4EORB

Thr 160 phosphorylated cdk2 wt - human cyclin a3 complex with the inhibitor nu6102
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
257
structure length
257
Chain Sequence
b'PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 2
publication title An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 96
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4eorB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4eorB02
2WXVB 1BU2A 3MY5B 1UNHD 5HBJB 5HVYB 4EOSB 5IDPB 3QHWB 4KRCB 2WMBB 4F6WB 1OKVB 1VINA 4EOKB 1JSTB 2B9RA 3BHVB 2IW6B 3EJ1B 4F6SB 2V22B 1OI9B 4FX3B 1FVVB 2PMIB 2QDJA 4UN0A 2PK2A 3F5XB 4BCGB 1GH6B 4EOLB 2BPMB 4ROEA 4F6UB 2R7GA 3TNHB 4YOZA 3MIAB 1AISB 1JKWA 1OIYB 5HNBB 2BKZB 4EC8B 5LMKB 5LQFB 4CFVB 2I53A 5EFQB 1FINB 1ZP2A 1JOWA 4BCMD 2W9ZA 5CYIB 1N4MA 5IF1B 1E9HB 4NSTB 4BCMB 3BLRB 2UZDB 3TNIB 1H4LD 1UNLD 1W98B 4EOOB 3BHTB 2C5VB 4CFXB 1TFBA 4YC3B 1KXUA 5HQ0B 2UUEB 4EOJB 4F7SB 3QHRB 2C5XB 4CFUD 1OGUB 1URCB 5HBEB 5L2WB 4EC9B 4KRDB 4CXAB 1G3NC 2X1NB 5CEIB 4CFUB 1H28B 1OKWB 3BHUB 2IW9B 4BCND 3TN8B 4BCPB 3MY1B 1P5EB 3BLHB 4OR5B 4BCNB 2CJMB 2I40B 2WPAB 2F2CA 3K7AM 2CCIB 3BLQB 4EONB 4ELLA 1H24B 5I5ZB 2WMAB 4ROCA 1H1QB 4TTHA 3TNWB 3LQ5B 4RODA 4F7JB 2WEVB 3DOGB 4G6LB 2W9FA 2W96A 4CFMB 2WIPB 1H27B 4F7LB 2WHBB 3RGFB 4EOQB 4CFWB 3MI9B 5FGKB 1OL2B 3POMA 2IVXA 4II5B 1H1SB 1O9KA 4EOIB 3EIDB 2EUFA 1H1PB 1H1RB 4BCKB 1AD6A 1UNGD 4YOOA 4BCFB 4CFNB 1JSUB 5ACBA 2W2HA 4IMYB 2W99A 4EORB 2G9XB 4Y72B 1C9BA 1XO2A 1GUXA 1OIUB 2WFYB 2C5NB 2PHGA 2CCHB 2JGZB 1GY3B 1H25B 4BCHB 3M03A 3H4CA 3O0GD 4YOSA 5IDNB 4EOMB 2UZEB 4ELJA 1QMZB 3DDPB 2C5OB 1O9KB 4I3ZB 4BCQD 5HBHB 3EOCB 4BCQB 1VOLA 2WIHB 2UZBB 4EOPB 2PK9B 2C4GB 4BCOB 4BCJB 2C6TB 1VYWB 3DDQB 5BNJB 4OGRB 1D3UB 1H26B 4CRLB 2IW8B 4F7NB 1F5QB 5ICPB 2UZLB 1GUXB 3G33B 4BCIB 4F70B 1OL1B 1PKDB
chains in the Genus database with same CATH superfamily
3MY5B 4EOSB 1VINA 2B9RA 4BCGB 2QGSA 3HB9A 2BPMB 4F6UB 1AISB 5LQFB 5EFQB 2CYZB 2UZDB 2ZCFB 3DJBA 1E7PA 2CZ0B 4YC3B 4ZGDB 4F7SB 3QHRB 2C5XB 2DXBB 5HBEB 5L2WB 1G3NC 2X1NB 4CFUB 2IW9B 3BLHB 3QYHB 4OR5B 4QSHA 1H24B 4ROCA 2KR6A 3TNWB 2WEVB 3GTMS 1H27B 4F7LB 2WHBB 3RGFB 3X28B 4EOQB 4CFWB 4OB2B 4MFDA 4II5B 3NDQA 4EOIB 4HNVA 1H1PB 1H1RB 5IHYA 1AD6A 2QFZA 1ENWA 4CFNB 1JSUB 3HO8A 2DXCB 3QZ5B 4HNTA 4AKIA 2DD4B 1GY3B 4BCHB 4EOMB 2UZEB 4ELJA 2C5OB 3EOCB 4BCQB 1VOLA 2BS4A 2UZBB 4BCJB 3VKGA 3DDQB 5ICPB 4BY7X 2D0QB 3VYGB 1PKDB 2WXVB 5HBJB 5HVYB 5IDPB 3QHWB 3TW7A 4F6WB 1OKVB 4BBRM 4EOKB 3DL1A 3BHVB 2IW6B 2V22B 1UGRB 2QDJA 4UN0A 1GH6B 2KMGA 4EOLB 1OIYB 5HNBB 2BKZB 4CFVB 1FINB 1ZP2A 5CYIB 1N4MA 5IF1B 4BCMB 3BLRB 4BXXX 1H4LD 4HLQA 3X25B 2UUEB 3B57A 3HZJA 2ZPFB 3A8MB 4EC9B 5CEIB 5EJCA 4BCNB 1AHJB 2F2CA 3K7AM 2CCIB 3BLQB 3A8OB 3QYEA 3QXEB 4AKHA 2AHJB 4G6LB 4OB0B 2DD5B 3EIDB 2EUFA 4ZGEB 4BCKB 4YOOA 4BCFB 5ACBA 2W2HA 2ZZDB 4EORB 2G9XB 3QWLA 2ZPIB 3WVEB 2PHGA 1TD6A 2JGZB 1H25B 2ZPHB 3M03A 4ZGJB 1QLBA 4M6VA 4JX4A 2WIHB 2DPPB 2C6TB 4CRLB 2BS3A 1F5QB 2ZPGB 4KRCB 1JSTB 3EJ1B 4F6SB 2QQ8A 1OI9B 4FX3B 1FVVB 1UGPB 1UGQB 2PK2A 3F5XB 4LOCA 4ROEA 2R7GA 4NC6A 1FKMA 4EC8B 2IN3A 2I53A 2W9ZA 4MIMA 1E9HB 4NSTB 2WJ9A 3VYHB 3X20B 4AKGA 3QYGB 3BHTB 4EOOB 3QZ9B 4CFXB 5HQ0B 4EOJB 4CFUD 1URCB 4KRDB 4CXAB 1H28B 1OKWB 3TN8B 4BCPB 3MY1B 2CJMB 2I40B 4EONB 2WMAB 4MFEA 4TTHA 3PO3S 3DOGB 1UGSB 2W96A 3MI9B 5FGKB 3POMA 2IVXA 1O9KA 3VKHA 1UNGD 3HHTB 4Y72B 2LW4A 4Z6YA 1XO2A 1GUXA 1OIUB 2C5NB 1QMZB 3HBLA 4I3ZB 4BCQD 5HBHB 2ZPBB 2PK9B 4BCOB 1VYWB 5BNJB 5DQWA 2IW8B 4F7NB 2UZLB 1BU2A 1UNHD 4HNUA 2WMBB 2PMIB 1IREB 3TNHB 4YOZA 3MIAB 1JKWA 5LMKB 1JOWA 4BCMD 3BG5A 3QYBA 3TNIB 2DMEA 1UNLD 1W98B 4FM4B 2C5VB 2QDYB 1TFBA 1KXUA 3A8HB 1OGUB 3TW6A 3WVDB 4BBSM 3BHUB 4BCND 3X24B 1P5EB 2WPAB 4ELLA 5I5ZB 1H1QB 3LQ5B 4RODA 4F7JB 2W9FA 4CFMB 2WIPB 2CZ6B 3BG3A 1OL2B 3X26B 1H1SB 1V29B 4JX6A 2BS2A 2CZ7B 2PJQA 4IMYB 2W99A 4HL4A 1C9BA 3A8GB 2WFYB 2CCHB 3BG9A 3H4CA 3O0GD 4YOSA 5IDNB 5DQVA 3DDPB 4AI6A 1O9KB 2ZPEB 4BY1X 3A8LB 4EOPB 2C4GB 3KHIA 4OGRB 1D3UB 1H26B 2G77A 3DTOA 4OB1B 2QF7A 4JX5A 1GUXB 3G33B 4OB3B 2CZ1B 4BCIB 4F70B 1OL1B
chains in the Genus database with same CATH topology
2WXVB 1BU2A 3MY5B 1UNHD 5HBJB 5HVYB 4EOSB 5IDPB 3QHWB 4KRCB 2WMBB 4F6WB 1OKVB 1VINA 4EOKB 1JSTB 2B9RA 3BHVB 2IW6B 3EJ1B 4F6SB 2V22B 1OI9B 4FX3B 1FVVB 2PMIB 2QDJA 4UN0A 2PK2A 3F5XB 4BCGB 1GH6B 4EOLB 2BPMB 4ROEA 4F6UB 2R7GA 3TNHB 4YOZA 3MIAB 1AISB 1JKWA 1OIYB 5HNBB 2BKZB 4EC8B 5LMKB 5LQFB 4CFVB 2I53A 5EFQB 1FINB 1ZP2A 1JOWA 4BCMD 2W9ZA 5CYIB 1N4MA 5IF1B 1E9HB 4NSTB 4BCMB 3BLRB 2UZDB 3TNIB 1H4LD 1UNLD 1W98B 4EOOB 3BHTB 2C5VB 4CFXB 1TFBA 4YC3B 1KXUA 5HQ0B 2UUEB 4EOJB 4F7SB 3QHRB 2C5XB 4CFUD 1OGUB 1URCB 5HBEB 5L2WB 4EC9B 4KRDB 4CXAB 1G3NC 2X1NB 5CEIB 4CFUB 1H28B 1OKWB 3BHUB 2IW9B 4BCND 3TN8B 4BCPB 3MY1B 1P5EB 3BLHB 4OR5B 4BCNB 2CJMB 2I40B 2WPAB 2F2CA 3K7AM 2CCIB 3BLQB 4EONB 4ELLA 1H24B 5I5ZB 2WMAB 4ROCA 1H1QB 4TTHA 3TNWB 3LQ5B 4RODA 4F7JB 2WEVB 3DOGB 4G6LB 2W9FA 2W96A 4CFMB 2WIPB 1H27B 4F7LB 2WHBB 3RGFB 4EOQB 4CFWB 3MI9B 5FGKB 1OL2B 3POMA 2IVXA 4II5B 1H1SB 1O9KA 4EOIB 3EIDB 2EUFA 1H1PB 1H1RB 4BCKB 1AD6A 1UNGD 4YOOA 4BCFB 4CFNB 1JSUB 5ACBA 2W2HA 4IMYB 2W99A 4EORB 2G9XB 4Y72B 1C9BA 1XO2A 1GUXA 1OIUB 2WFYB 2C5NB 2PHGA 2CCHB 2JGZB 1GY3B 1H25B 4BCHB 3M03A 3H4CA 3O0GD 4YOSA 5IDNB 4EOMB 2UZEB 4ELJA 1QMZB 3DDPB 2C5OB 1O9KB 4I3ZB 4BCQD 5HBHB 3EOCB 4BCQB 1VOLA 2WIHB 2UZBB 4EOPB 2PK9B 2C4GB 4BCOB 4BCJB 2C6TB 1VYWB 3DDQB 5BNJB 4OGRB 1D3UB 1H26B 4CRLB 2IW8B 4F7NB 1F5QB 5ICPB 2UZLB 1GUXB 3G33B 4BCIB 4F70B 1OL1B 1PKDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WXV B;  1BU2 A;  3MY5 B;  1UNH D;  5HBJ B;  5HVY B;  4EOS B;  5IDP B;  3QHW B;  4KRC B;  2WMB B;  4F6W B;  1OKV B;  1VIN A;  4EOK B;  1JST B;  2B9R A;  3BHV B;  2IW6 B;  3EJ1 B;  4F6S B;  2V22 B;  1OI9 B;  4FX3 B;  1FVV B;  2PMI B;  2QDJ A;  4UN0 A;  2PK2 A;  3F5X B;  4BCG B;  1GH6 B;  4EOL B;  2BPM B;  4ROE A;  4F6U B;  2R7G A;  3TNH B;  4YOZ A;  3MIA B;  1AIS B;  1JKW A;  1OIY B;  5HNB B;  2BKZ B;  4EC8 B;  5LMK B;  5LQF B;  4CFV B;  2I53 A;  5EFQ B;  1FIN B;  1ZP2 A;  1JOW A;  4BCM D;  2W9Z A;  5CYI B;  1N4M A;  5IF1 B;  1E9H B;  4NST B;  4BCM B;  3BLR B;  2UZD B;  3TNI B;  1H4L D;  1UNL D;  1W98 B;  4EOO B;  3BHT B;  2C5V B;  4CFX B;  1TFB A;  4YC3 B;  1KXU A;  5HQ0 B;  2UUE B;  4EOJ B;  4F7S B;  3QHR B;  2C5X B;  4CFU D;  1OGU B;  1URC B;  5HBE B;  5L2W B;  4EC9 B;  4KRD B;  4CXA B;  1G3N C;  2X1N B;  5CEI B;  4CFU B;  1H28 B;  1OKW B;  3BHU B;  2IW9 B;  4BCN D;  3TN8 B;  4BCP B;  3MY1 B;  1P5E B;  3BLH B;  4OR5 B;  4BCN B;  2CJM B;  2I40 B;  2WPA B;  2F2C A;  3K7A M;  2CCI B;  3BLQ B;  4EON B;  4ELL A;  1H24 B;  5I5Z B;  2WMA B;  4ROC A;  1H1Q B;  4TTH A;  3TNW B;  3LQ5 B;  4ROD A;  4F7J B;  2WEV B;  3DOG B;  4G6L B;  2W9F A;  2W96 A;  4CFM B;  2WIP B;  1H27 B;  4F7L B;  2WHB B;  3RGF B;  4EOQ B;  4CFW B;  3MI9 B;  5FGK B;  1OL2 B;  3POM A;  2IVX A;  4II5 B;  1H1S B;  1O9K A;  4EOI B;  3EID B;  2EUF A;  1H1P B;  1H1R B;  4BCK B;  1AD6 A;  1UNG D;  4YOO A;  4BCF B;  4CFN B;  1JSU B;  5ACB A;  2W2H A;  4IMY B;  2W99 A;  4EOR B;  2G9X B;  4Y72 B;  1C9B A;  1XO2 A;  1GUX A;  1OIU B;  2WFY B;  2C5N B;  2PHG A;  2CCH B;  2JGZ B;  1GY3 B;  1H25 B;  4BCH B;  3M03 A;  3H4C A;  3O0G D;  4YOS A;  5IDN B;  4EOM B;  2UZE B;  4ELJ A;  1QMZ B;  3DDP B;  2C5O B;  1O9K B;  4I3Z B;  4BCQ D;  5HBH B;  3EOC B;  4BCQ B;  1VOL A;  2WIH B;  2UZB B;  4EOP B;  2PK9 B;  2C4G B;  4BCO B;  4BCJ B;  2C6T B;  1VYW B;  3DDQ B;  5BNJ B;  4OGR B;  1D3U B;  1H26 B;  4CRL B;  2IW8 B;  4F7N B;  1F5Q B;  5ICP B;  2UZL B;  1GUX B;  3G33 B;  4BCI B;  4F70 B;  1OL1 B;  1PKD B; 
#chains in the Genus database with same CATH topology
 3MY5 B;  4EOS B;  1VIN A;  2B9R A;  4BCG B;  2QGS A;  3HB9 A;  2BPM B;  4F6U B;  1AIS B;  5LQF B;  5EFQ B;  2CYZ B;  2UZD B;  2ZCF B;  3DJB A;  1E7P A;  2CZ0 B;  4YC3 B;  4ZGD B;  4F7S B;  3QHR B;  2C5X B;  2DXB B;  5HBE B;  5L2W B;  1G3N C;  2X1N B;  4CFU B;  2IW9 B;  3BLH B;  3QYH B;  4OR5 B;  4QSH A;  1H24 B;  4ROC A;  2KR6 A;  3TNW B;  2WEV B;  3GTM S;  1H27 B;  4F7L B;  2WHB B;  3RGF B;  3X28 B;  4EOQ B;  4CFW B;  4OB2 B;  4MFD A;  4II5 B;  3NDQ A;  4EOI B;  4HNV A;  1H1P B;  1H1R B;  5IHY A;  1AD6 A;  2QFZ A;  1ENW A;  4CFN B;  1JSU B;  3HO8 A;  2DXC B;  3QZ5 B;  4HNT A;  4AKI A;  2DD4 B;  1GY3 B;  4BCH B;  4EOM B;  2UZE B;  4ELJ A;  2C5O B;  3EOC B;  4BCQ B;  1VOL A;  2BS4 A;  2UZB B;  4BCJ B;  3VKG A;  3DDQ B;  5ICP B;  4BY7 X;  2D0Q B;  3VYG B;  1PKD B;  2WXV B;  5HBJ B;  5HVY B;  5IDP B;  3QHW B;  3TW7 A;  4F6W B;  1OKV B;  4BBR M;  4EOK B;  3DL1 A;  3BHV B;  2IW6 B;  2V22 B;  1UGR B;  2QDJ A;  4UN0 A;  1GH6 B;  2KMG A;  4EOL B;  1OIY B;  5HNB B;  2BKZ B;  4CFV B;  1FIN B;  1ZP2 A;  5CYI B;  1N4M A;  5IF1 B;  4BCM B;  3BLR B;  4BXX X;  1H4L D;  4HLQ A;  3X25 B;  2UUE B;  3B57 A;  3HZJ A;  2ZPF B;  3A8M B;  4EC9 B;  5CEI B;  5EJC A;  4BCN B;  1AHJ B;  2F2C A;  3K7A M;  2CCI B;  3BLQ B;  3A8O B;  3QYE A;  3QXE B;  4AKH A;  2AHJ B;  4G6L B;  4OB0 B;  2DD5 B;  3EID B;  2EUF A;  4ZGE B;  4BCK B;  4YOO A;  4BCF B;  5ACB A;  2W2H A;  2ZZD B;  4EOR B;  2G9X B;  3QWL A;  2ZPI B;  3WVE B;  2PHG A;  1TD6 A;  2JGZ B;  1H25 B;  2ZPH B;  3M03 A;  4ZGJ B;  1QLB A;  4M6V A;  4JX4 A;  2WIH B;  2DPP B;  2C6T B;  4CRL B;  2BS3 A;  1F5Q B;  2ZPG B;  4KRC B;  1JST B;  3EJ1 B;  4F6S B;  2QQ8 A;  1OI9 B;  4FX3 B;  1FVV B;  1UGP B;  1UGQ B;  2PK2 A;  3F5X B;  4LOC A;  4ROE A;  2R7G A;  4NC6 A;  1FKM A;  4EC8 B;  2IN3 A;  2I53 A;  2W9Z A;  4MIM A;  1E9H B;  4NST B;  2WJ9 A;  3VYH B;  3X20 B;  4AKG A;  3QYG B;  3BHT B;  4EOO B;  3QZ9 B;  4CFX B;  5HQ0 B;  4EOJ B;  4CFU D;  1URC B;  4KRD B;  4CXA B;  1H28 B;  1OKW B;  3TN8 B;  4BCP B;  3MY1 B;  2CJM B;  2I40 B;  4EON B;  2WMA B;  4MFE A;  4TTH A;  3PO3 S;  3DOG B;  1UGS B;  2W96 A;  3MI9 B;  5FGK B;  3POM A;  2IVX A;  1O9K A;  3VKH A;  1UNG D;  3HHT B;  4Y72 B;  2LW4 A;  4Z6Y A;  1XO2 A;  1GUX A;  1OIU B;  2C5N B;  1QMZ B;  3HBL A;  4I3Z B;  4BCQ D;  5HBH B;  2ZPB B;  2PK9 B;  4BCO B;  1VYW B;  5BNJ B;  5DQW A;  2IW8 B;  4F7N B;  2UZL B;  1BU2 A;  1UNH D;  4HNU A;  2WMB B;  2PMI B;  1IRE B;  3TNH B;  4YOZ A;  3MIA B;  1JKW A;  5LMK B;  1JOW A;  4BCM D;  3BG5 A;  3QYB A;  3TNI B;  2DME A;  1UNL D;  1W98 B;  4FM4 B;  2C5V B;  2QDY B;  1TFB A;  1KXU A;  3A8H B;  1OGU B;  3TW6 A;  3WVD B;  4BBS M;  3BHU B;  4BCN D;  3X24 B;  1P5E B;  2WPA B;  4ELL A;  5I5Z B;  1H1Q B;  3LQ5 B;  4ROD A;  4F7J B;  2W9F A;  4CFM B;  2WIP B;  2CZ6 B;  3BG3 A;  1OL2 B;  3X26 B;  1H1S B;  1V29 B;  4JX6 A;  2BS2 A;  2CZ7 B;  2PJQ A;  4IMY B;  2W99 A;  4HL4 A;  1C9B A;  3A8G B;  2WFY B;  2CCH B;  3BG9 A;  3H4C A;  3O0G D;  4YOS A;  5IDN B;  5DQV A;  3DDP B;  4AI6 A;  1O9K B;  2ZPE B;  4BY1 X;  3A8L B;  4EOP B;  2C4G B;  3KHI A;  4OGR B;  1D3U B;  1H26 B;  2G77 A;  3DTO A;  4OB1 B;  2QF7 A;  4JX5 A;  1GUX B;  3G33 B;  4OB3 B;  2CZ1 B;  4BCI B;  4F70 B;  1OL1 B; 
#chains in the Genus database with same CATH homology
 2WXV B;  1BU2 A;  3MY5 B;  1UNH D;  5HBJ B;  5HVY B;  4EOS B;  5IDP B;  3QHW B;  4KRC B;  2WMB B;  4F6W B;  1OKV B;  1VIN A;  4EOK B;  1JST B;  2B9R A;  3BHV B;  2IW6 B;  3EJ1 B;  4F6S B;  2V22 B;  1OI9 B;  4FX3 B;  1FVV B;  2PMI B;  2QDJ A;  4UN0 A;  2PK2 A;  3F5X B;  4BCG B;  1GH6 B;  4EOL B;  2BPM B;  4ROE A;  4F6U B;  2R7G A;  3TNH B;  4YOZ A;  3MIA B;  1AIS B;  1JKW A;  1OIY B;  5HNB B;  2BKZ B;  4EC8 B;  5LMK B;  5LQF B;  4CFV B;  2I53 A;  5EFQ B;  1FIN B;  1ZP2 A;  1JOW A;  4BCM D;  2W9Z A;  5CYI B;  1N4M A;  5IF1 B;  1E9H B;  4NST B;  4BCM B;  3BLR B;  2UZD B;  3TNI B;  1H4L D;  1UNL D;  1W98 B;  4EOO B;  3BHT B;  2C5V B;  4CFX B;  1TFB A;  4YC3 B;  1KXU A;  5HQ0 B;  2UUE B;  4EOJ B;  4F7S B;  3QHR B;  2C5X B;  4CFU D;  1OGU B;  1URC B;  5HBE B;  5L2W B;  4EC9 B;  4KRD B;  4CXA B;  1G3N C;  2X1N B;  5CEI B;  4CFU B;  1H28 B;  1OKW B;  3BHU B;  2IW9 B;  4BCN D;  3TN8 B;  4BCP B;  3MY1 B;  1P5E B;  3BLH B;  4OR5 B;  4BCN B;  2CJM B;  2I40 B;  2WPA B;  2F2C A;  3K7A M;  2CCI B;  3BLQ B;  4EON B;  4ELL A;  1H24 B;  5I5Z B;  2WMA B;  4ROC A;  1H1Q B;  4TTH A;  3TNW B;  3LQ5 B;  4ROD A;  4F7J B;  2WEV B;  3DOG B;  4G6L B;  2W9F A;  2W96 A;  4CFM B;  2WIP B;  1H27 B;  4F7L B;  2WHB B;  3RGF B;  4EOQ B;  4CFW B;  3MI9 B;  5FGK B;  1OL2 B;  3POM A;  2IVX A;  4II5 B;  1H1S B;  1O9K A;  4EOI B;  3EID B;  2EUF A;  1H1P B;  1H1R B;  4BCK B;  1AD6 A;  1UNG D;  4YOO A;  4BCF B;  4CFN B;  1JSU B;  5ACB A;  2W2H A;  4IMY B;  2W99 A;  4EOR B;  2G9X B;  4Y72 B;  1C9B A;  1XO2 A;  1GUX A;  1OIU B;  2WFY B;  2C5N B;  2PHG A;  2CCH B;  2JGZ B;  1GY3 B;  1H25 B;  4BCH B;  3M03 A;  3H4C A;  3O0G D;  4YOS A;  5IDN B;  4EOM B;  2UZE B;  4ELJ A;  1QMZ B;  3DDP B;  2C5O B;  1O9K B;  4I3Z B;  4BCQ D;  5HBH B;  3EOC B;  4BCQ B;  1VOL A;  2WIH B;  2UZB B;  4EOP B;  2PK9 B;  2C4G B;  4BCO B;  4BCJ B;  2C6T B;  1VYW B;  3DDQ B;  5BNJ B;  4OGR B;  1D3U B;  1H26 B;  4CRL B;  2IW8 B;  4F7N B;  1F5Q B;  5ICP B;  2UZL B;  1GUX B;  3G33 B;  4BCI B;  4F70 B;  1OL1 B;  1PKD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...