4EO5A

Yeast asf1 bound to h3/h4g94p mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
164
structure length
161
Chain Sequence
b'SSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNGDLYPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone ASF1
molecule tags Structural protein/chaperone
source organism Saccharomyces cerevisiae
publication title The conformational flexibility of the C-terminus of histone H4 promotes histone octamer and nucleosome stability and yeast viability.
pubmed doi rcsb
total genus 29
structure length 161
sequence length 164
ec nomenclature
pdb deposition date 2012-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 4eo5A00
2DZEA 5EIIG 4ZBJA 5C3IA 5BNXD 1WG3A 2IIJA 4RRPM 5BO0D 2I32A 2YGVA 1ROCA 1TEYA 2IO5A 2HUEA 2IDCA 2Z3FA 2Z34A 4EO5A 2CU9A 3AADB
chains in the Genus database with same CATH superfamily
1AYOA 1JZDC 1R33A 1K3IA 3EFOA 1MCRA 3KLSA 4Y0GA 3RX5A 3WO4C 4WIQA 2NXZB 3AXLB 2OP4L 4G43A 1SVCP 4XBMA 3FB6B 4HZAA 5KANG 3LCYA 2RALA 4MYPA 4I7ZC 1CD8A 5DS8B 3P2BA 4HF5L 1DQMH 1AG6A 4JFXB 4X4ME 5C07E 4WFGE 2VQ1B 4OTXH 4Y2DC 2EE6A 2FBOJ 5FM8A 4A7VA 4PW4A 3ELAT 1BPVA 2YAOA 3ZLQC 5C07A 3V0EA 3WJJC 1XWVA 5LAPA 5HD8C 2CIIB 3MOAH 4FFYL 5KVDL 1H8LA 4E9WA 1CGYA 1S6NA 3QCUL 4XXCC 4DT2A 1I7UB 4FXTA 1LP9A 1ACCA 1A6TA 1LJMA 2CHXA 2WNKA 1FGNH 5FOBB 3QFDA 3PU7A 1OT1A 2GK0B 1AD0B 2YN3A 4N3UA 4YDZA 2CJUH 4GI6A 1FYTA 1Q1JL 3ARWA 1RZGB 3MJ7A 4MVBD 3M17A 3QQXA 4TV3A 5HJDA 1W16A 3GJEB 3PJLA 4YSPA 4MNHA 4J39A 3V7AE 2XFXA 1B90A 3QR0A 3RWEA 1HH6B 4OT1L 4QPEA 4N87A 1J11A 5ID1B 4AJWA 5F72S 5FYLE 3T77B 1NGPL 1N5AB 1F4XH 5F9WB 4U6HA 4GAJH 4V1DE 1RZ8B 1EX0A 4JO4H 4CAGA 1SXZA 2RTTA 4AJYV 5T3XL 2EZ0D 3SDDA 5H4ZA 1CB4A 1A6ZA 2X4TB 3E8UL 3QQDB 3FQ4A 3LEXA 4HEMA 3VJ6A 2I9LA 4YVNA 1FNGB 2D2CC 3L1EA 3LKNB 1J5OL 4MCYA 2A6JA 5C0EA 2WNWA 4BE5A 5E5UB 1GAFH 2EYRA 3VI4F 3V0AC 4JFFD 2IDSA 1CXLA 3VXTA 4A2DA 3DA0A 3L45A 4ICWA 4M1DL 3DBXB 5L2KD 1AY1L 4KXZH 2IOOA 1B9ZA 4IRJA 2ZCKL 3LXBA 1AZRA 2EIKB 2V9TA 3DPBA 5FO9B 2VABB 4U1GB 1H3TA 2OX5A 1F18A 4XP4H 1SEQH 2X87A 4H26B 1A3RL 2G75B 3GIVA 4JO4L 3TT3H 1EJFA 4F58L 4RGNE 3I2CL 2H1PL 3W0WD 1AO7A 1NUNB 3EAKA 2VOTA 3ILPB 4JHWH 5FW8A 4TQIA 3G3LA 3RJQB 3UBXI 15C8L 2N01B 3EDDA 2DYPB 3TA4D 4LCYB 3KMDA 1K5NA 5IM7A 3WAKA 5I1CH 1RIHH 4NZTH 5INDA 4RX4A 3UCQA 1JMZA 4H8HA 5GRVK 2XWZA 4MFHA 3QDGD 3ESPA 5DYOB 3T4YA 5GSVA 4WENB 3D39D 3OGOE 4GS7B 4UTCA 2E27H 2N59A 1S5HB 2ALWA 2UZIL 2BZCA 2D7OA 4JM0A 1DDHB 1MAJA 4M61A 1A64A 4JL1A 1CBJA 3QUYB 3EJSA 1BBJA 1EAPA 5EZPA 2FJUB 1HXMB 4DIXA 3HG0A 1NANI 5GZND 2EDRA 3CDGB 3RWJB 3V0VB 4XO9A 1KIUA 5E2UL 1EZLA 1AGDA 4XMVA 2CDGB 3GGWB 5I1IH 3UYPA 2DJSA 5IJDC 1JGVH 2PN5A 4LVNB 4LDOB 4NZTL 1G4MA 2WKLA 2XG4A 3TV8A 4Z7NF 3JWOH 4HLZG 3L4ZA 2F7QA 2EYSA 5EZOL 4MA8L 1Q38A 1XGPA 1MDAA 4TN9A 2D4FA 4XWOC 1IAIH 1NUDA 1N8ZA 3G7TA 2HJLA 4NQCD 2XBZA 3ARTA 5J7CC 2G2NA 4PV9A 3P54A 4AKQA 4ENEC 2WQRA 2D3JA 5KG9B 1MKFA 4K3DH 5JHLL 3MCLH 3AY4C 4JFEB 3VYPA 3ULVF 3FTXA 1ZY9A 2UXFA 5C0BB 1RZJH 5MEOA 4Z3FA 3HMWL 1EJ6A 2OV0A 4ILDA 3IDUA 1JGVL 5LLIC 5C0BD 1O7VA 5CINL 2IPTH 1J1PH 4YHNA 2ICWJ 2YXWA 3N41F 3P9MB 4HC1A 4YE0A 2VCOA 3IF1A 1NPUA 1PSKH 1XH0A 3MVSA 1A21A 3QCVL 4I3SL 3TN0D 2EDQA 1M57B 1U3HB 4R7NA 4X6FB 3QXAB 1CLYL 2EDFA 3ZR6A 1LNUA 5ACLA 2QSVA 2YAFA 1TMCB 5EWIL 1BVKB 1FNFA 3UERA 3GFUA 4H8WL 1ORSA 1UJ3B 3QQ9D 4N86A 4LCIH 4YO0A 2Q8AL 3UTTD 1F8TH 1XXDC 3ARDD 1QVOB 1HOEA 3BLKA 4NNYA 4QRTB 3WSQH 4HYTB 2EUXA 5SWQB 3BD4A 2XVBA 3MJ8B 3CAFA 3T1WA 2NSQA 2PO6A 2KPNA 4N85A 4UAOC 3TJEH 2VISA 4EVNB 4KX9A 1J88A 1L9NA 1RIVL 4QRPD 3KPMB 3NJJA 2WXJA 2J1YA 2Z31A 5EU5B 5EZLA 1TO5A 4F1ZA 1L0QA 2E7CA 1SQMA 2GAZB 3GRWH 3LB6C 4HULB 3MRBA 4JM2F 3ESOA 8FABB 4WTXA 4G9FB 1F4HA 4YDVA 5B7EA 1CL7I 1MHEB 3ATEA 4MQSB 4Q14A 3VB9A 3AAZA 1OP3K 3HMXL 4PLKD 5ERWA 5ADPH 3ZDXF 3WLWD 3L3OA 2EDNA 1JN6A 5TFSL 5LBSL 1IGTA 1M56B 1G7LB 3QWRD 1WBYB 4W81A 3F58L 2YOAA 1M7DA 1R5VA 1I7TB 2HJFB 1Q94A 1WP6A 3KYMA 1PDKA 3LDBC 4JN2B 1QLFA 3CXDH 5JDSB 3MN8A 5LBSA 2CCVA 3L7EB 1WA2X 3IEAA 4PRHA 2BP0B 2JKSA 4XVUD 4G8IB 2NQDA 5HPMB 5IQOA 2P8PA 2NR6A 4ZO9A 2GSGA 2DMCA 4YHKL 4FQXC 3VFNA 4F91B 4BSVB 3GJFB 1WFMA 1RZJC 4Z7UE 1WUNT 2ZYSA 4PJHA 3HR5A 1QLEL 2LU3A 3BJLA 3IXTB 4Y4HA 1CWVA 1RSFA 3D85B 4QRUA 4HHGA 3ZUCA 1G0XA 1DJGA 3R7QA 5TQ0L 3SYQA 2UVFA 3BE1L 1T66D 3KYNA 1PZCA 4BH7B 5TPWL 2F18A 4NCDA 2X05A 2BC4B 2DQFB 4P9ML 5DQ9B 5JHBA 3S6CA 3QA3B 4HXBH 3S35H 2YS4A 4HEPG 4S0HA 1S9VB 1QO3A 4N8VB 2J1KA 2V8LA 3A67H 4CBZA 4JJOA 4P4KA 5L4IA 1Y18B 5AYUL 5KVFL 4Q6IB 3G9AB 1BIHA 4LPUA 4Z76B 4TULH 4LIQL 5L4MA 5I15L 2GHWB 1QFWM 4F15B 1AYRA 3DIVA 1JZ4A 3T2NL 4R5TA 1OSZB 1FYHB 1MRCL 3WIHL 5GS1C 5ECJE 4PJHF 1HJBC 4OLXH 3J7HA 5CCKH 4XVJL 4RX4D 3NVQA 4WI9A 5CEXB 3SBQA 2X6VA 3SJVB 4F7KA 3QUGA 3WEOA 3NPSC 4KKLD 3I74A 1U3HD 1U8OB 2B1HL 1TQWA 4UMGA 2UY6B 4QGTA 3C6LB 1PY9A 1WWAX 5JOFA 4P9MH 3VRIB 1XH3B 5EO9A 4ABVA 5L88L 1XZ0A 3QUMH 1KZYA 5KZCD 2OLDA 4YDKH 4HSQA 2C1PB 2K1MA 4WFEE 1BX2B 3SE3C 1J8HA 2FD6H 4PYGA 1JXKA 3EOAA 4DGIL 1ET7A 1IC5L 3EJJX 6FABL 4EUPA 4ESKA 1OAYL 1JK8A 1AHKA 3L5WA 5K9KB 2X7LA 2E56A 4FKEA 3V4VB 2NUPA 4GKSB 2R83A 2DQIH 2XC8A 2VM9A 2PPFA 1IFRA 1U42A 4NC0B 4UB0L 4YSQA 1YEEL 1DHKA 4WSJA 3NJHA 4NP4L 3US0A 3VFWA 4X7TB 1PGRB 1M9WA 1KBKA 4QRPE 2YBRB 4YK4C 5EC1A 4J1UB 1XZWA 1VHPA 2DN7A 1R24B 5ICUA 5EU6E 2IBGA 5CD5C 2E6QA 1HC1A 3QUML 3REVA 2AITA 1A4AA 4XRCA 5FO7A 4ZOAA 2LR4A 5AAMA 4ZUTA 2F2HA 1ZT1A 1CXIA 2FD6L 2DKMA 2E6PA 2IOIA 1ZTXH 2CJ3A 5F1KC 1AANA 3LNIA 1RHHA 3EIFA 4N8CL 3FHEA 5EBWA 2XXGA 2YA0A 3QRGH 4AG4L 2CHZA 2AERT 2RB8A 5BRZE 4Q9RH 4N20A 1GCFA 3BZFA 2PF6A 1C08A 1IC4H 1J8KA 3MFGB 1NKGA 3A6CL 5KAQG 1KFGA 1F2QA 1AIFA 1XGYH 5KJ4A 1YYML 3GSQB 4M9PA 5IHZB 2FO8A 1JHTA 1TR7A 4KPHL 1BFOA 1JWSB 3LVEA 4LKCB 4O02H 1M7XA 2HA1A 3MKGA 4G8GB 5HHMB 5J9PA 2ZUYA 1R19A 1IVTA 1N4XL 2JQMA 3MAWA 3NCFB 3VXOA 3CFBA 1L6ZA 2UXGA 3MV8B 1ZLSH 1WC7B 4PJIE 1ZA6B 3GUTA 3T2QA 4XPTL 5I6KA 4FXKB 1PKQB 5DGQA 4MA3A 2B3RA 2ZT9C 5ESAB 3FQNB 2HUHA 4HQQH 5EU7E 4GFTB 4AMXA 2PYEB 5HGDB 5IHLB 5IT2L 1FI8C 1N3NA 4HD5A 3INUL 3MCG1 2FGZA 2NYZA 2X6BA 4N2OA 5CLTA 3I6LE 1GGBH 4PRDA 1M6UA 3VD2A 4K0OA 1LO5B 2OL3B 3ABZA 3DXAA 1ACYH 2FJGB 4MJ5A 1OARH 3C60C 3DOSA 3SJVE 5TDNA 1Q9LA 3II1A 3S36H 2DMBA 1A2YA 1MAMH 3HHRB 5DJYA 4JFQB 4NUQA 3APNA 1MEXH 2A99A 3BH9B 2FNWA 4YHPB 4EIZC 1AI1L 3E9TA 3PXJA 4X98A 4RAUA 4M1GL 1ZIBA 4OZGA 3RHWF 3GKWL 3RA7H 3WFHA 3WE6B 1PZDA 3EGSA 4KK6C 5JXAL 1IQWL 1GGBL 3VM5A 1BFTA 2DF3A 3APMA 3I02B 3TF7C 5IB4A 1S7TA 1ZSDA 3BP4B 2NYYC 2X38A 4JFUA 4GUOA 3C5JB 1T89A 4WUKL 4HDIB 3ZKMC 4A7SA 1SJEB 2CKNA 5T3ZH 1OARL 4ZO8A 1G6RA 1NGZA 4NM8H 5ESVB 5BZDA 3D0LB 1TZ8A 2IV9A 5HDBE 4PBDA 4MNGA 3S5YA 3AU1B 1NCGA 5DMIL 1NFIB 2W95A 1IBDA 1FFNA 3L3DB 2YPLD 1BHGA 2XACC 1KT2B 4AEFA 1U8QB 2IH3A 4YEFA 2HMID 1B4TA 4Z5RA 3AFLA 3WHXB 2J1ZA 1ZKAA 1ZJAA 3S35X 3CSYA 3TF4A 1JF6A 3NP4A 4I2XB 3SGEI 1D5BB 1H9VA 4X4ZA 1G1YA 1SDDB 1YEIH 1X3DA 3BAEH 3K91A 3R4DA 5I73C 3ZIYA 2NX5E 2Q8BH 3AGVA 1T1WA 1J10A 2DWDA 2PW2A 2WIMA 3BN3B 1X5XA 4XE0A 1JIBA 2DQCH 5DLMH 1QR1A 2QKIA 4MYWB 3COOA 2B7DT 3V52H 4FLOA 3BUYA 1AQDB 3KCPB 3RBSA 3O3AB 4Z78B 1E5YA 3BSZA 4OCYH 3CXHJ 5HHMD 5DVNA 1CR9H 4NWTH 5CJQL 3DSNA 2K70A 3OZ9L 1VESA 3PWVB 3ISRA 4M8VA 3EXJA 3ARVA 2YMXH 3BI9X 2A9NH 4PJEE 5ANMB 2VQUA 2WK2A 3EJYD 3PFUA 4MKMA 5IK3A 5HYEA 1A47A 4ONHB 5GRVL 4U3SB 3DUSB 2R1XB 1F6AB 2LTQB 3RZCA 1OO2A 2IVFC 4APXA 3HS9A 4ZOEA 2EEFA 2G9KA 3GEFA 3V0JA 4ENED 3UAJA 2EACA 2YFOA 1DBMH 4DKDC 4AYDC 3QDAA 3HRZC 4ZXBA 1Z5LA 3ABGA 4ELMB 4JAMA 3QJHB 2COVD 2WXFA 1E4HA 3GZPA 4QAMB 3RGHA 3U48A 2G2PA 4NUJA 5F7KC 3S9DB 3WO3B 1FZOA 5D7LB 3MLVH 1AXSA 2ORBL 3CPLA 3U9WA 5F88B 5AD0B 4HJTA 3EUUA 3THMH 4M48H 3PWLB 3EHBC 1XL6A 3VWKD 4U1SB 3TA3C 3HNTH 1OSEA 3C08L 1HKLL 3LHPH 4NQED 3SY0A 3TNNB 2Z93A 2DYRB 3IS0X 3VO0A 3VRJB 5MI0B 5BJTB 1HZLA 5GZNC 2EDKA 3MUHL 15C8H 4XP9L 2VL4A 1ZXQA 4HU2A 5D7IF 4HPOL 1TQTA 2JE8A 1U8NB 4A2FA 2DLGA 1WGOA 3MLSH 1RIHL 3FTZA 1EUTA 2IMMA 3DI2B 4PJIB 3EOTL 1KBBA 1P9MA 3IFLH 1GRWA 4N2CA 4WCYH 5KSAC 4C56A 3PWPB 1INEL 4ZODA 2YK1L 3QYCA 4LLUA 2FWSA 2OMYA 2VZ3A 1FVDA 5ECGA 3O4OC 4AWJC 5IMMA 2ZKYA 2Y3AA 5I8CA 4OZHB 4L0PB 1R3LA 4OR1A 4AGOA 1JZHA 4U4IA 1JVLA 1DSYA 2EQDA 3CC5B 2WLMA 3TXAA 2NY5L 3CFDB 3OKLB 5GGSY 3TX4A 2HVKB 1DZ0A 4XN7A 1HNFA 3MRNB 1L9MA 4HBQA 3ECUA 1P2CB 3VQ1C 2EC8A 2Z4QA 5D1ZB 4AMKL 2H26B 4E41B 4XX5A 5AW2B 3ZX1A 2CRYA 1N70A 2VM3A 3OR6B 3KWUA 1ET5A 3H7BA 3HUJF 5J6GA 2XETA 2YZ1A 3KH3A 4CRPA 2WKGA 4GIAA 4AYFB 4ACTA 1JGLL 3UACA 2P80A 4NYLA 3O41B 1E4KC 2QELA 3N9GL 3CH8A 4M93C 3OAWA 4YC2C 3C6EA 4JANB 3B5HA 2D31B 1HDMA 4MAUH 4WWKB 1UD3A 3SKNB 1JAEA 2QDWA 4MJIA 3EYUL 4S1SH 4BRJA 4BQ8A 1JK9B 2N7AA 3RFZB 2GSIB 5DRWA 3SKNA 3CN1A 2QHRH 4KKPA 2J8OA 5IKCB 2V3EA 3DX7A 2D31A 4Y1TA 4JANA 2DAVA 4ZPTB 3PP3K 1I4FB 3MJ6A 4HCRA 4JFEE 2V9RA 3MU3A 5FAAA 1IBFA 4FFZH 4XXDB 5HDQL 1XGTA 3SEPA 4KDVA 5KOVC 1AS6A 1BVNP 5IUSA 3FNKA 2DWEA 2CA4A 4U7KA 4X6BB 2Z4QB 1QRND 4E41A 5JDJA 1FYTE 5IB5B 1P2CA 2RACA 3MRNA 1KV7A 3QIWA 2Z91B 4NKIH 4UILH 3P0YH 4FQQA 3N55A 2Y24A 2XV6B 4NX0A 3OTTA 2Z92A 2BSEA 2VLKA 3CC5A 3RL2B 2WVSA 3V6FB 2NY2C 1U3YA 4GAYA 2YXFA 5E5LA 3SPHA 3L4CA 4H8PA 3IU3A 5CUSL 2YQ2A 4UT6L 5HDLA 4L1TA 2A74B 4O9HH 4QUOA 1RUKH 5BO0D 1WICA 1WQVT 4C56B 2P42B 4KJQC 1OOAA 2VERN 5KVFE 3BIBX 4G42A 1RV6X 3M6DA 1JV5A 1VCAA 2H3NA 3ZR5A 2EC9U 4GT0A 3V0DA 2OJEA 4L9DA 1H5BB 4UT7L 1MFEL 4ACPA 2VQ4A 4H13C 3GRWL 1A1OA 2HFFA 3DHJA 3O6ML 3BP6A 2ATKA 1MPAL 2L7QA 3P02A 5DFVD 4HGMA 3JWNH 3QJFA 4ADJA 4U1SA 3DX1A 3CG8A 3T2LA 4I89A 4JW3A 4FFYA 2JELL 4F57L 5F9DC 4UT6H 3F12B 1AXSB 2ZCLL 1JHLH 4KTEH 5D7LA 4CGUB 2X1XR 3MBWA 3DDFA 3NCJH 5C8JA 4Z7VA 1S7VB 2L7UA 3LKRB 1P84K 3FZUD 1YQ2A 3QJHA 4U1KB 3F58H 5DJ0B 2PETA 1Z5LB 4HIHA 3H4HA 1FCCA 4ZXBB 4GBXC 1G9NH 4FNLH 2OJZL 3BVUA 4RSYA 3RUGE 4FJYA 5TDPB 1O6VA 4F7EB 4MCMA 3BAIA 2F5BH 1NMAH 4YSEA 3RGVA 3WN6A 5MERB 3K2UH 1JV2A 1XX9C 5DEFB 4QRRA 2VLME 1BV8A 2RGSA 2R1XA 2X2YA 2XQYG 4HIJB 3WELA 1EGJH 1LK3L 3A22A 3EGXB 5I5IA 3EJUA 1L9TA 4XAKD 4DVBB 3S37L 4UQIM 2X4UB 5EEYA 3KGSA 1OAQH 4WFHD 4IRSA 1PEZA 3ILQC 1NCAL 3QXUA 1J8SA 1FN4A 2JELH 4H0GA 4XNAA 1J1XH 4BFRA 3U0TB 2ZCLH 4FQXA 5BZWB 4CU6A 4AVIA 1T0MB 5KYYA 3TM6A 4NQSB 3ULUE 5EIIG 1Q9WA 2NY3B 3BUYB 3NPZB 1T7YA 3AXIA 4P2AA 5TQ0H 2NPLX 4AYBA 4PVNA 5I23A 1DTUA 4URKA 2RD0A 3EO1B 4A63A 5MI0C 1OAUH 1LDSA 3SB3A 2NX5B 2EDJA 5JOPE 2EIEA 3RILA 3BVTA 3ECBA 1CDYA 5ISZE 4XO3A 2DBJA 2DWDB 2OW7A 3MV9D 4GOSA 4LHQB 4YE4H 2OMXA 4LRNH 3ML9A 3FQTA 1SDDA 1DVFD 4YVUA 3O11A 3NSJA 1H8OA 3WO4B 4BK8A 3FJTA 4I2XA 5CSGA 3WJLA 5CIPA 4XVTL 4LZKA 4K23L 5CGYD 3NZHH 2OSXA 3QI9C 3WHXA 4F2FA 4Z7NB 2FBJH 4MA7L 4YXHL 1WFUA 2PR4H 1URLA 4MNGB 1KY6A 4YNYB 1QQDA 4PJHE 5DCCA 3TZVD 3IBEA 4HMEA 4XB8A 4OCRL 1H3UA 1LO2L 3DX4A 3K74B 5K93A 1OAUL 1UXWB 1BLIA 4HDIA 1TZGL 4HJUA 3CDYA 4U7SA 3C5JA 1X5ZA 2OXHB 1FAIH 1UFUA 3U1QA 4NHUA 2A9ML 1ZSDB 1S7TB 4YOKA 4QLWA 1MFDH 3UL4A 5FFOA 3ZHKA 5B7FA 4GSUA 4TQEL 1ZHLA 3N85H 4FG4A 1EEYA 1BYPA 1SBSL 5GGQH 4OW6A 2ITCA 2JCCF 3FN0L 3TCLA 4X98B 1M53A 2MFNA 1EGJA 3KLDA 5D7LE 3FOLA 3QEHA 2ADYA 5KVDE 1U58B 2HKHL 1FPTL 2JQZA 3RFZC 1MN4A 1JI1A 2YKLL 4K5LA 4P2OA 2P28B 4JPVH 12E8L 3D1MC 3BDYL 2Y4SA 1NIBA 1Q9LB 3UMNA 1LO2H 3BVVA 4J3OF 3FQYA 4JL2A 4NS0A 4KU1A 3T3MF 4XGZB 5DFVC 5IJKA 3RNKB 3DXAB 1EEQA 4YUEL 3GUFA 3MUZ1 4HISA 4WDIB 4B9KC 5CF3A 3IAPA 1VKXB 3CFIC 4PRDB 1FORL 2AMGA 2WSPA 5D2LB 3VWJD 2MKLC 1DVSA 4HALA 4LEXL 4KROB 1G7PA 2I07B 1NBCA 1OV8A 4ZTOH 3ABKB 4POYA 2IH8A 2I7OA 4FMKA 4KXCA 5J11B 2ZP9A 3K3QA 1H0DB 1PKQA 2B8OT 2HKHH 1HNGA 1INDH 3Q48A 1DVXA 1QAWA 2C9RA 4FG6C 4J27A 4KO7A 1ODUA 1ZA6A 1GZQB 1BD2A 2PW1A 5GISL 4JQIL 4F8PA 1KCBA 4TM9A 4KROC 1L0YA 1NMBH 1C16B 3B7RL 3TZVC 3UJTH 3VFPB 1KIRA 4KZDL 2VXUL 2LVCA 3MUGA 4TVPE 4WHTB 5E56A 4DZBA 2FR4B 1Z9OA 2OR7A 1RURL 2R69H 1BFOB 1JWSA 5E9DA 1VADA 4NPJA 3QRBA 2EXWD 3MNDA 4Y89A 2QQNH 4B9YA 2AV7A 2HPOA 1REIA 4JM4L 3DJSA 3PHSA 4L3EA 4AQ8A 2O30A 5J8OA 3APDA 1CZ8H 1C08B 4MQXD 5IR1B 3STZB 2WWMD 1E6OL 4YH6A 4X7SL 3EYVB 5D96B 2Z6FA 3EHBB 3IETB 5EBWB 3MRRB 3V6BR 4BGLA 4AL8L 5EULV 1FV1B 1HYRC 1E4KA 3FQWB 2GSMB 4NZUH 4XNZB 2YN5A 5C0RH 2DMHA 2XTSA 4V2BA 3DGCR 4H7VA 3A5VA 3GMOA 3QIBA 3QQ9C 4RFOL 4XPGL 5D7JC 1P7QD 3BD3A 1BPLB 1Y6NR 2VXUH 3RUGA 1YQVH 3ZKSD 1MREH 3DO7B 1G9MC 3CMOH 4ZZFA 1E5AA 1CL7L 2Y5QA 3W57A 5FYKH 2NNRA 5DTFB 2VWEE 2H7WA 5CILH 2ZUUA 4ODTL 4JM4H 4OKVA 4YL4A 4EBQL 3VFWB 4EI0A 1LE9B 1X4XA 4JFDE 5IVNA 5A16B 1S7UA 4EDXA 1DO6A 1NUGA 2NY2B 1XEDA 3US1A 3IDMB 2JKIS 2O6CA 3OVUB 3Q13A 5EEVA 3V4VA 1ZLEA 3C60B 4AL8H 3VXPB 2KPWA 4LOUC 3N1MC 4AJVA 3K80A 3GI8L 2M8XA 5E2TL 3MQIA 3RVXD 3AGWA 5E08L 2VXVH 5JYLA 1IMHC 5BV7L 2IADB 1XH3A 2R1WB 1P4IH 3BLPX 2UY6A 5CILL 4FTVB 3GHEL 3N43B 3QULB 4Q0XL 3VSTA 4YHYC 3SDDC 2R0WH 5D7IE 1U8OA 5AW3B 4I48A 3IAQA 3TN0A 4HWZA 4OIIL 1YNKL 2MQ0A 4GI9A 1DBAH 3OG4B 3N06B 2KL6A 4TVPH 5EN2A 5SWSB 5D7KE 2V8MA 5IBUB 1CIUA 1FFQA 1Z3GL 3NAAH 5L4JA 5E8EB 4U6YB 4ZTPL 2G60L 3DRTB 5IESL 4IIZA 3KBPA 4HUXB 2NY1B 3CCHA 3QPXL 4MX7A 1Y18A 1ZD6A 4XNUL 5I82A 5E08H 4WK0B 3UYRL 1XD0A 3PDGA 4H2CA 3MI6A 4E0RA 4UUJA 2GI7A 5JQIB 1JNLH 3L3KB 3TURA 3EJCA 2BC4A 2DQFA 4M3JA 3GSNH 4B5ZA 1Z9LA 5A2FA 1DBKL 4Q0XH 1Z9SB 1UXSB 2WLIA 4AMWA 3SDXB 1RD6A 1AS7A 3SGJC 3L4YA 3D2UB 4X6EA 3WN5C 2WSKA 3U7WH 3HI6H 1UHVA 4ZUWA 2V2TA 2GK2A 5I1DB 3SO3B 3HR5B 3K4ZA 4TVPL 2PMZA 1HEZB 2LLGA 2ADFH 2GTZB 1I9JH 4LLVA 4CVXA 4UTAH 2JCCB 1M7IB 2WVVA 2ZYRA 4OSUH 5C0ND 5LCVH 4OCXH 2A9NL 3E3QC 5F3BA 4N90D 4N2FA 1JZ8A 3NSYA 3GD1C 2Q86A 3FQRB 1LQBC 1EHXA 5HPMA 3V7MA 5FV1L 4I9WE 1F45A 1MNNA 4PRHB 2BY2A 5B1JA 5DC2A 5TK2A 4FYTA 1H5BC 1TVHB 3O3DB 1PJ9A 2WZPD 3QUXA 3NGBC 4Z18A 7FABH 3P1VA 5IB1B 2HJFA 4G7YH 5DHVH 1WBYA 3P3RA 1DP0A 2HT2C 1G7LA 4QOKA 4EI6B 3TPUB 5INCB 1JNNL 4KZEL 1TT6A 2FHBA 2MPAH 2NTFB 3U9UB 3QFJA 2JMRA 2IXQA 3THML 4WW2A 4H1LB 3D05A 1L9OA 2H3KA 3AAZB 2NNCA 4QHUB 3T0XA 1GMIA 3HRZB 2EEXA 3KLKA 3NABH 4YHOL 4LAQL 1TTGA 2HH0H 4U1MA 2IDCA 1KTLA 4ZSOB 5FFGA 1HILB 2OK0H 5E7FA 1J9TA 1QLEB 3KM1A 5D4QA 2BOCA 4XR8C 2PO6D 3N0AA 1MY7A 4FZ8L 2W9LA 3FAWA 4LVEA 2WWNA 3FN9A 1WD9A 3MJ9H 1WHPA 3DTUB 4FL4C 3S37X 1F4WH 2PO6B 3ZUNC 4R96B 4V33A 5FGSA 3CN0A 4FFZA 4J4PC 4AV5A 4G9DB 1AACA 2H0FA 4IRJD 1RJYB 4WCYL 2J6EH 3QDMB 3W39A 4JZNA 3BH8A 1Z7JA 3H7LA 2FX8H 4YO0B 1A14H 1UJ3A 1ORSB 3WS3A 4OY9A 2GG1A 2O93L 1BVKA 3FTGA 1G94A 1R3HA 1L5GA 4PB9H 2G3NA 2FYVA 3NCCB 3QXTA 1S7QB 3FOMB 3TN0C 4FL4B 4X5QA 4KI5E 3ZE0F 5HHPB 5CHNB 1XCTB 4AC2A 4CSSA 1CVSC 3CIAA 3C8HA 5GGRY 2AQTA 4FQCL 3T9WA 3ZMRA 5ISZA 5DVLA 3VFVB 2WXQA 2AGJH 4FG2A 1YMMA 3B8YA 1NQBA 1QSED 5HXMA 3I9AA 3JSSA 4X4KA 2LE9A 2H1XA 1TETH 1ADQA 1D7BA 1UENA 3CZUB 3MRKA 1ZOXA 1GA2A 4TSBH 4JREB 3DTDA 4JJ5A 2VLRE 5KG9A 2F7PA 1DEEA 3DPDA 3OMIB 3OPZH 1HSBA 3SDXF 3SZ6A 4PJCF 1P7BA 5IEKB 3IMSA 3WN5A 3SCMA 2R2HB 4MMZB 1YY8A 4X0NA 5F7MC 2A4CA 4P06A 3LIUA 2WLJA 3TS8A 3GZOA 3IYLW 2XG4B 2Y23A 4FFZL 4JKWA 3VFTB 3CHRA 3VI3A 4DFHA 1BF5A 3QNXB 2PCPA 2Z65C 5IMKB 4N2DA 4EQ3A 4KUCD 4KZCA 2LU5A 1XR8B 4PHZA 3X17A 4BEIA 4JE0A 5I1EH 2FECL 3MNZA 5FYJH 2ARWA 2OCCB 2BPBA 2CDGA 3DKHA 3EBIA 4PB0L 5D6CA 5C09A 1M6OB 1P1ZA 1LYQA 5L9DH 1KIUB 1M05A 5IQLA 1SJMA 3V0VA 3R0MA 1DJIA 5C7XL 4KK9C 4LCWD 5F9AC 1HXMA 4MB1A 4OBRA 3JYBA 5DWUL 2J2ZA 3EYSL 4ZO6A 3VSVA 5JORB 3ZKXC 2KBGA 1BBJB 3PS6A 3V79C 3QUYA 3OB0H 4M61B 2V7HA 3OPZL 3RRQA 4ZMLA 3ASOB 3V4LA 3LKQA 4HIEB 4F1SA 1CGTA 4F8LA 3KYKH 3SPVB 2GKIA 2AQNA 1GS8A 4LL1A 4P9HC 5E5MA 4M02A 4YPGA 3ZL1A 3ZJAA 1J5HA 5KBPA 2ZNWA 1KPUA 2Q3AA 5IY5B 1OE2A 1N7MH 2C3XA 1MI5B 2ZKHH 2NY1C 4HUUA 3HFML 1TEGA 2CRIA 3I50H 5CGYC 5HHOA 5CP3A 5BMFL 1MI5D 2BVOB 2FB4L 2VMFA 1DQVA 2ZXGA 4QYOB 5K1VA 4KRLB 3TEXA 3WBDA 4M6NH 5ELIA 5I28A 4GFXA 5J12B 3V9CA 3H55A 1E9QB 5MEQB 3ZKMD 3VTTA 1M9SA 2DI8A 4QRBA 1AS8A 3GIVB 1AQKL 4Y16D 3AUVA 2EH7L 1MW3A 3PV7A 4F57H 3DPBB 1JHLL 2BNUB 5KTEH 4I0PD 4W9DC 4G8FA 4IRJB 1EERB 1EDQA 4NN7C 3NJFA 4JBSA 2VR4A 1JGUL 1E8WA 3MV7D 5D5MA 3WEAA 1PEWA 1ZA3B 5I17A 5I6LA 3O6FB 2GBAA 1FJ1B 2BXYA 3EOBA 4ODHH 4KKBC 3IRZA 3UTSB 4A55A 2ZX9A 2ADIB 4NN6C 4F7MB 5C0EB 5IJKC 1WZ1L 2A6JB 3OKOA 4MCYB 4EDWL 2WLYA 2X2UA 2W59A 1L9RA 2FQEA 3H9SE 4XCCH 5DRZA 5IJVB 1TCMA 1XAKA 2FVNA 3EYQD 4ZFFA 1G9NC 4YQXL 3WTXA 1OP3H 3VJ6B 4JY6B 1LK3H 1JGIA 4HX1B 1EVUA 1A6ZB 2X4TA 4P2OC 4TNWK 2VLMD 2Q2EB 4IMKA 4CVZB 5I19H 3QI9D 1T83C 2DQEL 1BW8A 2FWUA 4MQTB 1RZ8A 2R7EA 2ILLA 4NJAH 5GZOC 1XBDA 2Z3FA 3PXHA 4U6HB 5DFTA 2H32H 1NLDL 1TKWB 3KYOB 1NEUA 4Y4KB 5ID1A 1G7QA 1MJ8L 2FE0A 3KGUA 3L7FA 4LHUA 4OQTL 4RGND 2ZUTA 3RWEB 4QHNA 3V6OC 5I1JL 1BAFL 2WLLA 3IJHA 3ZE1F 4XHJC 2ATPB 1QWUA 3GMRA 1RZGA 5FYLH 4UTBA 2X5PA 4KKRA 4G6JL 4NSKA 3C87A 8CGTA 3QFDB 3MRCB 1CD1A 2YEQA 5K5YA 3WUWA 3AVEA 4DP9X 4IEFB 3VWJB 2A74C 2QGCA 4YE4L 2QPFA 2DD8L 3QDME 1NPNA 4Y8AA 4DP6X 1EXUA 1UT2A 1DO5A 1BREA 2XVGA 4I3GA 4Z7QF 2FUQA 2DJ4A 3WDHA 4ES9A 1MDTA 2UZXA 1KTKE 3FRPA 4OGYL 3J2PA 4N25A 3FFCA 5C6TL 3NZHL 4N5ED 1L0XA 3U7YL 2P44B 4D9LL 1CIDA 2WAHA 1P0SE 3QNZA 1UYWH 4KI5F 3ZE0E 3ZSSA 3L95A 1O5DT 4U31A 5DS8A 2G4EA 4EUPG 1AAJA 2PR4L 1NC4B 5DRNA 3VYNA 4UQAA 2ZD0A 4MMYB 2QVKA 1XSJA 4UQDA 5FYLL 2QR0A 3MA7B 1WF5A 4MAYC 4OD2B 2W94A 3SDYL 5IGXH 1FF5A 4HG4K 2G0LA 1KIQB 3VXSA 3C9NA 2OSLA 1I8IA 1MFUA 2XXCB 4MA1C 1CT8A 4XMKH 3ML8A 4PEEA 1G1KA 4W9JC 5BUGA 2E86A 3ARFA 3N85L 4N0UA 4OFVA 4XH2A 5DZOA 5KSAB 1PX3A 2OMUB 4X0KB 2UV3A 4ODVL 1JRHL 2VLRA 1MFAL 1T1YB 3DHMA 3RPIA 3NJVA 3OXSB 4BH8A 2W0FB 1A0QL 5T1LA 2V5TA 4L9LB 3K2KA 1T2XA 3TYGH 1E5ZA 1SEBB 2APTA 4HBCL 2CLZA 1NGYB 3BWSA 3BDYH 2ROXA 1BJMA 3IU4H 5T1LB 3CX2A 1AR1D 2DIAA 4BH8B 3OXSA 1L7TL 4HIIA 1CPUA 1T1YA 2YAEA 1KIPA 4X9YA 3EYFB 1QSEE 5FCSH 3U82B 4EN3B 4ZUUB 3UTZA 3BZ4A 4CW1A 1MCQA 3NJIA 3ARFB 4N0UB 4YSRA 3AITA 1JWMA 4XAWL 2F54B 4BD4A 2CDEB 3EJRA 1OHQA 4QLRA 5DHMC 5LBVA 1N18A 1SMDA 1UADC 3EBGA 2XPGB 3DMMD 3UTSE 4BWUA 4AXWA 4YFLI 4CSTA 4QCIA 1RKRA 2E76C 4AIZB 3KPOA 4M7KH 5CMAA 1TF4A 2QR0B 3MA7A 4Q9CA 2FT7A 3LRMA 1GR7A 3WIIL 4MMYA 4G70B 4OCSL 2GIYA 5GISH 5DRNB 1NC2A 2A1WH 4JRWA 4LPVA 4ELKA 2H6PA 1JPFB 4K8RH 5IW1A 1ZWIB 4NI6A 4UNUA 3GDCA 5ABZA 4OZFB 4PVBA 4POUB 5F7UA 3MLWL 3MJ9A 1IU1A 3HG1A 4PJ7B 3JTSB 1MCWW 4PJ9B 4HIPA 1OPGL 1YHPA 3D34A 1K4DB 4E9XA 2B0SH 4JFVA 4PJ9D 1LK2B 1N68A 1PNDA 2N0MA 3MPCA 5ACZA 2IAMD 1MNUH 4ZFQA 1NZRA 1D7FA 3KPPA 2ZOWA 4IEFA 4MTMA 3WUWB 5E24E 4Y2DB 25C8H 3O6KL 3IFNL 4GIPD 4NSKB 3W0WE 4HK3N 2XWEA 2DQTH 2ZWLT 5I16B 3CVCA 3HC4H 1MJJA 3MV9E 4AUYA 4KRPD 2WLLB 3FFDA 4QHNB 2B59B 4LHUB 1G7QB 1HAUA 1DQLL 1OM9A 2PUQT 1P84J 1TKWA 3KYOA 1OSPL 3TWYA 4YFDB 2NY4C 4B9GA 2XX1A 2XV0A 3D6GA 3WXWL 4NM4L 4FA7B 4OFKA 3V4VH 2CGZA 4TYUA 1Z6JT 3QJZA 1UD8A 3WIFB 1S7SA 4LLMA 1WISA 1YNLL 4LESA 3LV3B 2X2IA 1KB9J 4AYSA 2BJML 4XO4A 5DRZB 3KWXA 2APFA 1HT6A 3OJMB 4NQDD 2SODB 4KJPD 1OP4A 1A6PA 1JOIA 3FT9A 5TK4A 5BVPL 2WMPB 1I1AC 3ARBC 1VENA 1SNRA 1FJ1A 4NQXB 4K2UL 1ZA3A 5I17B 5E6RB 5HY9B 1RLWA 5DSCA 3W0WA 1EPFA 1E5CA 1T1ZA 4PLOB 3V0FA 4ZFOA 5GS2H 4NRXA 5H2BA 2NY5C 4GW4B 3Q8BA 4GQPH 4Y9CA 1BLNA 5GJTL 4ZOBA 5K39A 4EUPH 1ADWA 1RI8A 1UZ6E 5AALA 2C8NA 4LEOB 3GJFK 2FLMA 4OFQA 4ZW3A 4F37F 3UP1A 2F6AA 1GZPB 3CIQA 3PNWB 3QC5X 2OS7A 3RB7A 4DN4H 1X9QA 2H6UA 3L3IA 4IW4C 1YG9A 3NRQA 3JYCA 1AZVA 1EMTL 4R2GC 3A4FA 4B6ZA 3KNBB 3LOWA 5E8PB 2BVOA 4QYOA 3BISA 3TWCH 1H6FA 5FGCB 2P24A 4L1LA 4N5UA 4OFYD 3T0VA 3FTWA 4HUUB 2HTKC 3QFJD 4NN7B 1GGCL 2NY6B 4ALAH 2NY3D 5CJOL 4NUGL 5CJXA 1BM3L 4AH2A 4WK4B 4YPGB 3SPVA 1T21B 1FO0L 5JR1H 1BSIA 3LKQB 4C59B 3NEEA 1F3DJ 2Y36L 1CLZH 3Q5TA 3RVUD 5JORA 4L0ZA 3GPSA 2N1KA 5F89B 1UZ6F 2CCWA 4GH7B 3DO4A 32C2A 5AWNH 3DYOA 1BZ9A 3NJLA 1M05B 2WIIB 1E27B 2YLHA 5EMYA 5C09B 1RJLA 1NA8A 1TU2B 3G6AA 3HNSH 3MNZB 4FHBD 1KJ3H 2ZPKH 4BFKA 1HI6A 3CFCH 1XR8A 2CXKA 5KBMA 4K55A 5DHEA 5IMKA 1IGCH 2PCPB 4ANUA 1JI2A 2EDMA 1E7UA 3L1OL 3QNXA 1U8JA 3VI3B 3S3DB 3RWDA 4OFPA 1CLVA 1KLFA 1MH5A 1AGCA 2YO3A 1TZIB 3QJSB 1YY8B 1A1MB 5I1HH 3GS7A 4L8BA 5E4AA 1NAMH 2R4RH 3MV8D 4KXAA 3WN5B 4ANKA 5CEZD 3UAJC 3QO0A 4I18A 1F90L 2K6WA 3HLAB 4WWID 3H3PL 4QYAA 7FABL 1EAOA 5E1GA 3ZDWA 5L0QB 3ULVC 1I9IL 5J12C 3TFKC 4FNSA 5BS0E 4L5FH 1M1XB 5KYNA 3QCTH 4YSOA 4N0CD 5CN3A 2ZP0T 3OGCB 1A7NH 1QFUL 1INQB 2DOCA 1HXYB 4ISVB 2D03H 1VA9A 4YBLC 5DJZB 4YSUA 1YMMB 4FI7A 3VFVA 4B9PA 2KQNA 4K7PX 2CR0A 2BVQA 3ARUA 3CXFA 3QE5A 4MBRA 5B38B 3OKKA 1X7SA 4NI3A 3O4LD 1HOCB 5MENE 4K94C 3KM2A 1XCTA 1ZLWK 4I1PA 4Z77A 1IILE 4Y8DC 2H8PA 3X12B 2OK0L 3AWFA 3I6GA 4DW2L 1OF0A 1OGTB 1R3HB 3LNGA 1D5XA 5G5DA 2IFFL 1J18A 1WT5C 1B0GA 2C1OA 3H6AA 3MXWH 3WS3B 5GZNA 1CLOH 4M8QA 3OPUA 3ZTCC 1O9ZA 3MC0A 4ZDHA 2J4WH 2PP7A 4JZNB 2CO7B 3QDMA 3W39B 1RJYA 5DS2A 1EXGA 3TO4B 1AKJD 4LSVL 2XG5A 3M07A 4LDLB 4R96A 5DHYB 3UPCA 2AAAA 4MNQB 2OM5A 1BCIA 5IW6A 2ZSWB 1EWHA 4WFGD 2YC1B 2BOCB 2G2RA 3D39A 1BXUA 5E1QA 2QQQA 1P1VA 1HILA 2I25N 2O6DA 4QRQB 1KTLB 3AADB 1JWUB 4H20L 4Y1AB 4OZGE 4NIKB 2NY0D 3X3FL 4XOEA 2QJDA 3I6KA 3HRZA 4PP1D 4QHUA 2ZP8A 2J8UB 3MRLB 4IMLA 4H1LA 4Q7DA 1CS6A 3RJOA 4PGCA 1EXHA 1FFRA 3UMTA 1G7MB 1EFXD 4BQBA 3EYOA 1ZANH 3U9UA 5I1LA 5I5MA 5DMJB 2XLLA 2EH8H 2R29A 1AO7D 3KDMB 5INCA 3OAZH 3TPUA 1RK1B 4AT6A 2X9WA 1EDHA 3BUBA 1CGSL 1VIWA 5MHSE 3NSXA 4IMKC 3PJSA 4DUWA 2P8MB 4MWFA 4UYQA 5JW4R 3MRDB 3ULUC 3U2IA 3EBAA 3QUXB 1VFBA 1TVHA 3O3DA 4NQUA 1SBBA 2NOYA 1ZGLP 2F08A 1BVNT 1I8LC 1NFDA 3KJ6H 4WNSA 2C3HA 2FX7L 3CFEB 4BV1A 2MKWA 1GTFA 3KYAA 4X8JB 3FQRA 5LN4A 3OKDB 1U41A 2XN0A 5E94B 3W11C 2X2HA 2P43B 5F3BB 1S9KC 3CHQA 5T1KA 4DCQB 4HGWA 4EIUA 1M7IA 4K3HA 3K2MC 4CVXB 2C9SA 5KVDH 3IDNA 1WT5A 2MOQA 2ZXBA 4J3OH 3QIUB 1RK0B 4X2UA 2V2TB 3SBRA 5HPOA 1ITCA 1Z5HA 1Y6KR 2CJUL 4M7JL 5TE7H 3V0HA 3Q1SL 4A7TA 1CG9A 1YCSA 2E9IA 5D7EA 4NNPH 3NCEB 4M3KB 1BXAA 2OI9B 3L3KA 2J5LB 4XOCA 3T0EE 4E0RB 3S88L 3KJ6L 4D9QD 3F6LA 1NGPH 4MX7B 1WYJA 3LNEA 4HXAL 1KDJA 2VR9A 1HX0A 1YEHH 3ZZLA 1GHFH 1HL4A 5FM5O 5CO1A 2QZQA 5E8EA 5BRZA 4XMZA 1TTAA 3DV6B 4KGLA 3LHAA 4RVBA 1EV2E 3HFMH 5E03A 3QXWA 5IJCC 4O51A 2BLFA 1ZT4B 3W2DL 2QPUA 1ZLUH 3WS6C 2F19L 1UM6H 4D0DA 2GYSA 2H0PA 3ELQA 4AQEA 1U30A 3KVPA 4FTVA 3H3KA 2NUTA 2Y2YA 3QT2A 4JO2H 4LB8A 2R1WA 4J2QA 1SGKA 3IJSB 4YLBA 4HIXH 2XZCH 2NXZD 5AZEL 4I0CC 4KH2A 4RQQA 3BCFA 4PH8A 1TVDA 2GTWA 3U25A 1O9VA 2CO1A 4L05A 2XVKA 3V55A 1IKOP 3ZHNA 2G5UA 1MHCB 4JPQA 2H1PH 3DYMA 3NZUA 1FL6B 4MNQD 5AOZA 4WWNA 5DD5H 3C60A 5EC2A 4WWPA 4AE0A 1QYGH 4F8TA 4DWHA 5J56B 5HI3C 2LQRA 4JPKL 4ZMAT 1MIEL 3IDMA 4RLDA 1JF1B 4DQAA 1Y1DA 3NCMA 1LE9A 3UTPE 1OZTG 4H8UA 3O9WD 4Y19E 3B2UC 4RETB 4OKVB 2ZJSL 4HJ1A 2AVFA 3DV6A 4UANA 2C9QA 2HRPL 2MPVA 5BRZB 2VDKB 3WKQA 2YD7A 5DTFA 1P9MC 4JO2L 3KG5A 4KHXH 5T1DH 5ICZB 2YSSA 4H40A 1KJ2L 1DLFL 4G82A 4DOHE 2VDRL 2CMRL 2PABA 2CBQA 4K71C 5E8DH 3RUGB 1NFAA 1IBGH 3GXTA 3L4UA 1V7ML 4ANVA 1X5AA 3POCA 4X6CB 4ZNCD 3GMOB 3QIBB 4MZIA 5I0VA 5MENB 1RPQA 3IDJA 3Q6GL 5E6IA 3UO8B 4JJHA 2JF1A 4DKAA 1OTTD 2PWDA 3JTTA 3T0EB 5MEND 1E4XI 3IETA 4FLSA 1R46A 3ZYZA 2WOYA 5JOPD 1I3GH 1RK0A 5IR1A 3QYMA 1SOKA 5AG8A 1LE5B 4DTGH 1TDQA 2YQ3A 4DKFH 1KLUA 3IE4A 1SLUA 1YC8A 2HRPH 4OLWL 4DGWC 4HGWB 2DTMH 2ZUQC 2B3IA 2RQ8A 1IIIA 4AYEC 1VADB 2PPCA 4F2MB 4OGYH 1I1AA 3ARBA 3LXUX 5AVZB 1OTSC 4ZFZB 1CLCA 1RZQA 2FR4A 2APVA 2VSKB 4X8JA 4CJ1A 2A0LC 2ENQA 2NY7L 4A6YA 4ZZKA 1C16A 1GC1H 2ERJB 4K3EL 2MWCA 1VFBB 1ROCA 5FYJD 1DVTA 2PW1B 4U7MA 2I24N 3OG6B 2P8MA 4MWFB 2P5ED 3IM1A 1XEUA 1BMZA 2MMXA 1H0DA 4GRLA 3UBFA 3WMQA 4BQ9A 3BAJA 3FU7A 3IMUA 4NQVB 4YXKL 3AXHA 4R83A 2KLSA 4KK6D 5HI3D 1DFBH 2I07A 3EYOB 3WFEL 5L7XL 3ILQD 2D0HA 4KMTH 5D1XE 3HC3L 1HH9A 3T6ZA 4H5SA 3I6KB 2P48B 1EFXA 1A7QL 1VKXA 3O6FC 3DIFB 2ITFA 1CBVH 4J6RL 4DESA 3QUXC 4QRQA 3TPKA 5DZLA 2G2RB 3FS9A 5JMOC 2YC1A 5EU6B 4OGXL 2ZSWA 5T1MB 4MNQA 2R4SL 3QPKA 3HG2A 3WSQL 2XG5B 5DHYA 3IN0A 1FRGL 3OAUH 5HDOA 3HHSB 5C0CD 3BKCH 1U58A 2DL9A 3FOLB 4EXKA 1RUPL 4A2HA 4YXKH 3C8KB 2ODIA 3KEHA 2ITCB 4P23B 1DFBL 3TOPA 3RWGB 4TTGA 2NCMA 1ET8A 4ZD3H 3X12A 2H8PB 4HCFA 2VLKE 4L48A 3UC0H 2DEYX 4Z77B 2R0ZH 3BDXA 1PF3A 4FNPA 4NHUB 2OXHA 2NMSA 3OKKB 2QTEA 4TSAL 3NDZE 4B95C 4M5SA 5EU4A 4KI1A 5BPPA 1E42A 2Y7SA 4M7KL 2XTJD 4FMVA 4D9QE 4OGXH 2YAPA 4YZWA 3WKYA 5TFSH 4MJ6B 2WZAA 4ISVA 4JCLA 4YNYA 3U4KA 5LDUA 3GSXA 2DKUA 1UA6H 2MCPH 5EZIL 3D3VE 5F1OB 2ZCZA 4P4KC 2UX6A 4K8RL 1M1XA 4JR9L 4OJYA 4TL5A 4GSXA 4AQAB 4M56A 4F5CE 3C5ZD 4DF9A 4Y19B 2X09A 2DQUH 3LXAA 4GSQA 4I9XA 3QO0B 2XZAL 2AF2A 2BS9A 2YXVA 4H88L 1A25A 3C5ZB 2ICCA 4P99A 4GNKB 4EO5A 1KXVA 1P4BH 5ABDE 1TZIA 4YHKH 3G9VA 5IVZB 1OK8A 1U8JB 1Z0NA 4ZMQA 3ECBB 4UQCA 2I85A 4G1EA 1W6LA 3LN5B 4ZW8A 5LKNA 4ZX3A 1VACA 2YGOA 3WJLC 4XCNB 1NAKL 3G6AB 1TU2A 3N04A 4JGJA 3TYFB 1L9SA 1E27A 2BHZA 1T0MA 2FX9L 3B7TA 4PSRA 4WHDA 1AZZC 3F84A 4XBPB 3BPCA 3ETBF 3HS0B 4BZ2H 2ICES 5F93C 5E9DE 4L0YA 2Z7YA 2WJ7A 1QMUA 2X4UA 3HG5A 5CZVH 4MAYA 1OWWA 5DC4B 4FLHA 4KH9A 5SWZD 3EGXA 4M6ML 3TIDA 1T21A 4HIJA 1XGUB 3E0GA 2YWZA 1V3KA 5A43C 2FLRT 3VFMA 1YNTA 3ULVD 4U3XA 2IH1A 4PGJA 5BUPA 4XVJH 1F4YH 3BSGA 1UWXH 4N0CC 3UADA 2EDEA 3BEVA 5E8PA 5DJ0A 3KNBA 3QIBC 3X1GA 2BZ7A 4Q52A 4U1KA 3EF7A 4C8XA 2DYPD 3LZRA 4Z7VB 4K5OA 4NCC2 5E6SB 1WFOA 5C07D 1RHFA 3B2PA 4RMQA 2WAQA 4MAZA 4R4NC 2DMGA 2GJJA 4YDJA 3MA9L 3F12A 4OF3A 5GJTH 3IT8D 4JRYD 4C4KO 4EN2A 5ALBH 1EEZB 2FH6A 5J11C 2BZDA 3QJFB 1BLNB 2WUBL 5C9KA 4YBQC 1A4BA 4JHZA 2EUWA 3BP6B 3NZSA 4NRXB 3DETC 5H2BB 2OAAA 1T1ZB 2R2CA 3S3BB 1RUAL 3KBEA 5HY9A 4WY7L 4EQ2A 3MRPA 4LASH 3UXFA 4NQXA 5EIQA 4MNGE 4DERA 1P4LB 2DIBA 5BV7C 3LMJH 3OKMA 3D4ZA 5HGAB 4M7LT 5D7SH 3HVDA 3ZT7A 1KENL 2NRDA 1F13A 1O6SB 1XB8A 2VN7A 2D7PA 1PFOA 3WIFA 2L0DA 1ZV9A 4IBUA 1QPPA 3PE9A 1KWKA 1SFHA 4WGVB 4HS8L 1JPEA 3AT9A 3VFSB 4TOYH 5D5ME 4WI3A 3UAJD 5GXBB 2H47C 2OMVB 3V6FA 5LBGA 3MBXH 4DP7X 2VLKB 2Z92B 4PQXA 5D55A 1IGIH 1NM9A 5AWNL 2B20A 5TE6H 4PJ5D 3TEZA 3I75B 3MYZA 4NO5A 4LSRL 4LOUD 5BQDA 5FK9B 2J3SA 3F65A 4KI5D 3ZHLA 1U8CB 3CFCL 2OSWA 4MS8D 3DWTA 4H1LG 1HHHB 1SUJA 3FPXA 2D9CA 3JWNC 5B22A 3UG4A 3OF6D 1IM9B 4A66A 3RP1A 1U6AL 2AK4D 3KBFA 5ACZB 3NJGA 5FFLA 1TQCB 2Y5TA 1YYMH 2GPZA 5DRWB 1WAAE 3RFZA 4HS8H 3GC3A 3QZBA 2MCAA 2VN5A 3GLAA 1UB6B 3JTSA 3HG1B 4ZW7A 4PJFF 4GXFA 1HDMB 1A3ZA 4OZFA 4Q56A 1BQKA 2BP8B 4PJGE 5K9QI 1JPFA 1G9HA 1P5UB 3GK8H 1Q1PA 4GG6A 1NC2B 4L3EE 5F96H 1KCRL 2QPEB 1W72H 4FHKA 4LKXA 5C2BH 3GQFA 3MXVH 5J6GB 5CMAB 4ETYA 2Q7AA 4KHTL 4XN5A 3KPOB 4AIZA 3IDXL 4S1RH 1ZEAH 5BZZA 4O58L 4PMFA 4UZSA 2E7DA 2HVKA 4XMLL 5C92A 3OKLA 3PPSA 4MKTA 3FO2B 2F54A 1KPRA 2QGDA 4AYGA 1RZKC 2IBZX 2R56L 5IMOA 2CLRB 3UTZB 5I8CB 1LILA 3SO3C 3I9PA 3AUWB 3JZ7A 4QRRE 4LVNC 3MXWL 1WCBA 4HIIB 1J0JA 3O6LL 4XXCA 4DGVH 4LLUB 3L5XH 1BA9A 3P3SA 3TO2A 2CPCA 2F1AA 3FUDA 4RMUA 4X8XA 1JYVA 1E43A 3PWPA 3ZT6A 1S2EA 1FZMB 3GSNA 2Q0ZX 4WFHE 43CAA 4JNXA 2HG5B 4JM2B 1KCRH 3RWCB 2ED6A 2HUEA 1W72L 4JVUA 5C2BL 2DEXX 2LFEA 1U8NA 5J3HC 5IROD 3FU0A 4OZGF 2H4EA 2KYIA 1USQA 1QX1A 4IRJC 3ZE2B 4YBQD 1TXKA 4O58H 3RPIB 4LOVA 2R29H 1URIA 2OMUA 4R5VA 4X0KA 4A7UA 5KSAA 2W0LA 3TBYA 4IDJH 3GKWH 1IGJB 3RA7L 3N44B 3G08B 3QBTB 5CN2A 4N6QA 5KSBF 3PWLA 4P9HL 4N24A 4G6ML 2A9AA 5F88A 1CT8B 2WYIA 2AEOA 1V3MA 2OL3L 2R69A 3QUMA 1ZT7A 3DK2A 5T3ZL 1OXYA 1OVZA 3ECQA 4RGMB 4JAMB 4OD2A 4BFJA 2VDMB 1Q1JH 1TPXB 1UWEH 4IJTA 3P77A 1NC4A 5DMIH 3NCWA 3L95B 4FFVD 1Q0XL 3QNZB 2MTAA 2FEEL 3M1OA 3ARDC 4IU3A 3HAEG 4BIKA 1OB1B 2MIZA 3WNMA 2IAMC 4OLEA 4U1IB 3FFCB 3DUSA 5FB8A 4U3SA 4QTFA 2UZXB 3FRPB 1FFPB 5ANMA 4KKZA 3KPQA 4HD9A 4J4PA 2GEQA 1YYLL 1MVFA 1OT2A 2TAAA 5CU5A 5HP5A 2Y7OA 3VWJA 1V5JA 1QI3A 4DPAX 3IMBA 4W6YB 4Z7QB 1CD1B 3MRCA 1QASA 5I66A 3O8XB 3BUTA 3G5XB 1BBDH 1FA4A 1MCSA 3E80A 3QAZC 4QXVA 1BECA 1H19A 2IWEA 1U8LA 1HL5A 1UATA 5EOCJ 3UJIL 3WNJA 2V33A 5DUPL 2ZCHL 2HX8A 4DN3L 4LP8A 4Y4KA 2YD3A 2PW2B 1CGUA 3RIAF 1F42A 5IOPB 4H0LC 2R7EB 1NC2D 2VDQL 2CO6B 4C55A 2BIIA 5K9QG 4XO8A 3O81A 3OR7A 3SDAD 4QO1A 3NPSB 4WLCA 3F85A 3OJDB 3CSYB 2QV4A 4JY6A 1OGPA 1A3QA 2DS4A 4Z5RB 2IQ9H 3GTTA 3OB8A 4YWGL 3CZLA 1OW0C 2FWOB 4M62L 1FFNB 3L3DA 2J8UF 1LMKA 4RGOL 5DJ6B 3W2DH 1JG9A 5GGTA 5E70A 3ALPA 3TCXA 3UTSA 1EHKB 3O6FA 1UGKA 2TSBA 3D0LA 3L3GB 5ESVA 3O3UN 4BQCA 3PAYA 2D4DA 1A65A 5CLWA 4PWFA 2ZCHH 5L8JB 2FYYB 5LGJB 3UPRB 2BNUA 1XR9A 4X5WA 4FLRA 2ORBH 3MLTA 3BP4A 4TPRL 4V1DB 1TITA 3KPSE 3Q2LA 4BBWA 4IK7A 4GRLC 3EGSB 3WE6A 2JKTM 2KZBA 4PS4H 4GKNA 3K1DA 1P6AB 5IVOA 3KLAA 5C86A 3WLWC 4YGVB 2AJXL 2DQHL 3GT6A 3ZDZE 4ZQKB 4XNXL 3BKJH 4FJZA 4JPKH 2CE6A 3BH9A 1IJNA 4HT1L 1N6UA 2QQKH 1OOWA 5DJYB 4QJ5B 2ALAA 1BM7A 2OMWB 2VR6A 1NEZA 1A2YB 2OCJA 3BRDA 2OPCA 1MI5A 1O75A 2XICA 3KAAA 1KPUB 4NT6A 2QPSA 1EO8L 5T1DL 5E5MB 2YK1H 2I69A 4FQ1H 4RZCA 4X80L 2ZCKH 1NCBL 4HIEA 1P6WA 3EYQC 3VXUB 3WS6A 5HYSB 2OTWA 4TKWA 4WI8A 3UGEA 4PJ6A 4FQIH 2BSBA 2V7HB 4P2OD 2XIDA 2L04A 3ALWA 3DGDA 2NY5H 3RWIB 3T8XA 1H8SA 4ES8A 3PJNA 3VXUE 4UDTB 3FQNA 4XX1E 5ESAA 5D6CB 1DQDH 4PREA 2EABA 4JFSA 2FECI 1NDGB 2VO8A 4C83B 1IKFH 1B6DA 3T0BA 4QRRD 2NW3A 3GUTB 2WZ6A 1I1RA 5EN3A 3VX0A 3AROA 1WC7A 1GY1A 3QUKA 4ZBJA 1PU0A 1FGVH 3MV8A 3V0IA 1EO8H 3VFTA 4NKDB 3VXOB 4AQ1C 1FG2B 4AYMC 3AB0C 3WFZA 9CGTA 4G8GA 1BQLH 4LKCA 1VAHA 4MB4A 1HSBB 2IGFL 1DJYA 5IHZA 4NGHH 4X7CC 3L9RB 1AIFB 4AITA 3CE1A 4ZUSB 5DD1L 2XYBA 2O4EA 3LXCA 1UOLA 4NQCE 2JCWA 1VEOA 4LE8A 3MRKB 3QUHA 4XHQA 4JPIB 2WKOF 5DS1A 1G0DA 2BVYA 3STBA 2AJSL 1QWHA 3SE8H 5B4MC 3BKYH 3BDBA 3WLBA 4UWQB 3WFEH 5L7XH 5ISZB 2AJ3A 5IBUG 4WKZA 4ZI8A 1AHWB 3D5OF 1I31A 1ZT1B 3VQMA 4XN1A 4OAWB 5FO7B 2ZAHA 3QJTB 5HHPA 5K9JL 1CBVL 1EAJA 1BQLL 1S7QA 1JPTH 3FOMA 1R24A 3BEWA 4KDTC 5G4NA 3FTGB 4P04A 5TGBB 1X5FA 1YDPB 1L7IH 3T09A 4EZMA 1LEGA 2IEPA 2YBRA 4Y1AD 2R4SH 3ZTNL 3QORD 4JRLA 2YUWA 1AVAA 1DSFH 5AAMC 2A4EA 4G9DA 4OD1L 4OD3H 3WEXB 1T66C 2BSSB 1RZJL 5T5NF 1UACL 2V7NB 1RUPH 4MD5A 3IDGA 2CUIA 2NUPB 2VUYA 4U0QB 5M95B 3EJTA 1KEMH 2DWTA 1AQHA 1JK8B 1Q72L 1DBBH 4E41D 2F8VA 3H9ZA 2NSXA 4HJJL 3QZWG 1PSKL 4ZSOA 1UEMA 3X1NA 3UTQA 2XVLA 4U1MB 3QJRB 1E4XH 2AXHA 2R0ZL 2OQJB 3L6FA 5L2KA 3E1ZA 3VE0B 5G55A 1DANU 2V3FA 3D69B 2CRMA 1XZ0B 4N2GA 2A9BA 3K0YA 3U79A 5AFAA 2ZXWB 2E8YA 1KCVL 3SYCA 5JOFB 5DJ8B 1IB5A 4JO1H 4HZ1A 4UDUA 5DU7A 1EUUA 5EO1A 4BHUI 4CDHA 5KW9L 2W07B 3RVWD 3U4BH 4C54A 1DSWA 3Q01A 1F41A 1U3HC 5CEXA 5E00A 2AK4A 2AQ3A 5IB1A 2EP6A 5IQMA 3PWUA 4UMSA 5L8LB 2PWHA 4Z7IA 1SN2A 3S35L 2C4XA 1OSZA 2CHWA 3IJ9A 1IZKA 2WZPA 1CTMA 2PCXA 3BSHA 1I1FA 1QKZL 1W0VB 4R6UA 3PV6B 5DXWA 2ZOKA 5C0CE 3C5SA 4LIQH 2YJQA 2ZWKA 2EO1A 4XNYL 2WVVB 5SWZE 3D0AA 4RISH 3X3GL 5JW4M 3VGAB 4LLVB 2RFXB 2F5AH 1IFHH 3D06A 4Y4KD 4WSKA 4BZ2A 1LO0L 3VWJC 4I18C 1NEZG 3ATAA 4ZMXA 2A4ZA 2B15A 1LEKB 2CDFB 2WCSA 4P2YA 5IG7B 2JI3A 4M29A 3NIFF 5BOPA 1N26A 3GM8A 2NTSP 3SDXA 1ETB1 2WLIB 2AQQA 1UXSA 4HWUA 1Z9SA 4QRUB 3VMNA 1CFVH 2CDFA 3D85A 4HWBH 1LEKA 3UP6A 5IG7A 5CBAA 1WFTA 1VGEH 1V7NL 1YEKL 5HDRA 3GJFA 3QRLA 4BSVA 1A6VL 5L0QC 2YARA 3VFNB 3BC9A 4OUUB 1HKFA 5CGTA 3UAFA 3MACL 1CYXA 3C5SB 1OGSA 2ZXAA 1QKZH 3AMLA 2GSGB 3CCHB 4ZFOL 3A24A 3BUPA 1CE1L 1W0VA 2YGVA 3LPGA 2JJTA 2DM7A 4CVUA 4FI6A 4L29A 2AS5M 1SHWA 3E6HB 4Y4HC 4ZS6C 2QLVB 4PJEF 5JDSA 5CXPA 3PWUB 4MA7H 5SWSA 5EN2B 3O0LA 2DQIL 3EH3B 4YXHH 2AK4B 4P8QA 4XWGL 5E00B 1R5VB 1M7DB 1MCEA 3BPNB 1AXTL 5F9WC 4HWZB 3TN0B 2EJ1A 4AK2A 2W07A 1IGTB 1UJTA 1D9KC 1XCQA 1YUHA 3RVWC 2VKXA 1GIGH 3ZE1B 5DJ8A 2E7MA 3MGOA 2XXMB 2DICA 1RY7B 4IDLA 4HA1A 2BIOA 4BZ1L 3D69A 2E9JA 2YGQA 3VE0A 2XBTA 4P48A 3WFBH 3MACH 5I71B 3PGCA 1FNSH 3H9YA 1DN0B 3VGGA 2GAZA 3UTQB 5EU5A 1ZTXE 5EZLB 3BP5B 3L9BA 3PP4L 4OU3A 4TNVK 4F20A 1RK7A 3T2NH 3QR2A 4U4BA 4FYQA 4K9EL 4N8CH 4QNPE 2HAZA 2VISB 3IDGB 3KXFD 4G6KH 2BSSA 5D7SL 3MCYA 4EDXB 4D94A 4GMSL 1NUFA 5CZXD 5IREA 1FLRH 2YKLH 1FLTX 3KXFB 4Q6IC 1SOSA 1EAQA 2ZNXA 1F4AA 3OWEA 1X5MA 2BP3A 1OGAD 4JX0A 4ZFGL 3OMNB 5TGBA 1AOZA 5CD5D 4S1QL 3BEWB 4TOYL 3DO7A 2I5YL 3VXSD 1IAIM 1N0XH 1TO4A 1QD0A 4OAWA 1EK3A 4Z0BH 2PLTA 1IGIL 4M5ZH 2WBXA 2AJ3B 2A5UA 4YHNB 2J88H 2HSIA 3WLBB 4P46A 5I1AB 4JK0D 1ZVYA 1TTCA 3B34A 3EYVA 5TQ2H 3H42H 4PWHA 3ZGIA 1C9SA 4UB0H 2LAAA 5BRPA 4NP4H 4N8UA 4TVUA 4ZUSA 4GXVL 3L9RA 4PLJD 2HJLB 1FNAA 3AG3B 2FWLB 5DA4A 5E9DB 5AW4B 1JBJA 4S1QH 3Q2NA 3IMWA 5AZ2H 4QHPA 5DJCA 1D2OA 1OPOA 1UVQB 3BYYA 3MUGB 4DZBB 2NY6C 2EYSB 1FG2A 1L3WA 2BOLA 4RWYL 2WNXA 3AY4A 4KVNL 4NKDA 4BA0A 4M5ZL 2XTJC 3K46A 2VO5A 3QUKB 1BD2B 1D2PA 1GZQA 3AS3A 2MOVA 3SE3A 2EXSA 3BIAX 1CZ8L 4JEGB 1DUYA 3LQMA 1NGWA 3BESR 5GRUH 4ATWA 2KLTA 2AKRA 1EA9C 1MEXL 4MS6A 2Q7YA 4JUTA 3EH2A 2WO4A 5AW8B 1RZ7H 1G7PB 1DVQA 2YFNA 3NYKA 3RWIA 3T0EC 3T8XB 4ZMVA 3HZ3A 2HX7A 3BFWA 4PCKA 3Q05A 1SY6L 5JXAH 1DQJB 2IG2L 3KPRE 4U2YA 1B88A 4E5XG 1D5MA 3DVNA 4WDIA 4KPHH 1CDUA 3RNKA 1S5HA 2BDNL 1KCKA 4XGZA 2AABH 4OI9A 4P46C 4CU8A 1MCJA 5A2BA 1R9FA 5DYOA 4KVNH 2AQPA 4NT6B 4KFZC 4KAQL 5INDB 5B3SB 4DQOL 1K5NB 3SJVD 2VZ1A 4LCYA 3HE7A 1V27A 1S3KH 4QWWC 3D2TA 3QEHB 2X1PA 3U1SL 3CFTA 3B9VA 2BO0A 3VQLA 1PBYA 2A83B 3ILPA 4WVRA 2YR3A 2ZKXA 1EEYB 6PAZA 1ZHLB 4H26A 1TTFA 1AKPA 3NZ8B 3GXFA 1JCKA 2OX5B 4CSZA 2VMEA 4HEME 4G6MH 1DANT 3IGFA 2QMKA 4GI8A 1U3NA 2D73A 1JDCA 5I8KH 2FYYA 3BUIA 5IFAH 3UPRA 4FA6A 3VGHA 1UXWA 2V5SA 4ZOCA 1CDJA 5CGBA 3DBXA 4DGYH 3UDWC 3BOVA 4TRPL 3L3GA 3LS4H 3ARFC 5CCGE 1WWBX 1UWEL 3Q9PA 3Q8CA 4G8GE 4OZHF 4V1DD 3BVWA 4Z7OE 2E7LA 2YQBA 2EECA 5LB1A 5IBLD 2J5WA 5KVGE 4E9RA 3JV0A 2V17H 5DT1H 4UT9L 4UOW0 4E9LA 2ADJB 5K59E 3SDDB 2NXZC 5EOQH 5HYFA 1JL8A 3O11B 2P45B 3FQTB 2GC4C 3IS1X 4YGAB 5CWSB 1N5AA 5IVXF 3T77A 2VR8A 1HH6A 4WUKH 5E2JA 4LNRB 4ELMF 2NX5A 1T3FA 1U8LB 4LSTL 4IRSC 3EO1A 4GO9A 3GJEA 3X2QB 4XP5L 2DWYA 3CQPA 4RFNB 1FYTB 3MJ7B 3EG9A 2UWEF 4OJAA 3Q06A 3O8XA 3WNNA 1KXVC 2EEAA 4BCYA 3EJYC 3VGAC 5BZWA 4FQXB 1GY2A 3MLVL 3ZVVA 1QFWL 4K07A 5GPRA 3U0TA 2ADFL 4J3XA 5DT1L 3TTSA 4UTAL 5FUCE 2CIIA 5AW0B 3KPQB 3T71A 5C07B 1HE7A 3G6JE 4J4PD 2B9AA 2EE2A 1RULL 4U1IA 3QC6X 3V6OA 3GBDA 4QRRB 5DEFA 2OR8A 3ARQA 3VXRE 5MERA 1OKEA 4IU3B 3BZEB 4JFXA 1AGBA 3IWVA 3RGVB 2I60H 3P77B 4F7EA 4G43B 4HJEA 3EOTH 1QZ1A 1Z2KA 4HIHB 2EUZA 1NKRA 2CBOA 4JGNA 3TBVB 1KEGH 2ICWA 1HZKA 1D3CA 2ZG1A 3MYJB 4X6CF 5GRXG 1ZT7B 4RAHA 3NIDB 4IBSA 2GT9A 3CBRA 2WKOA 5IQNA 4D8PB 5D7LD 2H3XC 2RR3A 4QHMA 4WUUE 1GMEA 3BYTA 3G08A 2V2WB 4PWJA 1IGJA 2K8QA 3DVIA 4F58H 1UUSA 3I2CH 3GHBH 2HFFB 2N7SA 2L7JA 3NCBB 1MWOA 4WUUA 4PJCE 4PS8A 5FDWA 1H5BA 2XOTA 4N2EA 1T6WA 5T3XE 5EIVA 2ENJA 5GHWL 4RWHA 3HR6A 1A6WH 1JV5B 3D50A 4QXTA 3RWCA 1YJDH 4CMHB 2HG5A 3Q43A 1X44A 3GSNB 1FZMA 4DK6A 2M83A 5AL0A 1FWXA 5GS2D 4G6FD 1QNZL 3TO2B 3VXME 2CKBH 1U2YA 2E27L 3QK0A 3TONA 2ED7A 2A74A 2QKSA 4O2FB 1CK0H 5EOTB 2JI2A 5IMOB 3IU3B 3OC5A 4UT9A 4WI0B 1YLBB 4HC1H 1KPRB 4PVLA 1KMGA 1RSYA 3FO2A 4GY4A 2WQSA 4FC3E 3K2IA 1TLMA 4MCNA 3RL2A 3ZHFA 4CKQA 2Z91A 4YXLH 3QIWB 3NEOA 3QHZH 1RQ5A 1AFVH 3IJYA 1T89C 4UNTA 2R0LH 4X6BA 1G87A 3B3BA 3N42F 1OEZW 2DWEB 2XU9A 1OHZA 2WBJD 1ZE3C 4JN1L 4LKXB 1SJVA 5GZOA 4UINL 3V0WL 3MLSL 1D6VH 4XXDA 4QTHB 5I0ZA 1P5UA 4GG6B 2KKQA 5E0FA 5DK2B 2BP8A 4ZPTA 3DX7B 4WV1A 3RX8A 1A02N 1OCOB 5IKCA 4P3CL 2GSIA 8PAZA 4ZYKB 1JK9A 1UB6A 5CUSH 4FABL 4PBVC 1DJHA 4MJIB 1XSIA 4O9HL 3QORC 2AANA 4WWKA 1HSAB 2Y5TB 3BN9C 3SQBB 5CKGA 4L4TE 4Z7UA 4HWEH 4QTIH 1IM9A 3QZMA 4A2EA 3O41A 5HTSA 4NYLB 3HS0C 3OLEA 3QHZL 1HHHA 2EDTA 3IPFA 3SCMC 4AYFA 1XF3B 5A7BA 4LVOC 2R0LL 3H7BB 4HLJA 1U8CA 3OR6A 1ZHKB 1PLGL 2H26A 3GLEA 4XMPH 5C0AA 4NO5B 1KCLA 5IFJA 4QF1A 2O61B 3ESUF 3JWDL 4RDQF 2Y7MA 3F7LA 1ECZA 1MY5A 1CLYH 2HFEB 3VFSA 4TS6A 3V5KB 3JWOC 3P3YA 3HN8A 1PX4A 5EWIH 2GBVA 2APXA 5FWRA 5HYIA 2E47A 3CLWA 4TQPA 2XXFA 1KCSL 1TENA 1QW9A 2OMYB 2Z8RA 2D0GA 4XPBH 5E51A 1WS7A 5HHNB 3VXRD 1XD1A 3I85A 1CDCA 1NM4A 1DSFL 4R4BA 4ZS7H 5DVMA 3SDXE 5C9JA 1RMFL 5GRJH 2OJZH 2K7QA 2B14A 5IBLC 3EO9H 4MDIB 4WSGA 2VWEC 2Z8SA 1KEML 3S8WA 1WCQA 2A6DB 3FC8A 4AJ0A 5E95B 3MRPB 3FBQA 4F7CA 3Q0HA 3UOAB 5DFAA 1W2KT 4ERSL 2Z93B 1E4XL 5B3NA 1Y07A 1TPXC 5E1AA 3ULUH 1V54B 4Z3EA 1CF8H 1A66A 4XHJD 1GPOH 3TT1H 5FKPB 5LJYH 2X2JA 1HTYA 4H4NA 3WNIA 3CPLB 2HCZX 3FFCD 1SVZA 2GJZA 4PJDA 1OL0A 4HFWB 3FB7A 3QJQB 2DJUA 4K7PY 4GQ9L 2IH9A 3HZKB 2W0KA 4PJCB 3IN2A 5CEYA 4CUCA 4NHCH 4HKJB 3P11H 4GW1B 4WJKB 2IH1B 5JIPA 1G5GA 1DVZA 3QEQB 3VI4A 1YNTB 4WEUD 5HYQB 3V7AG 3ARYA 2V5YA 3O9WB 4APXB 3MFFA 1XGUA 2BNQA 1F6AA 3RZCB 2VDLH 3VACA 1LE5A 4JM2C 4ONHA 4UF7C 2P49B 3VD5A 4N9GB 1CCZA 4MAYB 3SQRA 2WHVA 3NG5A 4XVTH 2QKIC 3D9AH 1XFPA 3OC8A 2BP5M 1IFHL 5IROC 2YUXA 4G5ZH 5CLYA 1DQKA 2HJKA 2XWJB 1VFUA 5EZJB 4DK3A 5I1JH 3O3AA 4Z78A 1GXEA 1TCRA 4WAFA 1AQDA 3KCPA 4OCMC 43C9A 5GJSH 1RZFL 1G4RA 3DHPA 3TYFA 4OBSA 4L1DA 2AI0H 4D3CL 1VACB 2OZNA 3FRUA 2P3YA 3HG3A 3LN5A 1U91B 1MWAH 1V7NH 1VERA 1YEKH 4G1EB 2F5BL 4N2AA 4FAAB 3WFCL 3D25B 4PP2B 3O45B 2KC0A 1A6UH 2FATH 4OB5L 5IVZA 3UH8A 4BZ1A 3CLFL 3GRWA 4L9LC 5FIEA 2KZKA 3MV7A 1QR4A 3AG4B 2PWEA 4I1NB 1D5BA 4J8RB 3FT1A 2CLVB 1Q0YL 3SHSA 1Z32X 4EZJA 2WSDA 2IH3B 4KXBA 5CCKL 1U8QA 1I75A 4PGBA 2WXIA 5L8KB 3C5ZC 1JZ3A 1NFIA 4FZEH 4I3RH 2X88A 4GAFB 3GSXB 4GRWH 2AJUL 1CVRA 1THCA 1S7XA 1P69B 1UGNA 4FQ2H 5T1JA 3MLRH 5BZDB 1G6RB 1NGZB 1SJEA 2KH2B 2NYYD 1YJDC 2Z4TA 3OJVC 3P0GB 2ENYA 2BW4A 1WPCA 3ZKND 3F01A 2ESVD 1WZLA 4NLAA 4U0RB 5IB4B 1CDHA 2ARJQ 4DO4A 1NIFA 1SM3H 4K9JA 1CUOA 3PP4H 4MMXC 4UV7H 3L4VA 4OZGB 5FLVA 5HGGS 5EUOA 1QBML 4YDLB 1Y7VA 2CK2A 4ZTOL 1AQ8A 1XTMA 3KE0A 5B39G 1CFQA 5HYSG 5DQDH 5B1JC 2AEQL 2BH0A 4JFWA 2F0CA 1H15B 3V4UL 1BGXL 1QEXA 2IAAC 2N0KA 4ICXA 2AQSA 4Y9EA 5E2VH 2C34A 2MNWA 4JQIH 4Q4IA 4FQ2L 5T1MA 2VZSA 3PWJB 4WU7B 4QT5A 5L2JB 4KNTA 2JXMA 5EU6A 3DOSB 4M6OH 3T4AC 5GGVH 1IAMA 4G8AC 4XC3H 2FJGA 1SF3A 1LO5A 2OL3A 2R69L 4E2OA 4DUXA 3DIFA 2A9MH 3IJEB 4Z8FL 2E7LC 1F02I 4PJIF 5AEAA 3QG7L 5TJWK 1FFOB 2UUDK 3PF2A 4UV7L 1N3NB 1YEDA 5BUAA 1Y0LA 4KDWA 4KBPA 2PYEA 5HGDA 2F8IA 1FHGA 1I8AA 5F9OL 4JO8A 4KROD 1YA5A 3FU7B 4NQVA 5TQ2L 1E3FA 1G7IA 1OLLA 1Z3RA 5DVOA 1GOGA 2O5NA 3FPYA 1I3VA 3N40F 4XMUA 2HT4D 2VXQA 1MJ7L 4NZUL 4R84A 3NJMA 2XUWA 1NMCC 3KPLB 5A2AA 4F15C 3TJHC 3DV4A 4L8CB 3WMSA 1QSVA 2NXYB 3W82A 4N9OB 4X6DE 3MV9A 2EE0A 3FH5A 1JFHA 4O02L 5CLZA 5J9PB 1OD9A 5PAZA 4YUEH 4KKNA 1I1AB 3ARBB 1JHTB 1QFWI 3HAEB 3RVUC 1ZV2A 1KGXA 1RVFH 3GSQA 1WIPA 3P0VH 5BVJB 3ATBA 4ODTH 1KLUB 1MNUL 4TLKA 1TOXA 2JJSA 4M6AA 3BZFB 4O2EB 1U8HB 3QHFH 4JKPL 5GRUL 4BFIB 3FT4A 1KB9K 3KS0J 3HLKA 2EILB 5DF0A 4Y5YB 1TQBB 4L8SC 1INDL 2NLJB 4JZOB 5I1GL 1CC3A 3T8VA 3HC4L 3JTTB 3LPFA 2BXZA 3QW9A 3IDJB 4GMTL 4R26H 5MENA 3GMPA 2IG2H 4X6CA 4XRCB 2B4CL 3NFPB 3REVB 1MCFA 1WEJH 5T1LD 1N64L 3HOGA 3IMTA 4FFTA 2DQJL 3OLGA 3WNPA 5IQ9B 4Z7WA 2YSSB 3AJ7A 2VJXA 1JHKH 3KPRB 5EC1B 1BFVL 1ECYA 3A21A 4AGMA 4BGDA 3EDJA 1AE6H 4Q2ZA 1D7DA 4YHMH 3GSUB 4I77L 5B7MA 1DBAL 3T1FA 3V8CA 3L8QA 4IBQA 3NK4A 4LRIC 2P5PA 5BVPH 4F93B 4OZIB 2FO1A 1OCZB 3HPLB 4M4PA 1CICB 3LZOA 5GSRA 2NY2D 1IUZA 3L5WB 1FL6A 1EJOH 4JM2D 4EUPB 1MHCA 2VGLM 3AQZA 3VGEA 4AUUA 3EOAB 3C60D 5C0RL 1XXFC 3CJJA 5AW7B 1J8HB 3JT0A 3CV5A 2C1PA 4AE1A 4XPFH 4U1LA 4RQQB 1L6PA 3WDIA 3SE4A 2E7HA 5EO9B 4YR6A 4AQOA 5GS1A 1J9SA 3IJSA 2Y1YA 4XPHL 1UXLA 3C6LA 1U92A 2NUTB 2VW6A 3VD0A 5M7QA 4AQ8C 2VLJB 2B1AL 2F68X 1CGWA 4D0DB 1ZHNA 1NWPA 2X28A 3HE7D 4FTVD 3SJVA 1IC0A 4N0UE 2LLNA 4KOCA 4O51B 4X83A 5D1ZI 2BERA 5CZKA 1NGXB 2XKNB 3UZEC 3PXLA 5LCVL 4NUGH 1HS6A 4OCXL 4JZJC 5DA0B 4Z76A 4Q6IA 5E2TH 3IKCA 3UTTE 3S4SB 1QO3B 4PJBA 2WXMA 2IANA 3E8UH 2JLLA 1UWXK 1KXHA 2DQCL 4GQZA 4XNQA 5DLML 1FAKT 1DR9A 2UZYB 5DVKA 3KHQA 4I88A 2Y25A 4KKQA 5E9AA 4BH7A 3QDJD 3RVXC 1XCWA 2ICWI 3SGDI 2NR6C 4PJDE 2WB7A 2Q9OA 5GS0D 1UD2A 3IXTA 3QIUA 1R0AH 3H2QA 3MNWB 4X6DB 3IB4A 3T65B 1CTNA 3F05A 1L6XA 3OKYA 4N68A 2EVGA 1NL0H 1XIWD 4BCZA 1QHQA 1I7RB 3CBJB 3LH2H 1HIML 5CN1A 4G8IA 3PDOB 3CFEA 4KITB 2CGYA 1NFDB 4MDJA 3W11D 4N0RA 4FZ8H 1PZ3A 3IVKB 3B2VH 1QLFB 1RERA 3MBEB 1PDKB 4HCIA 2HKFL 1Q94B 3KYMB 4L1SA 1N19A 2PNDA 2QVIA 2J6EL 1A7NL 1QFUH 4K8RD 1ADQH 2JSFA 4AT6B 3ES6A 3U30C 3KDMA 3X11A 4QXWA 4BK4A 3HW7A 2Z31C 5I1LB 3L3OB 3WJMA 2JB6B 4PJXE 1T0NA 3PQYA 5ERWB 3RGVC 4HPHA 4AZ8A 4P2QA 4PGCB 1AG0A 2WP3T 3REWB 4IMLB 3WG7B 3M8OL 4OZ4A 1MFBH 3H56A 4G9FA 1DE4B 4JQVC 4Y1AA 2NY6D 3MRBB 4HCRL 4P5SA 4GIOA 5L6YL 4HH9B 3NFNB 1PFCA 2NYKA 4PIBA 3B1UA 1Z1WA 2Z31B 5HDBF 4JG1H 1KN2L 1KTRL 3CFUA 4FRWA 5GHWH 3ZOAA 4EVNA 1GYWA 3JWNE 1FBIH 2X6UA 5E2UH 4N1EA 1OP5H 4IKNA 5I75C 4QRPA 3MJGX 5C08B 3TO4A 4CKVX 3MJ8A 4G7YL 5A6LA 5I1IL 1J8HD 2IQAB 4P5RA 4O5LH 2F15A 4NNYB 2KI6A 1QVOA 3FU9A 3UJJH 3CFJA 4M8QB 4G7SB 1NCIA 3LKPA 2C1OB 3RGBA 1D5XB 2VTFA 4JFZL 3H9SB 3I6GB 2ZSVA 5BRQA 1BF8A 1LNUB 1CU4H 4X6FA 1KYAA 1ZLUK 1OE3A 1U3HA 4R7NB 2OXGB 4G59C 3ZKQD 5KVGH 3ZZQA 3MROB 1IAIL 1FC1A 2GVYA 1HOCA 1FNLA 2MEJB 3DI3B 1OM3L 2GQHA 4WNQB 3VXUD 4CSPA 3P9MA 2C5DC 4BDVA 3D0VB 4JG1L 2F53D 3EJZC 5DJZA 5FYJL 3T4AB 5B38G 3TVMA 5FYKE 1CDBA 2IAMB 1IAOB 3ZTJH 1W80A 3LZPA 5IV2A 3EKCA 1INQA 4XMXA 5C0BA 4ODUB 4Y2DD 5FDYA 5F6IC 5FC9A 2WD0A 1CE6B 2Y07H 4GEJA 2BFGA 3PHQA 3QIWC 5DWPA 3UJJL 3B56A 4U1HA 4HWNA 3JV4B 1N8ZB 2L3BA 2BWIA 2EIJB 4I18B 4NUPA 4NJ9L 1FH2A 1XGPB 3VXMA 1BZEA 1OTTC 2QHRL 4UBDC 3RVVD 5I5RA 1AGCB 3X1BA 1BWMA 2VZUA 3PYCA 4GO8A 1IV8A 4N22A 1B4JH 3QEQD 1AD9B 3NEXA 2O5YL 1RZKH 3TH3T 4ZW6A 2WPGA 3TIEA 1HI6B 1IQDB 2AGJL 1XF5B 2MRYA 3HNVL 4S11A 2FQFA 4BHUA 3GGWA 1BYNA 1AR2A 1BZ9B 4YHIA 4QD2E 32C2B 1RIVH 1KYOJ 1IGYA 4NNPL 5F89A 2W88A 3N5AA 2HVJB 1JZ2A 4POZC 4FFWC 4P5KA 1O6TA 4YS4A 1NFDE 1HCYA 4H8WC 1DDHA 1HCFX