4EOIB

Thr 160 phosphorylated cdk2 k89d, q131e - human cyclin a3 complex with the inhibitor ro3306
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
258
structure length
258
Chain Sequence
b'VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 2
publication title An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 98
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4eoiB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4eoiB02
1H1PB 1H1RB 2WEVB 3TNWB 1OL1B 4UN0A 2UUEB 2PMIB 2WXVB 2R7GA 5HBHB 2JGZB 2PHGA 1GUXB 2IW9B 4F7JB 2C5VB 5HVYB 2WMAB 5CYIB 4EOLB 4EC9B 5CEIB 3H4CA 4EORB 4TTHA 3TNIB 4BCQD 4CFUD 1G3NC 1VOLA 1C9BA 3EOCB 5FGKB 4OGRB 4ROEA 2C5OB 2W99A 4BCIB 1P5EB 4CFVB 4BCQB 2I40B 4BCND 1KXUA 1GH6B 3MY1B 4OR5B 2WFYB 4F7SB 2I53A 2WHBB 1H28B 1JOWA 1W98B 4YOZA 3TN8B 4ROCA 2WPAB 3POMA 4CXAB 1AISB 4YC3B 4BCNB 3O0GD 1OKWB 2QDJA 2WIPB 3LQ5B 4BCKB 4EOIB 1F5QB 1VINA 4II5B 1JSUB 5HBEB 4CFWB 2C5NB 1ZP2A 3BLHB 1O9KA 2PK9B 2V22B 4F7LB 2X1NB 1N4MA 3QHRB 4Y72B 1H4LD 2UZEB 5I5ZB 3DOGB 2B9RA 4KRDB 1VYWB 2W2HA 2IVXA 1OKVB 5HBJB 4F6WB 3MI9B 4BCOB 4I3ZB 4CFNB 2F2CA 4EOMB 3F5XB 2G9XB 1UNLD 1OGUB 4BCJB 4F70B 1OIYB 2CJMB 4EONB 4IMYB 1H24B 5EFQB 2UZDB 3K7AM 2UZLB 4KRCB 5ICPB 4CFMB 4F7NB 5ACBA 4CFXB 3BHTB 4EOKB 1BU2A 3M03A 1URCB 4EOPB 1OI9B 1PKDB 1AD6A 2BKZB 2C4GB 4EOJB 5HNBB 2EUFA 3RGFB 5LMKB 3DDQB 4EC8B 1GY3B 3TNHB 3MY5B 4ELJA 2IW8B 1OL2B 4G6LB 1TFBA 5IDPB 4BCMD 3BLRB 3EIDB 2WIHB 4YOSA 2PK2A 1XO2A 2BPMB 5LQFB 2IW6B 4BCMB 5HQ0B 2WMBB 4BCHB 4EOSB 2C6TB 3G33B 4EOQB 5BNJB 1GUXA 1JKWA 2UZBB 2W96A 4F6UB 1OIUB 2W9FA 1H25B 3BHUB 5L2WB 1E9HB 1H27B 4BCGB 1QMZB 1UNHD 1O9KB 1H1SB 1FINB 2W9ZA 4ELLA 3DDPB 4BCFB 3QHWB 4NSTB 2CCIB 5IDNB 4YOOA 4CFUB 4RODA 3EJ1B 3BLQB 1JSTB 1FVVB 4CRLB 1UNGD 3BHVB 4BCPB 1H1QB 3MIAB 4EOOB 4FX3B 5IF1B 1H26B 2C5XB 4F6SB 2CCHB 1D3UB
chains in the Genus database with same CATH superfamily
1OL1B 2WXVB 1GUXB 5HVYB 3HZJA 2WMAB 4EOLB 5CEIB 4AKGA 1VOLA 2DMEA 3B57A 2WFYB 2W2HA 4HNUA 2WPAB 3POMA 4BCNB 4CFWB 3BLHB 4F7LB 5I5ZB 1N4MA 3DOGB 3WVDB 4MFDA 2D0QB 4I3ZB 4CFNB 4EOMB 2WJ9A 1H24B 4AI6A 2UZDB 3K7AM 3DL1A 4HNVA 5ACBA 4ZGJB 4HL4A 1PKDB 4M6VA 1E7PA 3QYBA 2BKZB 2EUFA 3RGFB 1GY3B 2BS4A 3TNHB 1OL2B 4G6LB 4BCMD 4OB1B 4QSHA 2QDYB 4BBSM 1QLBA 1H27B 1UNHD 1O9KB 3DDPB 4NSTB 3GTMS 4CFUB 4MFEA 3BLQB 1JSTB 4BY1X 2QGSA 5IF1B 1H26B 2C5XB 4F6SB 2CCHB 1D3UB 4JX6A 2QQ8A 2WEVB 3PO3S 2PMIB 2JGZB 2PHGA 2ZPBB 4F7JB 2C5VB 5CYIB 4EC9B 4EORB 4TTHA 3TNIB 2CZ7B 3EOCB 4BCIB 4BCQB 3KHIA 4BCND 4ROCA 3NDQA 5IHYA 3HB9A 3QWLA 1OKWB 3X28B 1VINA 2CZ6B 1ZP2A 2PK9B 2V22B 4BBRM 5DQVA 2IN3A 4AKHA 2F2CA 2G9XB 4F70B 1OIYB 3QXEB 2UZLB 2KR6A 3HO8A 4BY7X 1BU2A 1URCB 3WVEB 4EC8B 1TFBA 2KMGA 2IW6B 5HQ0B 2AHJB 3QYEA 4BCHB 5BNJB 1JKWA 2BS3A 4Z6YA 1E9HB 1QMZB 1H1SB 1FINB 1UGPB 4JX5A 1UGSB 4BCFB 2CZ1B 5IDNB 4MIMA 2QF7A 2QFZA 3BHVB 4BCPB 3QYHB 4EOOB 3A8MB 1H1PB 1H1RB 5EJCA 1FKMA 3QZ9B 1V29B 1UGRB 2DD5B 4BCQD 2W99A 4CFVB 2CYZB 3A8OB 1GH6B 3MY1B 2I53A 2WHBB 1H28B 1JOWA 3A8LB 4YOZA 3TN8B 4CXAB 4NC6A 3O0GD 2QDJA 2WIPB 1F5QB 2ZCFB 5HBEB 3DTOA 2ZPHB 1O9KA 4AKIA 2LW4A 3QHRB 4Y72B 2B9RA 4OB2B 1OKVB 4F6WB 3MI9B 4BXXX 4JX4A 1UNLD 1OGUB 3QYGB 4EONB 5EFQB 4CFMB 4CFXB 3BHTB 4HNTA 3M03A 5LMKB 4EOJB 3A8GB 3BLRB 3VKHA 2DD4B 2WIHB 5DQWA 2BPMB 4EOSB 2C6TB 3G33B 4EOQB 1GUXA 2UZBB 2W96A 4ZGDB 1H25B 5L2WB 4FM4B 2G77A 3BG3A 4ELLA 3BG9A 2ZPFB 3QHWB 2DXBB 4CRLB 4ZGEB 3MIAB 4FX3B 3TNWB 4UN0A 2UUEB 4LOCA 3VYGB 2R7GA 5HBHB 2IW9B 3H4CA 1UGQB 3X26B 1AHJB 4CFUD 1G3NC 1C9BA 5FGKB 4OGRB 4ROEA 2C5OB 1P5EB 2I40B 1KXUA 4OB0B 1TD6A 2CZ0B 4OR5B 4F7SB 1W98B 1AISB 4YC3B 4EOIB 4BCKB 3LQ5B 3X25B 3QZ5B 4II5B 1JSUB 3DJBA 3X24B 2C5NB 3X20B 2X1NB 1H4LD 2UZEB 4KRDB 1VYWB 2IVXA 2PJQA 5HBJB 4BCOB 3HHTB 3F5XB 3TW7A 4BCJB 2CJMB 4IMYB 3BG5A 4KRCB 5ICPB 4OB3B 4F7NB 3A8HB 4EOKB 2ZPIB 2ZPEB 4EOPB 1OI9B 1AD6A 2C4GB 2BS2A 2ZPGB 4HLQA 5HNBB 3DDQB 2DXCB 3MY5B 4ELJA 2IW8B 1IREB 5IDPB 3EIDB 1ENWA 4YOSA 2PK2A 2ZZDB 1XO2A 5LQFB 3VYHB 4BCMB 3TW6A 2WMBB 4F6UB 1OIUB 2W9FA 3BHUB 3HBLA 4BCGB 2W9ZA 2DPPB 2CCIB 4YOOA 4RODA 3EJ1B 3VKGA 1FVVB 1UNGD 1H1QB
chains in the Genus database with same CATH topology
1H1PB 1H1RB 2WEVB 3TNWB 1OL1B 4UN0A 2UUEB 2PMIB 2WXVB 2R7GA 5HBHB 2JGZB 2PHGA 1GUXB 2IW9B 4F7JB 2C5VB 5HVYB 2WMAB 5CYIB 4EOLB 4EC9B 5CEIB 3H4CA 4EORB 4TTHA 3TNIB 4BCQD 4CFUD 1G3NC 1VOLA 1C9BA 3EOCB 5FGKB 4OGRB 4ROEA 2C5OB 2W99A 4BCIB 1P5EB 4CFVB 4BCQB 2I40B 4BCND 1KXUA 1GH6B 3MY1B 4OR5B 2WFYB 4F7SB 2I53A 2WHBB 1H28B 1JOWA 1W98B 4YOZA 3TN8B 4ROCA 2WPAB 3POMA 4CXAB 1AISB 4YC3B 4BCNB 3O0GD 1OKWB 2QDJA 2WIPB 3LQ5B 4BCKB 4EOIB 1F5QB 1VINA 4II5B 1JSUB 5HBEB 4CFWB 2C5NB 1ZP2A 3BLHB 1O9KA 2PK9B 2V22B 4F7LB 2X1NB 1N4MA 3QHRB 4Y72B 1H4LD 2UZEB 5I5ZB 3DOGB 2B9RA 4KRDB 1VYWB 2W2HA 2IVXA 1OKVB 5HBJB 4F6WB 3MI9B 4BCOB 4I3ZB 4CFNB 2F2CA 4EOMB 3F5XB 2G9XB 1UNLD 1OGUB 4BCJB 4F70B 1OIYB 2CJMB 4EONB 4IMYB 1H24B 5EFQB 2UZDB 3K7AM 2UZLB 4KRCB 5ICPB 4CFMB 4F7NB 5ACBA 4CFXB 3BHTB 4EOKB 1BU2A 3M03A 1URCB 4EOPB 1OI9B 1PKDB 1AD6A 2BKZB 2C4GB 4EOJB 5HNBB 2EUFA 3RGFB 5LMKB 3DDQB 4EC8B 1GY3B 3TNHB 3MY5B 4ELJA 2IW8B 1OL2B 4G6LB 1TFBA 5IDPB 4BCMD 3BLRB 3EIDB 2WIHB 4YOSA 2PK2A 1XO2A 2BPMB 5LQFB 2IW6B 4BCMB 5HQ0B 2WMBB 4BCHB 4EOSB 2C6TB 3G33B 4EOQB 5BNJB 1GUXA 1JKWA 2UZBB 2W96A 4F6UB 1OIUB 2W9FA 1H25B 3BHUB 5L2WB 1E9HB 1H27B 4BCGB 1QMZB 1UNHD 1O9KB 1H1SB 1FINB 2W9ZA 4ELLA 3DDPB 4BCFB 3QHWB 4NSTB 2CCIB 5IDNB 4YOOA 4CFUB 4RODA 3EJ1B 3BLQB 1JSTB 1FVVB 4CRLB 1UNGD 3BHVB 4BCPB 1H1QB 3MIAB 4EOOB 4FX3B 5IF1B 1H26B 2C5XB 4F6SB 2CCHB 1D3UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H1P B;  1H1R B;  2WEV B;  3TNW B;  1OL1 B;  4UN0 A;  2UUE B;  2PMI B;  2WXV B;  2R7G A;  5HBH B;  2JGZ B;  2PHG A;  1GUX B;  2IW9 B;  4F7J B;  2C5V B;  5HVY B;  2WMA B;  5CYI B;  4EOL B;  4EC9 B;  5CEI B;  3H4C A;  4EOR B;  4TTH A;  3TNI B;  4BCQ D;  4CFU D;  1G3N C;  1VOL A;  1C9B A;  3EOC B;  5FGK B;  4OGR B;  4ROE A;  2C5O B;  2W99 A;  4BCI B;  1P5E B;  4CFV B;  4BCQ B;  2I40 B;  4BCN D;  1KXU A;  1GH6 B;  3MY1 B;  4OR5 B;  2WFY B;  4F7S B;  2I53 A;  2WHB B;  1H28 B;  1JOW A;  1W98 B;  4YOZ A;  3TN8 B;  4ROC A;  2WPA B;  3POM A;  4CXA B;  1AIS B;  4YC3 B;  4BCN B;  3O0G D;  1OKW B;  2QDJ A;  2WIP B;  3LQ5 B;  4BCK B;  4EOI B;  1F5Q B;  1VIN A;  4II5 B;  1JSU B;  5HBE B;  4CFW B;  2C5N B;  1ZP2 A;  3BLH B;  1O9K A;  2PK9 B;  2V22 B;  4F7L B;  2X1N B;  1N4M A;  3QHR B;  4Y72 B;  1H4L D;  2UZE B;  5I5Z B;  3DOG B;  2B9R A;  4KRD B;  1VYW B;  2W2H A;  2IVX A;  1OKV B;  5HBJ B;  4F6W B;  3MI9 B;  4BCO B;  4I3Z B;  4CFN B;  2F2C A;  4EOM B;  3F5X B;  2G9X B;  1UNL D;  1OGU B;  4BCJ B;  4F70 B;  1OIY B;  2CJM B;  4EON B;  4IMY B;  1H24 B;  5EFQ B;  2UZD B;  3K7A M;  2UZL B;  4KRC B;  5ICP B;  4CFM B;  4F7N B;  5ACB A;  4CFX B;  3BHT B;  4EOK B;  1BU2 A;  3M03 A;  1URC B;  4EOP B;  1OI9 B;  1PKD B;  1AD6 A;  2BKZ B;  2C4G B;  4EOJ B;  5HNB B;  2EUF A;  3RGF B;  5LMK B;  3DDQ B;  4EC8 B;  1GY3 B;  3TNH B;  3MY5 B;  4ELJ A;  2IW8 B;  1OL2 B;  4G6L B;  1TFB A;  5IDP B;  4BCM D;  3BLR B;  3EID B;  2WIH B;  4YOS A;  2PK2 A;  1XO2 A;  2BPM B;  5LQF B;  2IW6 B;  4BCM B;  5HQ0 B;  2WMB B;  4BCH B;  4EOS B;  2C6T B;  3G33 B;  4EOQ B;  5BNJ B;  1GUX A;  1JKW A;  2UZB B;  2W96 A;  4F6U B;  1OIU B;  2W9F A;  1H25 B;  3BHU B;  5L2W B;  1E9H B;  1H27 B;  4BCG B;  1QMZ B;  1UNH D;  1O9K B;  1H1S B;  1FIN B;  2W9Z A;  4ELL A;  3DDP B;  4BCF B;  3QHW B;  4NST B;  2CCI B;  5IDN B;  4YOO A;  4CFU B;  4ROD A;  3EJ1 B;  3BLQ B;  1JST B;  1FVV B;  4CRL B;  1UNG D;  3BHV B;  4BCP B;  1H1Q B;  3MIA B;  4EOO B;  4FX3 B;  5IF1 B;  1H26 B;  2C5X B;  4F6S B;  2CCH B;  1D3U B; 
#chains in the Genus database with same CATH topology
 1OL1 B;  2WXV B;  1GUX B;  5HVY B;  3HZJ A;  2WMA B;  4EOL B;  5CEI B;  4AKG A;  1VOL A;  2DME A;  3B57 A;  2WFY B;  2W2H A;  4HNU A;  2WPA B;  3POM A;  4BCN B;  4CFW B;  3BLH B;  4F7L B;  5I5Z B;  1N4M A;  3DOG B;  3WVD B;  4MFD A;  2D0Q B;  4I3Z B;  4CFN B;  4EOM B;  2WJ9 A;  1H24 B;  4AI6 A;  2UZD B;  3K7A M;  3DL1 A;  4HNV A;  5ACB A;  4ZGJ B;  4HL4 A;  1PKD B;  4M6V A;  1E7P A;  3QYB A;  2BKZ B;  2EUF A;  3RGF B;  1GY3 B;  2BS4 A;  3TNH B;  1OL2 B;  4G6L B;  4BCM D;  4OB1 B;  4QSH A;  2QDY B;  4BBS M;  1QLB A;  1H27 B;  1UNH D;  1O9K B;  3DDP B;  4NST B;  3GTM S;  4CFU B;  4MFE A;  3BLQ B;  1JST B;  4BY1 X;  2QGS A;  5IF1 B;  1H26 B;  2C5X B;  4F6S B;  2CCH B;  1D3U B;  4JX6 A;  2QQ8 A;  2WEV B;  3PO3 S;  2PMI B;  2JGZ B;  2PHG A;  2ZPB B;  4F7J B;  2C5V B;  5CYI B;  4EC9 B;  4EOR B;  4TTH A;  3TNI B;  2CZ7 B;  3EOC B;  4BCI B;  4BCQ B;  3KHI A;  4BCN D;  4ROC A;  3NDQ A;  5IHY A;  3HB9 A;  3QWL A;  1OKW B;  3X28 B;  1VIN A;  2CZ6 B;  1ZP2 A;  2PK9 B;  2V22 B;  4BBR M;  5DQV A;  2IN3 A;  4AKH A;  2F2C A;  2G9X B;  4F70 B;  1OIY B;  3QXE B;  2UZL B;  2KR6 A;  3HO8 A;  4BY7 X;  1BU2 A;  1URC B;  3WVE B;  4EC8 B;  1TFB A;  2KMG A;  2IW6 B;  5HQ0 B;  2AHJ B;  3QYE A;  4BCH B;  5BNJ B;  1JKW A;  2BS3 A;  4Z6Y A;  1E9H B;  1QMZ B;  1H1S B;  1FIN B;  1UGP B;  4JX5 A;  1UGS B;  4BCF B;  2CZ1 B;  5IDN B;  4MIM A;  2QF7 A;  2QFZ A;  3BHV B;  4BCP B;  3QYH B;  4EOO B;  3A8M B;  1H1P B;  1H1R B;  5EJC A;  1FKM A;  3QZ9 B;  1V29 B;  1UGR B;  2DD5 B;  4BCQ D;  2W99 A;  4CFV B;  2CYZ B;  3A8O B;  1GH6 B;  3MY1 B;  2I53 A;  2WHB B;  1H28 B;  1JOW A;  3A8L B;  4YOZ A;  3TN8 B;  4CXA B;  4NC6 A;  3O0G D;  2QDJ A;  2WIP B;  1F5Q B;  2ZCF B;  5HBE B;  3DTO A;  2ZPH B;  1O9K A;  4AKI A;  2LW4 A;  3QHR B;  4Y72 B;  2B9R A;  4OB2 B;  1OKV B;  4F6W B;  3MI9 B;  4BXX X;  4JX4 A;  1UNL D;  1OGU B;  3QYG B;  4EON B;  5EFQ B;  4CFM B;  4CFX B;  3BHT B;  4HNT A;  3M03 A;  5LMK B;  4EOJ B;  3A8G B;  3BLR B;  3VKH A;  2DD4 B;  2WIH B;  5DQW A;  2BPM B;  4EOS B;  2C6T B;  3G33 B;  4EOQ B;  1GUX A;  2UZB B;  2W96 A;  4ZGD B;  1H25 B;  5L2W B;  4FM4 B;  2G77 A;  3BG3 A;  4ELL A;  3BG9 A;  2ZPF B;  3QHW B;  2DXB B;  4CRL B;  4ZGE B;  3MIA B;  4FX3 B;  3TNW B;  4UN0 A;  2UUE B;  4LOC A;  3VYG B;  2R7G A;  5HBH B;  2IW9 B;  3H4C A;  1UGQ B;  3X26 B;  1AHJ B;  4CFU D;  1G3N C;  1C9B A;  5FGK B;  4OGR B;  4ROE A;  2C5O B;  1P5E B;  2I40 B;  1KXU A;  4OB0 B;  1TD6 A;  2CZ0 B;  4OR5 B;  4F7S B;  1W98 B;  1AIS B;  4YC3 B;  4EOI B;  4BCK B;  3LQ5 B;  3X25 B;  3QZ5 B;  4II5 B;  1JSU B;  3DJB A;  3X24 B;  2C5N B;  3X20 B;  2X1N B;  1H4L D;  2UZE B;  4KRD B;  1VYW B;  2IVX A;  2PJQ A;  5HBJ B;  4BCO B;  3HHT B;  3F5X B;  3TW7 A;  4BCJ B;  2CJM B;  4IMY B;  3BG5 A;  4KRC B;  5ICP B;  4OB3 B;  4F7N B;  3A8H B;  4EOK B;  2ZPI B;  2ZPE B;  4EOP B;  1OI9 B;  1AD6 A;  2C4G B;  2BS2 A;  2ZPG B;  4HLQ A;  5HNB B;  3DDQ B;  2DXC B;  3MY5 B;  4ELJ A;  2IW8 B;  1IRE B;  5IDP B;  3EID B;  1ENW A;  4YOS A;  2PK2 A;  2ZZD B;  1XO2 A;  5LQF B;  3VYH B;  4BCM B;  3TW6 A;  2WMB B;  4F6U B;  1OIU B;  2W9F A;  3BHU B;  3HBL A;  4BCG B;  2W9Z A;  2DPP B;  2CCI B;  4YOO A;  4ROD A;  3EJ1 B;  3VKG A;  1FVV B;  1UNG D;  1H1Q B; 
#chains in the Genus database with same CATH homology
 1H1P B;  1H1R B;  2WEV B;  3TNW B;  1OL1 B;  4UN0 A;  2UUE B;  2PMI B;  2WXV B;  2R7G A;  5HBH B;  2JGZ B;  2PHG A;  1GUX B;  2IW9 B;  4F7J B;  2C5V B;  5HVY B;  2WMA B;  5CYI B;  4EOL B;  4EC9 B;  5CEI B;  3H4C A;  4EOR B;  4TTH A;  3TNI B;  4BCQ D;  4CFU D;  1G3N C;  1VOL A;  1C9B A;  3EOC B;  5FGK B;  4OGR B;  4ROE A;  2C5O B;  2W99 A;  4BCI B;  1P5E B;  4CFV B;  4BCQ B;  2I40 B;  4BCN D;  1KXU A;  1GH6 B;  3MY1 B;  4OR5 B;  2WFY B;  4F7S B;  2I53 A;  2WHB B;  1H28 B;  1JOW A;  1W98 B;  4YOZ A;  3TN8 B;  4ROC A;  2WPA B;  3POM A;  4CXA B;  1AIS B;  4YC3 B;  4BCN B;  3O0G D;  1OKW B;  2QDJ A;  2WIP B;  3LQ5 B;  4BCK B;  4EOI B;  1F5Q B;  1VIN A;  4II5 B;  1JSU B;  5HBE B;  4CFW B;  2C5N B;  1ZP2 A;  3BLH B;  1O9K A;  2PK9 B;  2V22 B;  4F7L B;  2X1N B;  1N4M A;  3QHR B;  4Y72 B;  1H4L D;  2UZE B;  5I5Z B;  3DOG B;  2B9R A;  4KRD B;  1VYW B;  2W2H A;  2IVX A;  1OKV B;  5HBJ B;  4F6W B;  3MI9 B;  4BCO B;  4I3Z B;  4CFN B;  2F2C A;  4EOM B;  3F5X B;  2G9X B;  1UNL D;  1OGU B;  4BCJ B;  4F70 B;  1OIY B;  2CJM B;  4EON B;  4IMY B;  1H24 B;  5EFQ B;  2UZD B;  3K7A M;  2UZL B;  4KRC B;  5ICP B;  4CFM B;  4F7N B;  5ACB A;  4CFX B;  3BHT B;  4EOK B;  1BU2 A;  3M03 A;  1URC B;  4EOP B;  1OI9 B;  1PKD B;  1AD6 A;  2BKZ B;  2C4G B;  4EOJ B;  5HNB B;  2EUF A;  3RGF B;  5LMK B;  3DDQ B;  4EC8 B;  1GY3 B;  3TNH B;  3MY5 B;  4ELJ A;  2IW8 B;  1OL2 B;  4G6L B;  1TFB A;  5IDP B;  4BCM D;  3BLR B;  3EID B;  2WIH B;  4YOS A;  2PK2 A;  1XO2 A;  2BPM B;  5LQF B;  2IW6 B;  4BCM B;  5HQ0 B;  2WMB B;  4BCH B;  4EOS B;  2C6T B;  3G33 B;  4EOQ B;  5BNJ B;  1GUX A;  1JKW A;  2UZB B;  2W96 A;  4F6U B;  1OIU B;  2W9F A;  1H25 B;  3BHU B;  5L2W B;  1E9H B;  1H27 B;  4BCG B;  1QMZ B;  1UNH D;  1O9K B;  1H1S B;  1FIN B;  2W9Z A;  4ELL A;  3DDP B;  4BCF B;  3QHW B;  4NST B;  2CCI B;  5IDN B;  4YOO A;  4CFU B;  4ROD A;  3EJ1 B;  3BLQ B;  1JST B;  1FVV B;  4CRL B;  1UNG D;  3BHV B;  4BCP B;  1H1Q B;  3MIA B;  4EOO B;  4FX3 B;  5IF1 B;  1H26 B;  2C5X B;  4F6S B;  2CCH B;  1D3U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...