WB 4L8SA 1SHWA 1CICA 3TA3A 1KN4L 2WTRB 2BSSA 2K3HA 2ZOKB 1XVSA 1RXLA 4CW1B 4ZNCD 1W0YT 4H13C 4QRRA 2NNXA 1LVEA 1CXHA 3C08H 4EN2A 1J86A 4EDXB 4R7LA 2OXHA 4HUXB 2CBPA 4JN1L 3D25A 1AGBA 3UPAA 3S48A 3IDIB 35C8H 4HUNB 3QIUB 2EH7L 1FFQA 4WKZA 1OPOA 5A2FA 1F42A 1YHPA 2D73A 2HWZL 2NY4D 2FLBT 1EX0A 4YQXL 1MJUH 1ILUA 5HHOE 5I75C 4ZMYA 4WUUA 3QDJE 1W72H 5CJQL 2VJXA 3MLYH 3MUJA 3HTLX 1PJ9A 1I1AD 2QKSA 5KSVB 5DJ8A 3VMNA 3ELAT 1FL6A 3FULA 4Q6IC 3DOSA 1MCFA 2LFGA 3UO1H 1OT2A 4W9CC 4JO1L 2FQGA 5BRZA 4TF4A 1MWAL 1NSNL 2ZSWB 3ZDZE 2E7HA 2ATKB 2CSPA 3ES6A 2Y72A 2YUZA 3KYNA 3S36X 2ED9A 5C0DA 3IU4H 3ZO0A 3QS2A 4C4UA 3NZ8B 4NBZB 3VD5A 4G8EA 1ZCRA 3WD5L 4Y1AD 4R4FH 2R56H 1E43A 2DQFA 3QZPA 1VADB 4YN3A 5EF2A 2R15A 4QRBA 4NQCB 4WO4B 1SOQA 3MLXH 1M57B 2WINA 4GAJL 4KNQA 4FFZH 3WJJC 2V2TA 3D0AA 1M7UA 2VM3A 3QIWD 3O4OC 5J8OA 2C9XA 3HBQA 3PQYD 4LKXB 3T0EE 2BP0B 1VEMA 1UM4H 3MRRB 5KANG 4B9ZA 2FJGA 5LGJB 5AAMC 4PRNB 1C5DB 3LZLA 1FBIL 5DZNA 3ZZLA 5D96B 4CU6A 1AIZA 5JHAA 3HVDA 3JZYA 4MBOA 4UQ3A 1A65A 3LNDA 3OXSA 4P2RD 1FZOA 2JI2A 4RMUA 3ZVVA 2B77A 4IOFC 5JOFB 1QYGH 2W07B 1ECZA 1QA9B 3FCTB 5FO8B 2WOBA 1FO0L 2ILLA 4KHTL 2J4WL 2EADA 2ENPA 3L48A 1R3HA 2C9AA 1UWXH 2YD4A 4WTXA 4NZUH 2GSGA 3O6FD 5GZND 1J5IA 1I1RA 2VR7A 2YS4A 2FUTA 2APWA 3BJ91 3EDKA 5H4YA 1MFDH 4RGOH 1CTNA 5CMAB 4R96A 1I9IL 1UWXK 3D30A 3UGXA 5MEPA 3EBAA 4OLXH 5CD5D 3MRLB 1L7IH 2IFFL 4NO0B 5I6KA 4EUPA 3ZKXB 1ECYA 2AJYH 3ARBA 4HAFA 4KDWA 4NS0A 2A74B 4HCIA 4ZT1A 5LBVA 3VYNA 3HHMA 3T0EC 4JL2A 3R8BB 1SF3A 1MVFA 3RL2B 2CIKB 1M3IA 2A6DB 5EC2A 1NKRA 2MRYA 4OD2B 3DPBA 3GMMB 4XXCA 5FA3A 2LAGB 3L1OL 3E2HB 3Q2LA 3PWNA 5HHVH 3VWKB 2F58L 4Z7VE 4WFHD 4AJYV 2JJWA 4BH7B 4PHXA 3GRWA 3X11A 3K2UL 4WHTA 1KNOA 2FX7H 3VXMA 3MLRL 1UWGL 3TASA 4XWGH 2WKLA 3P30H 3U9PH 4UTCA 3VCLA 5EF0A 5I1DB 3FT3A 5E5LA 1IX2A 4Y1AE 4NAMA 2DEWX 3RWIA 1TKWB 1BAWA 3ARFD 2NNAA 1LDPH 2PWFA 3UEZA 4LPWA 3VU1A 2Y23A 2C1PA 2ZYHA 3KBHE 2MQ0A 4TRPH 1VGEL 1USZA 3O3DB 3PWPA 4RGMC 4U05A 1OGPA 4DOHE 1U8NB 3PQYE 5HYJA 1MRFH 4KNTA 1U8PB 5GRYA 5J11B 1AFVH 5GGRB 1E4KA 1R75A 4X6BB 4PLNC 1BX2B 1J5CA 1YEEL 2NY4C 1AAJA 1LEIB 1VKXB 2GTZB 1TZGL 1NCJA 1S9VA 4QYAA 5I2IB 1DUZB 3WS3B 1XH2A 3IJYB 3SDYH 3BPCA 2BHFA 3S8WA 2H0EA 3H6JA 3F7YA 1A6UH 4XBEH 4P2RE 4F8QA 4IBWA 2BY1A 5HHPB 3CZEA 4AZ8B 3ZE1F 4C83A 2FX8L 4E0RA 1DFXA 2ALWA 1BYPA 3K1KC 2PR4H 4JQIL 5SWZA 1WV7T 3WTWA 3KJ4B 2RB8A 5DEJA 2X9ZA 4CVZB 4OD3L 3VTAA 1IV8A 1FRGH 4PS4H 2V5SA 2FLMA 1CDUA 2ITCB 2HRLA 3OKKA 4A7SA 5DUML 3FQ2A 1DEEB 3VSTA 2AQPA 4Z1PA 1EPFA 3MJ8A 3CFQA 3U46A 5LQBL 1XHHA 1BSIA 1YPZE 5AOJA 3K4ZA 3OTTA 2I07A 4N0YH 3AWEA 2HTLD 3B9KD 3E8UH 4N6QA 3ISYA 5JYMA 1JF6A 4JBSA 2XPGB 4GW1B 4R90L 1A14L 2YJLA 5LAXB 4R26H 5I1HH 4ZXBD 2YFNA 1DN0B 4JY6A 4WFHE 2MJWA 3D4GA 2CGRL 5B8CB 1K5WA 4LPVA 2X4RA 1N2RB 3DXAD 2YPVL 3RPBA 4A7UA 3W57A 5FR3A 1T5KA 1KJ2L 3VXUB 3OR7A 3IETA 4PRDB 3KPRA 4D8PA 3FQWB 2YAPA 2CLZA 3IBEA 4P2QA 4PPTA 1YN6A 1SJXA 4WK4B 4ZJ9A 3O6FC 3POHA 2VQUA 3VMPA 1JPGB 1PZAA 2I9LA 2R0ZL 4HIXH 4LEXH 1P7QB 2JJUA 1E9OA 4ZFOB 3H9HA 4QHLB 2Q6WB 4UANA 1L9RA 2K8MA 3SDCB 3IDXL 3F05A 3PWVA 1U8QB 1U2CA 4JFPA 5DRZA 1G6RA 2IDFA 3MCKB 3FT2B 3HZKB 1KLFA 3ALPA 2A77H 1HEZA 3L9EA 2DI7A 5EUKA 3H2WA 1H8SA 7TAAA 4FNPA 4AM0B 3CVHL 3V8OA 1ET5A 3BHBB 3FO2B 2HKAA 3VH8G 3P9MA 1JNJA 2QR0A 4RAUB 4WTZG 1RZ8A 1YECL 3QHZL 4O2FA 4RSVA 3SPVA 3SE4C 1BEYL 3IXTB 2F5AH 4YC2B 3LB6D 2EEXA 3UBXG 4XZUA 3F12A 2CGYA 4KDTA 1GS7A 4EI5C 2C4FU 4RDQF 4J8RB 5AZUA 1EERB 2UWEE 5FB8A 4UT7L 2YPKA 1IEHA 1BQRA 1CLOH 4QTIH 4D0CB 1CT8B 2LW3A 5I1CL 15C8H 3LZPA 2R0KH 2NY5L 1I4FB 2X6AA 2OAAA 4HHAA 4X5PA 3RY6A 1JGUL 4GY4A 1KEML 3VXSB 3N3EA 3D85B 1DVSA 3M17B 1H0DB 4ETYA 2HVKA 2IIJA 3O9WB 4N2DA 4PRIB 4F9PA 1OB0A 3LVTA 1NIAA 2Q7YB 4PBVC 1BXAA 1H5BB 3CFCH 2WIMA 3CC1A 3T2PA 2EDEA