4EO5C

Yeast asf1 bound to h3/h4g94p mutant
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
b'KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQPRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone ASF1
publication title The conformational flexibility of the C-terminus of histone H4 promotes histone octamer and nucleosome stability and yeast viability.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein/chaperone
total genus 26
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4eo5C00
1JFIA 4KUDB 5DNNC 4H9OB 5F99D 5GSUB 4H9SA 2JSSA 4JJNC 5AV5B 3WAAB 4XZQB 3RELA 2IO5C 5B2IA 2F8NH 5CHLB 3LZ1D 3REJB 4YS3A 1M18C 4J8VC 1AOID 3KXBA 3W98A 5B31B 4WV4B 1S32D 1KX4C 5E5AC 5GXQD 1ZLAD 3A6NA 3UTBC 4WU9B 3WKJA 1JFIB 3O62C 2CV5D 2RVQD 1P3GB 3AV1C 5C3IB 1TZYD 5AV8D 3RELB 5B2IB 2AROC 5B24C 3X1VC 3REIA 4Z5TC 4YS3B 4XUJA 3MGPA 3VH6W 3UTAD 3KXBB 3W98B 5DNMD 4E45A 5F99C 3KUYD 3B6FA 5B1LA 3TU4D 4G91C 3A6NB 3VH5T 2NQBD 5JRGD 4AWLB 2BYMA 3LZ1C 3R45A 5AVCA 1A7WA 3C1BD 1P3BD 5B0YD 1AOIC 2F8ND 1F66A 4UUZB 3MGRA 2HIOD 1S32C 2NZDD 1P3PD 5B31G 5B32D 4HGAB 4XUJB 3MGPB 4Z2MG 5G49A 5DNNA 2CV5C 2RVQC 1BFMA 1KU5A 3B6FB 5B1LB 4JJNA 1TZYC 3X1TD 2BYMB 3R45B 5AVCB 4CAYA 5B33D 1M18A 4J8VA 3X1SA 3UT9D 1F66B 1B67A 3UTAC 3MGRB 1KX4A 5DNMC 2NQBC 5G49B 3O62A 5DNNB 3AV1A 3B6GD 3REKC 3X1UC 1P3BC 3AZMD 5B0YC 3C1CA 5BS7C 2IO5B 4M6BA 3W99C 2AROA 5B24A 3AZEC 3X1VA 2HIOC 1P3AC 4Z5TA 5AY8D 3MNND 5B32C 1P3PC 4CAYB 4KHAA 1M18B 4J8VB 5GT3D 3X1SB 1P3MD 5B2JD 1KX4B 5F99A 5FUGA 5CP6B 4E44A 4CSRA 5BNVA 3O62B 3LZ1A 3LELA 3MGQD 5B33C 1AOIA 3B0BA 3UT9C 1P3FD 3C1CB 2AROB 5B24B 3X1VB 1S32A 4Z5TB 3AYWC 4KHAB 1P3OD 5F99B 4G91B 1TZYA 3AZMC 4CSRB 5GT0D 5BNVB 3LELB 3LZ1B 1EQZD 5AY8C 4X23D 1P3MC 4EO5C 4Z66C 3UTAA 3LJAD 5KDMA 5DNMA 4YM6D 2NQBA 1P34A 1P3KD 5CPKD 3WTPD 3REKA 3X1UA 3MGQC 1P3BA 1ULYA 1ID3B 5B0YA 1P3FC 4QLCA 3W99A 3AZEA 4R8PD 1P3AA 1P3PA 5JA4A 5B32A 5CPJC 3MVDD 1P3LD 1P3OC 3UTAB 3AZLD 5KDMB 5DNMB 1KX3D 2NQBB 3AV2D 1P34B 5B1MC 5GT0C 4ZUXC 1WWIA 3MGSA 1EQZC 5B33A 3X1UB 3REKB 1P3BB 3UT9A 4QLCB 3W96C 3W99B 3AZEB 3LJAC 4J8XD 1P3AB 2YFWA 4YM6C 1P3PB 5JA4B 5B32B 3AYWA 1P3KC 5BNXA 2F8NK 3WTPC 4KGCD 3AZMA 3KWQD 2PYOD 1KX5D 3WA9D 4WZSB 4R8PC 4DRAA 3MGSB 1BH8A 5AY8A 3MVDC 1P3MA 1H3OA 3UT9B 4Z66A 5AV6D 2YFVA 3AZLC 3WKJB 2YFWB 3W97D 3AYWB 3V9RA 2HUEC 3AZNA 5BNXB 3B0CW 3REHD 3AZFD 3MGQA 3AZMB 1P3FA 3REIB 5GXQC 1ZLAC 2F8NG 4J8XC 4KUDD 1HQ3D 1BH8B 5CPJA 5AY8B 4DRBA 5GSUD 3LZ0D 5B32G 1H3OB 4EO5B 5AV5D 4XZQD 3WAAD 4Z66B 5AV8C 2YFVB 5B0ZD 4NE5A 3AZID 3VH6T 3KWQC 3V9RB 2PYOC 1M1AD 5B1MA 1KX5C 3AZNB 3WA9C 4ZUXA 1EQZA 5B31D 3MGQB 5E5AA 1P3FB 4WU9D 3KUYC 3UTBA 3W96A 3TU4C 3LJAA 3B0CT 5JRGC 4YM6A 5CPJB 1P3GD 3W97C 1P3KA 3C1BC 3RELD 4JJNB 3REHC 3WTPA 3AZFC 3KSYA 2NZDC 5B1MB 4ZUXB 3AZGD 4KUDC 3W98D 1EQZB 1HQ3C 3LZ0C 5E5AB 3A6ND 4J8WD 3WAAC 3UTBB 3W96B 3LJAB 3AZLA 5B0ZC 4YM6B 3AZIC 3X1TC 3AN2D 2FJ7D 3AV1B 1P3KB 1M1AC 4XUJD 5GXQA 4WU9C 1ZLAA 4WNNA 2CV5A 1P3GC 3B6FD 5B1LD 5C3IC 3B6GC 5FUGB 5AV8A 3AZLB 4LD9D 1F1EA 3AFAD 5AVBD 3KWQA 3MNNC 5BO0A 1KX5A 2HUEB 3WA9A 5GT3C 1AOIB 3AZGC 5B2JC 5BT1D 1S32B 3A6NC 4J8WC 3KUYA 5GXQB 3TU4A 1ZLAB 4J8UD 4WNNB 5AV9D 5JRGA 5DNND 3AN2C 3W97A 2CV5B 2FJ7C 3C1BA 3REHA 2F8NA 1TZYB 5AV8B 3VH5A 5BS7A 3AZFA 1M19D 2HIOA 2NZDA 3KWQB 3AZKD 4J8VD 3B0DC 3X1SD 1KX5B 3WA9B 1HQ3A 4WU8D 4H9OA 1KX4D 4H9PA 3LZ0A 5B1LC 5CP6D 2L5AA 3KUYB 3TU4B 3AZJD 3NQJA 5B0ZA 4LD9C 5JRGB 3AZIA 3AFAC 3X1TA 5AVBC 1M1AA 3C1BB 3C1CD 3REHB 5B0YB 4X23C 2F8NB 5B40D 2AROD 2BYKA 5BT1C 3AZFB 3AZHD 2HIOB 4NE6A 1U35D 2NZDB 4WU9A 4J8UC 5AV9C 1HQ3B 1P3GA 5CPKC 4H9PB 3LZ0B 3B6GA 5B0ZB 3NQJB 3LELD 3AZIB 4Z2MH 3X1TB 1M19C 3VH5W 3MNNA 3AZKC 1M1AB 5B33B 3X1SC 5GT3A 1P3LC 3AZGA 1P3ID 5B2JA 4WU8C 2BYKB 4J8WA 4G92C 5CPID 1KX3C 5CP6C 3AZJC 3AV2C 4NFTA 3AN2A 2FJ7A 4ZBJC 1ID3D 3B6GB 3C1CC 4UUZA 5B40C 3AZHC 1U35C 3NQUA 3MNNB 1BH9A 5GT3B 3AZGB 1P3MB 1P3OA 5B2JB 4H9QA 4J8WB 3REJD 4KGCC 1P34D 4LD9A 3LELC 3AFAA 5GT0A 5AVBA 3AN2B 2FJ7B 3REKD 3X1UD 4X23A 3W99D 4QLCD 2CWEA 3AZED 3WTPE 1P3IC 1P3AD 5AV6C 5CPIC 3NQUB 4J8UA 3B0DB 5AV9A 1BH9B 1P3OB 5CPKA 5B2ID 4H9QB 1ID3C 4YS3D 4LD9B 4H9NA 3AFAB 3MGSD 1WWSA 4R8PA 5GT0B 5AVBB 1M19A 3KXBD 3AZKA 5GSUC 3MVDA 1P3LA 4X23B 1HTAA 4WU8A 5AV5C 4XZQC 3WKJD 3AYWD 5CP6A 3REJC 1KX3A 3AZJA 4J8UB 1P34C 4NE3A 3AV2A 5AV9B 5CPKB 5B31C 3WTPB 3REID 4H9RA 4QLCC 5B40A 2LY8A 3MGPD 3AZHA 4H9NB 1M19B 4R8PB 4J8XA 1U35A 3AZKB 3MVDB 1P3LB 4H9SC 4Z66D 4WU8B 3RELC 5B2IC 4G92B 1TAFA 1KX3B 4KGCA 5AVCD 1B6WA 3AZJB 4YS3C 3AZND 2PYOA 3AV2B 1N1JA 1F66D 3MGSC 4ZBJB 3KXBC 3MGRD 3W98C 4H9RB 1P3IA 5B40B 5AV6A 3AZHB 3WKJC 5CPJD 4J8XB 4AWLC 1U35B 5CPIA 4JJND 1ID3A 1TAFB 4KGCB 3REIC 4HGAC 5B1MD 4XUJC 3MGPC 1M18D 2PYOB 5BO0B 4ZUXD 1N1JB 4KUDA 5E5AD 5GSUA 1R4VA 3B6FC 3UTBD 3W96D 1P3IB 5AV5A 3WAAA 4XZQA 5AV6B 3O62D 3REJA 5CPIB 3AV1D 5AVCC 3W97B 3AZNC 1Q9CA 1F66C 5B24D 5B31A 3MGRC 3X1VD 4Z5TD 3VH6A
chains in the Genus database with same CATH superfamily
1JFIA 4KUDB 5DNNC 4H9OB 5F99D 5GSUB 4H9SA 2JSSA 4JJNC 5AV5B 3WAAB 4XZQB 3RELA 2IO5C 5B2IA 2F8NH 5CHLB 2JCHA 3LZ1D 3REJB 4YS3A 1M18C 4J8VC 1AOID 2Y2PA 3KXBA 3W98A 5B31B 4WV4B 1S32D 1KX4C 5E5AC 5GXQD 2XD5A 1Z2CB 3A6NA 3UTBC 1ZLAD 4WU9B 3WKJA 1JFIB 3O62C 2Y2HA 2CV5D 2RVQD 1P3GB 3AV1C 5C3IB 1TZYD 5AV8D 3RELB 5B2IB 2AROC 5B24C 3X1VC 3EG5B 3REIA 4Z5TC 4YS3B 4XUJA 3MGPA 3VH6W 3UTAD 3KXBB 3W98B 5DNMD 4E45A 5F99C 3KUYD 3B6FA 5B1LA 3TU4D 4G91C 3A6NB 3VH5T 2NQBD 3AL0C 2ZY3A 3EPLA 5JRGD 4AWLB 2BYMA 3LZ1C 3R45A 5AVCA 1A7WA 3C1BD 1P3BD 5B0YD 1AOIC 2F8ND 1F66A 4UUZB 3MGRA 2HIOD 1S32C 2NZDD 1P3PD 5B31G 5B32D 4HGAB 4XUJB 3MGPB 4Z2MG 5G49A 5DNNA 2CV5C 2RVQC 1BFMA 1KU5A 2DQNC 3B6FB 5B1LB 4JJNA 1TZYC 3X1TD 2BYMB 3R45B 5AVCB 4CAYA 5B33D 1M18A 4J8VA 3X1SA 3UT9D 3H0MC 1F66B 1B67A 3UTAC 3MGRB 1KX4A 5DNMC 2NQBC 4DQYB 5G49B 3O62A 5DNNB 3AV1A 3B6GD 3REKC 3X1UC 1P3BC 3AZMD 5B0YC 3C1CA 5BS7C 2IO5B 4M6BA 3W99C 2AROA 5B24A 3AZEC 3X1VA 2HIOC 1P3AC 4Z5TA 5AY8D 3MNND 5B32C 1P3PC 4CAYB 4KHAA 1M18B 4J8VB 5GT3D 3X1SB 1P3MD 5B2JD 1KX4B 5F99A 5FUGA 5CP6B 4E44A 4CSRA 5BNVA 3O62B 3LZ1A 3LELA 2Y2IA 3MGQD 5B33C 1AOIA 3B0BA 3UT9C 1P3FD 3C1CB 2AROB 5B24B 3X1VB 1S32A 4Z5TB 3AYWC 4KHAB 1P3OD 2JE5A 5F99B 4G91B 1TZYA 3AZMC 4CSRB 5GT0D 5BNVB 3LELB 3LZ1B 1EQZD 5AY8C 3H0RC 4X23D 1P3MC 4EO5C 4Z66C 3UTAA 3LJAD 5KDMA 5DNMA 4YM6D 2NQBA 1P34A 1P3KD 5CPKD 3WTPD 3REKA 3X1UA 3MGQC 1P3BA 1ULYA 1ID3B 5B0YA 1P3FC 2Y2JA 4QLCA 3W99A 3AZEA 4R8PD 1P3AA 1P3PA 5JA4A 5B32A 5CPJC 3MVDD 1P3LD 2ZY4A 1P3OC 3UTAB 3AZLD 5KDMB 5DNMB 1KX3D 2NQBB 3AV2D 1P34B 5B1MC 5GT0C 4ZUXC 1WWIA 3MGSA 1EQZC 2ZY2A 5B33A 3X1UB 3REKB 1P3BB 3UT9A 4QLCB 3W96C 3W99B 3AZEB 3LJAC 4J8XD 1P3AB 2YFWA 4YM6C 1P3PB 5JA4B 5B32B 3AYWA 1P3KC 5BNXA 2F8NK 3WTPC 4KGCD 3AZMA 3KWQD 2PYOD 1KX5D 3WA9D 4WZSB 4R8PC 4DRAA 3MGSB 1BH8A 5AY8A 4WJ3C 3MVDC 1P3MA 1H3OA 3UT9B 4Z66A 5AV6D 2YFVA 3AZLC 2Y2GA 3WKJB 2YFWB 3W97D 3AYWB 3V9RA 1T3UA 2HUEC 3AZNA 5BNXB 3B0CW 3REHD 3AZFD 3MGQA 3AZMB 1P3FA 3REIB 5GXQC 1ZLAC 2F8NG 4J8XC 4KUDD 1HQ3D 1BH8B 5CPJA 5AY8B 4DRBA 5GSUD 3LZ0D 5B32G 1H3OB 4EO5B 5AV5D 4XZQD 3WAAD 4Z66B 5AV8C 2YFVB 5B0ZD 4NE5A 3AZID 3VH6T 3KWQC 3V9RB 2PYOC 1M1AD 5B1MA 1KX5C 3AZNB 3WA9C 4ZUXA 1EQZA 3H0LC 5B31D 3MGQB 3EPHA 5E5AA 1P3FB 4WU9D 3KUYC 3UTBA 3W96A 3TU4C 3LJAA 2RIQA 3B0CT 5JRGC 4YM6A 5CPJB 2Y2MA 1P3GD 3W97C 1P3KA 3C1BC 3RELD 4JJNB 3REHC 2XD1A 3WTPA 3AZFC 3KSYA 2NZDC 1W2EA 5B1MB 4ZUXB 3AZGD 4KUDC 3W98D 1EQZB 1HQ3C 2Y2NA 3LZ0C 5E5AB 3A6ND 4J8WD 3WAAC 3UTBB 3W96B 3KFUG 3LJAB 3AZLA 5B0ZC 4YM6B 3AZIC 3X1TC 3AN2D 2FJ7D 3AV1B 1P3KB 1M1AC 4XUJD 5GXQA 4WU9C 1ZLAA 4WNNA 2CV5A 1P3GC 3B6FD 5B1LD 5C3IC 3B6GC 5FUGB 5AV8A 3AZLB 4LD9D 1F1EA 3AFAD 5AVBD 3KWQA 3MNNC 5BO0A 1KX5A 2HUEB 3WA9A 5GT3C 1AOIB 3AZGC 2DF4C 5B2JC 5BT1D 1S32B 3A1KA 3A6NC 4J8WC 3KUYA 5GXQB 3TU4A 1ZLAB 4J8UD 4WNNB 5AV9D 3A1IA 5JRGA 5DNND 3AN2C 3W97A 2CV5B 2FJ7C 3C1BA 3REHA 2F8NA 1TZYB 5AV8B 3VH5A 5BS7A 3AZFA 1M19D 2HIOA 2NZDA 3KWQB 3AZKD 4J8VD 3B0DC 2ZY5A 3X1SD 1KX5B 3WA9B 1PZRA 1HQ3A 4WU8D 4H9OA 1KX4D 4H9PA 3LZ0A 5B1LC 5CP6D 2L5AA 3KUYB 3TU4B 3AZJD 3NQJA 5B0ZA 4LD9C 5JRGB 3AZIA 3AFAC 3X1TA 5AVBC 1M1AA 3C1BB 3C1CD 3REHB 5B0YB 4X23C 2F8NB 2Y2LA 2AROD 5B40D 2BYKA 5BT1C 2BG1A 3AZFB 3AZHD 2HIOB 4NE6A 1U35D 2NZDB 4WU9A 4J8UC 5AV9C 1HQ3B 1P3GA 5CPKC 4H9PB 3LZ0B 3B6GA 2Y2QA 3NQJB 5B0ZB 3LELD 3AZIB 4Z2MH 3X1TB 1M19C 3VH5W 3MNNA 3AZKC 1M1AB 5B33B 3X1SC 5GT3A 1P3LC 3AZGA 1P3ID 5B2JA 4WU8C 2BYKB 3P5JB 4J8WA 4G92C 5CPID 1KX3C 5CP6C 3AZJC 2F2AC 3AV2C 4NFTA 3AN2A 2FJ7A 4ZBJC 1ID3D 3B6GB 3C1CC 4UUZA 5B40C 3AZHC 2G5IC 1U35C 3NQUA 3MNNB 1BH9A 2Y2OA 5GT3B 3AZGB 2ZM5A 1P3MB 5B2JB 1P3OA 4UPKA 3F6TA 4H9QA 4J8WB 3REJD 4KGCC 1P34D 4LD9A 3LELC 3AFAA 5GT0A 5AVBA 3AN2B 2FJ7B 3REKD 3X1UD 4X23A 3W99D 4QLCD 2CWEA 3AZED 3WTPE 1P3IC 1P3AD 5AV6C 5CPIC 3NQUB 4J8UA 3B0DB 5AV9A 1BH9B 1P3OB 3IP4C 5CPKA 5B2ID 4H9QB 1ID3C 4YS3D 4LD9B 4H9NA 3AFAB 3MGSD 1WWSA 4R8PA 5GT0B 5AVBB 1M19A 3KXBD 3AZKA 5GSUC 3MVDA 1P3LA 4X23B 1HTAA 5AV5C 4WU8A 4XZQC 3EPKA 3WKJD 3AYWD 5CP6A 3REJC 1KX3A 3AZJA 4J8UB 1P34C 4NE3A 3AV2A 5AV9B 5CPKB 5B31C 3WTPB 2UWXA 3REID 4H9RA 4QLCC 5B40A 2LY8A 3MGPD 3AZHA 4H9NB 1M19B 4R8PB 4J8XA 1U35A 3AZKB 3MVDB 1P3LB 4H9SC 4Z66D 4WU8B 3RELC 5B2IC 2W8SA 4G92B 1TAFA 1KX3B 4KGCA 5AVCD 1B6WA 3AZJB 4YS3C 3AZND 2PYOA 3AV2B 1N1JA 1F66D 3MGSC 3EPJA 4ZBJB 3KXBC 2G5HC 2J8PA 3MGRD 3W98C 4H9RB 1P3IA 5B40B 5AV6A 3AZHB 3WKJC 2Y2KA 5CPJD 4J8XB 3FDDA 4AWLC 5CPIA 1U35B 2VQRA 4JJND 1ID3A 1TAFB 4KGCB 3REIC 4HGAC 5B1MD 4XUJC 3MGPC 1M18D 2PYOB 2FFFB 5BO0B 4ZUXD 1N1JB 4KUDA 5E5AD 5GSUA 1R4VA 3B6FC 3UTBD 3W96D 1P3IB 5AV5A 3WAAA 4XZQA 5AV6B 3O62D 3REJA 5CPIB 3AV1D 5AVCC 3W97B 3AZNC 1Q9CA 1F66C 5B24D 5B31A 3MGRC 3X1VD 4Z5TD 3VH6A
chains in the Genus database with same CATH topology
1JFIA 4KUDB 5DNNC 4H9OB 5F99D 5GSUB 4H9SA 2JSSA 4JJNC 5AV5B 3WAAB 4XZQB 3RELA 2IO5C 5B2IA 2F8NH 5CHLB 2JCHA 3LZ1D 3REJB 4YS3A 1M18C 4J8VC 1AOID 2Y2PA 3KXBA 3W98A 5B31B 4WV4B 1S32D 1KX4C 5E5AC 5GXQD 2XD5A 1Z2CB 3A6NA 3UTBC 1ZLAD 4WU9B 3WKJA 1JFIB 3O62C 2Y2HA 2CV5D 2RVQD 1P3GB 3AV1C 5C3IB 1TZYD 5AV8D 3RELB 5B2IB 2AROC 5B24C 3X1VC 3EG5B 3REIA 4Z5TC 4YS3B 4XUJA 3MGPA 3VH6W 3UTAD 3KXBB 3W98B 5DNMD 4E45A 5F99C 3KUYD 3B6FA 5B1LA 3TU4D 4G91C 3A6NB 3VH5T 2NQBD 3AL0C 2ZY3A 3EPLA 5JRGD 4AWLB 2BYMA 3LZ1C 3R45A 5AVCA 1A7WA 3C1BD 1P3BD 5B0YD 1AOIC 2F8ND 1F66A 4UUZB 3MGRA 2HIOD 1S32C 2NZDD 1P3PD 5B31G 5B32D 4HGAB 4XUJB 3MGPB 4Z2MG 5G49A 5DNNA 2CV5C 2RVQC 1BFMA 1KU5A 2DQNC 3B6FB 5B1LB 4JJNA 1TZYC 3X1TD 2BYMB 3R45B 5AVCB 4CAYA 5B33D 1M18A 4J8VA 3X1SA 3UT9D 3H0MC 1F66B 1B67A 3UTAC 3MGRB 1KX4A 5DNMC 2NQBC 4DQYB 5G49B 3O62A 5DNNB 3AV1A 3B6GD 3REKC 3X1UC 1P3BC 3AZMD 5B0YC 3C1CA 5BS7C 2IO5B 4M6BA 3W99C 2AROA 5B24A 3AZEC 3X1VA 2HIOC 1P3AC 4Z5TA 5AY8D 3MNND 5B32C 1P3PC 4CAYB 4KHAA 1M18B 4J8VB 5GT3D 3X1SB 1P3MD 5B2JD 1KX4B 5F99A 5FUGA 5CP6B 4E44A 4CSRA 5BNVA 3O62B 3LZ1A 3LELA 2Y2IA 3MGQD 5B33C 1AOIA 3B0BA 3UT9C 1P3FD 3C1CB 2AROB 5B24B 3X1VB 1S32A 4Z5TB 3AYWC 4KHAB 1P3OD 2JE5A 5F99B 4G91B 1TZYA 3AZMC 4CSRB 5GT0D 5BNVB 3LELB 3LZ1B 1EQZD 5AY8C 3H0RC 4X23D 1P3MC 4EO5C 4Z66C 3UTAA 3LJAD 5KDMA 5DNMA 4YM6D 2NQBA 1P34A 1P3KD 5CPKD 3WTPD 3REKA 3X1UA 3MGQC 1P3BA 1ULYA 1ID3B 5B0YA 1P3FC 2Y2JA 4QLCA 3W99A 3AZEA 4R8PD 1P3AA 1P3PA 5JA4A 5B32A 5CPJC 3MVDD 1P3LD 2ZY4A 1P3OC 3UTAB 3AZLD 5KDMB 5DNMB 1KX3D 2NQBB 3AV2D 1P34B 5B1MC 5GT0C 4ZUXC 1WWIA 3MGSA 1EQZC 2ZY2A 5B33A 3X1UB 3REKB 1P3BB 3UT9A 4QLCB 3W96C 3W99B 3AZEB 3LJAC 4J8XD 1P3AB 2YFWA 4YM6C 1P3PB 5JA4B 5B32B 3AYWA 1P3KC 5BNXA 2F8NK 3WTPC 4KGCD 3AZMA 3KWQD 2PYOD 1KX5D 3WA9D 4WZSB 4R8PC 4DRAA 3MGSB 1BH8A 5AY8A 4WJ3C 3MVDC 1P3MA 1H3OA 3UT9B 4Z66A 5AV6D 2YFVA 3AZLC 2Y2GA 3WKJB 2YFWB 3W97D 3AYWB 3V9RA 1T3UA 2HUEC 3AZNA 5BNXB 3B0CW 3REHD 3AZFD 3MGQA 3AZMB 1P3FA 3REIB 5GXQC 1ZLAC 2F8NG 4J8XC 4KUDD 1HQ3D 1BH8B 5CPJA 5AY8B 4DRBA 5GSUD 3LZ0D 5B32G 1H3OB 4EO5B 5AV5D 4XZQD 3WAAD 4Z66B 5AV8C 2YFVB 5B0ZD 4NE5A 3AZID 3VH6T 3KWQC 3V9RB 2PYOC 1M1AD 5B1MA 1KX5C 3AZNB 3WA9C 4ZUXA 1EQZA 3H0LC 5B31D 3MGQB 3EPHA 5E5AA 1P3FB 4WU9D 3KUYC 3UTBA 3W96A 3TU4C 3LJAA 2RIQA 3B0CT 5JRGC 4YM6A 5CPJB 2Y2MA 1P3GD 3W97C 1P3KA 3C1BC 3RELD 4JJNB 3REHC 2XD1A 3WTPA 3AZFC 3KSYA 2NZDC 1W2EA 5B1MB 4ZUXB 3AZGD 4KUDC 3W98D 1EQZB 1HQ3C 2Y2NA 3LZ0C 5E5AB 3A6ND 4J8WD 3WAAC 3UTBB 3W96B 3KFUG 3LJAB 3AZLA 5B0ZC 4YM6B 3AZIC 3X1TC 3AN2D 2FJ7D 3AV1B 1P3KB 1M1AC 4XUJD 5GXQA 4WU9C 1ZLAA 4WNNA 2CV5A 1P3GC 3B6FD 5B1LD 5C3IC 3B6GC 5FUGB 5AV8A 3AZLB 4LD9D 1F1EA 3AFAD 5AVBD 3KWQA 3MNNC 5BO0A 1KX5A 2HUEB 3WA9A 5GT3C 1AOIB 3AZGC 2DF4C 5B2JC 5BT1D 1S32B 3A1KA 3A6NC 4J8WC 3KUYA 5GXQB 3TU4A 1ZLAB 4J8UD 4WNNB 5AV9D 3A1IA 5JRGA 5DNND 3AN2C 3W97A 2CV5B 2FJ7C 3C1BA 3REHA 2F8NA 1TZYB 5AV8B 3VH5A 5BS7A 3AZFA 1M19D 2HIOA 2NZDA 3KWQB 3AZKD 4J8VD 3B0DC 2ZY5A 3X1SD 1KX5B 3WA9B 1PZRA 1HQ3A 4WU8D 4H9OA 1KX4D 4H9PA 3LZ0A 5B1LC 5CP6D 2L5AA 3KUYB 3TU4B 3AZJD 3NQJA 5B0ZA 4LD9C 5JRGB 3AZIA 3AFAC 3X1TA 5AVBC 1M1AA 3C1BB 3C1CD 3REHB 5B0YB 4X23C 2F8NB 2Y2LA 2AROD 5B40D 2BYKA 5BT1C 2BG1A 3AZFB 3AZHD 2HIOB 4NE6A 1U35D 2NZDB 4WU9A 4J8UC 5AV9C 1HQ3B 1P3GA 5CPKC 4H9PB 3LZ0B 3B6GA 2Y2QA 3NQJB 5B0ZB 3LELD 3AZIB 4Z2MH 3X1TB 1M19C 3VH5W 3MNNA 3AZKC 1M1AB 5B33B 3X1SC 5GT3A 1P3LC 3AZGA 1P3ID 5B2JA 4WU8C 2BYKB 3P5JB 4J8WA 4G92C 5CPID 1KX3C 5CP6C 3AZJC 2F2AC 3AV2C 4NFTA 3AN2A 2FJ7A 4ZBJC 1ID3D 3B6GB 3C1CC 4UUZA 5B40C 3AZHC 2G5IC 1U35C 3NQUA 3MNNB 1BH9A 2Y2OA 5GT3B 3AZGB 2ZM5A 1P3MB 5B2JB 1P3OA 4UPKA 3F6TA 4H9QA 4J8WB 3REJD 4KGCC 1P34D 4LD9A 3LELC 3AFAA 5GT0A 5AVBA 3AN2B 2FJ7B 3REKD 3X1UD 4X23A 3W99D 4QLCD 2CWEA 3AZED 3WTPE 1P3IC 1P3AD 5AV6C 5CPIC 3NQUB 4J8UA 3B0DB 5AV9A 1BH9B 1P3OB 3IP4C 5CPKA 5B2ID 4H9QB 1ID3C 4YS3D 4LD9B 4H9NA 3AFAB 3MGSD 1WWSA 4R8PA 5GT0B 5AVBB 1M19A 3KXBD 3AZKA 5GSUC 3MVDA 1P3LA 4X23B 1HTAA 5AV5C 4WU8A 4XZQC 3EPKA 3WKJD 3AYWD 5CP6A 3REJC 1KX3A 3AZJA 4J8UB 1P34C 4NE3A 3AV2A 5AV9B 5CPKB 5B31C 3WTPB 2UWXA 3REID 4H9RA 4QLCC 5B40A 2LY8A 3MGPD 3AZHA 4H9NB 1M19B 4R8PB 4J8XA 1U35A 3AZKB 3MVDB 1P3LB 4H9SC 4Z66D 4WU8B 3RELC 5B2IC 2W8SA 4G92B 1TAFA 1KX3B 4KGCA 5AVCD 1B6WA 3AZJB 4YS3C 3AZND 2PYOA 3AV2B 1N1JA 1F66D 3MGSC 3EPJA 4ZBJB 3KXBC 2G5HC 2J8PA 3MGRD 3W98C 4H9RB 1P3IA 5B40B 5AV6A 3AZHB 3WKJC 2Y2KA 5CPJD 4J8XB 3FDDA 4AWLC 5CPIA 1U35B 2VQRA 4JJND 1ID3A 1TAFB 4KGCB 3REIC 4HGAC 5B1MD 4XUJC 3MGPC 1M18D 2PYOB 2FFFB 5BO0B 4ZUXD 1N1JB 4KUDA 5E5AD 5GSUA 1R4VA 3B6FC 3UTBD 3W96D 1P3IB 5AV5A 3WAAA 4XZQA 5AV6B 3O62D 3REJA 5CPIB 3AV1D 5AVCC 3W97B 3AZNC 1Q9CA 1F66C 5B24D 5B31A 3MGRC 3X1VD 4Z5TD 3VH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JFI A;  4KUD B;  5DNN C;  4H9O B;  5F99 D;  5GSU B;  4H9S A;  2JSS A;  4JJN C;  5AV5 B;  3WAA B;  4XZQ B;  3REL A;  2IO5 C;  5B2I A;  2F8N H;  5CHL B;  3LZ1 D;  3REJ B;  4YS3 A;  1M18 C;  4J8V C;  1AOI D;  3KXB A;  3W98 A;  5B31 B;  4WV4 B;  1S32 D;  1KX4 C;  5E5A C;  5GXQ D;  1ZLA D;  3A6N A;  3UTB C;  4WU9 B;  3WKJ A;  1JFI B;  3O62 C;  2CV5 D;  2RVQ D;  1P3G B;  3AV1 C;  5C3I B;  1TZY D;  5AV8 D;  3REL B;  5B2I B;  2ARO C;  5B24 C;  3X1V C;  3REI A;  4Z5T C;  4YS3 B;  4XUJ A;  3MGP A;  3VH6 W;  3UTA D;  3KXB B;  3W98 B;  5DNM D;  4E45 A;  5F99 C;  3KUY D;  3B6F A;  5B1L A;  3TU4 D;  4G91 C;  3A6N B;  3VH5 T;  2NQB D;  5JRG D;  4AWL B;  2BYM A;  3LZ1 C;  3R45 A;  5AVC A;  1A7W A;  3C1B D;  1P3B D;  5B0Y D;  1AOI C;  2F8N D;  1F66 A;  4UUZ B;  3MGR A;  2HIO D;  1S32 C;  2NZD D;  1P3P D;  5B31 G;  5B32 D;  4HGA B;  4XUJ B;  3MGP B;  4Z2M G;  5G49 A;  5DNN A;  2CV5 C;  2RVQ C;  1BFM A;  1KU5 A;  3B6F B;  5B1L B;  4JJN A;  1TZY C;  3X1T D;  2BYM B;  3R45 B;  5AVC B;  4CAY A;  5B33 D;  1M18 A;  4J8V A;  3X1S A;  3UT9 D;  1F66 B;  1B67 A;  3UTA C;  3MGR B;  1KX4 A;  5DNM C;  2NQB C;  5G49 B;  3O62 A;  5DNN B;  3AV1 A;  3B6G D;  3REK C;  3X1U C;  1P3B C;  3AZM D;  5B0Y C;  3C1C A;  5BS7 C;  2IO5 B;  4M6B A;  3W99 C;  2ARO A;  5B24 A;  3AZE C;  3X1V A;  2HIO C;  1P3A C;  4Z5T A;  5AY8 D;  3MNN D;  5B32 C;  1P3P C;  4CAY B;  4KHA A;  1M18 B;  4J8V B;  5GT3 D;  3X1S B;  1P3M D;  5B2J D;  1KX4 B;  5F99 A;  5FUG A;  5CP6 B;  4E44 A;  4CSR A;  5BNV A;  3O62 B;  3LZ1 A;  3LEL A;  3MGQ D;  5B33 C;  1AOI A;  3B0B A;  3UT9 C;  1P3F D;  3C1C B;  2ARO B;  5B24 B;  3X1V B;  1S32 A;  4Z5T B;  3AYW C;  4KHA B;  1P3O D;  5F99 B;  4G91 B;  1TZY A;  3AZM C;  4CSR B;  5GT0 D;  5BNV B;  3LEL B;  3LZ1 B;  1EQZ D;  5AY8 C;  4X23 D;  1P3M C;  4EO5 C;  4Z66 C;  3UTA A;  3LJA D;  5KDM A;  5DNM A;  4YM6 D;  2NQB A;  1P34 A;  1P3K D;  5CPK D;  3WTP D;  3REK A;  3X1U A;  3MGQ C;  1P3B A;  1ULY A;  1ID3 B;  5B0Y A;  1P3F C;  4QLC A;  3W99 A;  3AZE A;  4R8P D;  1P3A A;  1P3P A;  5JA4 A;  5B32 A;  5CPJ C;  3MVD D;  1P3L D;  1P3O C;  3UTA B;  3AZL D;  5KDM B;  5DNM B;  1KX3 D;  2NQB B;  3AV2 D;  1P34 B;  5B1M C;  5GT0 C;  4ZUX C;  1WWI A;  3MGS A;  1EQZ C;  5B33 A;  3X1U B;  3REK B;  1P3B B;  3UT9 A;  4QLC B;  3W96 C;  3W99 B;  3AZE B;  3LJA C;  4J8X D;  1P3A B;  2YFW A;  4YM6 C;  1P3P B;  5JA4 B;  5B32 B;  3AYW A;  1P3K C;  5BNX A;  2F8N K;  3WTP C;  4KGC D;  3AZM A;  3KWQ D;  2PYO D;  1KX5 D;  3WA9 D;  4WZS B;  4R8P C;  4DRA A;  3MGS B;  1BH8 A;  5AY8 A;  3MVD C;  1P3M A;  1H3O A;  3UT9 B;  4Z66 A;  5AV6 D;  2YFV A;  3AZL C;  3WKJ B;  2YFW B;  3W97 D;  3AYW B;  3V9R A;  2HUE C;  3AZN A;  5BNX B;  3B0C W;  3REH D;  3AZF D;  3MGQ A;  3AZM B;  1P3F A;  3REI B;  5GXQ C;  1ZLA C;  2F8N G;  4J8X C;  4KUD D;  1HQ3 D;  1BH8 B;  5CPJ A;  5AY8 B;  4DRB A;  5GSU D;  3LZ0 D;  5B32 G;  1H3O B;  4EO5 B;  5AV5 D;  4XZQ D;  3WAA D;  4Z66 B;  5AV8 C;  2YFV B;  5B0Z D;  4NE5 A;  3AZI D;  3VH6 T;  3KWQ C;  3V9R B;  2PYO C;  1M1A D;  5B1M A;  1KX5 C;  3AZN B;  3WA9 C;  4ZUX A;  1EQZ A;  5B31 D;  3MGQ B;  5E5A A;  1P3F B;  4WU9 D;  3KUY C;  3UTB A;  3W96 A;  3TU4 C;  3LJA A;  3B0C T;  5JRG C;  4YM6 A;  5CPJ B;  1P3G D;  3W97 C;  1P3K A;  3C1B C;  3REL D;  4JJN B;  3REH C;  3WTP A;  3AZF C;  3KSY A;  2NZD C;  5B1M B;  4ZUX B;  3AZG D;  4KUD C;  3W98 D;  1EQZ B;  1HQ3 C;  3LZ0 C;  5E5A B;  3A6N D;  4J8W D;  3WAA C;  3UTB B;  3W96 B;  3LJA B;  3AZL A;  5B0Z C;  4YM6 B;  3AZI C;  3X1T C;  3AN2 D;  2FJ7 D;  3AV1 B;  1P3K B;  1M1A C;  4XUJ D;  5GXQ A;  4WU9 C;  1ZLA A;  4WNN A;  2CV5 A;  1P3G C;  3B6F D;  5B1L D;  5C3I C;  3B6G C;  5FUG B;  5AV8 A;  3AZL B;  4LD9 D;  1F1E A;  3AFA D;  5AVB D;  3KWQ A;  3MNN C;  5BO0 A;  1KX5 A;  2HUE B;  3WA9 A;  5GT3 C;  1AOI B;  3AZG C;  5B2J C;  5BT1 D;  1S32 B;  3A6N C;  4J8W C;  3KUY A;  5GXQ B;  3TU4 A;  1ZLA B;  4J8U D;  4WNN B;  5AV9 D;  5JRG A;  5DNN D;  3AN2 C;  3W97 A;  2CV5 B;  2FJ7 C;  3C1B A;  3REH A;  2F8N A;  1TZY B;  5AV8 B;  3VH5 A;  5BS7 A;  3AZF A;  1M19 D;  2HIO A;  2NZD A;  3KWQ B;  3AZK D;  4J8V D;  3B0D C;  3X1S D;  1KX5 B;  3WA9 B;  1HQ3 A;  4WU8 D;  4H9O A;  1KX4 D;  4H9P A;  3LZ0 A;  5B1L C;  5CP6 D;  2L5A A;  3KUY B;  3TU4 B;  3AZJ D;  3NQJ A;  5B0Z A;  4LD9 C;  5JRG B;  3AZI A;  3AFA C;  3X1T A;  5AVB C;  1M1A A;  3C1B B;  3C1C D;  3REH B;  5B0Y B;  4X23 C;  2F8N B;  5B40 D;  2ARO D;  2BYK A;  5BT1 C;  3AZF B;  3AZH D;  2HIO B;  4NE6 A;  1U35 D;  2NZD B;  4WU9 A;  4J8U C;  5AV9 C;  1HQ3 B;  1P3G A;  5CPK C;  4H9P B;  3LZ0 B;  3B6G A;  5B0Z B;  3NQJ B;  3LEL D;  3AZI B;  4Z2M H;  3X1T B;  1M19 C;  3VH5 W;  3MNN A;  3AZK C;  1M1A B;  5B33 B;  3X1S C;  5GT3 A;  1P3L C;  3AZG A;  1P3I D;  5B2J A;  4WU8 C;  2BYK B;  4J8W A;  4G92 C;  5CPI D;  1KX3 C;  5CP6 C;  3AZJ C;  3AV2 C;  4NFT A;  3AN2 A;  2FJ7 A;  4ZBJ C;  1ID3 D;  3B6G B;  3C1C C;  4UUZ A;  5B40 C;  3AZH C;  1U35 C;  3NQU A;  3MNN B;  1BH9 A;  5GT3 B;  3AZG B;  1P3M B;  1P3O A;  5B2J B;  4H9Q A;  4J8W B;  3REJ D;  4KGC C;  1P34 D;  4LD9 A;  3LEL C;  3AFA A;  5GT0 A;  5AVB A;  3AN2 B;  2FJ7 B;  3REK D;  3X1U D;  4X23 A;  3W99 D;  4QLC D;  2CWE A;  3AZE D;  3WTP E;  1P3I C;  1P3A D;  5AV6 C;  5CPI C;  3NQU B;  4J8U A;  3B0D B;  5AV9 A;  1BH9 B;  1P3O B;  5CPK A;  5B2I D;  4H9Q B;  1ID3 C;  4YS3 D;  4LD9 B;  4H9N A;  3AFA B;  3MGS D;  1WWS A;  4R8P A;  5GT0 B;  5AVB B;  1M19 A;  3KXB D;  3AZK A;  5GSU C;  3MVD A;  1P3L A;  4X23 B;  1HTA A;  4WU8 A;  5AV5 C;  4XZQ C;  3WKJ D;  3AYW D;  5CP6 A;  3REJ C;  1KX3 A;  3AZJ A;  4J8U B;  1P34 C;  4NE3 A;  3AV2 A;  5AV9 B;  5CPK B;  5B31 C;  3WTP B;  3REI D;  4H9R A;  4QLC C;  5B40 A;  2LY8 A;  3MGP D;  3AZH A;  4H9N B;  1M19 B;  4R8P B;  4J8X A;  1U35 A;  3AZK B;  3MVD B;  1P3L B;  4H9S C;  4Z66 D;  4WU8 B;  3REL C;  5B2I C;  4G92 B;  1TAF A;  1KX3 B;  4KGC A;  5AVC D;  1B6W A;  3AZJ B;  4YS3 C;  3AZN D;  2PYO A;  3AV2 B;  1N1J A;  1F66 D;  3MGS C;  4ZBJ B;  3KXB C;  3MGR D;  3W98 C;  4H9R B;  1P3I A;  5B40 B;  5AV6 A;  3AZH B;  3WKJ C;  5CPJ D;  4J8X B;  4AWL C;  1U35 B;  5CPI A;  4JJN D;  1ID3 A;  1TAF B;  4KGC B;  3REI C;  4HGA C;  5B1M D;  4XUJ C;  3MGP C;  1M18 D;  2PYO B;  5BO0 B;  4ZUX D;  1N1J B;  4KUD A;  5E5A D;  5GSU A;  1R4V A;  3B6F C;  3UTB D;  3W96 D;  1P3I B;  5AV5 A;  3WAA A;  4XZQ A;  5AV6 B;  3O62 D;  3REJ A;  5CPI B;  3AV1 D;  5AVC C;  3W97 B;  3AZN C;  1Q9C A;  1F66 C;  5B24 D;  5B31 A;  3MGR C;  3X1V D;  4Z5T D;  3VH6 A; 
#chains in the Genus database with same CATH topology
 1JFI A;  4KUD B;  5DNN C;  4H9O B;  5F99 D;  5GSU B;  4H9S A;  2JSS A;  4JJN C;  5AV5 B;  3WAA B;  4XZQ B;  3REL A;  2IO5 C;  5B2I A;  2F8N H;  5CHL B;  2JCH A;  3LZ1 D;  3REJ B;  4YS3 A;  1M18 C;  4J8V C;  1AOI D;  2Y2P A;  3KXB A;  3W98 A;  5B31 B;  4WV4 B;  1S32 D;  1KX4 C;  5E5A C;  5GXQ D;  2XD5 A;  1Z2C B;  3A6N A;  3UTB C;  1ZLA D;  4WU9 B;  3WKJ A;  1JFI B;  3O62 C;  2Y2H A;  2CV5 D;  2RVQ D;  1P3G B;  3AV1 C;  5C3I B;  1TZY D;  5AV8 D;  3REL B;  5B2I B;  2ARO C;  5B24 C;  3X1V C;  3EG5 B;  3REI A;  4Z5T C;  4YS3 B;  4XUJ A;  3MGP A;  3VH6 W;  3UTA D;  3KXB B;  3W98 B;  5DNM D;  4E45 A;  5F99 C;  3KUY D;  3B6F A;  5B1L A;  3TU4 D;  4G91 C;  3A6N B;  3VH5 T;  2NQB D;  3AL0 C;  2ZY3 A;  3EPL A;  5JRG D;  4AWL B;  2BYM A;  3LZ1 C;  3R45 A;  5AVC A;  1A7W A;  3C1B D;  1P3B D;  5B0Y D;  1AOI C;  2F8N D;  1F66 A;  4UUZ B;  3MGR A;  2HIO D;  1S32 C;  2NZD D;  1P3P D;  5B31 G;  5B32 D;  4HGA B;  4XUJ B;  3MGP B;  4Z2M G;  5G49 A;  5DNN A;  2CV5 C;  2RVQ C;  1BFM A;  1KU5 A;  2DQN C;  3B6F B;  5B1L B;  4JJN A;  1TZY C;  3X1T D;  2BYM B;  3R45 B;  5AVC B;  4CAY A;  5B33 D;  1M18 A;  4J8V A;  3X1S A;  3UT9 D;  3H0M C;  1F66 B;  1B67 A;  3UTA C;  3MGR B;  1KX4 A;  5DNM C;  2NQB C;  4DQY B;  5G49 B;  3O62 A;  5DNN B;  3AV1 A;  3B6G D;  3REK C;  3X1U C;  1P3B C;  3AZM D;  5B0Y C;  3C1C A;  5BS7 C;  2IO5 B;  4M6B A;  3W99 C;  2ARO A;  5B24 A;  3AZE C;  3X1V A;  2HIO C;  1P3A C;  4Z5T A;  5AY8 D;  3MNN D;  5B32 C;  1P3P C;  4CAY B;  4KHA A;  1M18 B;  4J8V B;  5GT3 D;  3X1S B;  1P3M D;  5B2J D;  1KX4 B;  5F99 A;  5FUG A;  5CP6 B;  4E44 A;  4CSR A;  5BNV A;  3O62 B;  3LZ1 A;  3LEL A;  2Y2I A;  3MGQ D;  5B33 C;  1AOI A;  3B0B A;  3UT9 C;  1P3F D;  3C1C B;  2ARO B;  5B24 B;  3X1V B;  1S32 A;  4Z5T B;  3AYW C;  4KHA B;  1P3O D;  2JE5 A;  5F99 B;  4G91 B;  1TZY A;  3AZM C;  4CSR B;  5GT0 D;  5BNV B;  3LEL B;  3LZ1 B;  1EQZ D;  5AY8 C;  3H0R C;  4X23 D;  1P3M C;  4EO5 C;  4Z66 C;  3UTA A;  3LJA D;  5KDM A;  5DNM A;  4YM6 D;  2NQB A;  1P34 A;  1P3K D;  5CPK D;  3WTP D;  3REK A;  3X1U A;  3MGQ C;  1P3B A;  1ULY A;  1ID3 B;  5B0Y A;  1P3F C;  2Y2J A;  4QLC A;  3W99 A;  3AZE A;  4R8P D;  1P3A A;  1P3P A;  5JA4 A;  5B32 A;  5CPJ C;  3MVD D;  1P3L D;  2ZY4 A;  1P3O C;  3UTA B;  3AZL D;  5KDM B;  5DNM B;  1KX3 D;  2NQB B;  3AV2 D;  1P34 B;  5B1M C;  5GT0 C;  4ZUX C;  1WWI A;  3MGS A;  1EQZ C;  2ZY2 A;  5B33 A;  3X1U B;  3REK B;  1P3B B;  3UT9 A;  4QLC B;  3W96 C;  3W99 B;  3AZE B;  3LJA C;  4J8X D;  1P3A B;  2YFW A;  4YM6 C;  1P3P B;  5JA4 B;  5B32 B;  3AYW A;  1P3K C;  5BNX A;  2F8N K;  3WTP C;  4KGC D;  3AZM A;  3KWQ D;  2PYO D;  1KX5 D;  3WA9 D;  4WZS B;  4R8P C;  4DRA A;  3MGS B;  1BH8 A;  5AY8 A;  4WJ3 C;  3MVD C;  1P3M A;  1H3O A;  3UT9 B;  4Z66 A;  5AV6 D;  2YFV A;  3AZL C;  2Y2G A;  3WKJ B;  2YFW B;  3W97 D;  3AYW B;  3V9R A;  1T3U A;  2HUE C;  3AZN A;  5BNX B;  3B0C W;  3REH D;  3AZF D;  3MGQ A;  3AZM B;  1P3F A;  3REI B;  5GXQ C;  1ZLA C;  2F8N G;  4J8X C;  4KUD D;  1HQ3 D;  1BH8 B;  5CPJ A;  5AY8 B;  4DRB A;  5GSU D;  3LZ0 D;  5B32 G;  1H3O B;  4EO5 B;  5AV5 D;  4XZQ D;  3WAA D;  4Z66 B;  5AV8 C;  2YFV B;  5B0Z D;  4NE5 A;  3AZI D;  3VH6 T;  3KWQ C;  3V9R B;  2PYO C;  1M1A D;  5B1M A;  1KX5 C;  3AZN B;  3WA9 C;  4ZUX A;  1EQZ A;  3H0L C;  5B31 D;  3MGQ B;  3EPH A;  5E5A A;  1P3F B;  4WU9 D;  3KUY C;  3UTB A;  3W96 A;  3TU4 C;  3LJA A;  2RIQ A;  3B0C T;  5JRG C;  4YM6 A;  5CPJ B;  2Y2M A;  1P3G D;  3W97 C;  1P3K A;  3C1B C;  3REL D;  4JJN B;  3REH C;  2XD1 A;  3WTP A;  3AZF C;  3KSY A;  2NZD C;  1W2E A;  5B1M B;  4ZUX B;  3AZG D;  4KUD C;  3W98 D;  1EQZ B;  1HQ3 C;  2Y2N A;  3LZ0 C;  5E5A B;  3A6N D;  4J8W D;  3WAA C;  3UTB B;  3W96 B;  3KFU G;  3LJA B;  3AZL A;  5B0Z C;  4YM6 B;  3AZI C;  3X1T C;  3AN2 D;  2FJ7 D;  3AV1 B;  1P3K B;  1M1A C;  4XUJ D;  5GXQ A;  4WU9 C;  1ZLA A;  4WNN A;  2CV5 A;  1P3G C;  3B6F D;  5B1L D;  5C3I C;  3B6G C;  5FUG B;  5AV8 A;  3AZL B;  4LD9 D;  1F1E A;  3AFA D;  5AVB D;  3KWQ A;  3MNN C;  5BO0 A;  1KX5 A;  2HUE B;  3WA9 A;  5GT3 C;  1AOI B;  3AZG C;  2DF4 C;  5B2J C;  5BT1 D;  1S32 B;  3A1K A;  3A6N C;  4J8W C;  3KUY A;  5GXQ B;  3TU4 A;  1ZLA B;  4J8U D;  4WNN B;  5AV9 D;  3A1I A;  5JRG A;  5DNN D;  3AN2 C;  3W97 A;  2CV5 B;  2FJ7 C;  3C1B A;  3REH A;  2F8N A;  1TZY B;  5AV8 B;  3VH5 A;  5BS7 A;  3AZF A;  1M19 D;  2HIO A;  2NZD A;  3KWQ B;  3AZK D;  4J8V D;  3B0D C;  2ZY5 A;  3X1S D;  1KX5 B;  3WA9 B;  1PZR A;  1HQ3 A;  4WU8 D;  4H9O A;  1KX4 D;  4H9P A;  3LZ0 A;  5B1L C;  5CP6 D;  2L5A A;  3KUY B;  3TU4 B;  3AZJ D;  3NQJ A;  5B0Z A;  4LD9 C;  5JRG B;  3AZI A;  3AFA C;  3X1T A;  5AVB C;  1M1A A;  3C1B B;  3C1C D;  3REH B;  5B0Y B;  4X23 C;  2F8N B;  2Y2L A;  2ARO D;  5B40 D;  2BYK A;  5BT1 C;  2BG1 A;  3AZF B;  3AZH D;  2HIO B;  4NE6 A;  1U35 D;  2NZD B;  4WU9 A;  4J8U C;  5AV9 C;  1HQ3 B;  1P3G A;  5CPK C;  4H9P B;  3LZ0 B;  3B6G A;  2Y2Q A;  3NQJ B;  5B0Z B;  3LEL D;  3AZI B;  4Z2M H;  3X1T B;  1M19 C;  3VH5 W;  3MNN A;  3AZK C;  1M1A B;  5B33 B;  3X1S C;  5GT3 A;  1P3L C;  3AZG A;  1P3I D;  5B2J A;  4WU8 C;  2BYK B;  3P5J B;  4J8W A;  4G92 C;  5CPI D;  1KX3 C;  5CP6 C;  3AZJ C;  2F2A C;  3AV2 C;  4NFT A;  3AN2 A;  2FJ7 A;  4ZBJ C;  1ID3 D;  3B6G B;  3C1C C;  4UUZ A;  5B40 C;  3AZH C;  2G5I C;  1U35 C;  3NQU A;  3MNN B;  1BH9 A;  2Y2O A;  5GT3 B;  3AZG B;  2ZM5 A;  1P3M B;  5B2J B;  1P3O A;  4UPK A;  3F6T A;  4H9Q A;  4J8W B;  3REJ D;  4KGC C;  1P34 D;  4LD9 A;  3LEL C;  3AFA A;  5GT0 A;  5AVB A;  3AN2 B;  2FJ7 B;  3REK D;  3X1U D;  4X23 A;  3W99 D;  4QLC D;  2CWE A;  3AZE D;  3WTP E;  1P3I C;  1P3A D;  5AV6 C;  5CPI C;  3NQU B;  4J8U A;  3B0D B;  5AV9 A;  1BH9 B;  1P3O B;  3IP4 C;  5CPK A;  5B2I D;  4H9Q B;  1ID3 C;  4YS3 D;  4LD9 B;  4H9N A;  3AFA B;  3MGS D;  1WWS A;  4R8P A;  5GT0 B;  5AVB B;  1M19 A;  3KXB D;  3AZK A;  5GSU C;  3MVD A;  1P3L A;  4X23 B;  1HTA A;  5AV5 C;  4WU8 A;  4XZQ C;  3EPK A;  3WKJ D;  3AYW D;  5CP6 A;  3REJ C;  1KX3 A;  3AZJ A;  4J8U B;  1P34 C;  4NE3 A;  3AV2 A;  5AV9 B;  5CPK B;  5B31 C;  3WTP B;  2UWX A;  3REI D;  4H9R A;  4QLC C;  5B40 A;  2LY8 A;  3MGP D;  3AZH A;  4H9N B;  1M19 B;  4R8P B;  4J8X A;  1U35 A;  3AZK B;  3MVD B;  1P3L B;  4H9S C;  4Z66 D;  4WU8 B;  3REL C;  5B2I C;  2W8S A;  4G92 B;  1TAF A;  1KX3 B;  4KGC A;  5AVC D;  1B6W A;  3AZJ B;  4YS3 C;  3AZN D;  2PYO A;  3AV2 B;  1N1J A;  1F66 D;  3MGS C;  3EPJ A;  4ZBJ B;  3KXB C;  2G5H C;  2J8P A;  3MGR D;  3W98 C;  4H9R B;  1P3I A;  5B40 B;  5AV6 A;  3AZH B;  3WKJ C;  2Y2K A;  5CPJ D;  4J8X B;  3FDD A;  4AWL C;  5CPI A;  1U35 B;  2VQR A;  4JJN D;  1ID3 A;  1TAF B;  4KGC B;  3REI C;  4HGA C;  5B1M D;  4XUJ C;  3MGP C;  1M18 D;  2PYO B;  2FFF B;  5BO0 B;  4ZUX D;  1N1J B;  4KUD A;  5E5A D;  5GSU A;  1R4V A;  3B6F C;  3UTB D;  3W96 D;  1P3I B;  5AV5 A;  3WAA A;  4XZQ A;  5AV6 B;  3O62 D;  3REJ A;  5CPI B;  3AV1 D;  5AVC C;  3W97 B;  3AZN C;  1Q9C A;  1F66 C;  5B24 D;  5B31 A;  3MGR C;  3X1V D;  4Z5T D;  3VH6 A; 
#chains in the Genus database with same CATH homology
 1JFI A;  4KUD B;  5DNN C;  4H9O B;  5F99 D;  5GSU B;  4H9S A;  2JSS A;  4JJN C;  5AV5 B;  3WAA B;  4XZQ B;  3REL A;  2IO5 C;  5B2I A;  2F8N H;  5CHL B;  2JCH A;  3LZ1 D;  3REJ B;  4YS3 A;  1M18 C;  4J8V C;  1AOI D;  2Y2P A;  3KXB A;  3W98 A;  5B31 B;  4WV4 B;  1S32 D;  1KX4 C;  5E5A C;  5GXQ D;  2XD5 A;  1Z2C B;  3A6N A;  3UTB C;  1ZLA D;  4WU9 B;  3WKJ A;  1JFI B;  3O62 C;  2Y2H A;  2CV5 D;  2RVQ D;  1P3G B;  3AV1 C;  5C3I B;  1TZY D;  5AV8 D;  3REL B;  5B2I B;  2ARO C;  5B24 C;  3X1V C;  3EG5 B;  3REI A;  4Z5T C;  4YS3 B;  4XUJ A;  3MGP A;  3VH6 W;  3UTA D;  3KXB B;  3W98 B;  5DNM D;  4E45 A;  5F99 C;  3KUY D;  3B6F A;  5B1L A;  3TU4 D;  4G91 C;  3A6N B;  3VH5 T;  2NQB D;  3AL0 C;  2ZY3 A;  3EPL A;  5JRG D;  4AWL B;  2BYM A;  3LZ1 C;  3R45 A;  5AVC A;  1A7W A;  3C1B D;  1P3B D;  5B0Y D;  1AOI C;  2F8N D;  1F66 A;  4UUZ B;  3MGR A;  2HIO D;  1S32 C;  2NZD D;  1P3P D;  5B31 G;  5B32 D;  4HGA B;  4XUJ B;  3MGP B;  4Z2M G;  5G49 A;  5DNN A;  2CV5 C;  2RVQ C;  1BFM A;  1KU5 A;  2DQN C;  3B6F B;  5B1L B;  4JJN A;  1TZY C;  3X1T D;  2BYM B;  3R45 B;  5AVC B;  4CAY A;  5B33 D;  1M18 A;  4J8V A;  3X1S A;  3UT9 D;  3H0M C;  1F66 B;  1B67 A;  3UTA C;  3MGR B;  1KX4 A;  5DNM C;  2NQB C;  4DQY B;  5G49 B;  3O62 A;  5DNN B;  3AV1 A;  3B6G D;  3REK C;  3X1U C;  1P3B C;  3AZM D;  5B0Y C;  3C1C A;  5BS7 C;  2IO5 B;  4M6B A;  3W99 C;  2ARO A;  5B24 A;  3AZE C;  3X1V A;  2HIO C;  1P3A C;  4Z5T A;  5AY8 D;  3MNN D;  5B32 C;  1P3P C;  4CAY B;  4KHA A;  1M18 B;  4J8V B;  5GT3 D;  3X1S B;  1P3M D;  5B2J D;  1KX4 B;  5F99 A;  5FUG A;  5CP6 B;  4E44 A;  4CSR A;  5BNV A;  3O62 B;  3LZ1 A;  3LEL A;  2Y2I A;  3MGQ D;  5B33 C;  1AOI A;  3B0B A;  3UT9 C;  1P3F D;  3C1C B;  2ARO B;  5B24 B;  3X1V B;  1S32 A;  4Z5T B;  3AYW C;  4KHA B;  1P3O D;  2JE5 A;  5F99 B;  4G91 B;  1TZY A;  3AZM C;  4CSR B;  5GT0 D;  5BNV B;  3LEL B;  3LZ1 B;  1EQZ D;  5AY8 C;  3H0R C;  4X23 D;  1P3M C;  4EO5 C;  4Z66 C;  3UTA A;  3LJA D;  5KDM A;  5DNM A;  4YM6 D;  2NQB A;  1P34 A;  1P3K D;  5CPK D;  3WTP D;  3REK A;  3X1U A;  3MGQ C;  1P3B A;  1ULY A;  1ID3 B;  5B0Y A;  1P3F C;  2Y2J A;  4QLC A;  3W99 A;  3AZE A;  4R8P D;  1P3A A;  1P3P A;  5JA4 A;  5B32 A;  5CPJ C;  3MVD D;  1P3L D;  2ZY4 A;  1P3O C;  3UTA B;  3AZL D;  5KDM B;  5DNM B;  1KX3 D;  2NQB B;  3AV2 D;  1P34 B;  5B1M C;  5GT0 C;  4ZUX C;  1WWI A;  3MGS A;  1EQZ C;  2ZY2 A;  5B33 A;  3X1U B;  3REK B;  1P3B B;  3UT9 A;  4QLC B;  3W96 C;  3W99 B;  3AZE B;  3LJA C;  4J8X D;  1P3A B;  2YFW A;  4YM6 C;  1P3P B;  5JA4 B;  5B32 B;  3AYW A;  1P3K C;  5BNX A;  2F8N K;  3WTP C;  4KGC D;  3AZM A;  3KWQ D;  2PYO D;  1KX5 D;  3WA9 D;  4WZS B;  4R8P C;  4DRA A;  3MGS B;  1BH8 A;  5AY8 A;  4WJ3 C;  3MVD C;  1P3M A;  1H3O A;  3UT9 B;  4Z66 A;  5AV6 D;  2YFV A;  3AZL C;  2Y2G A;  3WKJ B;  2YFW B;  3W97 D;  3AYW B;  3V9R A;  1T3U A;  2HUE C;  3AZN A;  5BNX B;  3B0C W;  3REH D;  3AZF D;  3MGQ A;  3AZM B;  1P3F A;  3REI B;  5GXQ C;  1ZLA C;  2F8N G;  4J8X C;  4KUD D;  1HQ3 D;  1BH8 B;  5CPJ A;  5AY8 B;  4DRB A;  5GSU D;  3LZ0 D;  5B32 G;  1H3O B;  4EO5 B;  5AV5 D;  4XZQ D;  3WAA D;  4Z66 B;  5AV8 C;  2YFV B;  5B0Z D;  4NE5 A;  3AZI D;  3VH6 T;  3KWQ C;  3V9R B;  2PYO C;  1M1A D;  5B1M A;  1KX5 C;  3AZN B;  3WA9 C;  4ZUX A;  1EQZ A;  3H0L C;  5B31 D;  3MGQ B;  3EPH A;  5E5A A;  1P3F B;  4WU9 D;  3KUY C;  3UTB A;  3W96 A;  3TU4 C;  3LJA A;  2RIQ A;  3B0C T;  5JRG C;  4YM6 A;  5CPJ B;  2Y2M A;  1P3G D;  3W97 C;  1P3K A;  3C1B C;  3REL D;  4JJN B;  3REH C;  2XD1 A;  3WTP A;  3AZF C;  3KSY A;  2NZD C;  1W2E A;  5B1M B;  4ZUX B;  3AZG D;  4KUD C;  3W98 D;  1EQZ B;  1HQ3 C;  2Y2N A;  3LZ0 C;  5E5A B;  3A6N D;  4J8W D;  3WAA C;  3UTB B;  3W96 B;  3KFU G;  3LJA B;  3AZL A;  5B0Z C;  4YM6 B;  3AZI C;  3X1T C;  3AN2 D;  2FJ7 D;  3AV1 B;  1P3K B;  1M1A C;  4XUJ D;  5GXQ A;  4WU9 C;  1ZLA A;  4WNN A;  2CV5 A;  1P3G C;  3B6F D;  5B1L D;  5C3I C;  3B6G C;  5FUG B;  5AV8 A;  3AZL B;  4LD9 D;  1F1E A;  3AFA D;  5AVB D;  3KWQ A;  3MNN C;  5BO0 A;  1KX5 A;  2HUE B;  3WA9 A;  5GT3 C;  1AOI B;  3AZG C;  2DF4 C;  5B2J C;  5BT1 D;  1S32 B;  3A1K A;  3A6N C;  4J8W C;  3KUY A;  5GXQ B;  3TU4 A;  1ZLA B;  4J8U D;  4WNN B;  5AV9 D;  3A1I A;  5JRG A;  5DNN D;  3AN2 C;  3W97 A;  2CV5 B;  2FJ7 C;  3C1B A;  3REH A;  2F8N A;  1TZY B;  5AV8 B;  3VH5 A;  5BS7 A;  3AZF A;  1M19 D;  2HIO A;  2NZD A;  3KWQ B;  3AZK D;  4J8V D;  3B0D C;  2ZY5 A;  3X1S D;  1KX5 B;  3WA9 B;  1PZR A;  1HQ3 A;  4WU8 D;  4H9O A;  1KX4 D;  4H9P A;  3LZ0 A;  5B1L C;  5CP6 D;  2L5A A;  3KUY B;  3TU4 B;  3AZJ D;  3NQJ A;  5B0Z A;  4LD9 C;  5JRG B;  3AZI A;  3AFA C;  3X1T A;  5AVB C;  1M1A A;  3C1B B;  3C1C D;  3REH B;  5B0Y B;  4X23 C;  2F8N B;  2Y2L A;  2ARO D;  5B40 D;  2BYK A;  5BT1 C;  2BG1 A;  3AZF B;  3AZH D;  2HIO B;  4NE6 A;  1U35 D;  2NZD B;  4WU9 A;  4J8U C;  5AV9 C;  1HQ3 B;  1P3G A;  5CPK C;  4H9P B;  3LZ0 B;  3B6G A;  2Y2Q A;  3NQJ B;  5B0Z B;  3LEL D;  3AZI B;  4Z2M H;  3X1T B;  1M19 C;  3VH5 W;  3MNN A;  3AZK C;  1M1A B;  5B33 B;  3X1S C;  5GT3 A;  1P3L C;  3AZG A;  1P3I D;  5B2J A;  4WU8 C;  2BYK B;  3P5J B;  4J8W A;  4G92 C;  5CPI D;  1KX3 C;  5CP6 C;  3AZJ C;  2F2A C;  3AV2 C;  4NFT A;  3AN2 A;  2FJ7 A;  4ZBJ C;  1ID3 D;  3B6G B;  3C1C C;  4UUZ A;  5B40 C;  3AZH C;  2G5I C;  1U35 C;  3NQU A;  3MNN B;  1BH9 A;  2Y2O A;  5GT3 B;  3AZG B;  2ZM5 A;  1P3M B;  5B2J B;  1P3O A;  4UPK A;  3F6T A;  4H9Q A;  4J8W B;  3REJ D;  4KGC C;  1P34 D;  4LD9 A;  3LEL C;  3AFA A;  5GT0 A;  5AVB A;  3AN2 B;  2FJ7 B;  3REK D;  3X1U D;  4X23 A;  3W99 D;  4QLC D;  2CWE A;  3AZE D;  3WTP E;  1P3I C;  1P3A D;  5AV6 C;  5CPI C;  3NQU B;  4J8U A;  3B0D B;  5AV9 A;  1BH9 B;  1P3O B;  3IP4 C;  5CPK A;  5B2I D;  4H9Q B;  1ID3 C;  4YS3 D;  4LD9 B;  4H9N A;  3AFA B;  3MGS D;  1WWS A;  4R8P A;  5GT0 B;  5AVB B;  1M19 A;  3KXB D;  3AZK A;  5GSU C;  3MVD A;  1P3L A;  4X23 B;  1HTA A;  5AV5 C;  4WU8 A;  4XZQ C;  3EPK A;  3WKJ D;  3AYW D;  5CP6 A;  3REJ C;  1KX3 A;  3AZJ A;  4J8U B;  1P34 C;  4NE3 A;  3AV2 A;  5AV9 B;  5CPK B;  5B31 C;  3WTP B;  2UWX A;  3REI D;  4H9R A;  4QLC C;  5B40 A;  2LY8 A;  3MGP D;  3AZH A;  4H9N B;  1M19 B;  4R8P B;  4J8X A;  1U35 A;  3AZK B;  3MVD B;  1P3L B;  4H9S C;  4Z66 D;  4WU8 B;  3REL C;  5B2I C;  2W8S A;  4G92 B;  1TAF A;  1KX3 B;  4KGC A;  5AVC D;  1B6W A;  3AZJ B;  4YS3 C;  3AZN D;  2PYO A;  3AV2 B;  1N1J A;  1F66 D;  3MGS C;  3EPJ A;  4ZBJ B;  3KXB C;  2G5H C;  2J8P A;  3MGR D;  3W98 C;  4H9R B;  1P3I A;  5B40 B;  5AV6 A;  3AZH B;  3WKJ C;  2Y2K A;  5CPJ D;  4J8X B;  3FDD A;  4AWL C;  5CPI A;  1U35 B;  2VQR A;  4JJN D;  1ID3 A;  1TAF B;  4KGC B;  3REI C;  4HGA C;  5B1M D;  4XUJ C;  3MGP C;  1M18 D;  2PYO B;  2FFF B;  5BO0 B;  4ZUX D;  1N1J B;  4KUD A;  5E5A D;  5GSU A;  1R4V A;  3B6F C;  3UTB D;  3W96 D;  1P3I B;  5AV5 A;  3WAA A;  4XZQ A;  5AV6 B;  3O62 D;  3REJ A;  5CPI B;  3AV1 D;  5AVC C;  3W97 B;  3AZN C;  1Q9C A;  1F66 C;  5B24 D;  5B31 A;  3MGR C;  3X1V D;  4Z5T D;  3VH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...