4EOWH

Crystal structure of a disease-associated anti-human gm-csf autoantibody mb007
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
228
structure length
228
Chain Sequence
QVHLVQSGSELKKPGASVKVSCKASGYSFSRYGIKWVRQAPGQGLEWMGWINTRSGVPAYAQGFTGRFVFSLDTSVDTAFLEISSLKTEDTGIYYCATRPPRFYDKTEYWEDGFDVWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MB007 human IgG1 Fab fragment heavy chain
publication title Molecular structure of human GM-CSF in complex with a disease-associated anti-human GM-CSF autoantibody and its potential biological implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2012-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eowH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eowH01
3PWUB 2ZP0T 3QXTA 4M8QA 4PJEB 2YZ1A 5ICXA 2H6PB 3QIWB 3CPLB 4JO3H 1XF2B 3IFOA 5MERB 2GAZB 5KOVC 4P3DB 1F6AA 1A3RH 4X9BA 5E03A 2X4NA 3MROB 4MD5A 1Y6KR 4BZYA 3DRTB 1AKJB 1MFAL 2OS7A 1NEZG 3P77A 1A3LH 3HHRB 4URTB 3S8WA 1XH3A 2O5YL 1HHKB 4OCRH 2X9WA 3SE4A 3GBLA 1JWSB 3U7YL 3WEXB 1BZ9B 3HC4L 1X4YA 2AEQL 2H32B 4NDMB 3T0EA 3TP4A 3P4OA 4F57H 3DOSA 1FORL 3STZB 2CDGB 1ACZA 1JPSL 2GT9B 2D0GA 5LKNA 2ADGA 5I1HH 2DQCL 3NA9H 3S4SG 3L5XL 1FO0A 1FH5H 1Q9LB 3I3EA 5JORB 4LVEA 4ERSH 2Q8AH 2PXYD 3K8LA 2VXTL 2VXSL 5CWSA 1BWMA 1F45A 3O6LH 4WUKH 4D0CA 3VGBA 5A16B 1QSZA 1OTTD 3MV9E 1KF9B 4HSQA 2LTQB 5FAAA 4LCWD 2BVOB 2PO6D 4HH9B 2P47B 2NXZB 4MDJA 1RU9L 2DD8H 1W72L 1NFDB 4RFNC 3UTTB 4PLKD 1RZKH 4LU5L 2ZUXA 2AV7B 2V2WA 4OZHB 1D7FA 5LWYL 3WFDH 4RISL 2VLMD 3HUJB 2QSVA 2NW3A 2R8SL 5GRUH 1JI2A 1NQBA 1K4CA 5EZJB 4OUUA 3NH7L 5DK0B 1A21A 2VLRA 3QQ3B 1QR4A 1MCBA 4FQJH 4QY8A 3WIFA 4GKSA 2OP4H 1OCWH 3FCTB 3RTQC 2UY7A 3STLA 2W1NA 3DYPA 2C1OB 2XN9A 3RQ3A 2UVFA 1M71B 3LAFA 4NQCB 4WI7A 3WJJC 1SMOA 4CMHB 3TN0D 4X9IA 2J12B 3TZVC 2Q3ZA 5EOCH 3U2SA 3OAZH 2WBKA 1K5NA 3FFDB 4XNQB 1LP9B 5JHDB 3L3OB 4LCUA 1NCAL 1XT5A 4QRPA 5E2UH 4I0PD 3IDIA 4DN3H 3DX9B 2GCYA 2PETA 3Q6FA 3SE3C 4WENB 1EAPA 4NQXB 5HYSB 3SDDD 4WUUA 4XNZC 2YSSA 2NCMA 5HYEA 2VL5A 3QIUD 4N90D 3MRLB 5AD0B 5I15L 5FKPB 4ODWA 5EIVA 5HGAB 5MEPA 5IOPA 2O5XH 1MCDA 3HPLB 4D3CL 5BW7A 4ODXB 4DEPB 2XV6B 2DF3A 4KRLB 1T21A 3WFBH 5DEZA 1C7SA 4IIQB 4KMTL 5EOQH 2B1AL 2JCCA 3UMTA 5TGBA 2HT4C 4L3CB 3M07A 3MA7A 1OL0A 5E6IA 5I1JH 2A9NL 1JNNL 2OJEB 1G7PA 4O02L 1PSKH 3U0WL 1F4HA 2DQTL 3R4DA 2V5YA 3NCYP 4M6AA 3GJFH 5K9OA 1MRDH 4NKMA 5IFAL 2XKSA 3RAJH 1J0YA 2ICEB 3A6BL 4YX2L 3MBEA 3VDBA 1RJYB 2ZCLH 2X41A 3QDJB 4B41A 4MNQB 4LSDA 1QYGL 5I17A 3G6JF 1IZKA 1MCQA 5GRXG 1Z3GL 4HJJL 1F3JB 4GAJL 3U4BL 3MLPA 3HZMB 1BFSA 2ED8A 5FOBB 2P5EE 5D5MF 3ME0A 3LKNB 3G5VB 4JRYA 1QLFB 4LQFH 3ARFD 4PJBA 2BVYA 1XZ0A 5H94A 2VB5A 4TUKL 1F4AA 1U3HD 1RSFA 5MI0C 1FFOB 3EYFB 4MA1C 1OHQA 5D72L 1G7HB 5F71A 4EI5A 5CCKL 5CEXA 1MRCL 2X9XA 4G7YL 1NGWA 3NABL 3OKMA 2D03L 4NM4H 1BIIB 4NQED 3OAYH 2I07B 2MCPH 1XEDA 4LARL 5C9JB 4NC1C 5FUCE 1N0LA 4OIBA 3I50H 4OFIA 2CK0H 3DX8B 1AP2B 3FT3A 1TFHA 5H8DA 3U4EA 1JZ2A 4FXGB 5I66A 1TETL 5BO1H 1EO5A 4TSAH 2W38A 2D7TH 3WJLA 5KW9H 4NYLA 3RP1A 2YD1A 3TBTB 35C8H 1C7TA 5EO0B 1S7RA 4NGHL 4PRIE 3FQRB 3OKKA 1P2CA 1PLGH 1NEZB 4ZNCD 5BV7L 4F2MB 4RA0C 4JKLA 4JFZL 1VGKA 3CDYA 1AD9A 1WT5C 3BIKA 4EIGB 43C9B 1E4WL 3CMOH 1FGNH 1EHXA 1MHEA 5F1SA 3TCLB 5D9SB 3IFPB 4RFEB 2AJSL 1XR8B 1NGZB 5DURB 3WNNA 4MVBD 5LGJA 3MPCA 1HHHA 2BNQE 2D7OA 3W5NA 3S4SB 2CRYA 3TPUA 4IDLA 4KMLB 4JFOA 1NAMA 5IQ9B 5IFJB 1P7KB 1EO7A 2OK0L 1BFVH 1P9MA 4HC1L 1H8OA 1RZJC 4CDGC 4L4TA 1F58H 4JDTL 3V0VB 1YNKH 3G08A 2IBZY 1UA6L 4N0YL 3ZHKA 2QKIB 4NN7C 5IVXE 2OXGA 3PWNB 5FHAL 5DUML 5ID1B 2EYSB 1P7HL 4X8JB 4X6EA 5ECJE 2VR5A 3C2AL 1WIOA 3EDDA 5ISZB 1T7WA 3BXNB 2H1PH 2H26A 1GGYA 1M7IB 2BSTA 3SDXA 1KJ2B 1W0YT 5A2JH 4TVPH 1IL1A 5EU7C 4HX1B 2DOCA 3Q1SH 1UM4L 1QO3B 1IEBA 4UB0H 4BA8A 4LL9A 1JZ7A 4GKZA 1HEZA 2OJZL 3ZKMD 1HKFA 4P4RA 4IOFD 1FVDA 1WFOA 3N85H 2IMMA 1BECA 2DIBA 3C6LB 4TUOB 1U8JA 5B4MD 4Z7QF 1A9EB 1IGYB 3VWKB 1Q0XH 4FG6C 5K9QG 3DMMD 4G42B 1XCTA 4WO4A 4AH2B 2NY4B 4Y19D 2YWZA 1OD9A 4NO3B 2Y5EA 4LGPB 2JJSC 2V2XA 4AM0A 5KVDH 4LHUD 5HY9A 5J56B 1S8DA 4RMWA 3CFCL 1NGQH 1PKQA 3W9EA 4CN1A 5E1HB 1FZJB 3ZL4H 3VDAA 1RK0A 1F2QA 3QIBB 4J3UA 4F7CB 4IBLT 4ODTL 2X5PA 3P40A 4LCWA 4I3RL 4E5XB 1A9BB 3GHBH 4XPFL 4Z7OE 4JFHE 4J8RA 1K2DB 5I8OL 1EERB 1HILA 4UIMA 3BKCL 1CBVL 5LAXA 4NHUB 4PGJA 3IDJB 3O11A 2PNDA 2Q7YB 3I2CL 1EFQA 2PKDA 3GSNL 3T8XA 4P57B 1TPXC 1T4KA 4WIQA 2IANA 2W65B 1W0WB 1WFNA 2Z93B 2YK1H 1RUMH 3X11B 3GMLA 1O0VA 1UYWL 4NQDE 4X6CE 2Y06H 2FX7H 3DX6A 1UM5L 1FJ1B 2KH2B 1OAZL 3BKYL 4O51A 3NIFE 3UJTH 5GISH 3MMEB 1JPGB 2IFFL 3SN6N 5J06A 3RHWF 4AZ8A 4Z0BL 4MJ4A 4PJDA 5J6HB 1DQDH 4M43H 4PLJD 4PJ5E 5AZ2L 4G8FA 3PGFH 4FNLH 3OJMB 5HXMA 3GIZL 2NNAA 3GIVB 3CFEB 4KKCC 4ONGL 1QSFA 1J9CT 4HUUA 4MJ6A 3UTSD 3V4PH 3BW9A 5D96B 3BZFA 5FB8A 5I9QB 1EUTA 1G7JB 1S7SB 3KS0H 4FP8L 3O81A 3ZE1F 3GMNA 4F37F 1QRNE 1G9NL 3FQNB 2YA1A 3JV0A 4XWGL 5KBNC 3MCKA 4WHCA 2IH3B 4N9GA 4XP9L 4GRWF 4LLWA 3RBGA 4H1LA 3ARXA 2XWBB 4IHOA 4HAFA 4ZMAT 3TJHC 1U8IB 5H37G 2Q86B 3SO3B 1B2WL 2ATPB 3HZVA 4CMMA 2DTML 3V5DA 3V52L 4D2NA 3EOAB 3RWEB 4PY8J 5AZEL 1K9TA 4GRWH 1T0NB 4M7ZB 2IF7A 3V5KB 4MXVF 3DV4B 5E6ZA 4PJIF 5FCSH 2XY2A 1AE6H 4LSUL 5EUOB 1BBDL 3MV01 3TBVB 5I1EH 2J6EA 3ZLQC 1MJ7H 1U95B 1C5DB 1GPOH 2UWEE 2YXMA 4Z76A 4PJCE 1I3RA 1E4KC 3GEWB 3PWPA 5AEAA 4KZEL 3VGFA 3EW3B 4HF5L 4OKVA 5EC2A 5IHUL 1BOGB 3EGSA 2YPLE 1QPXA 4QCIA 2ENYA 3ZDZE 5F97E 3MLTB 1CDHA 1U41A 4U1NA 5CEZE 5HYJE 4Y2DD 3FZUD 4WHDA 3RKPA 3MRMB 1UB6B 5D7IE 3TO4C 1C1EH 5HVHC 1MWAB 4WEUD 4X7TB 3IGAA 4UDUA 1WBYA 3JWNC 4LSQH 4Q9CA 2VIRA 4WV1B 5DZNA 2CUHA 5EO1A 1TZGL 3AAZA 4TUJB 1NMAH 4Y8DC 3SCMD 4UT7H 1OPGH 1U58A 3QBTB 3DRQA 1KIUA 1L7IL 4Z7WB 5HBBA 2DI8A 5D70L 4N8PA 1T6VN 3I85A 1SJHB 2BVPB 1R3IH 3OKOA 2P48B 3QFJA 5JIPA 3C6SB 1BVLA 4H25B 1AJ7L 5D2LB 1ITCA 3SHSA 5C0RH 4NBXB 5ALBH 5FYJH 1TQCC 1JVKA 4G6ML 1KSRA 1LK2A 4N1CA 3BP7B 4BFIA 4CNIB 2NY0B 4P2OA 4UT6H 5FF6B 3K7UA 2RHEA 1ORQA 4PTTB 2NX5B 1U36A 1U2HA 5ADOH 1A2YA 3IKCB 2BOBB 1A6TB 4KHTH 1A3LL 4FXKA 4JRXE 4F80A 1DQLH 4I8DA 3LB6C 4LPUA 1DE4A 4OCRL 3RUGF 2UYLB 4WU7A 4EOWL 1BJ8A 1YEKL 2FEEI 4PV8B 3ILQD 3DVNA 1X5AA 4N0UA 2VLJA 1A4JA 4JANB 4F57L 3SBWA 4ZDHA 5EU4B 3PXJA 4P46B 3V7AE 4LPYA 5IKCA 3P4NB 2G9HB 4MAYD 2X70B 4X98B 3DYMA 4G6FB 1T89A 5I1HL 2HRPH 3NA9L 4ERSL 1FG9C 3QUMA 2X44D 2Q8AL 4LLMA 5FYLH 1FVEB 2W0FA 3O6LL 5DS8A 4I77H 4WUKL 1EXUA 4IJ3C 4E41E 3PE9A 4PJIB 3I6KB 4KH2A 3DX7A 5F1IA 2QADD 3V4VH 3PP3K 4NO5A 4OTXH 5SX5H 2DD8L 2YD3A 3MFFB 5D7LB 3WFHB 3NTCH 4L4VA 2EDEA 3TBWB 4U0RC 4HWBA 3VXPB 2AK4B 4LLQA 1ZT7A 2R2CA 1YN7B 4NNXB 4MA3B 5D7JB 3RZCA 1EZVX 1A7BA 1D5MA 4FQJL 1XAUA 5D4QA 5BCAA 1H15B 2OP4L 1OCWL 2R69H 2VLLA 3HE7B 2LU3A 2FATH 2MNUA 5GJTH 3F8UB 2CPCA 4PJAE 3BISA 2PTTB 1U6AL 2M8XA 5EOCL 5FO7B 4HEME 1HHJA 4Y5VA 3GSQB 5E2UL 1GH7A 2BP3A 1HYRC 5C3LD 4DN3L 4WFHE 3H0TA 1A8JH 2DQJH 4I18A 1JGUH 4L8SA 4PJGB 4N8VB 3HG1D 3E6HA 1GZQA 2YC1A 1X7QA 2VDNH 3DUHA 1QPPA 1UWGH 3RX5A 1PZUB 3O4OB 4HXBL 2O5XL 5IHLB 2G5BB 1KCUL 1DN0B 4U0QB 3WFBL 5IJKC 3O3EB 5EOQL 1CFBA 3O2DA 4QXGH 4YBHA 4UBDC 5CP7B 4U6VH 3AFLA 2XN9E 5I1JL 2O61B 1A1OB 2EEBA 4I4WA 3GSOA 5HTSA 3E8UH 4LKXB 5IB4A 2A6KA 2AS5M 1S7XA 4JY5H 5MEOB 2PYED 1W8NA 1ZXQA 5C0AE 4QRPE 1MRDL 4Z8FH 5FDWB 3RAJL 3FN0H 3K2MC 4JN2A 3TBSB 3KPOB 2ZCLL 3EYQD 2ZPKH 3PJSA 1E27B 4H0IA 1NEUA 1PYWA 3WUWA 3QQ9C 1P53A 1KLUA 2NY5C 2VQ1A 3SDAC 4XNYL 5TF1H 1U8QA 1E4XI 3SDCC 5MEQB 1J1PH 4LGSB 3WNLA 2EH7H 2HFEB 3VFTB 4LQFL 4KDTA 5D8JL 3MLRL 3CDGA 4G43B 4JN1H 1TITA 3BQUD 4LLYB 5GQBA 4OGAD 4RFNB 2Y7QB 3A6CH 3P9WB 2Z8WC 3RNQB 1VFUA 3IDMB 3HI1B 1NC4D 5I1DB 2XWTB 4YEFA 3D39D 4NM4L 4AIOA 1JF5A 5INDA 1MFBH 3I50L 3L3GB 4WNQA 3VRLE 3SY0A 4OZIA 2CK0L 4XCCH 4LCCC 4HPYH 3L3DA 2VITA 2WBJA 3SKNA 1GOFA 4R2GD 3RTQB 1XMWA 3BPOC 1L0QA 1HQ4B 3DHMA 4HKZA 5BO1L 3PABB 2A0LD 1CGUA 3F5WA 2K7QA 1CVSC 4JRYE 5F89A 2D7TL 5DK3A 4MQXC 1KCKA 3VRJB 1DLHA 1KCLA 2E9IA 1E28A 5FA4A 5KW9L 1A7RL 5KS9F 3L3KB 3KG5A 1FCCA 5D7KE 1WCQA 4M9PA 5I73B 2BNUB 2JJUA 1NBQA 2X4UB 2VOTA 5T1LB 4NZRH 5IROA 1RZ8B 5I71C 4L8DB 3QDGA 2XKNA 1PLGL 2AJZB 5IMOB 2EC9U 1JYNA 1NFKA 5E94B 1GZPA 4F3FB 4KRPD 1X5GA 5D1XD 1D6EB 4LAJH 5F3HB 4FQCH 2HWZH 1M7DB 1FC2D 1BAFH 1FGNL 1QEWA 3CMOL 4PY7B 5CBEA 1JPTH 4WFFD 4FOMA 4IMLB 3DV6A 5KSAD 3U7AA 5J3HD 1CZ8L 4K7PH 5TE7H 4N5UA 4P0DA 4QHMA 3ZHDA 1X5HA 5C0IA 1E6OH 4NUJB 5C0FB 2I24N 2BVUA 2VDLL 3X3FL 5GZOD 5E99H 5FV1L 1BFVL 2WUBL 4S0SD 1F58L 1YNKL 4QHUB 5JW4Q 4M1CD 2HH0L 4Q9RH 1JTOA 4ZS6C 4CVXB 1MCPL 2R23B 4LSSH 5F9JB 4PLNC 5KSUB 3QRGH 3Q3GB 2P8MA 3MLUH 3TLRA 1CDJA 5ESQA 4H5SA 3T1FB 4PRPA 5CZKA 1K6QL 4LSPH 1ZLUK 1WZLA 2M1KA 2H1PL 5FYJU 3ULSA 4HIEA 5TQ2L 3PG2A 4TVPL 5T3ZD 2COQA 2MSPA 4UB0L 4C54A 2XOTA 3KPMA 4P5TD 2Z92B 2GITA 3GM8A 3SGJC 3VXSB 1FGVH 1PG7H 5ENWA 1IQDB 4J23A 4YDKH 5MI0B 3N85L 4L4TE 5D1ZA 2AQ1A 3VFVB 5B8CA 1CE1H 2IPKB 4AQOA 3C60C 4RMVA 1YPZA 3L5JA 3FN9A 4YHNA 4IRJB 4BM7A 2Z31A 4LDLB 1Q0XL 1KGCD 5DSCA 5BZWB 1CU4H 1ND0B 1SBSH 4F33B 1AGEA 3SDXE 2Y6SC 4LRNH 1NGQL 3ZL4L 5J6GA 3L6FA 1NGYA 4EI6B 1KN4H 3GHBL 3CFKA 5IHBA 3QULA 4EN3B 4DVRL 3KYAA 3ARQA 3LV3B 4PBWD 3HAEA 3NACH 4APQA 1VDGA 2FRGP 2WLYA 2L7JA 5K9KA 5GGUB 4Y4FD 3LKSA 2DQFA 1IAII 3EOBA 2YK1L 3LKQA 1RUML 2V9TA 2D9QB 3RL2B 1VB9A 2FX7L 1D6VL 5EWIH 1C8PA 4HS3B 1PKQE 3K4AA 5FGBA 4ELMA 1CD1A 3UJTL 5CLTA 5GISL 3JWOH 4RDQG 1A6WL 4LCWE 4GRLA 5KSBE 3PIQB 5HHOA 2CLZA 4U6HB 1W2KT 4KKBD 3VA6A 1DQDL 4M43L 4ZFZA 6FABL 3QEQB 3PGFL 4FNLL 3CZJA 4NN7B 2VLME 1D9KA 1JGDB 1JGLL 3F62A 2OL3H 3VXOB 2HFFA 1QR1B 1Y6MR 3MRFB 5F7NC 2ADFH 3TJEH 3QAZC 4P3CH 3D18A 3KPPB 1UKSA 3S96A 1OAYL 1I7TA 3MFGB 3EYVB 2XY1A 3GMMB 3HC3H 4P2QB 4Y16C 1IRAY 1DQMH 3PQYB 4GG6A 1F3DH 3E1F1 5HGBB 2ARWA 3QIWD 1NC2A 5F7HA 2PF6A 5DJDA 3OQ3B 5T1KD 1ZWIB 3P9MA 4KQ4H 1L7TH 1BWWA 1BEYH 2XQBL 3VFGL 2JELH 3NPSC 3O3BA 2UUDK 5J57B 1WK0A 4ODVH 3FHQA 5SWSA 4YHIA 1KG0B 1XGQB 2AP2A 2C4FT 4N90E 5IEHA 3VXTB 5GXBB 5LBSH 5C1MB 2BFVH 1G9MC 3VD9A 1U8NB 1UJ3A 2ESVD 1C12A 2NY1D 4LDOB 4QTHA 3IU3B 4KMQA 1MJ7L 5T5NF 3MGAA 5ELIA 4GKOA 2QR0A 5JPMA 3VH8A 2DJSA 3QEGH 3ZHLA 5IWLA 3UAJD 3FQTA 1NC4A 3MO1B 3ARPA 2WIMA 2X4SA 2NXZD 2HTLC 5DJ0A 3V6OA 1C1EL 1H5BC 3IB4A 5IVNA 1TPXB 4YK4C 1TJIH 1OOAA 1GXEA 2C4FU 4PJ9C 1MPAH 1FL6A 3REVA 4OZFG 1NMAL 2WQ8A 4UT7L 1OPGL 4I2XA 3UXFA 5DJ8B 3SE4C 1JV5A 1FNLA 4XHJD 3ESVF 15C8H 2IQAB 4WI5A 1AXSB 3T0EC 4WJ5B 4NQCD 2ICWB 4JKMA 1DBAH 1CGXA 3VWJC 5EUKA 2L4OA 2V7HA 3O3DA 4TVSa 1R3IL 3T4AA 5JHDD 2ED7A 1DDHB 5ALCH 4NQEE 5GGSB 3C5ZD 5IHZA 5C0RL 5JXED 3BD5A 4I13B 3QO0A 1BJ1H 1F90H 4PYHA 3HFMH 2R0WL 4HUXB 5L8KB 5F7YC 5DD3L 4DFHA 2EECA 3O4LB 4OKDA 3P0GB 4JM2C 4ZFOL 3VCLA 4G80A 3RI5K 1MQ8A 1PZ5A 5ADOL 4JZJA 1UXSA 4KHTL 1Z9OA 5DD0H 1B9ZA 3KPQB 1RJZA 1DQLL 5DD1H 1G6RL 3WFZA 1VFMA 3BZ4B 5KANG 1WEJH 2J88H 1HHIB 5DGRA 1ZHBB 3FAWA 3IFNH 1BMGA 2E3VA 5EBMB 1CN4A 4MD0B 2EXWC 5GRZA 3VXNA 5C6WH 5JA9A 4XGZB 1BVKB 1EVUA 3O9WB 4RMRA 1ZA3A 4DKEL 1JZ5A 1FRGH 1KB5A 3QI9B 2MQ3A 4I77L 1J8HD 4PJFA 2HP4A 3I9GH 3UYOD 5DFVC 2Q87A 1K4DA 1RMFH 2P7TA 2HJKA 4EDWH 1UWEH 5HDBF 5EO9A 1GRWA 4O2FA 3NTCL 3UBXA 4OFKA 4ZFFB 4N0UE 5BW7C 5E8OA 2VLJE 3NZ8B 3TO4B 4ZTOL 5HVHB 2Z91A 4Q58C 4M5ZH 5EZLB 4A6YL 4R4BB 3IU4H 2CIIA 1T1WB 4S10A 1JZ8A 4HFUH 4LPVA 4OLEA 2H3NA 4WVRA 3GO1H 1YMMB 3DUUB 3WIHA 2FJGA 5GJTL 4BKLB 4R8WH 3DROA 1CXFA 3QXWA 5GIRB 1GHFH 3RVXC 3KYKH 3TV3H 1U8OB 1ZSDA 2DYPA 5F88B 1W0VA 2H41A 2Y5TA 2DQJL 2VRAA 2QQLH 3UPCA 1JGUL 1YY8A 2X4PA 4PD4J 1F4XH 3B2VL 5LG1A 3BP6A 3PHQB 5FIEA 4OM0H 1NJ9B 1UWGL 3OGCB 4LSTL 1KLGA 5E8NA 4F58H 2FX8L 1S7TA 3KYMA 5SWZA 1VPOH 3ET9F 4QXGL 3V79C 4U6XA 1SYVA 1AQDA 4P9HC 4U6VL 4JFDB 3LVEA 4DQOH 3E8UL 1R5WB 4H0HB 4EI5C 4JY5L 3EO9H 4JFXA 4Z8FL 1D5XA 4LRIC 3SQOL 5DJ6A 1ZLVH 5I0ZA 3FN0L 2VE6A 4HWNA 2FBJH 2DLFH 4KUCD 1IQWH 1XCQA 5SV4A 1EX0A 4F9LA 3SJVD 1FBIH 1TCRA 4KY1H 3QNYB 3WJLC 1QVOB 5ISZD 4N0CC 4QRTB 2LU7A 5TF1L 3QIWA 2YD7A 3CPLA 1XF2A 1T66D 4PYGA 1KLFA 2GAZA 5MERA 5F72S 3AM8A 4P3DA 2A6DB 4PJ8D 1J1PL 3MROA 3S9DB 3ZT5A 4OZFB 3DRTA 4D0DA 1AKJA 4JREB 4BUGA 3RL1A 3C8HA 4N5EC 2DL9A 2D9CA 1I3GH 1HHKA 5T33H 4P5KB 1QLRB 1JWSA 3A6CL 5E2WH 5CD3B 3E3QE 1NKOA 2H32A 5ACLA 2Y9RT 1A6VH 4U0RB 3EJZD 3UTSE 3HLAB 3STZA 3UROR 4HJ0D 3FTGB 3BDYH 4G6JH 5K59E 4WW2F 1IC4H 2P8LB 1KEGH 1MFBL 4YFLF 2NY4D 1Q9LA 4EDXB 3U0PA 1B0RB 1DEEB 1P9MC 1R3KB 3P4MB 4UILH 5F7KC 5C0BB 5A16A 2FBOJ 4FN0A 2JK5B 2BVOA 4HH9A 5FYKD 2CDEB 3ARED 1NFDA 4NZRL 3UTTA 3MRNA 1RJLB 4KHXH 2AV7A 4PGZA 4OZHA 5CILL 1J0KA 1MLCB 3HUJA 2KBGA 4FQCL 5EZJA 4U1LB 3T65B 5BJTB 1CIUA 4X83A 1JPTL 3V7MA 3QQ3A 3MNWB 1A6ZB 1LWRA 1CDCA 4K7PL 2GJZB 5DK2B 3SEPA 4XPBL 5BRZB 5JW3H 5TE7L 3FCTA 3HE6D 5FHBH 4NQSB 4ISVB 4S2SB 1NBVL 2IQ9H 1M71A 4NQCA 1E6OL 4NJ9H 2UVEA 5JLZB 2QL1A 3MCG1 3NFPB 2YUZA 4X6DF 2VZTA 1UG9A 1YY9D 1HSAB 3KLDA 5E99L 3FFDA 5JHDA 3L3OA 2XNAB 5TDPB 4FRWA 4WO4C 1VA9A 1VFAA 1FFNB 4LEXH 2YBRB 2NY6C 4Q9RL 4JPIA 1G0DA 2HFTA 3MNVA 4LSSL 1MLBB 5F9AC 4NQXA 5HYSA 1MCEA 4XBGB 5INCB 1U9KA 1ACYH 5FYKH 5AD0A 5HGAA 4LSPL 5DJCB 4LQ1A 3HPLA 2CIKB 3SDAB 1NBYB 2H2SC 1OLZA 1F4WH 1BP3B 5I1CH 3VXMB 3QPQC 4L3CA 5IJVB 5E9DB 1IGTA 4XI5D 4P4KB 2OJEA 2IAMA 4HZLB 1FGVL 5BMFH 2M2DA 4XVUC 2CUIA 4HEPG 2BCKB 2DI9A 5JZ7C 1NCCH 2ICEA 3NIDF 4O4YH 3MLVH 5F1OB 5F7FA 3ULVD 3BMVA 1RJYA 3QDJA 4MNQA 1CU4L 1FAIL 4O2CB 1SBSL 1XGTB 5EG6C 5BS0B 1RFDH 1F3JA 1G7LB 4LRNL 3HZMA 2DN7A 2FSEB 1CL7H 5C3TA 4DZ8B 3BRDA 1G7MB 3LKNA 3G5VA 4AL8L 4NWTH 5I74C 3KPSB 3NZHH 1KN4L 2VSDA 1LHZA 4TSBL 3UJJH 5I71B 2VLKB 1FFOA 3EYFA 2VABA 3NACL 2EC8A 1G7HA 1YPZE 25C8H 2A6JB 3FQUA 4MGXA 1S78D 3LS5H 1BIIA 4WEMB 2I07A 4ZODA 2G2RA 5C07B 3SGDI 5C9JA 5EB9A 1CLYL 3CLFH 2XTJC 4HWEH 3DX8A 3PHOA 5MHSD 5EWIL 1AP2A 4FXGA 3HPJA 1XF5A 1CCZA 4LP4A 2ADIB 3BN9C 5EBGA 3JWOL 4I9WD 4OF8A 1CIDA 3QCVH 1S7QB 3TBTA 2NY2C 5EO0A 4FQQB 3FQRA 1TXKA 5IUSA 3DXAA 2OL3L 5DLMH 2ADFL 2NR6D 3LMJH 4P3CL 4YZFE 3JV6B 4JPKH 43C9A 3ES6B 4FQXD 4X6DB 1U92B 2MPAL 3HC3L 4PJ7F 2IBBA 4OCNC 5D9SA 3IFPA 4RFEA 5JO5B 1XR8A 1NGZA 3H42H 2NY0D 4S1QH 5I18H 4H26A 3S4SA 4L3EB 1J0IA 4KQ4L 1L7TL 5IFJA 4JHZA 1BEYL 5HHOE 1P7KA 5IQ9A 3UDWA 4FFVC 5GS2D 2JELL 2YOCA 3V0VA 4ODVL 3JXAA 4MS8C 2DKMA 5HHQB 1DBML 2AJ3B 3C60B 2ZUUA 2QKIA 3CLEH 3PWNA 4GMTH 3WKML 1SYSB 5ID1A 5GGVH 3B8SA 1OTSD 1UENA 3GJFA 4TULH 5LBSL 4X8JA 1SQ2N 1MFEH 4RBPK 5IV2B 5L0QC 5J7CC 3MOQA 5DUPH 5F7UA 1M7IA 1KIQB 1KJ2A 1JUFA 3AGVA 4DK6A 4GG6E 4HX1A 1AO7B 2ITDB 1QO3A 2FYYB 3WNPA 1HSBB 4OGYH 5HVWA 2PYEE 4MNGB 4XTRC 3UBXI 1EDQA 3QEGL 2EO9A 3KR3L 1BPVA 4MAUH 4OD3L 3CH1B 2NZ9D 3G6JA 5L9DH 3T0WA 5C0JA 2MFNA 3C6LA 4TUOA 4ZXBD 5SWSE 1L6ZA 3OAUH 1EIBA 2E27H 3RPIB 5D7LD 3O2VH 3VWKA 1XIWA 3O0RH 1TJIL 4G42A 4AH2A 1MPAL 4JKWA 4NO3A 1M4KA 4JPVH 2O26U 5D7JD 4XHQA 1FZJA 3GFUA 3QIBA 5C09B 4A2MA 2OSLB 15C8L 4HV8B 4NZJA 3MRRA 4G9FD 5HSFA 3HE7D 4E5XA 1A9BA 3EO1B 3LKRB 3G6AB 2IEPA 1DBAL 3SBWC 3GJEB 1EA9C 2DDQH 1K2DA 5IT2H 3IJYB 5GSVA 4P2RA 4NHUA 1T89C 4DKAA 3V6OE 5J13C 5ALCL 1ZHNB 3IDJA 4W4OA 1Q8MA 2IPTH 5F44A 1RD6A 2HLAB 4P57A 3QAZB 5EU6B 2QBWA 2W65A 1W0WA 2X10A 4FFYH 3KJ4C 2XA8H 1B0WA 2Z93A 3LN5B 3HFML 3W0WA 3X11A 4BH8B 2BNRD 3MCLH 3VG0H 1FJ1A 4Y16B 3EOYG 5KTEH 2YPVL 2VH5H 3MMEA 1JPGA 4CVUA 4X6FB 2MKLC 5DD0L 3LS4H 2KPNA 1U8KB 3L7EA 3B9VA 1QLEH 5J6HA 3NPSB 3H6JA 4HLJA 4V2BA 3HMWH 1WEJL 4K23H 4FMFA 2J88L 4D9RD 4HW6A 3RZCC 3GIVA 3GBML 3IFLL 3IFNL 3TPKA 3DO7B 5JW5B 3FRUB 2F54B 2X42A 4M93C 4WFFE 3ILPA 1UACH 1G7JA 1S7SA 3VFRB 5FYKU 3PXHA 1LVEA 3FQNA 5IMKB 3I3DA 1U8LB 2OM5A 4JZNB 1CICC 5C0NC 5JXAH 3VGEA 2IH3A 3I9GL 2DAVA 2YD8A 4L8SC 3MA9H 1YYLH 2XWBA 4JJ5B 1RMFL 2XRAH 1U8IA 1AIFB 1UWEL 5IW1B 5FGCE 3EOAA 3RWEA 1KTKE 3DSNA 4X5WB 5T3XD 5ICXB 1H5BB 3RVWC 4M5ZL 4YK4B 3IFOB 1CLCA 3DV4A 4PJ9B 4HFUL 5BOPA 5DTFB 2ZJSH 4W6WB 5T3ZE 4U33A 3D3VB 2YXFA 4RCAA 3GO1L 3GHEL 3FO0H 1GC1H 4RX4D 2R0KH 4JQXC 2JKXA 2AERT 4HKJB 6CGTA 4WWKB 3RTQD 4R8WL 3T0EB 5E00A 1BOGA 4JR9H 1GHFL 3SKJH 3KYKL 4KK8C 3TV3L 4GT7A 1WICA 3TZVD 3VWJB 3LEYH 1RVFH 4XC3L 3MLTA 4WGWB 2ADGB 4FS0A 1T04A 5FA3B 3G5XA 1UB6A 3I02A 5T1LD 1HH9B 4Q0XH 1F4XL 4X7EC 1MWAA 5D7SH 4OM0L 3ZYOA 4PRBB 1V05A 5CWSB 4D0CB 1EBAA 1IBGL 4WV1A 4KDTC 4TUJA 5CAYB 3PWLA 3QJFB 1CT8B 1VPOL 3CXDH 4JM2B 5HHXH 4Z7WA 3LEVL 4DQOL 1G9EA 5LQBH 1DEDA 1WFUA 2HT4D 2JF1A 3ZT7A 4QWWC 1SJHA 2BVPA 3PV7A 5EBWA 4E9LA 4OUUB 3P0VL 2BY0A 1D3CA 3C6SA 2VLRB 3K3QA 5GGTA 1NBZA 4H25A 2FBJL 4OZ4B 5D2LA 1P4IH 4GKSB 1YMHA 3C5JA 1FBIL 3BIBX 4MXQC 4KY1L 3QUXC 1UKTA 2WMPA 3BP7A 4CNIA 3U2SB 1K5NB 5SWZE 2AEIT 2FO1A 5FF6A 3MUY1 1G1CA 4PTTA 3IXAB 2NX5A 5I30H 3A0OA 3CX5J 5L7XH 3IKCA 3IS0X 1A6TA 4H0GA 4O2EB 3PDGA 5CS7A 1I3GL 1TIUA 4LVOC 3VXSD 3UPRB 1N3NB 2DQGH 3H9SA 3ZSSA 1C16B 3U7WH 5MEPB 4PV8A 1A6VL 3GBNL 4YHPB 4MD4B 4JANA 2FO4B 3DPBA 4P46A 4P23B 4G6JL 3P4NA 2UUDH 1IC4L 2W9LA 2X70A 4ZSOE 1KFAH 2R2BB 4PJEE 1PY9A 3SGEH 4M7JH 4GLRH 5HVFB 2WIIB 3QDHA 3E6FB 1V7NH 4ZNEA 5C0CB 4XPGH 4PJIA 3FN3A 3I6KA 3RGHA 4U2YA 1A0QL 1WTGT 3TEUA 5J11C 2CXGA 3RU8H 3QNZB 2J5LC 3MFFA 5D7LA 4LEOB 4POZC 4KHXL 3PL6A 3TBWA 1Q72H 4JO4H 3VXPA 2AK4A 3S37H 4YFDB 4E0RB 1YN7A 2WZPD 4MA3A 2QSCL 1IARB 2ESVE 5D7JA 1I9RH 3RY6A 5IIEB 4PJBB 1A7NH 1XZ0B 1JRHL 3WDIA 3ARBC 4YPGB 5DEFA 2KQMA 5JW3L 5D93C 5D1ZC 2IQ9L 4KJYB 4NPYB 3BP4B 4NJ9L 1T1XB 3EOTL 5FO7A 2Z31C 1NGWB 3GSQA 2ZWLT 1RIHL 4MJIB 1NFDE 4FQIL 3UTTE 4LEXL 1A3QA 4PD4K 5DC0A 2R1WB 3BZEA 2HVKB 4PJGA 4OZHE 4N8VA 4H1LG 2GUOB 3HUJE 4JGJA 4Y4HC 1ACYL 5FYKL 4YHOH 3VI4E 4YJZL 2G5BA 5GHWH 4AK1A 3O3EA 2CLRA 1N6QL 4AEHL 5DVLA 5GGQH 3O3AA 5IGXL 5F9WB 4HZAA 4HBQA 4P2QD 4NQCE 3GSUB 5BMFL 3UJIH 1MIEL 4LKXA 2FEDC 5MEOA 4N9OB 3FB5B 1LP9E 1AI1L 3QDMD 5JHDE 5KN5B 1MHEB 2OTUB 2Z8SA 1OF2A 1REIA 5B39B 5FDWA 4O4YL 3KPOA 3EJYC 5FGBC 4Z77A 1E27A 4MHHG 4FG6D 3R1GH 5DHVH 4OCXH 4GRLC 4XVSH 4JFOB 4ODHH 1NAMB 4POUB 4FXLA 3RUGA 4AT6B 2W9DH 4UV7H 2Y36H 4M03A 2B2XH 1A14H 4UNTA 5DJAA 1JRHI 5KJRH 3K74B 4NWTL 3NZHL 2HFEA 3VFTA 2AQ3A 1D9KC 2R56L 3IXTB 3TIEA 4HPOH 4G43A 1ES0B 5IBUG 5FM5O 1YEEL 2R2HA 1YEJH 1JNLH 4KV5F 4NFCA 2BRQA 4Y7MA 2Y7QA 5DI8A 4Q7DA 1FZMB 4HFWB 4HS6B 3RNQA 2GY5A 1ZVHA 1OM3H 1OWWA 3IDMA 25C8L 3HI1A 3OHXB 5FKAB 1CK0H 4NN5C 5I1DA 2HKHH 2XWTA 3HMXH 4MNQE 4ZTPH 2DB8A 3BDBA 5DT1L 5E8PB 3CLFL 1HEZB 4S1DC 4RX4A 3L3GA 4HWEL 1Y0LB 5F96H 2ZNWA 4WTXA 5E6YA 4G6KH 2WAHA 4KDWA 4YQXL 1NCWH 3DETC 4KRNA 1HQ4A 1T5WB 4YBLC 3ULVL 3WJJA 3PABA 4KGJA 1U8JB 2Q1EA 4X5LA 3WUZA 3VRJA 4HGMA 3L3KA 5AAMA 2BNUA 3QNXB 2X4UA 4Z7NE 4WO4B 1XCTB 3GDBA 2FECL 1I1AD 4K3GA 5T1LA 2NY6B 1RZ8A 5DMKB 4L8DA 5IMOA 2V2XB 4M4RA 4F3FA 3EAKA 4Q6YA 1B90A 4CGTA 4IMKA 1D6EA 4QHNB 5F3HA 3W9EB 3LMJL 4KKCD 4JLRA 3S3JA 2GHWB 1F8TH 4DKFL 4JPKL 1M7DA 4PY7A 4LAQH 4KJQC 2JB6B 1OQOA 4XX1E 4IMLA 2O93L 1X4XA 2GKIA 5IWLC 2B1HH 3H42L 5LGKA 1I9IL 3DI3B 2L0DA 2YN3A 3LHPH 3QCTL 3O4LD 4S1QL 5I18L 4NUJA 5C0FA 3O11B 3V6OC 3KPRB 1MCKA 3P0YH 3P9LB 2G60H 1T4KB 1IM9A 3TJHD 4QHUA 3OGOE 3T0XA 4CVXA 4GMTL 2R23A 2QQQA 4PJHF 5F9JA 1OAXH 2H8PB 2FLRT 3Q3GA 4LSVL 4TULL 4UDTB 1MFEL 3EDEA 3T1FA 3MV7B 5IK3A 2JTDA 1F00I 1FSKC 1OP5H 5DUPL 4PGCA 3D0LB 4WHYH 5IESH 1Y6NR 4G8FB 4OGYL 1Q9KA 2FGWH 1DZBA 2Z92A 2NNAB 4JM4H 1IQDA 1X9QA 2RB8A 4MAUL 1QSFB 1N5AB 2DRUA 5L9DL 1AQKL 5IW3A 3T09A 3VFVA 3KNBB 4NKQB 2IPKA 4TNVK 2E27L 4LK4A 4KWUA 1I85A 3IYLW 2FECI 4IRJA 3O2VL 2Q6WB 3VJ6B 5BZWA 5ISZE 1ND0A 2APBA 5JIIA 3KYOB 4X7SH 4F33A 4LLWB 4H1LB 3NPZB 2YRLA 2EKSB 3KYNB 2ARJB 3HZVB 5DQ9B 3MV9D 4S1SL 4FFZH 4EI6A 4JPWL 4Y89A 3SPVB 2NY2B 5IT2L 3QCUH 3MLYH 3V0AC 4R4NC 4M48L 4EN3A 1DQJB 3LV3A 2XIDA 4U7KA 1Q9WB 1CXLA 1RV6X 2IPTL 3DURB 4RIRB 4Z76B 1UZ6E 3LRGA 1EO8H 4YLQT 2DICA 4FFYL 3CU1A 2XA8L 3PWPB 2VNCA 5KS9A 3H3KA 4HQQH 3BPCB 3TC9A 1NGXB 4U1HB 3VG0L 5ABDE 1KB9J 4L3AA 2Z8RA 1JF1A 4HS3A 3LCYA 4U1NB 5KTEL 2VH5L 1NUFA 1X5FA 8CGTA 1TNMA 4D9QE 4JFDD 3KGRA 3PIQA 1QLEL 3S88H 2B4CH 3VMOA 1ZGLP 2DWDB 1FNSL 3N06B 1WBYB 3LB6D 1S9WB 2VIRB 3QEQA 4LHJB 1ADQA 4M4PA 4RAVA 3AAZB 1JGDA 1BD2B 5IBUB 1KENH 2X1WL 4R97C 4M6OH 3MRFA 1Z0NA 3H7LA 3OX8B 3KPPA 5L0QB 1WGOA 3RGVA 1A22B 5DGQA 3ARDA 3KXFB 4U6YB 1OAKL 1UACL 1YECH 3AMKA 3EYVA 3GMMA 5EU3A 3U0TB 1QD0A 4J1UA 1L9NA 3PQYA 1KXQE 5HGBA 4Z9KB 1CGSH 5JXAL 4AEIL 1ODAA 3MA9L 3O8XB 1YYLL 1YC8A 5B22A 4FMKA 5ICZB 2C26A 4OGXH 1KG0A 5C7XH 1XGQA 2YMXL 4YHML 1J88A 4RAHA 3VXTA 4JEGB 4QXUH 1XGYH 3AY4A 2ZJSL 1A2YB 2JJSA 4AQ1B 2XTLA 4KC3B 4BUHA 5IVOA 4C57C 1G6VK 1OT1A 1NKRA 3FO0L 3IU3A 1WTLA 5CJOH 3NMEA 2R0KL 4IRSA 2NXYC 1YUHB 3UX9B 4XPTH 3HI5H 4N0RA 3T77B 3MJ7B 1MREL 4JR9L 3SKJL 3LEYL 1RVFL 3KJ6H 3MV8B 5C0BD 4F9LC 3WMSA 1K85A 3OJVC 4K9EH 2FHCA 3LEXB 3FL7A 3MO1A 5DRWB 4J3SA 5J13B 3ULVE 1J12A 1WV7T 4Q0XL 4LBEB 3OKEB 2J8HA 4LLMB 4F7TA 3AM8C 3KJ4B 5DVMA 1T1ZB 2V17H 1EXUB 4LPTA 5EUOE 3VFMB 2R2EB 1G9NC 2W91A 4NO5B 5HHXL 3V8OA 1KIPB 4K8RH 5KAQF 2X89D 4ONHB 3FAXA 2OX5A 3FFCB 4UBDD 5BRZD 2IQAA 5LQBL 1AXSA 2H45A 4WJ5A 4AENB 2WWKO 2ICWA 2A1WH 3ZTJG 1QBLH 4UAOB 3CUPB 3RZCB 3CJJA 1DDHA 1GCFA 3BP5B 5CGTA 4EZMA 4HUWB 1ZVSB 5DUBA 3KAAA 5FV2A 2CRMA 4M93B 1TJGH 3WO4C 5DJXB 5MHSE 3OXSA 4HUXA 4YC2C 4TRPL 3QQ9D 4I9WE 4G8GA 3SDAD 4Z7WE 5I30L 1CICB 3ZE2E 4DGYH 3SDCD 5SX4H 5L7XL 2GJJA 3VXMD 4HMDA 3KPQA 5E9DD 3MRHA 4X9HA 4PLOB 1X7QB 4YHZL 3TT3H 3LZFH 4JFYB 3BZ4A 2DQGL 3U7WL 1HHIA 1ZHBA 2DIAA 5TE4H 5EBLB 5D2LE 2PUQT 5EBMA 2XZCH 1VERA 3HTLX 4K94C 2KDGA 5C6TH 1KFAL 1YQVH 1TVHB 1A7PH 4XGZA 4MQTB 1BVKA 3HAEG 3VD7A 4KI5C 4OM1H 2A6KB 3O9WA 4M7JL 4U3CA 1MCWM 3QI9A 4JVPA 1MI5D 4RBPH 5E7FA 2NX5E 1OGTB 1UB5A 2A9MH 4FQHB 5C9KA 4XPGL 2LU4A 1EFXD 1PJ9A 3O6MH 1BZQK 2GJ6D 1Q1JH 4MQXD 4ZO8A 1IMHC 4GAFB 3I75B 5AYQA 1DBBH 1P7QD 1N7MH 5IVXF 3T2NL 2NY5H 4JY4B 4F8QA 1OSZB 1WVZA 4ZFFA 1KLUB 1Q72L 2AXJA 3NZ8A 2VQ1B 3TO4A 4DEPC 1MJ8L 3S37L 1U8QB 4R4BA 3B9KB 2WQRA 2CR6A 1A47A 3R0NA 3H2WA 1I9RL 2IAMC 3CDGB 1A7NL 5C07D 1YMMA 2LAAA 2IMNA 1NANH 1XF4A 1G7IB 3HC4H 2ZNXA 2E7HA 4BKLA 2HG5A 1QNZH 5GIRA 4JZOB 4PJIE 1Q0YH 2FGZA 1NDGB 1U8OA 2FH8A 4WTZG 5J9PA 1B4RA 4NQTA 1JPSH 1R24B 1PGRB 4JFED 5IF0B 3RZWA 1WWCA 5D7LE 5INDB 3BVNB 1RURL 2DQCH 3L5XH 1CFTB 4ZS6D 2AK4E 4HK3N 3SKNB 2WP3O 3PHQA 2V5TA 4ZFGH 1NJ9A 3OGCA 1DUYB 3QUXB 4HLZH 4YHOL 5F89B 1BJMA 3LH2L 4Y4KD 5GHWL 4X4XB 3VXUA 4UTAL 5EN2A 5GGQL 1RU9H 3QXAB 1BQLH 3QDGB 4HUVB 2EO1A 4Z7OF 1GZPB 4PJ5D 3UJIL 1R5WA 3WDJA 2BHUA 4F8TA 4HH8A 3O6KH 4Z7UE 2BSED 3N50A 1HHGB 2BSRB 2R8SH 1RZKC 4KROC 4L9LB 1EJOL 4B7LA 3VI3E 1QEWB 5CBEB 1KNOB 4YR6B 1MFDH 4PJGE 3VH8G 1MCRA 1VCAA 3C60D 5BVPH 3RIFF 3NVQA 3R1GL 3FO1B 3K46A 4X6CF 4OFYA 3QNYA 4XVSL 3KHOA 1QVOA 5ACMA 4ODHL 1CG9B 1SY6H 4QRTA 3N1PC 5GRWA 3NIFF 5IFHL 2W9DL 4B53A 4UV7L 2A6DA 2Y36L 3CFJA 1M7XA 5F7EH 2Y6SD 5KJRL 1MNUH 2MWCA 3PWVA 4OZFA 1AO7D 4ETYA 1S7WB 4J3TA 4HPOL 1FYTA 1JNLL 4PGDA 5J11B 3NGBC 2W9EL 2B7DT 3Q5TA 1QLRA 4P5KA 3Q6GH 5I15H 5CD3A 5GRVK 3ZDYE 4OQTL 1CK0L 2I9TB 2HKHL 2VDQH 3HLAA 1UZ8A 3FTGA 4ZTPL 2A9NH 4DGVH 1HKLH 5F96L 2ZOKA 4G6KL 3ARBB 4EDXA 4LMQI 3MSPA 3ZDXE 5IVXB 1DEEA 3U0WH 1NCWL 3UDWC 5D93B 1R3KA 5D1ZB 3P4MA 4M5YH 1DVFA 4C83B 1CD9B 4NNYA 5CGMA 4Z7VB 1KULA 3U48A 3CGTA 3QPXL 5C0BA 5C09D 3QUZD 1KPVB 2Z31B 3W5MA 4UUJB 4TYUA 3A6BH 2C3VA 2JK5A 3R06B 4ZUUB 2C3HA 3SOBH 2CDEA 5T3XE 4QT5A 1RJLA 1AR2A 4HWZB 5ETUA 4QEGA 4HJJH 4YAQB 5K9JH 4X4ZA 4FTVB 4LOUC 4Y4HB 5A40E 1JGEA 1F8TL 4XXCA 4JG1H 3VGGA 2VKWA 2VN7A 3MODH 4LAQL 3L6FB 5BJTA 2UWEF 5IJKA 4PJCF 4RAUB 3MNWA 1A6ZA 1UCTA 2GJZA 2B1HL 5BRZA 3QIUC 4NQSA 4ISVA 2H2PC 3LHPL 4G8EB 4S2SA 4Y16D 3C6LC 3MZGB 4WFGD 5D72H 3CVHL 3HAEB 4ENEC 5JLZA 3ZDZF 3NFPA 1RI8A 3P0YL 1HSAA 5HGHB 1OB1A 1W72B 1XIWC 5JPNB 2XNAA 5TDPA 1DN2A 2DS4A 1FFNA 2YBRA 1TQBC 3GI9H 4X4ME 5D7IF 3T4YB 3MX0A 1MLBA 3QEUB 5CEZH 5INCA 1I7UA 4GRLB 5DJCA 4PY8I 4U2ZA 3DECA 4I48B 1NBYA 3DBXB 5IESL 3VXMA 4NGHH 1PX3A 4PRHD 2WK2A 5IJVA 5E9DA 1X44A 2FGWL 3ZYIA 4P4KA 4HZLA 4IRZH 5BV7H 3MLWL 3ULUE 4ZPVB 2VDKH 5LGHH 2EDXA 3JWDH 3ARRA 2DQHL 1IZJA 4MCZB 2QJDA 3RWJB 1MUJB 2F8OA 3S96B 2BCKA 3I3BA 3IJSB 1LO4H 2AJSH 2FJFB 2HTLD 4ODBD 5F8RC 4O2CA 5DJDB 2BC4A 5BS0A 3ECBB 4PJ9D 3P9MB 4XAKD 2XG4A 4R6UA 1DFBH 1G7LA 5L8LB 2I5YL 1CDUA 2FSEA 2Z0BA 2FWOB 3O3BB 3TFKC 3QZWA 4YBLB 4DZ8A 1G7MA 5DHXB 4PIRF 1F4YH 3KPSA 1GOGA 2I26N 3IAQA 3VXSE 5FHAH 5DUMH 4UT9L 2LV4A 4OLYH 3RNKA 4HIIA 1PVHA 4Y5XC 4OJFH 3T0ED 4WW2A 3QCUL 2XA3A 2VLKA 3LOWA 3VWJD 2HYMA 3GRWL 1NCDH 1QRNB 2I9LB 4WI2A 3AS2A 2E8ZA 5I9QC 4R3SA 2A6JA 4EUPH 1WBXB 3O6FC 1I3UA 3S35X 1EO8L 1FNFA 1N4XH 3F6LA 4Y1AB 3LN4B 4NC1E 3C8DA 4JO2H 4HQQL 1I8LA 1TTGA 4HDIB 3GKZA 2ADIA 2WW8A 4GOSA 4JM2D 2P5WB 2V5RA 2Z9TA 1S7QA 4LMQE 4ZO7A 3S88L 3HI6L 2B4CL 3UC0H 1GJIA 3FKUS 2IPUG 4GAGL 4FQQA 4XVTH 4NCC1 1FLTX 2GIYA 4JAMB 5CLWA 3PF2A 5CIPB 4F9PA 1KENL 3D85B 2Y25A 4M6OL 2EXYC 2VLRD 5CZXC 4M7KL 4MZ2A 3REWB 5BQ7B 3JV6A 1WISA 2VDOH 3OJDB 4NO2B 1FSKB 3ES6A 4X6DA 2EXWD 1U92A 1JMXA 5D6CB 5HYJB 5JO5A 2EDTA 3NBNA 5E24E 2BVTA 3TNNB 1HE7A 5D7IB 4PJAF 5JDSB 1KCRH 3CNKA 2APFA 5GPRA 5C2BL 1FO0H 3BKCH 4L3EA 3UO1L 4PG2C 3GSNH 2XKUA 5DFVD 4WUUD 4JB9L 3NOIA 5CJQL 3QEQE 5HHQA 5BV7B 2AJ3A 4OGXL 5F6HJ 4WV1C 5C7XL 2JB5L 1SYSA 1DR9A 1FV1B 1LNUA 3TO2A 4ODUB 5I2IB 1UH4A 4QXUL 2UY6A 4G80B 5IV2A 1XGYL 2DQEH 2IFFH 4UIKH 4QGTA 1QFUL 5E2JA 1RJZB 4B0MM 1KIQA 5CJOL 4P2QE 3S3PA 5EU7E 3X12A 3PQYE 3ZE0E 2ITDA 2FYYA 3LPGA 4ZPTB 5IB1A 5DZOA 3ZSTA 4XPTL 4OZGB 1FNEB 3HI5L 3BO8A 1H0DB 4HCRA 5ID0A 3MUGB 3GIZH 4Q9BA 3QDME 1PQZB 4QF1B 2OZ4L 5HYQB 4HWUA 2YWYA 1B6UA 1S9KC 4K9EL 3CH1A 3RVXD 3HNVH 2HMIC 4MMXC 5DMGD 3RPIA 1QBAA 1PX4A 4FP8H 1CQKA 2W60A 3ARUA 2AEWA 4XBEH 3QHZL 1MJUH 3QR2A 4JRXB 4XWGH 1CD0A 5HGDA 5IBTH 4TNWK 5C08B 4EUPB 4W6YB 1JNHB 1J7VR 4XP9H 5T1MB 4JRYD 2ZSWB 2HJKB 1QFHA 4R96B 3F58H 1T7YA 2OSLA 4J3OC 4HV8A 4MNHB 4M00A 3EO1A 3LKRA 3G6AA 2A1WL 3GJEA 1WZMA 1T7VA 2BHYA 4P46C 4EI5D 3LPFA 3IJYA 5FK9A 3V6FA 1MFCH 4GQ9H 4LNRB 3L3IB 1ZHNA 4UU9B 4R97B 3EHBC 5HI3D 1SVZA 2RGSA 5ESAA 5EU6A 4E41B 4OCLC 1TJGL 4QHKI 3QUYB 1KB9K 3PGDB 3IVKA 1HXYB 5I74B 1HZHH 4BH8A 3UCRA 4HF5H 1MOEA 2J8UB 4CW1B 1AGBA 4Y16A 3B2UC 4N0CD 2EDDA 2SEBA 5I75B 3BUYB 4XB8A 4Q2ZB 1SHMA 4DGYL 2FDBP 4X6FA 3H9HA 3PL6C 1FP5A 1I1CA 1U8KA 2X9YA 1CXKA 3ARTA 4BK5A 3ELAT 3TT3L 3LZFL 3P73B 5I1LB 4Y0GA 4PJXB 3D5OF 3K4DA 1CS6A 3U36B 3RY6C 5TE4L 1SMAA 3DO7A 5JW5A 1BLNA 3FRUA 2YPKB 1IILE 2F54A 2XZAL 3N1GC 5HYFA 3D69B 1X5JA 4IS6A 2HT3C 1A7PL 5DJZB 3STBA 2ZCHL 3VFRA 5L2JB 2CKBL 2NW2B 4GAYA 4OM1L 4DJMA 4JFXB 3O4LE 2MQ0A 3AS1A 5IMKA 2F58H 3BJ91 4WEBH 1U8LA 4CRPA 1A7QL 2BVQB 2VE6B 4JJ5A 1Q1JL 2VISB 1XCQB 4X6BB 3VRIB 5JIHA 2AAVA 1DBBL 3WFEH 1AIFA 5IW1A 3U83A 1TCRB 2NY5L 3OB8A 3LKPB 3O4OC 4J3XA 4G6MH 4X5WA 4TNVF 1OAQL 4OV5B 5BOZG 1GIGH 1H5BA 5EIQA 5E5UB 4PG9B 2FD6H 2PR4H 4NUGH 4PJ9A 3JTTB 4D0DB 5DTFA 1W8OA 3D3VA 3RL1B 3IT8D 4PRDB 2RQ8A 1CDGA 3WL9B 4JDZB 2ZUVA 4NZUL 1QBML 4EOWH 1K3ZA 1YEKH 4HKJA 3HS0B 1F6FB 4WWKA 1TNNA 1D5ZB 1QNZL 1KUMA 2CRIA 4PPTA 1Q0YL 5SX4I 3VWJA 4U31A 4QLRA 3SCMC 2HT2C 5KANI 4MXWH 5FA3A 1S3KL 4WO4D 4E42B 3TT1L 2PCPB 1HH9A 3SE9H 2XFXB 3U0PB 2CUMA 4XNXH 3WO4B 1H3PL 4ZFGL 4PRBA 2DIJA 4C56B 4OLVH 4M6ML 5H2BA 4YC2B 3H8NA 2OI9C 3QJFA 1GOHA 1CT8A 1ITBB 3OKYA 4AYFA 4JM2A 1CLZH 4GXVL 2H2SD 4RQQB 4V1DB 4MQ7A 1BQLL 1OSPL 3MRNB 4JHBA 2V2TB 3QPQD 1RHFA 2D31B 4XT1C 3O6KL 3NCYS 4J4PA 3CK0H 1YEGH 2C5DC 3FHAA 4WI9A 4HMEA 3U46B 1I8MB 1JPFA 1E4XH 1M1SA 2IAND 1MFDL 1RZIB 4WRLA 4NRZB 1JJUA 1A02N 4OZ4A 4PP2B 5DEGB 5LXGH 2D2OA 5BVPL 5JZ7D 2OBGA 3R0MA 4HKBB 1CI5A 3DUSA 1QFPA 4NP4L 4RGOH 1U6AH 3V6ZB 4PS4L 1SY6L 4AY0A 5I73C 3T08A 4NHCH 3DWTA 1VFAB 3AS0A 3IXAA 4PREB 1B3JA 1MNUL 5F7EL 1UM6L 4JFDE 3DIFB 4JPIB 5KSBF 3MNVB 1NANI 2AABH 4NBZB 4O2EA 1T2QH 4IMKC 4WI3A 2J7LA 3Q6GL 3UPRA 4KUZH 1N3NA 1AY1H 1C16A 4XXDB 1QSFD 4HXBH 1FFPA 4YHPA 1KCUH 1HINL 4MD4A 5GSRB 2FO4A 2VDQL 1HK6A 1VGEL 1QSEB 4DUWA 4P23A 5A2KH 1ETZB 1EHLL 1DCLA 1IGTB 4DGVL 2R2BA 1HKLL 2IAMB 1P5VA 5EC1B 3EDFA 3ULUC 1DUZB 2X40A 2WIIA 2XTJD 1EMTH 5SWQA 3GI8L 4S0TD 4X5XB 8FABB 1K8IB 3E6FA 4M5YL 4MCYB 1P4LB 2P24B 1TLKA 3MRQB 2WV3A 5C0CA 4WW1A 3BN9D 5KVFH 1B0GB 2Z4QB 3SOBL 4J3VA 4W81A 4YGVB 3QNZA 4LVHB 4QTIH 2NY2D 4LEOA 1GGUA 4QHLB 4JY6B 5CHNB 4JHAH 1S9XB 5K9JL 1EGJA 3TH2T 3BT2H 4XNYH 3X13A 4E0RA 1TZIA 4MA7L 3PDDA 4UZGA 4JG1L 5EOTA 5D2NC 3MODL 3O2WH 5IIEA 5D8JH 3MLRH 3S34H 2IPUK 3PWPD 4ZAKC 4DFIA 4YPGA 5TPWL 2N1KA 3N1MC 4IEFB 1WAAA 4R0LB 3OJ2C 2VABB 4KJYA 4NPYA 1BF8A 2EDFA 3BP4A 4P48A 3U30B 5C0BE 1I85C 1T1XA 3FQUB 4IRJC 3NCFB 5DDHB 1VACB 4KROB 3K4ZA 1NCBH 4MJIA 5JOPD 4LRIA 2G2RB 3GI9L 4FFVD 4MSWB 2R1WA 2HVKA 4S1RH 4RGNC 4ZO6A 3FONB 5TDNB 3PHOB 1BQHB 2V9RA 5CEZL 2GUOA 3RWCA 4ACPA 2AQ2A 3HPJB 1XF5B 5L2KB 4FABL 4F15B 2G75A 1T0MB 4K2UL 1A7RH 3GUTB 1JYWA 5BRZE 1OP3K 4EN3C 2R39A 5JW4N 3GSUA 3DXAB 4IRZL 1E4JA 3LQZB 1A1MB 1JE6A 3QFJD 2VDKL 5LGHL 3NGBB 3D1MC 3FB5A 3JWDL 4XTRD 1CFNB 5KN5A 4KK6C 2PXYB 2AJUH 2OTUA 3L9RB 2YKLH 5B39A 1LO4L 5IR1B 1NGPH 1CZ8H 3S36X 5KSBB 1U91A 4P2OD 4OGAC 5I16A 1IC7L 4H26B 4GBXA 1NMCC 5I1AB 1JGVL 2VDLH 3X3FH 1DFBL 4JCLA 4GSDH 3V0WH 2WUBH 4AT6A 3VXME 5ESVB 5E9DE 3HCVB 1F4YL 2HH0H 4FFWC 2B8OT 5DVKA 4JFFB 1MCPH 3IXTA 4OLYL 3FRPG 1ES0A 1IAIH 4OJFL 3GJFB 4HAGA 2VLJD 4R2GC 2HKFH 4RFOL 2NTSP 1FZMA 3GMRB 1NCDL 1K6QH 3MV8D 4HFWA 4HS6A 3RGVC 1PFCA 3GGWA 3TN0B 3ARDC 3NFNB 3OHXA 2BVEA 2F53A 5FKAA 5TQ2H 3T3PF 2GFBB 1JUFB 1N5YH 1EUUA 1N4XL 3UTQB 4F7MB 4W68A 4LASH 4JO2L 5E8PA 5ITBL 2MKWA 1Y0LA 5BS0E 3SDDB 1MI5E 5D1XC 1OGAA 4K7FB 3QIUB 4OV6F 3G6JB 3ETBF 1T5WA 5C0JB 4MQSB 2GJ6E 2A38A 1NMBH 4L4VD 1XIWB 3K0WA 5D5MB 2RIKA 3QNXA 4KU1A 3UC0L 4YIQB 2VLKE 4XVTL 1TQBB 5DMKA 3DGGA 43CAB 1DBKL 4M8VA 1YEIH 3AY4C 1JBJA 2OTWA 4UQ3B 5TQ0H 1T2XA 4LIQE 4QRRB 3VFPB 3DVIA 1VSCA 5DMJB 3RZCD 4QHNA 5GZOC 4YEEA 3VXRB 4IRSC 3L7FB 2ZKHH 2VDOL 3MZTA 1EEUA 5C07E 2B20A 3MRRB 5DD6B 3OPZL 1P6AB 2HN7B 1EZVY 2JB6A 5CSZA 4NZTL 2GK2A 2W59A 3L5IA 1OWRM 4B50A 3ARGC 3BE1L 3ZKQD 1KCRL 5GSVB 4DVRH 1IAMA 4AIZB 1FO0L 4OLUL 5IVZB 4HIJB 4P2RB 3KPRA 1CICD 5C0ND 4UINH 4JFEE 3N1QC 3P9LA 2VYRE 2EE6A 1T80A 1YN6B 1AGFB 1EHAA 1T0PB 2BK8A 4GW5A 3W0WB 4D94A 1A6UL 4P5TC 4H88H 3UTPD 3ARFB 3MACL 2H8PA 1U2CA 3Q5OA 1D6VH 3U79A 3WLWC 5BZDB 1ZAGA 4UDTA 3RVWD 1HN1A 4OB5H 3MV7A 1MAML 4OLWH 4MLIA 4BQCA 2DQEL 4HWBH 1A6WH 4MX7B 4LPCA 4UIKL 3L7EB 1SM3L 1GYAA 4OCSL 5M95B 1KJMB 2P46B 4O5LH 3D0LA 4KKLC 4LDEB 5DHVA 3CXHJ 4NQEB 5FGSA 3JWOC 5JOFB 2EIBA 3B5HA 6FABH 1VFBB 1JGLH 1S9YA 4M7LH 5AUMA 4Y5XB 3VGDA 1IKFH 2HVJB 4UNVA 1N5AA 5GGRB 3HNVL 1TTFA 1OAYH 2DLTA 3KNBA 3HRPA 3ILPB 1MCFA 5F7DB 3OZ9H 2XZQH 3O6FB 2Q6WA 3VJ6A 4XBEL 1MJUL 4YDLC 2WINB 5IBTL 3RKDC 1FNGA 4QXTA 3QQ4B 3WN5B 3KYOA 1U42A 2J1KA 2EKSA 3C5SB 2XQBH 3HMXA 3KYNA 4N8VG 3VFGH 1LEIB 2ARJA 5DQ9A 3W82A 3QG6B 2PW1A 4L29B 5CGYC 1AO7E 2W0PA 4I3GA 3X14B 4PGEB 3F58L 2VZUA 4CBPA 4KK9C 3RWGB 3BWAB 2K7PA 1X5LA 3O2DH 5EIIA 4MNGE 4X4YA 3SPVA 3EDJA 3VXQB 2YN5A 4QWWD 1MFCL 3O3UN 1DQJA 5MENB 4O00A 4GQ9L 1I9JL 1Q9WA 3GJFK 3RIAK 3O9WC 1TMCB 3DURA 4RIRA 5AAWA 5K59F 3QI9C 3WV0A 3IAGC 2WBJD 2WUCH 1HZHL 4DOHB 5JQ6L 5E00B 3BPCA 2UZYB 1NGXA 4MXQD 4U1HA 3QUXD 1J5OH 2FEEL 1ZLSH 4G7VH 1QA9B 1PG7W 5FM5M 3TYGH 5C09E 3D6GA 1T04B 3T1WA 2VAAB 3G5XB 2X4RB 2HJLA 3I02B 3QDGD 2F15A 2NY7H 2DWDA 2YUVA 4ELKA 3MJ8B 1S9WA 2FX9H 4ZOAA 3F7VB 3ARWA 1UWXK 3MOAH 3PWLB 1BD2A 4P9HL 2R4SL 5EU6E 4LLAA 3OX8A 2EZ0C 5DO2D 4DW2H 3NIGE 4EJ1C 3KXFA 2C3GA 4U6YA 3DJ9A 3U0TA 2C7UB 1JZ6A 3RVUC 4OUOA 4WFGE 3ARZA 4HKXB 5EBWB 1MHHB 2F58L 3DMMB 3IDNB 2A73A 3MUJA 4WEBL 1M6OA 3DGCR 4Y19B 1NBZB 1T7XA 3O8XA 3PGCB 3X3GH 1X5YA 1YMHB 2ICWJ 3ORJA 3WFEL 5FECA 3C5JB 4GJTB 5ICZA 5J4MA 2R0WH 1MRFH 1NUGA 4PRPD 3FQXB 4R26H 3IF1A 4POZD 1GIGL 2X1XR 5IB3A 5DD3H 2F54E 9CGTA 2FD6L 5E70A 3LSOA 2PR4L 4NUGL 1IFHL 5GS1C 5HI5D 3F12B 3BI9X 4PRHE 1IGMH 5HHMB 1G6RH 1NLBH 4KQ3L 5I19H 3S35H 3H9SB 1QOKA 3MUZ1 1YUHA 3ARBD 5ILTH 3EFDL 2LVEA 1IGIL 3T77A 3MJ7A 4GFTB 5D1ZD 3VMNA 1IJ9A 3OF6D 5JUEL 3MV8A 3BRFA 2GTZA 2Z31D 2QHRL 4MXWL 3LEXA 5DRWA 2R15A 4GRWB 2CRZA 2H9GB 1RUPH 4YDIL 3OV6A 3SE9L 1NLDH 3LQAH 3OKEA 4LBEA 4DKEH 1QRKA 2VXUL 4U1IB 2YA2A 4XNXL 1N6UA 2JLLA 4XAKE 1T1ZA 4OLVL 2XG5A 4R7DB 4JREC 3QYCA 3VFMA 1ZANH 1XF1A 3D3VE 2R2EA 4U1JA 2DQDL 2AGJL 3C5ZC 3M17B 1CLZL 3PUCA 2CJUH 1K3IA 2PYFB 1KIPA 3RBSA 5JXEC 4ONHA 3UTSB 5CD5C 3FFCA 4HS8H 1S7UB 3PL6B 1LO5B 3T0EE 4ZTOH 4AENA 4A6YH 4JDVB 1ZE3C 2APVA 3CK0L 4APQD 1YEGL 2FEDD 1YPZF 3MRPA 1E4XL 3CUPA 5CBAB 2BHZA 3BP5A 2UZIL 5JNYA 1Q9OB 1JK8B 4UQ2B 4KJWC 4HUWA 4NSKB 1ZVSA 2I60H 5LXGL 1P5UA 5DEFB 2GSIB 2F74A 3MJGX 4U1GB 3FMGL 5DJXA 3AU1B 1DVFC 4RGOL 3DLQR 4X0KB 4GRLD 4NIKB 3WD5H 4NHCL 4XPHH 3MGTB 2IADB 1IE5A 2ZUSA 1T6WA 1C08B 2B5IB 5HHOD 1JZ3A 1JYVA 4ZS7L 1CICA 3BZEB 1XGPB 2LABA 4M7LT 1VHPA 2AABL 1IM3B 4OCWH 1T2QL 4JHWH 1D9KD 3C9NB 3B2VH 2J4WL 4KI1A 4XMKH 4JFYA 4KUZL 4LSTH 4XXCC 1AY1L 2FX8H 1UFUA 2VLRE 2CLRB 4WWID 4YZFF 3BOVA 5EBLA 2BSSB 5J89A 3O3AB 4DTGH 4MDIB 2VTFA 2AXHA 3KLSA 4Y2DB 1ROWA 3RVTC 4N1HB 1TVHA 4GS7C 5JW4R 1EEZB 3E2HC 3PHSA 1NC2D 1ZVYA 4S1DD 4ZFOB 2VR4A 1EMTL 4JQXA 4QHKJ 4W4NA 4NT6B 2AEPH 3SQOH 1OGTA 4FQHA 3DETD 1OF2B 5F6IC 3N9GH 5KVFL 1G6RB 2ZUQB 4WUUE 1ZA6B 5SWSD 3SCMB 3I75A 2ATKB 2ZG3A 1KYOJ 4Z77B 4QTIL 4JY4A 1OSZA 2IFGA 5HDOA 5C6PB 1ULVA 3A67H 4JHAL 3BT2L 3RUGB 3JUYA 4AJ0A 2JCCE 3B9KA 2WBWB 3DTXB 5DJAB 1FFRA 1TJHL 2IG2H 4TNWF 3O2WL 4P4KC 3QWOA 5TDOB 3S34L 2OI9B 3TIEB 4GG6F 4KJQD 2R2HB 3EIFA 5DVNA 5DI8B 1G7IA 1ZTXH 1U3JA 4PRNB 4DN4L 5C0CE 2XXMB 1JHKH 1CFVH 4JZOA 4MA8H 1NDGA 2VWEC 1R24A 1HCFX 1NCBL 3LRHA 5D6DA 2UV3A 5J1TC 5IF0A 3BVNA 4LFHD 4A6YB 4S1RL 1CFTA 2VXVL 1DUYA 3QUXA 4P59H 1T7ZA 4PJBE 1I7RB 3LY6A 4X4XA 3MV11 3BHBA 4WW2C 4FZEH 3CFDB 3QXAA 5TF0A 4MAYB 4KXZH 1WAAE 4HUVA 1FYHB 2J6EL 3RWFB 1KBGH 2DKSA 4NRYB 5E95B 4U6TA 3ARYA 5CILH 4QGYA 2WWKT 5EH1A 5FM8A 1HHGA 4JLRB 2BSRA 2CQVA 2AJUL 4L9LA 1JN6B 4MJIE 4PJ8C 5KSVA 3HNTH 4JCMA 1F3RB 2YKLL 1CF8L 3BPLC 1KNOA 3BPNC 4YR6A 2K3TA 3OXRB 1I8LC 1NGPL 2V9QA 2YD5A 2QADB 4XPBH 3PV6B 2RAMA 3W11C 4OSUL 3WHXB 1FFQA 1NBVH 3FO1A 3PWJB 4CU6A 3R8QA 2HTKC 4NOFA 4PRIA 5GRJH 2AV1B 2Y23A 1CG9A 4QOKB 4GSDL 3V0WL 4HJ0C 1IM9B 3GNMH 4CVZB 3CAFA 5JW4M 1S7WA 1MH5B 4F9PC 4NKDB 1IAIL 2P43B 2XWJB 3SGDH 2HLFC 2FJHB 3ALWA 1IEHA 2Q3AA 2HKFL 1MCOL 3C8KB 5IK3B 4R4ND 3D25B 3TIDB 3QQNA 2I9TA 4ODSH 1N5YL 4PGCB 2NMSA 1LEGB 4JKPL 3AREC 5D2NB 1Q9KB 2FR4B 1BGXH 4LASL 1WF5A 1MIMH 3I6LE 3GZKA 4XB7A 4ZAKB 3ARBA 3HG1B 5C08D 5IVXA 3B4NA 1H3WM 4C83A 3OF6A 4Z7VA 4WTWA 4WGVB 1NMBL 4Q6IC 1KPVA 1LILA 4UUJA 3RWIA 3HC0B 3R06A 4ZYKA 4ZUUA 5DA0B 1FAIH 3CZFA 2F5BL 4HWZA 1YEIL 1TCMA 5TQ0L 4RGNB 1I8KA 1SEBB 4YAQA 3U6RB 5E5MA 4FTVA 4Y4HA 4RMSA 2ZKHL 3S7GA 3G5ZA 4UMGA 4AL8H 2FCBA 4LVNB 4XCYB 3FB8A 4LF3A 2XYCA 4RAUA 4I0CC 5DRZB 4TSBH 2WWMC 1J1XH 1U8PB 4G8EA 2AI0H 2BXZA 5T3ZH 2DYPD 4RNRB 3QUML 1KB5H 2W0KA 4B5EA 4UINL 5HGHA 1W72A 5JPNA 3OMZA 1I3VA 2F9BT 5KS9B 4OD1H 5SX5K 1CLYH 3T4YA 4H88L 4L1DA 3QEUA 1B4JH 4YHLL 5DHYA 1JF1B 2E6QA 3FQWB 5C0EB 4OB5L 5SWZD 4OLWL 4HWBL 1RZ7H 4KJPC 1NMCB 5TE6H 3BFOA 5T5NG 5IBLC 4I48A 3UYRH 1KPUB 3DBXA 3MGOB 3G04A 4YPJA 3F6IA 2APWA 4O5LL 3D39B 1JP5A 2GYSA 4OIIH 2OR7A 3RA7H 2IJ0C 3BGAA 4RAVB 2NXYD 4M7LL 3KPRE 4ZPVA 1Z9SA 4CJ1A 3WIHH 1IKFL 4R2GB 4MCZA 2IANE 4NQDA 5HD8D 5J8OA 2E9WA 3RWJA 1MUJA 5CZVL 2NLJB 5KZCB 1RQ5A 3RGVB 3OZ9L 1BFTA 3ARDB 3IJSA 5EU3B 2MPAH 2XZQL 3B5TA 4J1UB 4WTZA 4PB0H 3WNKA 2FJFA 1BFOB 3MRBA 3DI2B 2FLBT 3FO9B 4LLVB 1JTTA 3BKMH 3MV7E 3SDYH 5GRVL 3ECBA 4XRCB 2GEEA 5JMRA 2D0FA 5D1XB 1AKJD 4PJDE 3UP1A 2FWOA 4GW1B 5F9OH 3VMPA 3WKNA 4JQVA 1DBMH 1IGFL 1IGJB 3LRSB 3P30L 4U1MB 1UJTA 3O2DL 3WKMH 4DVBB 5KSAB 1HXMB 1QSFE 2BX5A 3SKOB 2I9LA 1QRNA 2BZDA 4YDVB 1KJ3L 5CEYB 1X5ZA 1WBXA 5FCUH 3KPLB 3T2OA 4IRSB 4PJEF 4Y1AA 3JVGA 2WUCL 5GGSY 3LN4A 2XTJE 1KV3A 3GSRB 5DC4B 5FGCB 2ZSVB 1J5OL 3KR3H 1ZLSL 4G7VL 4HDIA 3ARGB 3TYGL 3QDAA 4OD3H 4WDIB 3MUHL 3QRFM 4N8CH 1T1YB 2P5WA 3FB6B 4V1DD 3UTTD 2ADJA 2NY7L 1LE5B 3QA3A 4F7TB 1J10A 4KK5C 2YUWA 2FX9L 1XR9B 1CFQB 1ED3B 1IC5H 2DLHA 3RWDB 4P5TB 3MOAL 4JAMA 1X6LA 5CIPA 3IKKA 3D85A 1BBJA 3VE0A 5KOMC 4N68A 2DWEB 2YPLA 3REWA 5BQ7A 2V5SA 3PWPE 4DW2L 3OJDA 4MB3A 4NO2A 3KPNA 4WWKC 1ZGLB 1I8IB 5D6CA 5HYJA 3I84A 4C4KT 5IW6B 3TNNA 3S36H 5D7IA 5JDSA 1N64H 1AHWA 1G7QB 1KACB 3CX2A 1J05B 4TPRH 2VXQL 3X3GL 5CJXA 5JOPE 3CDFA 5DUBB 1NFDF 3HR5B 1Z2KA 3S97C 2OL3B 4OZHF 3OXSB 1MRFL 4R26L 3HUJF 4BSJA 1BD2E 1FV1A 1V3MA 2VR9A 4YDLB 4ODUA 5I2IA 2R1XB 4G8GB 4M6NH 3WS3B 4NNPH 3VI4F 2YPVH 3S5LG 2DQUH 4H20H 4I1NB 2FZ3B 3CXHK 3F7PC 3MRHB 1IGML 2IAMD 4J4PC 1AD0A 1NLBL 4Z18A 5I19L 2R0ZH 4LP5A 3S35L 4ZPTA 5ILTL 3F7QA 4DK3A 3BSZH 4OZGA 1FNEA 3QFJE 1H0DA 3MUGA 1R3LB 3GBMH 3IFLH 1LP9F 1PQZA 4QF1A 5GS3A 4HC1A 4KKAC 4BZ1L 5HYQA 2VERN 5ACZA 5FM4A 1L4IA 4FQ2H 4RWYH 3U9PL 3QDJD 4KTEH 1PW3A 3CFBB 4MNQD 1RUPL 4BYHA 3TA3A 1JHTA 1NLDL 3LQAL 3RVVD 3G9AB 3ABZA 2VL4A 3K1DA 4JRXA 4GRMA 1UB5B 2X1QA 2R0LH 5C08A 4EUPA 1JNHA 2E7CA 4YHKL 5T1MA 2XXCB 1ZANL 2ZSWA 3G6DL 2CJUL 4R96A 3B9AA 4HS8L 4MNHA 1CQYA 1XFPA 4XAWL 4ZSOB 3EJJX 3VG9B 4RMUA 4BQ6A 1J0ZA 3MV8E 3W9DB 3WLBB 4P23C 5HPMA 4LNRA 4KROD 4X8XA 3L3IA 4UU9A 5T1KB 3GHEH 1JF6A 2I60L 1K8DA 5EZIH 4E41A 4JGMA 2JJWA 1XF4B 4I3SH 2LVCA 3FO2A 3QUYA 3GSXB 3PGDA 5BVJA 5L2KD 1HXYA 4WI6A 2OR9L 2HG5B 2J8UA 1GC1C 2R4RH 4CW1A 2R29L 2EDOA 5J9PB 2NQCA 4XC3H 5EFIB 3WD5L 4XPHL 3QXDB 3BUYA 4Q2ZA 4UTBL 3FFCE 4L4VE 4NQVB 5J1SC 4K3EL 1U93B 4PR5B 3H3BC 4CN4A 4OCWL 2ESVB 1R3HB 2NY1B 4Z7NF 4JHWL 3D87B 3DXAD 5IEKA 1PG7X 4XMKL 3P73A 3QZWG 5I1LA 4PJXA 4HK3J 1AXIB 1IBGH 3FOLB 3U36A 4TOYH 3VXUB 3GSNA 1CLOL 5DD5H 5EN2B 2YPKA 4PJAA 1JI1A 4XMLH 5AYUH 3CCHB 4DTGL 2C1PB 5GS1B 3D69A 1VEMA 5CJ8A 1KTDB 3LEVH 5DURD 2DBLH 5DJZA 2CLVB 5L2JA 2NW2A 5TFSL 5JHLH 4TTDC 4YO0B 1MEXH 2AEPL 3P0VH 2I25N 1MCIA 4NZDA 3N9GL 4OI8A 2BVQA 4JFPB 4MJ2A 2CSPA 1SJEB 2VISA 4JFFD 4X6BA 3VRIA 4U1SB 4KTDL 3UTPE 2DMCA 3LKPA 2P45B 5HVGB 3A67L 4OV5A 1U3ZA 4PG9A 3ROOB 1VENA 1ZS8B 3CFJB 4U4BA 4ZQKB 1LQSR 3WXVH 5F9WC 5EPMB 1SJVA 2IG2L 3PWVB 4LOUD 3JTTA 1D5IL 5B3JE 1J8KA 5C0AA 1FZKB 1FYTB 1ERNA 4PRDA 1NPUA 5IMMB 3C5ZB 4PGDB 1DLFH 3D2UA 4F7PB 3WL9A 1ZTXL 4JDZA 5L6YL 3O41B 3HS0A 4YXLH 1NFIA 3GBNH 1FN4B 2H2PD 1ZEAH 1D5ZA 1JHKL 3T3ME 3EUUA 3C6LD 1CFVL 4MA8L 1L9MA 4ENED 3KLHC 3JSSA 1UZ8B 4KUCF 2EDKA 3VWKD 1NDMB 1XIWD 2E6PA 3BH8B 3RJDA 3OB0K 4E42A 4GBXC 2RBLA 2PCPA 2ZOKB 4K3HA 5D71L 3RDTA 3RIAF 4AEFA 2XFXA 3MLXL 4QRRD 2EYRB 1DVFB 4P59L 3LD8C 4NNYB 3R8BB 4C56A 3Q48A 3VXRD 5I8KH 3QIBD 5C0GB 5KVEH 3IJHB 5A2LH 2EDNA 2C3VB 4XCNB 4QNPE 1A0QH 4D9QD 4FZEL 4RQQA 4V1DA 3THMH 3S5LB 1WFTA 4QT5B 5JA8B 2V2TA 5ETUB 5ICYB 5IB5B 1KBGL 1KJ2H 2APTA 4DZBB 4EEEA 2D31A 3DNKA 3Q5YA 3O45B 4P2RD 2YHGA 4Z5RB 1Q94B 1JGEB 3GB7A 3MR9B 4G6AC 3HNTL 1C5BL 2QSCH 3D9AH 3U46A 1J8HB 1I8MA 2EEDA 3EO0B 1RZIA 1UZ6F 4NRZA 4OZIE 4LPXA 1JRHH 2AJVL 4KVNH 3NCJH 1OT2A 4PP2A 5DEGA 3W0WD 3OR6B 1YEFH 1UXWB 5F21B 2KUTA 2VDRH 3QP3A 3S3SA 1EVTC 4HKBA 4GS7B 1UWXH 4GMSH 3ZYJA 3E2HB 2R1YB 3V6ZA 2EE3A 4QRQA 5GRJL 3EOTH 1OB1B 1CXHA 1LO3L 4MLSA 4NO0B 3GNML 1RIHH 4PREA 3Q2CA 4FQIH 4EQ2A 3VU2A 3QDGE 3DIFA 3TFKD 5F6IB 1FCGA 2MQCA 3CH8A 5L88H 3G5YA 1J18A 1WZ1H 2DM4A 4QYOB 2QLVB 1MCCA 4FQLH 1I7UB 4XXDA 3M8OL 3UTOA 4EIZC 2AXGA 5GSRA 2DBJA 4ODSL 1N6QH 4AEHH 2Q8BL 4UV4L 1QSEA 5IGXH 3O6FD 1ETZA 1J1OL 1T20B 4C55A 1BGXL 4J6RH 4EKXA 3D0VA 1MIML 1BX2A 4KRMB 1FAKT 4A2LA 1MIEH 5EC1A 3BD4A 1DUZA 2O5ZL 4NWUH 1AI1H 4XP6H 4ZD3L 4X5XA 8FABA 1K8IA 4TVPD 1TTUA 4MCYA 1UH3A 1P4LA 2P24A 1R5IB 3MRQA 1KYOK 3V5HB 4KXZI 2F8VA 3B9DA 1B0GA 2Z4QA 4PRPE 4YGVA 4QHLA 4JY6A 2BC4B 5CHNA 1S9XA 1H3GA 5MEND 5GS0D 3WO3B 1OTUC 4XWOC 5F7LB 3QZWB 2EXYD 3AROA 5CZXD 3WHE0 2GY7B 1F11B 1HH6B 2F5AH 3PP4L 5CSBA 2R56H 2CGRH 5C8JB 3RNKB 2RFXA 5HGGS 4HIIB 1JHLH 2AJXL 1YEEH 3L3JA 4WW2B 5EA0L 1J1XL 1HQRA 3SJVB 3BAEH 4I5BB 2AI0L 4WHTB 5T3ZL 4R0LA 4Z7VE 1KB5L 2FIKB 4LSRH 4R3SB 4Z6AT 1G0XA 5DDHA 1VACA 3PP3H 3AC0A 1IT9H 4PJ8B 3ULVF 3BKJH 1T3FB 4MSWA 5DT1H 4OD1L 3BPLB 3BPNB 4OGZA 4YWGL 3MRKA 3FONA 5DMIL 5TDNA 1BQHA 1B4JL 2AKRB 4FTVE 4YQXH 2NZIA 3WXWL 5L2KA 1GGIL 4G9DB 3ULVH 1KCSL 2XZZA 5EUOF 1FDLL 1RZ7L 4HIHB 1JFQH 1T0MA 5TE6L 3UYRL 1BREA 4AMKH 1OLLA 3GUTA 4MJ5A 3VFUB 4OIIL 1Z9MA 3RA7L 5DXWA 1CE6B 5GS0H 4TSCH 4OCMC 2LQRA 4ZUVB 3LQZA 1A1MA 4PBVC 1ORSB 3WIHL 1CFNA 1OW0A 5A43C 2PXYA 4G3YL 4DKFH 3L9RA 3HZYB 5I1IL 4PRAB 5IR1A 2J3SA 4PB0L 2HMID 2PO6A 3GSVA 1MELA 5KSBA 1FQ9C 2CXKA 1I9IH 4ELME 3V8CA 3AREB 4LGRB 3BKML 3QCTH 3SDYL 2OMNA 2HRLA 1MWAH 2NX5D 5I1AA 4XZUB 1RIVH 1I1RA 1ZT1B 3ZE2F 4CAGA 4Z7WF 1ZHLB 5TH2B 3BZDA 4XNMB 5EORL 5F9OL 1A4KA 2VJXA 5ESVA 2DLEA 3HCVA 5HHMD 4JFFA 5F7WC 1TVDA 3H9SD 4Q6IB 5I6XB 1LNUB 4PBXA 3TO2B 4LSVH 5IB2B 4HT1L 3HE6B 4FA8A 4JFQB 3GMRA 4P46D 3TN0A 3NFNA 5D2LF 1QHPA 4OFPA 1WUNT 4G6FD 2GFBA 3F7YB 4P99A 1ONQB 1ZLVK 3MREB 5FCUL 3X12B 3BMWA 5BXFB 3EHBD 3UTQA 4F7MA 1DSFH 3BRGC 5IB1B 4I0PA 1GVIA 1I1AC 1YC7A 5GGTH 3BO8B 3BUTA 2X4OA 5ID0B 4BZ2H 4H8WH 3O8XC 3SDDA 4NKOB 2E6JA 4K7FA 3QIUA 1T03L 1AQKH 1S9VB 2FL5B 3B2UD 4N8CL 4JE4B 2W60B 3W39B 4L5FH 3PL6D 5D5MA 4NCDA 4HULB 4YIQA 5HGDB 4NC0B 2AK4D 5GS2H 1IC5L 43CAA 3MJ6A 2GW5A 4IM8A 1HWHB 4UQ3A 2EICA 4XVJH 4OAWA 4QRRA 1FG2B 3VFPA 3VGAC 3ISWA 5ERWB 3KLAA 2ITCB 4S1SH 3EYUH 3VXRA 4Y1AE 3L7FA 3OKDB 5H35B 5CKGA 5DD6A 2HN7A 2HT3D 4LHQB 1AXTH 4JPWH 5F7MC 5FK9B 3S36L 4OF5A 5GGVY 4M48H 3V6F