4EOWH

Crystal structure of a disease-associated anti-human gm-csf autoantibody mb007
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
228
structure length
228
Chain Sequence
b'QVHLVQSGSELKKPGASVKVSCKASGYSFSRYGIKWVRQAPGQGLEWMGWINTRSGVPAYAQGFTGRFVFSLDTSVDTAFLEISSLKTEDTGIYYCATRPPRFYDKTEYWEDGFDVWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MB007 human IgG1 Fab fragment heavy chain
publication title Molecular structure of human GM-CSF in complex with a disease-associated anti-human GM-CSF autoantibody and its potential biological implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2012-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eowH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eowH01
1TCRA 4JB9L 2PXYB 5HDOA 4P2RB 1NC4D 4Q97A 1DQMH 3WJJC 4R3SA 3WNOA 3ULUD 4MVBC 3JV0A 3QFJE 4PJEA 5T1MB 2Y07L 1EUUA 1T20A 3CNKA 4BQBA 1T5XB 4X4ME 4PV8B 3I6GB 5T1KA 1D6EA 2X44D 3N1PC 3QIUC 4Z7UA 5HYJD 4HK3N 4MSWA 2APTA 1XGPA 1E4JA 1L7IH 2AXFA 2L7JA 4QRPA 1SJVA 5CMAB 3KXFA 1YEIH 3GSQB 1YEHH 2DI8A 2NY4B 4JZJB 2R2CA 4H20H 4MMXC 1UVQB 3QNXA 2GAZA 1VPOL 3BW9B 3TZVD 2FSEA 2ESVB 5AG9A 5ILTH 2QSVA 1AGCB 1CGVA 4PJGF 4UMGA 2AV1B 3BPOB 3HZYB 3P9LA 1S7QB 5HI5D 1XF1A 4I3SH 3OKNA 4YHKH 3MFGB 3G5ZB 1BOGB 5ADPL 3KYKH 3D18B 4XP5H 1A6TA 4WWKB 2DQJH 5JOPD 1J0ZA 2W9EL 2EC9U 4R4ND 1TLKA 1W0VA 3HE7A 4GKSA 4KTEH 5E1AA 5K9KB 5ESVB 2RQ8A 3MOAH 3P4NA 4HKXA 5JIIA 1CLCA 4M3KB 3GNML 4G7VL 4XVJL 1SJEA 3E6FB 3JV6A 4OJFL 2VISB 2G5BA 1ZHBA 4OD1H 2VDOL 4YHOH 5FUZL 4PRHB 3O4LD 3ULSB 1MWAH 1OCWH 2YRZA 5FM8A 4HCRA 2CIKA 2QQQA 3GSRA 4JPVL 3GMQB 4KK8D 5FHBL 5EUKB 3RKDC 5HVHB 5MEOB 3LQAC 2A6IB 3VJ6B 4HJJH 4XP9L 3ZT6A 5EBGA 4LSRH 3E2HC 1OVZA 3PG2A 1J5OH 4A2MA 2XZAH 1A0QH 1R5IB 3QJHB 2B2XL 4R0LA 5JW4M 3IAGC 1JNHA 2WMPA 3GSNL 3ARPA 4Q6IC 4L29A 2YWZA 3BI9X 1U8HB 4WDIB 1KOAA 3OR6B 3BIBX 5T5NF 2DJUA 2DQGH 1J1PH 5EO9B 2H8PA 3DUSA 2X1XR 4PJAF 2VABB 1OOAA 1F4YL 1EIBA 4PPTA 1IQWH 4D0CB 3GM0A 1JZ5A 3TN0D 1PJ9A 4X7EC 2FJFB 2F53A 4IM8A 1NCUA 5EU3B 5IHUH 3I9GL 4I0PA 3RIFK 1BIHA 4S1QL 8FABA 2HTLD 4OLUL 5CJQH 4NJAL 2DQTL 4NC1E 1AI1H 1I7UA 1Q9WB 2AK4A 2R1WA 2D7TH 1MAKA 4TSAH 5IMKA 4ZNEE 5E08L 3LKPA 3BEWA 4BH7B 3BGMA 3UXFA 2AJVH 1EA9C 4WI9A 2GSIA 3RNQA 1DBBL 2X40A 3VXSD 5B4MC 1TQBB 1U93A 3WUWA 1YDPB 1ORQA 5HPMB 5J1AB 5CZXC 2Q76A 3O0RH 2R2BB 1E4XL 3SJVA 3B9AA 6FABH 5JW3L 3V9FA 1K85A 1IGTB 2JKXA 4WV1A 2FBJH 4M6ML 2QTEA 3QCVH 4NQEB 1BQLL 3GSWB 3TWCH 1S8DB 4APQC 3MRNA 4CN4A 3ULVE 4Q9BA 3S3PA 5DK0A 2K9UA 3I3BA 3QO1A 1KCRL 1KIQB 3BYYA 3FO9B 4LLQA 4CBPA 5DC0A 1UWGH 3SDAD 4PJ8C 4BZ2L 5GGTA 4XPFH 1RIUL 2EDLA 2F9BT 1F6AA 1LP9B 3BH8A 1TJIH 4I0KA 3DROA 1V8HA 2DF3A 1Y6NR 1SYVA 4H8WH 4G6KL 3M1BB 1S78C 3HNTL 2VZ3A 4JM2F 4JFEA 2PXYD 4P2RD 2ZCLH 1KLFA 2NZ9D 4MJ6B 3H9HA 1KB9J 1V3JA 4UT6L 1ZS8A 4P9HL 3OR7A 1GAFH 2VSCA 2X9YA 4LLYB 3L6FA 4RNRB 5DO2D 5TF1L 4Z95H 4XNQB 5GS3A 3T0EE 1GZQA 3MV11 5DJ2A 3FAXA 1UB5B 1JF5A 4RISL 4PIRF 3CMOL 3ZTJG 1WWWX 3NACH 4ZPVB 4ZYKA 1CL7I 2ZKHH 1KXQE 3GSNB 1ZLVK 4HUUB 2VZTA 4XMKL 2P5WE 5KSBE 4XNXL 4OKDA 3NFSH 1BVZA 4MAYB 2NY4D 2Z4QB 1ZLWH 3L3DA 3MSPA 5L7XL 2ZZUT 1DBAH 1M4KA 1T66C 4IJ3B 3LQAL 1F90H 3L5JA 4ZAKA 2FO4B 1MIEH 4YXKL 3MTRA 5AAMA 1NPUA 2BNQE 2JJTA 2WUCH 4EKXA 1OP5K 5L6YL 4WEUD 2YA0A 1UM6L 4G8EA 4Z7VF 1I8LC 5K9JH 3DMMB 4XNUL 5DA4A 3GSOA 1X4ZA 4UDUA 1R5WB 3ZKNC 1Q9OA 3TBYB 1OWRM 4WWKD 1IC4L 4TUKL 3T09A 1IAOA 3DSFL 4DZ8B 5E6YA 4JY5L 3EW3B 4DKAA 3H8NA 3V4VL 1YMMB 4M7ZC 4XC3L 5EU6B 1HXMA 2VDNL 4ODHL 4ZD3L 1KTDB 5C2UB 4G7YL 5F7LB 5E7BA 4LLUA 1J11A 3CLEL 5L88L 3PL6A 3OKYA 4AH2B 1XR9A 2FX8L 2IQAA 4PRHD 3REWA 3CFDA 5EPMB 2AK1H 5IESH 1KEGL 3QIUB 4ZTPL 2BHYA 1S7XA 4UILL 1G9MH 1EXUA 5DYOB 2X41A 1YY9D 4PS4H 5D1QA 5E2TL 4TTGA 1C5CL 3C2SA 3V5DB 3NGBC 2GTWB 5GISH 4NSKA 1CGUA 1P4IL 4PJFE 3V6FA 4HG4K 2ARJQ 3ULUE 4K9EC 5FO7B 3OKOB 3R0MA 1KC5H 5C8JA 3OKEB 4PY7A 2OK0L 4TOYH 5CJOH 4HMDA 2BVPB 4C56B 5ACMA 4HIEA 3VI3E 1MFCL 2IPKB 1A7OH 2AERT 3QG6B 4PJDB 2DQHL 5JIKA 1IGML 1OT1A 1ZA3A 4CW1A 5C3TA 4PGBA 4YWGL 2EYRA 1IAKB 3IKCA 5JZ7C 3AAZA 4WRLA 4D8PA 4LSPL 1RURL 3DYPA 1WBYB 3VFGH 1BFOA 1RUAL 4GG6A 2BRRH 2DWEB 5GJTH 4PJ5D 3L7EA 2JIXB 2QADC 3OAYK 5FKAB 5SWZD 5CIPB 3BPLC 1GPOL 5I1EH 1ZSDA 5TH2A 4PD4J 3W11C 2LTQC 5BMFH 4P4KA 4K3DH 3EOBB 2HJFA 4Y89A 4NQED 1TETH 3IDIA 4YDJA 1VEOA 4XXDA 4EQ2A 2FLBT 3HG1E 1RIVL 3WSQH 4HUVA 1I1YA 1A1OB 3WJLA 4QT5A 2OXHA 5F1NB 3TJHD 1FZKA 4Q6IB 4TN9A 3FOLA 5C08E 3SDXE 4DVBB 3C60C 5K59E 2FATL 4AMKL 1ZLUH 1HHGA 3NIGF 1RZJH 3DSNA 5D8JL 3RNKB 4M7LL 3IDMA 4U1IA 2KZ1B 3CFBA 4R7DB 3TO2B 2DLGA 3QPQC 1KF9B 3QDMB 4WI7A 3OAYH 1YQ2A 3QULA 5FEBA 1G7QB 1KIPA 3O8XC 2OJEB 1BBDH 4EN3C 3RVWD 4LRNH 4DEPC 4OM1L 3BP7A 3PXHA 1EFQA 4CVWA 2VXQL 3DYMA 5EIVA 4XPTH 4BFIB 2IG2H 2ZUYA 3L3IA 4NHUB 1IGFL 1JPGB 3VE0A 1MJ8L 2Y4SA 2AQ1A 4I18A 3MO1B 4RGOL 1J10A 5F7MC 2Y06H 5IVXF 2WQ8A 3MBEA 1XMWA 5IT2H 2ZCHL 4ZFFB 3O3BB 1OAKL 5BCAA 1HI6B 3I6KA 4OCSH 5IB2A 5I1JL 1I9RL 1NGQH 1U8OA 4QGTA 2VDRL 3PWJA 3ZDYF 4ERSH 2XZZA 1J18A 4MAYD 2CUHA 5FOBB 1P9MA 4APQB 3NTCL 4OD3H 3EDJA 1XAUA 2D7PA 1RZKH 3BKCH 3BD3A 3FB8A 4HFWA 4OCXL 4XT1C 1A6ZA 4MJIB 4PJ8B 1KB5L 5L0QC 1FH5H 4LOUD 1QQDB 4KVNL 1R3IH 1U8LB 1S7WA 4K9EL 3DMMD 2AEWA 3VXSE 1IC7L 2VR9A 2NLJB 4H88L 3JV5A 1F02I 3EGSA 4FOMA 1YMMD 5EU6D 5DQ9A 4JFFB 1OM3L 1NJ9B 2JJVA 2A6DB 3TO4A 2KPNA 3EFDH 3MJ6A 3T3ME 1K3IA 3CX5J 4BQ6A 3TV3L 4JQXC 3LSOB 5BS0B 2UUDH 4WY7L 2BCKB 2AXGB 5DJDB 3ULVF 1CD9B 5KZCB 2EDXA 1A2YB 3O2VH 4X6FB 2CLRA 3MGAA 2FEDC 5F1IB 5FYJH 5I75C 1F4XH 1UM4H 1WEJH 3QIUD 1DQLL 1ZKAA 3LRSA 3IU3B 4N8VB 1CF8H 3N85L 3HI1A 4OCRH 5ACZA 1CQYA 3L5HA 3I84A 4B50A 1CDGA 4Y8AA 2X4QA 4BFEA 4P2RE 3VRJB 4ODTL 1TZIA 4PR5A 4UAOC 4OLEA 1IFHH 5EZJB 3QUML 5ICZB 4LNRB 3ARFB 1X6NA 1NUDA 4XXCA 1JK8A 3IU4L 4X8XA 1DR9A 5EUOF 2QR0A 3B8YA 4PRBA 2HKHL 2AJZA 4C56D 4Y1AA 4Y4KC 1I1RA 4NM4L 1KEMH 1X9QA 4AIXA 1FFQA 4HWBH 1X4XA 5CILL 3HNVH 2HT2D 4J6RH 4IDJH 4KPHL 1NGPL 3JUZA 5D71H 3ZE2E 1JCKA 4L3CB 2NY0C 2EH8L 2FEEL 4M7ZB 4ZFZA 5DJAB 2K7QA 1MCPH 2FD6L 1UKSA 5SV4A 2XG5A 5ADOL 3UJIH 1NMCC 2P8PA 4LGRB 4PBXA 5FM5M 1KJVA 2ESVE 3K1DA 2JIXD 2RCSH 1EMTL 4LVOC 4YGAB 3HMXL 4UT7L 3VXOA 1DN0A 5IB1B 4OLYL 5T3XD 3VFWA 3X3GL 2NY2C 5IMLA 4LLAA 4ORGA 5ESAB 2HFFA 4KKBC 1BWMA 4I3RL 2HFGL 3RKDD 4OI7A 1FJ1A 4R9HA 4M61B 1XGYL 2O61A 3WXVL 2YK1L 1KB5B 2F8OA 3FQUB 4KXZI 4KROC 3TA3B 3IDGA 3CJJA 5IB3A 4FQ1H 4FTVA 3JVGC 3FJTA 4PJBF 1F00I 1NQBA 4M6OH 2GJJA 4PRHE 2VXVL 4OIIL 3VGGA 4FG6C 4HWEL 1Z9MA 2ADJB 1NANI 3QDMD 5CP3A 2MCG1 3FMGH 1B90A 4I48B 5I76B 3GMMA 1N6QH 2YD9A 1CICB 1J8HA 1JPST 1TJGL 2GY5A 3GKWH 4I13B 3VDAA 2YEZA 4PLKC 3G6AA 4JDTL 4S0SD 4O5LL 1OAQL 1NBVH 3OKDA 4YBLB 4NM8H 4YIQA 1JYXA 5LJYH 4LGPB 4F37K 2X4OB 3VFVB 3FFCA 4W4NA 4JPWL 3RWJB 4X6DE 3IGAB 2G60L 4DGIL 2GT9B 2QADB 2CDFB 4U1SA 3WHXB 5H37G 3MBXH 3ULUF 2IH1A 2BXYA 4Y2DA 2B8OT 3BPLB 4HD9A 1UG9A 3VD4A 5I66B 4DVRH 2LTQB 3RBSA 1HZHL 1IVLA 2IBZY 2OQJA 5CZXD 1UC6A 4NQSA 1CE6A 2VTFA 2VDMH 4F2MA 4NKDB 3F8UB 4MJ2A 2HKFH 3TH3T 1FFPB 3KYMB 3T1WA 4APQD 2HMIC 3QUMB 4OLWL 4ODWA 3ZHDA 4JQVA 1BP3B 1JI1A 2A83A 1KELL 3BZDA 4MJID 4PJ8D 4JAMA 1DE4A 2KDGA 4FXGA 4JRYE 1T0NA 1ERNA 2D4DA 1C1EH 3C60B 4GAFB 4EI5C 2UY6A 2FECL 4PJHE 1MRDL 4JG1H 4NDMA 1IGIL 3K4DA 3MV9B 5EOTB 1V3MA 4L8CA 5AZEH 5J7CC 1EO8H 1ZHKA 3P4OA 3GBNL 3O8XB 3KPRA 1S78D 4EN3B 4P5TA 5HHXL 5IQ9B 3ALWA 3C5ZA 1KCVH 4DEPB 4HDIA 1QHOA 1P5UA 4P23C 3OL2A 4JFXB 4HBQA 3UTPE 2DWDA 2BOBA 1T80A 1D5ZB 4L8DA 5BS0D 2EIZA 1LO4H 5FECB 3ARBA 1NAMA 5FDYA 3ET9F 3IFOB 5KZCD 5GS1C 4M93C 4PB0L 4YHMH 4P99A 3SDYL 4TUJA 3O6FC 5EB9A 3MLRH 3WN5A 5IBTH 4UV4L 4XCYA 1U8QA 3U0TB 3UEZA 4OLZH 4ZTOH 1FRGH 2W38A 3SDXF 5K59F 5EZIH 5JXEC 1DBKL 4FQXA 4OQTA 1F45A 1TZHA 2BVQB 3WNMA 3L3OB 4PYGA 1MHCA 3ILPB 4N5EC 4N90E 4BFBD 5C0JB 3NAAL 1M6OB 1CXFA 4FQHB 1XGRB 4IEFB 5GRUL 4XPHH 3R06A 3QUYA 3ARFD 1JPFB 1GJIA 3GJEA 1FBIL 1MF2L 3C08L 1PKQE 4BUGA 3IFNH 4P3CH 2GQHA 4F7TB 2W0KA 4XB7A 3L1OL 2FBOJ 2HVJB 3RPIB 1HNGA 5CBEB 1KIRA 5IF0A 5CGTA 1JGLL 5KSUB 4WIQA 4O2FB 3ZKND 1Z2KA 3OKMA 5DVLA 4Y7MA 4PJXB 1F6FB 4WCYL 3EBAA 1NCWL 3ROLB 1H3VA 1NGYA 1OAYH 4P2OA 4N0UB 1NBZB 1U3HC 4LLMB 4KI1A 2AP2A 2R0WH 1HQRA 2CUIA 4LCUB 3A6CL 1GIGH 5DMKB 3BPCB 1OT2A 1I85A 5F3BA 1EAJA 1PG7L 3U7WL 2AJ3A 3AXLB 3RZCA 4PLNC 2W0FB 2CDEB 4OFVA 1IGJA 1BFVH 2AKRB 1C12A 4AL8L 1DSFH 1QBLH 1A3LH 5D7JC 3U46B 2FGWH 1SBSL 2BMKA 1NFIB 1WSST 3SBWC 3DX9B 5EU6E 1WBZB 2DQCH 1HKLL 5DMYA 3P77A 2WANA 2FZ3B 5EORL 1OQOA 3TA3D 4D9RE 2DYPA 4UAOB 4LDLB 2V2XA 4G9FA 1KB9K 3HI5H 3RZWA 2HJLB 1HK6A 4UOW0 2V5MA 3S4SB 5IUSA 4PLJC 3IETA 4PLOB 1BHGA 5KSAA 4Y4KB 3MA9L 5HY9A 2OZ4A 5ALCH 3NIFE 1YY8B 4GKZA 3CVHA 1HYSD 1CICD 1RZIA 3MV7A 5JR1H 3UZEA 5E5MA 4PJ7F 2VLRB 2YPLA 1KFAL 2NY0B 3O6KL 4DN3L 1ZGLA 4GW4B 2RFXA 4AIZB 5HYQB 5JZ7D 3FAWA 3LKQA 5JW3H 3LEXA 4FZ8L 4NZTL 3OJMB 3SKUD 1CIUA 3LHPH 2ZSWB 4F7MA 3WIIH 1A9BB 3D9AL 2QADD 5DRZB 4LVOB 3S36L 4JFOB 3TBSA 1U8NB 4KQ4H 1A1NB 4C56E 2EDNA 1RU9L 2EC8A 5SX4H 3V95A 3MC0A 3W11D 2NY2B 3QNZB 1P4BL 4KKCC 3QB7C 5F7YC 2X4PB 1EPFA 3T8XB 4PJIB 2BNRA 1QP1A 4PJDE 3PV6B 3RA7H 5JOFA 1AH1A 4S1RL 3QDJA 5IEHB 1I4FB 1TCMA 4YHNB 4P46B 4AY0A 2HJKB 5HDLA 2XRAH 3HZKA 4G5ZL 5KS9A 1LEKA 4X6CB 1Q72H 5T1LB 2HWZH 4O58L 5CINH 4KROB 1BZ7A 2DLFH 3U4EA 1ITBB 3BDYH 4HXAL 5K9OB 8CGTA 3A67H 3C60D 3LCYA 4NOFA 4S1SL 5BRZA 4L4VA 4LASH 5GS2H 1AY1L 1WAAE 3MRGA 3MV9D 4NNPL 3ZMRA 2V7HA 3P9MB 4A2LA 4MB5A 1T7XA 5ITFB 4OFPA 1IAMA 4CU8A 4Q6YA 1FNEB 3O8XD 3G5XB 1CFNA 4EN3D 3RTQA 4DUVA 2IBZX 4JGMA 5GSVB 4QHKJ 3P4LA 2C7UB 4HS6B 5HGDA 2E27H 2HRPH 2P7TA 2C3GA 3B9KA 3DETC 2R4RL 4Y16A 3EOTH 5FYKL 4PGDB 2XWTA 5GGSB 3ZSSA 1A1MA 1QSFA 2ZUTA 3IDXH 4JN2A 4HV8B 4WFED 4MD5B 4BSVA 4XRCA 2XQYG 1NC4A 3AFLA 3QDME 1ZWIA 4QNPE 4U2ZA 3IB4A 5JPMA 3PWLA 4PTTA 1EEQA 5F9DC 3FCTA 2RR3A 4DTGL 4GMSL 5ANMA 4F58H 4YEFA 3FT3B 2VIRB 4YUEL 2QKIA 2ID5A 3DX7A 1RZGA 1N2RA 1DEDA 4V2BA 2F54E 4U1NA 1A9EB 3SPVB 4OF3A 1WCBA 2ZJSH 5TE4L 5TFSL 1CZ8L 2Q7YA 1P2CA 4EI5B 4NWUL 4QTIL 2HVKA 3TLRA 4NQCE 3K80A 4PD4K 1GC1H 3DURB 3WKNA 3T0AA 4ZXBC 4YHIA 5KVFH 3FO2A 4QXTA 5BW7A 1I1CA 4OCWH 3Q1SL 2JB5L 2MQ0A 4MMZC 4CMMA 1NDMB 4GSDL 1U6AL 4P23B 3GMOB 4ZUSA 4YGVA 1WIOA 4N8CH 3S37L 4XMLH 2W9DL 1VA9A 3HPLB 2BHZA 4MJIE 1FC1A 1R3HA 5LBSH 3QH3A 4M93B 2FEDD 3WLBA 3RVTC 3GZKA 3VH8A 4LSQL 3QI9C 3UTSA 4D2NA 1OAUL 5IK3A 2D7NA 3MV8E 1K8DA 1NCNA 4HK0A 3HZVA 3U2SB 4OGXL 2O5YL 3TT3H 3U9PH 3QWOB 5FA3A 4QHKI 3VI4F 1IRAY 4RQQB 5JTWA 2BSTB 2J6EA 1ACYL 5EH1A 1I7RA 1LO2H 2V6HA 4JFFE 1AC6A 1UXSB 5LCVH 2JB6B 1K4CA 5BOZG 1NBYA 2VXUL 4FQCL 5BS0E 5ABDE 1EAPB 1B0GB 2HN7A 1FVEB 5DRWB 4MA3B 4EOWH 4Y5VC 2ITCA 3QRFM 3DI2B 4LF3B 3CFKB 2JELL 1TITA 2A1WH 2LABA 4HIJB 4Y4KD 4U6YB 3BZFA 5IHZA 1QFPA 2X89A 1HHIA 2YUXA 3CC5A 4LAQL 2OTWB 1LP9F 2OR9L 3EIFA 4HH8A 2V2WA 2VDPL 4L9LA 5DJYB 5I2IA 4HPYL 2VLRD 4OM0H 2NY0D 3F12B 3QJFA 3BIKB 3T4AB 2I9LB 4S2SA 1FZMB 4OZHB 3TN0A 1OGAA 1C8PA 5GGSY 3W9EB 1T1YB 5DLMH 3FN3A 5D70L 2FH6A 1CDBA 1HDMA 4Y4HC 2P46B 1YEGH 4HKZB 1E6OL 1QFWH 3IFPB 3BXNA 3BFOA 4CDHA 3GIVB 5D7JB 4EUPB 3D85B 3C5JA 5CLTA 4P46D 3ZE1F 2CLZB 1ITCA 4GRMB 1ZV5A 1BFSA 1DDHB 2R1YB 5T1LD 1U8PA 1F8TH 4KROD 3WMSA 3J8F7 3DVGB 4K7FA 3MODH 2QHLA 4MQ7B 5E2UL 2A9NL 1HXYA 1J12A 4EDWL 5D7LB 1YEKL 2NY5H 4O4YH 4X9GA 3SE8L 5C2BL 1YN6B 3B9EA 4OF5A 4FG6D 1UWEH 3ZKMC 3O9WC 4LHJB 3MRFA 4EEEA 4NT6A 3SDAA 3UYRL 2OSLA 3WFCH 2Q86A 5C0DA 4NPYA 4GW5A 4XNYH 5D9SA 3FRUA 1P84J 5DDHB 3UTTA 4CN6A 1EEZA 4RMTA 1PEZA 4N8VG 5IMMB 1KCUL 2FDBP 2PXYA 5CZVH 5ALBL 4KZEL 2X1WL 3MR9B 4PRDA 4NKOA 2AEQH 2YC1A 5H94A 1G9NH 5F7DB 3F7VB 4N0YH 3K2UL 4MNGB 4NQXA 5EU7C 3NIFF 5A2FA 2HMID 4FMFA 3K8LA 4RMVA 4H88H 3STLB 2NR6D 3PJSB 4W81A 4FN0A 3RL2A 1K5NA 5D5MB 4QTHA 4ONGH 5D1XC 1KENH 4JANA 3BRFA 1NMAL 3MRRA 5J4MA 4Z78A 2IPTL 4MLIA 4RMQA 4EI5D 1DVFA 5JA8B 1SY6H 4DCQA 4CUCA 2X7LB 1CL7L 3FO0H 1IM9A 4HMCA 4NNXA 5BQ7B 3PDDA 4R2GC 3GGWB 4UU9B 2IAMA 3RI5K 1R0AL 4JO4H 4PJDF 1S3KL 2OP4L 5HHQB 2IADB 1G6RL 3BAEH 2GITA 1EVUA 4AEHH 5I8CB 1ULVA 4L5FH 2VNCA 4IOFC 2XKNA 3M45A 2ZWLT 3MREB 3MV9E 15C8H 3MRCB 1MCOH 4O00A 1FZOA 5L2KE 5FCUL 4GAJL 1N26A 4G8GB 1M7IB 5JXED 1MCHA 3IU4H 4KRPB 1WAAF 2X4UB 2HKHH 3G5VB 4O2EB 5E99L 2BJML 2YKLL 4N5ED 2I5YL 1DL7H 4L4JA 2DKUA 5C0BB 1H5BB 2AEIT 4WI3A 1RK1A 5HHNA 1VHPA 4O9HH 5DT1L 2N7BA 3L3HA 5C09A 4X4YB 1CD1A 3I3EA 3FN0L 2WK2A 4G6JH 1UXWB 1HIML 4QEGA 4FQ2H 5LWYH 4ZXBB 1CCZA 4OLYH 4ELKA 3BWAA 5FYKD 4GH7B 2R4SH 5EA0H 5HHOB 1UCTA 3JTTB 1PDKA 5I74B 3LS5H 1S9WB 1Q0YL 4PJCE 1C08A 5GQBA 1IGYB 4IIQC 3GK8H 3MRQB 3NPSC 2I60L 4D0CA 2NY7L 2UZIL 2ERJC 4TNVK 1UZ8B 2ARWA 1M71A 4KK9C 3WHE1 1P4LB 1I1FA 1BIIA 1NCBH 4GUPA 4QGYA 2EDHA 3WFHB 1ES0B 3MGTB 4V2CB 3QQNA 1RJZA 5D7JD 3D85D 1JFQH 4XBGB 4PJXE 1R24B 3REVA 5ESQB 4NKMA 2GJ6B 4PJ5A 1RUPH 5SWZA 5I15L 1MHEA 4O51A 4N0UE 1CXEA 1AHWC 5DFTA 4GAGL 4LCWE 3BMWA 3RGVD 5E6IC 3WXWH 5FK9B 1OAZL 1G7LA 1T7YA 4OI9A 4MNQA 3WDIA 3BUTA 5HXMA 5C0AE 4Y5VB 1IZJA 5D7LD 3RQ3A 5E9DB 4PLJD 2NNAB 4Z7QF 3LN4B 4KTYA 3NZ8A 3I2CL 25C8L 2OJZH 1KCSH 3K0WA 4DJMA 2QBWA 5TDPB 2NZIA 4UQ3A 1A3RL 1G6RB 5TPWH 3MJ7A 3GMLB 2DN7A 5FHAL 3KPMA 4KJQC 1MVUB 2YSSB 3QUKB 1P6AB 5FYJU 3ME0A 1IKFL 1HQ4A 1NGXA 4LPWA 3MRMB 2A73B 2YA1A 2GJZA 3SQOL 1AXTH 5BZDA 3UJTH 1NGWB 1U95B 4NN6C 5F70A 1SJHB 3C8KA 1MFEH 1SM3L 1N4XL 3OKLA 4Y4HB 5C07A 2PW1B 3W2DH 5IJKA 4PRPE 1YMHB 2VKXA 1ZMYA 1KJ2A 4XWOD 5D6CA 3RDTA 5HHMB 2VLRE 1HEZB 1LE5B 4P5KB 5C0RH 4Q2ZB 3GSXB 5F9JB 4GG8B 3GBNH 2BY0A 2FHCA 1LWRA 2J8HA 3IJSB 3QXDA 4TRPH 4OCNC 3WFBH 1BD2B 4XCCH 3JTSA 9CGTA 3O11B 5JHDD 4ODSL 2H41A 4WUKL 3TH4T 3BE1L 3O9WB 2FGZA 4WJ5B 3VFSA 3IXTA 1AR1C 2C3XA 4IMKA 5HYSB 5B38B 2FX9L 4YAQB 2VE6B 2VLJB 3QAZC 2F5BH 4H1LB 3OPZH 2BSED 4M5ZL 2YN5A 3UZVB 4YHPB 4ZSOA 3V0WL 1FC2D 4CN1A 4KKAC 3WNPA 4R0LC 4CADA 4RMWA 4P4RB 3P0VL 4E5XB 3LZFL 5B8CA 2P8MA 4GRWB 3I6LE 1O7SA 1S9VA 4JVUA 5HGBB 5TDOA 4M7JH 1MCQA 4KRPD 1HHJB 4QF1B 1F2QA 3MLWL 3ZZ1A 3MXVH 3CIQA 1G0DA 3EFFA 3BQUA 5CWSA 2ZPKL 3E6HA 3S4SG 4F8QA 5C0BD 1C16B 1QNZL 1M7DB 4P5MA 1TJHH 4I0PC 1K8IB 3THMH 2H32B 4GAYA 2X4RB 2BZDA 3FFDB 2WP3O 3BRGC 5D1XB 2FJGA 1JV5B 4DGVH 2H2SD 1S7SA 3V7MA 3MRJA 5K93A 3MRPB 3MUGB 2OL3A 5LGHH 4OZFH 4O02L 3QHFL 4UI2A 4TQEH 3LH2H 1BQSA 1I3VA 4NKQB 4ZXBD 1PSKL 3GHEH 5FO9A 4MNHB 4R2GB 1LNUA 5HHOD 4M48H 1DN2A 3IYLW 5DD6B 4RAHA 3P11L 4GQPH 4Z76B 2J2ZA 2Z93A 3ROOA 4WV1C 1MCCA 4YLQT 5T33L 3O3UN 1MFAH 4U49A 2CR3A 2EYTA 1XEDA 2VL5B 1W72A 2HTKC 1MLBB 1KNOA 5F7FA 2R2EB 1CTOA 4YQXH 4QRUB 1B3JA 5MEQA 2EDTA 3WIHH 2KUTA 3MCKB 5I16A 5E7FA 2LE9A 5J1SC 1HSAA 2GJ6D 1U2CA 3MRLB 4I5BA 4WFFE 3NMEA 1PQZB 2DQIH 3NN8A 5FF6B 3RUGE 1U92B 5CZKA 5ELIA 4M03A 3QG7L 4OZ4B 3BGFC 4LPYA 5E1HB 4KVCL 1RV6X 5DVOA 4XCFH 2ZUQB 3WNNA 3T0BA 1MUJA 5E9DD 4YDKH 1BWWA 4WEBL 5EO1B 2A6KA 1GHFL 2EDDA 1E4WL 3PP4L 3NFNB 1BZQK 3S3SA 1XCTA 3GSUA 1WWAX 3EYFA 1ETZA 3G5YA 4FXKB 3BEVB 4XAKE 1LHZA 4O2CB 3QWQB 2IANB 4POZC 2XA3A 5DSCA 4Z18A 1OP3K 5DEGB 3ZYZA 2CK0H 5L9DL 1OSZA 2ED7A 3B6SB 3L5WA 4S1RH 4IIQB 4HCRL 4PGEB 3PDOA 3NPSB 4HC1A 4X99B 3VG0H 3VXMB 1QG3A 1WITA 2ERJB 4HJ0D 5HJ3B 2EKSB 4LIQH 4V1DB 2NY1D 4HGWA 4ZAKC 4DUXA 4Y4HD 3GB7B 4TUOB 5EFIA 3RIFF 2WSKA 2J8UB 4JPKL 3DGCR 3X14A 5CGYD 4Y19A 2JJTC 3NCEB 1L9MA 1H8OA 3P9WB 3UPAA 2HLAB 5HHMD 5IBLC 5AD0A 4MJ4A 2O5XL 2R8SH 1F3DH 3OAUL 1AHWB 4JHZA 4HWZA 2J8OA 5E6IB 5EZOH 4MA8H 3O3BA 3RWGB 3GO1L 4RWHA 5C9JA 4BZ1L 3L9RA 3O45A 1AXIB 1TCRB 4UTBL 4NRZA 1AFVH 1LO5A 3VMNA 5BOPA 1RHHA 1BD2D 2R23A 4R3SB 4HS3A 3LOWA 4PJEB 1T20B 2KKQA 4I3GA 3V8OA 3O9WD 3SDCD 1GGBH 3PL6C 3HA0A 4TPRH 3F6LA 2DLIA 1CFVH 1T7WA 5DWUL 5IM7A 3LEVL 5T1KB 1VFAA 2UY7A 2VLJD 3H42L 1D6EB 1NEZA 3GI9L 4Z7UB 4PBWD 3BOVA 4MSWB 4XX1E 4PJXF 1XGPB 1XR8A 5FV1L 2AXFB 4EVNA 4QRPB 3OWEA 3U7YL 1NLBL 1F13A 4XBPA 3KXFB 4BQ9A 12E8L 5KJRL 4WUUE 3QNXB 4NN6B 4LSVH 4XNMA 2GAZB 1L6ZA 2QL1A 1QRNA 2JE8A 3EO0A 1KPUB 3QPXH 2AEPL 4IHOA 2FSEB 2B1AH 3KLSA 4GW1A 1MEXL 1RUML 3P9LB 1G7IA 4EBQL 2R9HC 1SEBA 4PP1C 1MJ7L 3OKNB 1T7VA 5GGTL 5F7KC 2IEPA 3LDBC 4JFQA 2IWGA 4LSTH 3T2NH 1A6TB 4E42A 1Z3GH 5HDBF 3P0YH 5CCKL 5D1XD 5E8DL 1W0VB 3HE7B 4GKSB 5JDJA 1INDL 5E1AB 1I9EA 1DLHA 3OX8A 4U7MA 3P4NB 4HKXB 2GK2A 3KPSE 5DURB 1SJEB 1MREL 3JV6B 3UYPA 2G5BB 1ZHBB 1EJOH 4MNGE 4R2GD 5I17A 4ZS7L 4POUB 1KGCE 4P4KC 2CIKB 2DQEH 3GSRB 3QAZB 4K55A 2PN5A 4K23L 3CFJA 1H15A 1ACYH 1A7NL 3QFJA 4IOFD 3WJLC 4X7SH 1TVBA 1BVLA 4NKIH 4R0LB 5F9OH 4EUPG 1JNHB 4I2XE 5ICXA 4L29B 3NZHH 2DMKA 4HIIA 1R3LA 1A5FL 1P7KA 3QISA 2J88L 4QOKA 3HS0A 2H8PB 4OZGE 3DUSB 4XX1G 5BV7C 3MRHA 1QKZH 5IW3A 4X0KA 5B3JF 1DP0A 4RRPG 4PJIF 3JWDC 2HLFC 1MNUL 4UV7H 3RWHA 5DJ6A 2F53B 4DKEH 4WVRA 4JO2H 4I0PB 3KR3H 2ATPA 8FABB 2W60A 1EUTA 1F3JA 4PRID 4X6CF 4JM4H 3HZMA 2E9IA 1I7UB 4JJ5A 1GRWA 2PNDA 2AK4B 2R1WB 5C6PB 3MNVA 4K94H 4I18C 4G8GE 1BM3L 5IMKB 4YDIH 5LAXA 3LKPB 2UWEE 3BEWB 3BGMB 3S35H 1CD8A 3MBEC 2IAND 2GSIB 3RNQB 2IPUK 1IJ9A 1U93B 3WUWB 3CDGA 1ORQB 1MWAA 2DRUA 4OLXL 5DD1H 1IZKA 3L5XL 2Q76B 3WLWD 3SJVB 1IAIH 2AI0H 4WV1B 5EC2A 1BEYH 4QHMA 3TYGL 3MRNB 3VXMD 5IVOA 3MOBL 5DK0B 4KK9D 2ZOKA 4V1DD 1KTRL 3QO1B 4LLDA 3QIWA 1N64H 3FQTA 4LLQB 4OUOA 4JFZH 1T1XA 1CFQA 3F7QA 2KH2B 2HG5A 4Z7OE 2XG4A 1F6AB 5IFJA 3BH8B 1FQ9C 4ZFOA 1CGWA 3DROB 4GQ9H 3VXTA 3BKJL 1SYVB 5I19H 1JGUH 1QD0A 1GXEA 3WFZA 3BGFB 5J6GA 4JFEB 4YXLH 2WP3T 4JFDA 3UP1A 3TO4C 2DB8A 2ZUUA 4K8RH 5DK2A 3H9HB 1OB1A 1JL8A 3HHRB 4MQSB 1ZS8B 3CZFA 3MLVL 3OR7B 5DJZA 3L6FB 5JQ6L 4R4FH 3V5HA 5T3ZE 1I3UA 3HC3H 3VGHA 5KG9A 1X5HA 1GZQB 4H0IA 5DJ2B 1A6VH 2GJ6E 5T1KD 3HRZA 3CPLA 3VFMA 3BJ91 1WWCA 4KJPC 4KJQD 1S5IH 1DZBA 4GLRI 3MJ9H 3U36A 4ZYKB 2VR5A 1RMFL 4QRPD 5EDXA 3EKCA 3V0VA 3UTQA 3KXFD 2YPVH 5CP7A 5C0IA 3L3DB 5E9DE 4XPGL 5T3ZH 3ZTNL 3MLXL 5DFVD 1JHLL 4OLVH 5C7XH 4ZAKB 4N9OB 4XXCC 3H3PL 1N5YL 4WHYH 3SKOA 1T1ZA 4XP1L 3HI6H 3MRDA 4U1MA 4G8EB 2HAZA 3GSOB 5DHVH 1VEPA 4UDUB 1A7PH 3UJJH 1FLTX 3QUXA 1Q9OB 3RVXD 5BV7L 1QLFA 1IAOB 1XT5A 2AQ2A 3O6LL 3TCXA 2AABL 3HE7D 4RWYH 3JWDL 1HXMB 5A2JH 2A77H 3K1KC 3CFCL 2DI7A 3L3GA 1MFDL 2HFTA 5DURD 3QHTC 2E6JA 4LLUB 1U42A 2CIIA 2X09A 3PL6B 1II4E 4M7KL 1XR9B 3REWB 3CFDB 4MXWH 3VFRA 3U0PA 3KS0H 2GSGA 3LIZL 2VDQL 1WTGT 1S7XB 3UC0L 1EXUB 2NXZB 1X7QA 4QLRA 4YBHA 5D1QB 4PB9L 3FO1A 5KW9H 1NAKL 4KKAD 2XZCH 4NSKB 2R0KH 3V6FB 1BD2E 4OZHF 1T03L 2I07A 3PDGA 4HKBA 5C8JB 4GRLA 4PY7B 2ADFL 2YMXL 1G7HA 4MQTB 2ORBL 4H26A 4HIEB 4YDVA 2P5WA 3QHZH 1FORH 2VO5A 2ZNWA 3LDBB 3PHOA 4GS7C 4HF5H 4OIAA 2F53D 1ZA3B 2XIDA 4I0PD 3MXWL 1F58H 1UM5H 4CW1B 1TNMA 4PGBB 1KCLA 2XOTA 4ONFL 2EYRB 3F7YA 4Z8FL 1LEIA 3QYCA 4CJ1A 3IKCB 3AAZB 2AK4D 4OSUH 4D8PB 2YN3A 2FZ3A 4F33A 1BFOB 1R3JA 4GG6B 5CD3A 3L7EB 4X4XA 4LU5H 1MCFA 3QXAA 4Y2DC 4ZO7A 4CU7A 1ZSDB 4FNLH 5TH2B 2M2DA 4E0RA 4FQLL 4P4KB 2WUBL 4FZEH 4KC3B 4LVNC 2HJFB 2E5EA 1WICA 5ICYA 2DJ4A 2DQFA 4KMTL 3KPQA 3IDIB 4YDJB 4P9MH 1OD9A 4XXDB 1T21A 4XC1H 5K33A 1WC7A 4F7EA 3Q6FA 3WKML 4NN7B 4L8SA 4HUVB 2HTKD 4JQVC 1I1YB 1T2QL 3TM6A 2FB4H 4QT5B 1NC2A 5HYIA 1FZKB 3FOLB 5HSFA 4AIZA 4AQ1B 1FIGH 3S96A 2EDYA 4TVPL 1HHGB 1MY7A 3PABB 5BV7B 4XBEH 3IDMB 4U1IB 3T2PA 3NA9H 4N1CA 3CFBB 1SBBA 5DJ0A 2PYFA 3QULB 2BK8A 3OJ2C 3UDWA 1KIPB 5F71A 3WYRA 4XMPH 4Z0BH 4P5TC 4JFED 5HD8C 3C5ZC 4PJFA 1FNFA 2VXTL 1F2XK 3BP7B 1PD6A 1ZEAH 4FQIL 2V5TA 4JFYA 3W39A 2LAGB 2SEBA 4UQ2A 2O26U 3ARBC 5D5MF 1NCTA 3RIAK 2ZG1A 3L3IB 5B38G 4X6CA 3VE0B 4K71C 3U1SH 1AGDA 3WFEH 5MENE 4I18B 2V5SA 4H1LG 1DANT 3KPLA 3ZL4H 1MHPL 2R1XA 3WN5C 1AGBA 2QHRL 3LV3A 4NRXA 1A64A 2BVOA 3IFLH 3RWDA 3S88H 1RSFA 3MBEB 4POZD 2FX7H 2F5AH 2CKBH 4N0FA 4PG9A 4JDVA 1T1WA 4FQXC 3I6KB 1KXTB 5IB2B 4M1GH 5CFHA 1U8OB 3PWJB 2DDQL 5DS8A 2BFVH 3C2AL 3QWRD 1EGJH 1MIML 4HS6A 4ZAKD 2PTTA 3FB8B 4HFWB 1A6ZB 2VDLL 2VH5L 2Z92A 3STBA 4JVWA 3I50H 4Z5RA 2BVEA 2AJUL 1P5VA 4F37F 1S7WB 1FV1A 1CXIA 1S7VA 5IBLD 1DFBL 2WV3A 3EYQD 1T6VN 1UEYA 4MXQC 4AK1A 1NGZA 4ELME 1NCDL 2QSCH 3V4UH 3HG1A 1V7MH 3KPOA 3EGSB 4P2OC 4HLZH 5LVEA 5DQ9B 2FX9H 2VQTA 4WI4A 4K3JH 4R90L 4HIHA 3TO4B 5C08A 1CBVL 4V1DE 1NL0H 2YR3A 1PYWA 2R29L 3AROA 1Y6MR 1C5BL 5GGUA 1BVKA 1NBQA 3PL6D 4P2QE 4M1DH 2MPAL 3HC0A 4XVSL 1CR9L 2CLRB 1CLZH 4IRZL 3C5SA 3ARGD 4OGYL 2VUOA 4JHAL 2W0PA 3DVNA 3LRSB 2EDFA 3HI1B 4DQOH 2NXZD 5ACZB 2I9TA 2FHFA 5D1QD 1V3LA 3B2VL 4KDWA 2X4QB 1MJJA 2EKJA 2Z91A 4G42A 4D9LL 1TZIB 4PR5B 3QXUA 5DVNA 2LQRA 3NCJL 4R8WH 5I8OH 3D25B 1PLGH 3RHWK 1FVDA 5FYLH 1AXSA 1JK8B 2EZ0D 2QR0B 4PRBB 3EJYC 2AJZB 4QXUH 5KSAC 3GHBH 4Y1AB 3IJHA 2R9HD 2VZOA 3V7AG 4Z7UE 1J1XL 1Q38A 4JFHE 2MJWA 2VAJA 1DBMH 3MMEA 2PW2A 4QRPE 3KXFE 2DQDL 4M6AA 3R4DA 4Y88A 4ZFZB 2Y5TA 5IR1A 2D0HA 3KYOA 5DD3H 4YPGA 1RI8A 3GMPA 1IL1A 3N1GC 2P8PB 5EOCH 2MQ3A 4KJWC 1KJVB 1PFCA 2B39A 3HR6A 1DN0B 1HH6A 3LPFA 3VFWB 4AENA 1NAML 3ARDA 5IMLB 1BF8A 4ORGB 2HFFB 3SCMA 1S7RA 4LPVA 5BVPL 4JO1H 2XY1A 5J56B 3VXRA 5GGRY 5F6HJ 3MRKA 3QEGL 3MACH 4GFTB 3TBTA 5DZOA 1FJ1B 1D5IL 2O61B 2XPGA 4OQTL 3KDMB 2CO7B 5EC1A 3IDGB 5IB3B 3GBLA 3QRGH 3BIAX 3W9DA 3PQYA 4FTVB 5CEYA 5FDWA 1WK0A 4WW2A 4RGND 1I7ZA 4XI5C 4M6NL 2MKWA 4LP4A 5E4EC 4AG4H 5DHXB 5C0FA 3VFPA 2L7UA 4HWBA 3GMMB 1XH3A 3QCTH 1J8HB 1VKXA 2YEZB 3G6AB 4IRJA 1YEFH 4G8FA 3OKDB 3MPCA 3B9KC 3EYVA 3MX0A 4YIQB 2RIKA 4Y16C 4JN1L 4POYA 1NFKA 3CCHA 3RGVA 3FFCB 3T04D 3MLYL 3F58L 1PAMA 4U1SB 3MUY1 1LDPH 4RRPA 3HAEH 3GIZH 2IH1B 4Y2DB 3MBED 3Q0HA 3P4MA 1YNLH 4QRSA 4GOSA 2EEBA 2OQJB 4KAQL 4LVNB 4NQSB 1CE6B 3SY0A 2F53E 4DKFL 5DMIL 2ED9A 2CRZA 3VGFA 4KV5F 3CSPA 4ODWB 5I18L 1FE8L 2YD2A 1UA6H 5DD0H 2A83B 1OARL 3KWWA 2EE6A 4JAMB 1DE4B 4FXGB 1T0NB 2BERA 5BVJB 1N0LA 2G9HA 4UOJA 2BX5A 1LEGA 4NOBA 4GRWF 4NDMB 4A6YH 1TFHA 4UINL 3FQXA 5F6HI 6CGTA 4L8CB 4NIKB 4TSCL 1ZHKB 2DIBA 2XZQH 3P4OB 4LKXA 1RK0A 5TE6L 3SJVE 1EDQA 1GOFA 3X12A 3KPRB 5KVEH 3PGFH 3F7VA 2OZ4L 4P5TB 3T0VA 1I9JL 3C5ZB 4Y5XA 3CVHL 4HDIB 3MJGX 1TDQA 3RAJL 3TO4D 3W81A 5J8OA 2DWDB 2YD6A 2BOBB 2EIZB 1HNFA 5CEXA 3ARBB 2P24A 1NAMB 3O6ML 2VQUA 3IS1X 3O2DL 1AKJA 4XAWL 3EOYG 4TUJB 5KJRH 3LPGA 2HRLA 1KBGH 3WN5B 4DFHA 2YWYA 4XCYB 2IQ9H 1ADQA 1U8QB 3ZSTA 1T83A 1L0YA 4JZNA 3LKNA 4M43H 4C57C 4NJ9H 3C6LA 4FQXB 5JHDA 3GBML 3GJFH 1TZHB 4XP4H 1JRHH 1YEJH 1MHCB 4OCMC 1I9IL 5I1KH 1JNLL 1JPSH 1ORSA 4K2UH 1MQKH 3QQ3A 3M8OH 3R06B 3QUYB 5E94A 3BWUC 1RAMA 3KPPA 4I1NB 4WFHE 3GJEB 1RZ7L 2VB5A 5D7KE 3E8UL 1HWGB 4PG2A 3S34H 4GXVL 2QQKH 4Y1AD 4XPAL 1BREA 4J1UA 5GJSL 4NZUH 4OF8A 3PE9A 1KIRB 5IF0B 3SE9H 1PEWA 2AJXL 1MREH 3N9GH 4MJ5A 2YD4A 2MCPH 4X5LA 1T0MA 5IFAL 3OKMB 4L9LC 5DD5H 2APXA 2E8YA 3O2WL 4P2OB 1NGYB 3U0WL 1I7TA 4FFZH 4JRYA 1MCWW 1HQRB 3PWPA 3TN0C 1CS6A 1FNGB 5CSBA 1WTLA 5F3BB 3HFML 2AJ3B 1VFBA 4PJHA 3RZCB 3Q6GL 4LARL 2IFFL 3RX5A 4YJZL 3W0WA 5D72H 2A6JA 2H9GA 2B0SH 5TQ0H 2I27N 2Y9RT 1IGJB 4X80L 1DCLA 1C12B 4AEIL 4F57L 4X9HA 4D9QD 1JIBA 1KN2L 4KWUA 2R56H 3KNBA 2VXSH 4X8JA 2DQUH 4DW2H 3T4YA 2BMKB 1QSZA 4KHTL 4YE4L 2VJXA 2XQBH 4FQQA 3P77B 5HYEA 5DUMH 3STZA 5C92A 1JNNH 2DYPB 5GRXG 4FQJH 2YPKA 3QUZA 4FTVD 2V2XB 3NABL 4G9FB 1UH3A 4D0DA 2LU3A 3B5HA 1B6DA 3L7FA 1H8NA 2G75A 3IETB 3DNKA 2J8UF 5I1HH 5KSAB 5HDQH 4PGCB 1A4JA 3BT2L 3D48R 4BELD 4GKZB 5TQ2H 1BGXH 3CVHB 3NCMA 1JWSA 3SDAC 2OCFD 1J8HD 2VR4A 1RZIB 4KZDL 4RFOH 3MV7B 1W0WA 5C3LD 4ZUVA 3U48A 4HXBH 4L9DA 4ZFGL 5E5MB 4KMLB 2YPLB 5HYFA 1ZGLB 2FJHA 2RFXB 3JXAA 4LMQI 3LKQB 3LEXB 3QO0A 5D7IA 2BOCA 3FFCD 4ENED 4X6EA 1PKQA 4U6VL 1BZ9A 4F7MB 2EDOA 3DX6A 3OHXA 3TBSB 2PXYC 3LAFA 3FQNA 1QLEH 3P30L 4Y2DD 4PJEF 5IVNA 4PJGE 1DQDH 5JW4Q 4Y4FA 3CDYA 2WLZA 1FGNH 4KKNA 3BHBA 5MP6L 2BNRB 1A6AA 5JOFB 3HN3A 5DO2C 3PIQA 1P53A 1SEQH 3QDJB 3UBXG 3OG4B 2RBLA 4Z7UF 4JR9L 5E2WH 3HZKB 5J13B 4QRQA 5KS9B 1LEKB 3PWUA 1LE9A 5HGHA 4AT6A 2J6EL 1BZ7B 3QP3A 4Q9QH 3U4EB 1JTTA 1J86A 3DXAE 1TZGH 5KVDL 4WW1A 4MD4A 4MS8C 5BRZB 4L4VB 1ZT4A 1AJ7H 1DVFC 2VC2H 3WDHA 5A2IH 3MRGB 3DHMA 5E4EB 2V7HB 1F4WH 1MRFL 5ITBH 3TPUA 5BJTA 1A6WL 1KG0A 1ZVSA 4KJYA 3TYFA 3KPRD 1CFNB 5B39G 3RTQB 5CEZE 1WISA 1BX2A 1YMHA 4P5TD 1WBXA 1DBJH 4PGZA 1FL5A 2IAMC 4KRLB 3WJJA 3CSYA 4UB0H 5HGDB 3LEYH 4HJGA 2P7TB 3B9KB 1PBYA 3WD5H 2R0ZL 4Y16B 3ARBD 2XWTB 1A1MB 1QSFB 4QRRE 4WWKC 3SGJA 1YC8A 1T22A 4HEME 1QBBA 4JN2B 3PP3H 4L3EE 5HTSA 4BSVB 1T2JA 4MLSA 4XRCB 2NY6C 2X4NA 1RVFL 5C9KA 5CEZH 3OGCA 1NC4B 1R3KA 5I1IL 3ZT5A 1ZWIB 4PJAE 3MLUH 2WWMD 3OB8A 4FQXD 5JPMB 3PWLB 5JUEH 2YUWA 4MCZA 1FDLH 4PTTB 4OD2A 2YRLA 3FCTB 4KK5D 1VADA 2M1KA 3SDCA 2CGRH 3LN9A 3FB7A 1NCAH 5ANMB 4WWID 1RZFH 1MFBL 1X6LA 2QKIB 4K8RD 4YZFF 3DX7B 1RZGB 1N2RB 3QUYD 4JQIL 1CWVA 5T1DH 5HVHC 4U1NB 1UACH 3O6LH 3BUYA 4YHZH 1Q0XL 1WCBB 2FCBA 3IRPX 2HH0L 4W6WB 1ZANL 1IT9H 3HMWL 1P2CB 1GGTA 4JLRA 2Q7YB 1K4DA 2HVKB 3RVVC 2FLRT 5F89A 5D93C 5HHVH 4MXQD 3G6JA 4YHIB 4F3FA 3ZKSD 3FO2B 4H5SA 4QXTB 1TNNA 5HGBA 5LXGH 3QQ9C 4P2OD 3C6SA 5E5UB 1AO7E 1EBAA 4ZUSB 4YGVB 4XCEA 1M7DA 1QZ1A 3DVIA 4HKJA 3RZCD 2J4WL 1R3HB 1JZ8A 4OZIB 3QH3B 3U4BL 5H8DA 3WLBB 3KJ6L 1G0YR 1QA9A 2APVA 3GI8H 3VH8B 3UTSB 1R5VA 5IK3B 4HBCL 1K8DB 1I3RA 1VFMA 3HZVB 1WVZA 4HK0B 5FA3B 4WI6A 1U58A 5J11C 3I85A 2D9QB 4OZFG 4AYFA 2YD7A 1WFOA 2FNBA 3U6RA 1CGSH 1NSNL 1I1AA 2EE2A 1I7RB 3CXDL 4LLWA 1K4CB 5EULV 2DYPD 1NBYB 4WO4D 4JY4A 2HN7B 7FABL 4G9FD 3LPWA 4U33A 1VACA 2ITCB 3WFDH 4XWGH 3PGCA 5KTEH 3H9ZA 3EJYD 5KSAD 1WZ1L 1IMHC 2Q6WA 2IGFL 3BZFB 5IHZB 3JWOH 2XTLA 2YS4A 1HHIB 3CC5B 3EOAA 1A8JH 2B20A 3MLZH 5KVGH 1LO0H 3V79C 1B4JL 1FLRH 1H3PL 3MV7D 1KSRA 4KTDH 4FS0A 1YNKL 4LSUH 1UYWL 2V2WB 4L9LB 5I2IB 2CMRH 5LQBH 1FFNA 3U82B 4QY8A 3QJFB 2F54A 1MPAL 3C09B 4QHNA 4TVPE 1OAXL 3F7PC 4S2SB 1KN4L 2YD3A 4KY1L 3RGHA 5AYUH 3TN0B 1OGAB 4KJWD 2CRYA 3N50A 4NQCA 3N06B 2OLDA 4XZUA 3RL1A 4C83A 1HDMB 1WV7T 2QSTA 4NZRH 3UTZA 4NGHL 1CD0A 4PRIA 2YXMA 2K3TA 3P3YA 2C4FT 5IJKC 4F15B 2EH7H 3EYUH 2BNRD 3BXNB 3TNMB 2PR4L 4ZOBA 4Z7VE 1OW0A 1FP5A 3QDJD 3S35X 4FXLA 1G7JA 1GGIL 2E3VA 3C5JB 1Z0NA 3RDTC 1Q94A 2R69H 5EWIL 5CSZA 1FVCA 4PJ9D 1U8PB 5F9AC 4OBSA 4K7FB 1RJCA 1YYLH 1HXYB 5IROA 3QBTB 5BRZD 4L4VD 3K4ZA 4XI5D 3BPNC 3MV8A 2DD8L 3QEQA 3IJYA 4RMSA 2PYEA 1J1OH 2CRIA 4P2YA 4TNVF 1CFSA 2XACC 2OMBA 1W0YT 3ISWA 3F5WA 3MRFB 4YHLH 4IMKC 4NT6B 3B3IA 3LD8C 4FFYL 4G80A 3SDAB 3RTQD 2OSLB 4LOUC 1LO3H 1NMBL 1N0XL 5H2BA 2Q86B 5MI0B 1CYGA 4Q0XH 5C0DB 4NPYB 3B9KD 2UV3A 4GW5B 4LLVA 1JHKH 3CDCA 3TJEL 4HIXH 4Y16D 4WTZA 5D9SB 3FRUB 3JV4A 1A6UH 1QSFD 2L4OA 2XTJB 3UTTB 4FTVE 1YECH 1ZTXH 4G3YL 3OZ9H 1EEZB 3TESA 4ZDHB 1FPTL 3GDBA 5B8CC 4PRDB 4NKOB 2YC1B 1YQVH 5H94B 3IF1A 4RAUA 3V8CA 4MDIA 5FGRA 1J8HE 3INUH 1N7ML 4NO2A 2V9TA 5SV3A 4HK3J 3UO1H 4NQXB 5C70A 2DKSA 3FQRA 1MI5A 4KQ3L 4QHLA 3MJ8A 1O5DT 1IGCH 5J9PA 5LGKA 3T77A 3MLSL 3RL2B 4UTAH 1K5NB 1IC5L 4G6MH 5CUSH 1JI2A 4QTHB 1TTFA 1MQ8A 3V4PL 4JANB 1Q1JL 3S98A 3MRRB 4X6BA 3TGXA 4Z78B 4OQ1A 2O5ZL 3RU8L 5D4QA 1DVFB 2Q87A 1C5DA 3DECA 4DCQB 4RAVA 1FAIH 4ZOAA 2FIKA 3PWVA 3V6OE 1IM9B 1CU4L 4NN5C 4NNXB 1KPUA 2DLEA 1YJDC 5ISZE 4FP8L 5I8KL 3TBWA 2Q1EA 2BDNL 2IAMB 5EU5A 2DBLH 4NC0B 3TCLB 4WHDA 5D1ZA 2GITB 4Z7WA 1QR4A 2HT2C 4WFGD 1N6UA 2XN9A 5GRJL 1ZVHA 2XKNB 4P9HC 5GS0C 2AJSL 2X1OA 4XB8A 2X4SA 1KV3A 1FNAA 3UTSD 2OX5A 2X1PA 2GYSA 4JG0H 4LQFH 4GG6F 2NY6B 3NIGE 1FZOB 4Q9RH 4LEXH 1JF1A 1WJ3A 4X7TA 4ESKA 3K2MC 5KOVC 1BMGA 4JO3L 3KPRE 3JSSA 4GKOA 5IP4A 3V52H 4ALAH 1JNJA 1KJ2L 2WBWB 1AE6L 1RK1B 2B1HL 5HHNB 1QACA 4ODVH 4TSBH 1ND0A 3L3HB 5F8RC 3T2QA 5C09B 3LS4H 5MHSE 4XVUD 4NUGL 5C0CE 2MNUA 1CD1B 2PO6A 3BKML 1V5JA 1XGTA 4U3HA 3SGDH 4OB5L 2X89D 1RUKH 3H9SE 4HQQH 4DKDC 1A22B 5I1AA 1SY6A 5D93B 5IVXE 5D96B 2RB8A 32C2A 3NH7H 1YPZA 4ELKB 3BWAB 1TVHA 1Z9SA 2Z8VC 2D03L 1LK3L 3TT1L 1CK0L 3RX7A 3ZDYE 1C08B 1OGAD 5GGVH 4HWUA 3DO7A 5FYLD 1CLOH 4LVHC 5T5FL 3VW3H 5JHLL 1M71B 3G6DH 4DN4L 1K3ZA 1LMKA 1E0OB 1B2WL 1I1FB 1D6VH 2D7OA 1BIIB 1A7RH 5DJCA 2R0LL 4GUPB 3ARSA 4W70A 1RJZB 1RUQH 4Z77B 2DAVA 5J11B 3REVB 4C54A 4NKMB 4PJ5B 3VCLA 5SWZB 3EO9H 1MHEB 4O51B 2VLMD 4PTUA 4MZ2A 2WINA 3DGGA 3GRWH 4ONHA 5EBWA 3SKJL 2F58L 3ZTJH 4CL7A 1G7LB 1QVOA 4C4KO 4MNQB 1RPQA 5JORA 3J7HA 2Y36H 5L2KA 3OB0H 3NZ8B 4KHXH 4UT9H 1IEAA 4KDTA 5FAAA 1AGEA 1IEBA 2OL3L 4UQ3B 4LBEA 4YX2H 3MJ7B 2B4CH 3KPMB 3BP4A 4D3CH 1HQ4B 1NGXB 2A9MH 2BVTA 5EO0A 1ZLWK 1JGVH 1NKOA 1YJDL 2AAVA 4Z7NE 3ULVH 3UPRA 1QFWM 4LHQB 2XTJD 2GJZB 1DEEA 4ODBD 3UTTD 4G9FE 5BZDB 2LU4A 2JF1A 4OT1H 3EO1B 5D2LA 4R7NA 3C8KB 1U3JA 3OKLB 4EDXA 4AEEA 5EUOE 2IPUG 5C07B 4NP4L 4U7KA 1MHHA 1W72L 2NYYC 2Q8BH 1A14L 5GS0L 1PY4A 3LMJL 3MV7E 1KJ2B 4DAGH 4PJCA 4HFUL 4WU5A 5D6CB 3RDTB 4JFPA 5EU4B 2YPLE 1N59A 4XTRC 4K7PH 1VCAA 1I3GL 1ZLSH 2QQNL 4MA7L 1INEL 5T3XL 2V9RA 2H1PH 3QXDB 4MS8D 5A3IC 1DVFD 1YC7A 3BPNB 3JTSB 4M3JA 1E6JH 4LCIL 5CJBA 3QWRA 3IT8D 1IM9D 4CAGA 1AQKH 2BNRE 5DUPH 3O2DH 4E41E 3UBXA 3ARFC 1RD6A 3IXTB 3VFSB 5J0BA 3QDJE 4NWTL 3LD8B 3MCLL 4IMLA 2DS4A 4LCWA 5EOQL 2IAMD 3R1GL 1BJ1H 4XNZC 5C0AA 2F15A 5GZND 4J3VA 5GRWA 4P59H 3AGVA 2Z31D 4XVTH 5CD5C 1MAML 3VFNA 5F1KC 4ZSOB 4YXHL 3CFIC 1DQTA 1IQDA 4CADB 5BRZE 4I77L 4L4VE 4EIZC 5C86A 1LK2A 4JHWL 4HW6A 4HC1L 4PJBE 2NY6D 5B8CB 1EO7A 2P8MB 5EBMA 4FABH 1B0RA 3BESR 3QA3A 1S9VB 5TDOB 5B39A 1EHLH 4PUBH 1GGCH 2Y25A 1H0DA 2F19H 1EERB 3EFFB 3BQUB 5CWSB 1E27A 5F96L 4GBXD 3E6HB 2ZSVA 4AQOA 1KLUA 4P5MB 4RFEA 3ARGA 4UNUA 1QSFE 2P5EE 4GAYB 1OPGH 4NRYA 3T65A 4HS8L 5C09D 1XCQA 4U1KA 1I8IA 2FJGB 1P69B 5LGJA 1S7SB 5AEAA 3MRJB 5SX4I 3VGEA 3ARRA 4M62H 4PRPA 3WS3A 2OL3B 3RVVD 3ZDXE 1WFTA 2H2PC 3TA3C 4M5YH 3S8WA 4JRWA 5DQDH 4NN5B 5FGCB 2OI9C 4GO6B 5FO9B 4NFBA 5ANME 3QQ9D 4YFEA 1LNUB 1QYGL 1QFUL 1QBML 1ROWA 1A7BA 3JWNC 4KRNA 2IC2A 1IBGH 2Z93B 3ROOB 4K3EH 5TE7L 4R26L 2WW8A 5HYJE 1HYSC 1X5ZA 1CICC 3VD3A 2EYTB 3DUUA 5IIEA 3ULUH 1W72B 5TDNA 3EYSH 1KNOB 4LL9A 4XP6H 1FO0H 2XA8L 4YBLC 3R0NA 5ENWA 3MUZ1 1ZLUK 5I30L 1NCCL 1WWBX 4G8IA 3X3FH 4LSSH 1CFTB 5MEQB 4EXPX 5I16B 3VFUA 2X42A 4NHCH 1HSAB 1FGVL 2VLKD 3ORJA 4I5BB 3NN8B 3SKNA 5DJXA 4HAFA 1YN7A 5MERB 2Q8AL 3MRIA 1RULL 1YYML 5JXAL 3JVGA 3BO8A 4MNQD 4XPBL 1QEWA 4X7CC 5E0QA 3SE4C 2NW3A 1MUJB 5JOPE 2A6KB 2ZG2A 3BN3B 5JW4R 3UTSE 4RZCA 1MVFA 1XCTB 2DTML 3GSUB 3EYFB 1ETZB 1EHXA 3G5YB 5I1LA 4OZFA 4RX4D 5C6TH 1CQKA 2C1OA 5DJ8B 1DQML 5I9QB 2CJUH 2QLVB 3IAPA 5DSCB 3PABA 3O4LE 1DLFH 4KU1A 2ICWA 1I8MA 1NEUA 1OSZB 3H3KA 2VLLA 3L5WB 3PDOB 4NC1C 5AZ2H 3ES6A 1MCRA 3FOMA 1AD0A 1HILA 4LVHB 5AWNL 2QQLH 3A0OA 4HGWB 1CE1H 2UYLA 5EFIB 5C07D 3U7AA 4HZAA 1L7IL 3X14B 2UVFA 5DR5H 4Y19B 5BO1L 1YEIL 1YEHL 4TULH 4J3XA 4JJHA 4H20L 3WIHA 1G7MA 3A6BH 3RDTD 1HOCA 2WLYA 5AD0B 3QUXC 2LAAA 4QRTA 2FR4A 1OSPH 4DOHB 4HWZB 3ZLQC 5ILTL 5GGRA 4HAGA 5C9JB 2I26N 4H8WC 3L9RB 3O45B 3CVIH 1UADC 1YEEH 2LU7A 4NRZB 1P1ZA 2UUDK 1A7QH 4I3SL 4YHKL 1LO5B 2GTZA 1RHHB 4M4PA 1A21A 2R23B 4NO3A 3CK0H 5GHWH 3KYKL 4HS3B 1V7NH 4XP5L 1ONQA 1VGEH 4J7RA 2DQJL 4ETQA 4LPXA 5FM5O 3DHJA 3RVUD 2DM3A 2VRAA 4KTEL 3RUGA 5F9WC 1D5BA 4J3UA 5IM7B 1JGDA 1KT2A 2MHAA 3MOAL 1VFAB 1UCBH 1NEZB 3V6ZA 2VLME 1NLDH 1N8ZA 5DGRA 5E2VH 1XR8B 1SVZA 4X5WA 4OD1L 4EVNB 3VH8G 5C0EA 5GS1A 4YHOL 5L8LB 4B7IA 4XBPB 1W8NA 4D94A 3BMVA 3O6FA 1MWAL 1OCWL 1UZ6E 5IFHH 5J3HD 3HC4H 4XNMB 5JMOC 2X10A 4HGKC 1QRNB 4KGJA 3NIDF 2ZUVA 3EO0B 4HLZG 2R2HA 4HJJL 2B7DT 4GRLC 1PKOA 4IHOB 3P40A 4LSRL 2Q7NA 4GW1B 3H6JA 1J5OL 2XZAL 2HH0H 3AVEA 4MAUH 1A0QL 1AR2A 3MYJA 1G7IB 3BQUD 3DRTA 1SEBB 3AS1A 4KRMB 5KSVA 2ZCKH 1DUYA 4JFQB 3VU2A 4IOIA 2DQGL 1J1PL 3CLFH 4GMTH 4ZFOL 4PJ7E 4E42B 1XF4A 5C0NC 5FUOH 4G6FB 1D9KD 1ZXQA 1DLHB 1KJ3H 1IQWL 4Z7NF 1Z6JT 3OX8B 1MRCH 2EDKA 2C3HA 2ADIA 1QFWI 4MCYA 2ATKB 3NCYS 5IHUL 2FYYA 1QSEA 3AREA 3D25A 4WU7A 5CJQL 5I17B 35C8H 1U3HA 1AI1L 3TVMA 1BAFH 1D5MA 3QXVA 2D7TL 1YZZA 4F9PA 2BVUA 4HT1H 3MUJA 4XNZB 4TSAL 5IB4A 2HFEA 5I1CL 3CFJB 1H15B 1G9MC 2AJVL 5HVFB 4L8SC 3QFJB 4OBRA 5GS0D 1TVBB 1BVLB 5ICXB 3O0RL 1W8OA 2CDGA 3LRHA 4JKPH 2P4AB 1MJUL 5F72S 4HIIB 5F93C 6FABL 1R3LB 2FBJL 3QCVL 1P7KB 3BSZH 3TWCL 5A16A 4QOKB 3HS0B 5GGQH 5IVZA 3QXWA 3MRHB 4L8BA 1FFOA 4X0KB 5H37H 1ZHNA 3T1FA 1DQQA 1UWGL 3UDWC 4C59B 3RWHB 5DJ6B 5JO5A 4XPFL 1JPTH 5KANG 4OV5A 4R4BA 3H0TA 1RFDH 4WUUA 1TJIL 2ATPB 4Y5YA 2W60B 5KS9F 1F3JB 4P46C 1Q9KA 5I1GH 3HZMB 4HPOH 4JJ5B 4QXGH 1XGUA 4H8WL 3MNVB 3KDMA 2Z8SA 1L7TH 3BZ4B 2E6QA 2Z35A 1M05A 4YFLI 1MY5A 5LAXB 2ZCLL 2OI9B 4WNQA 5GSRA 2Q3ZA 4OTXH 3V2AR 3CDGB 1GAFL 1MWAB 1JGEA 4Z95L 4IS6A 5EC2B 4QHMB 4YNYA 5C09E 1IKNA 4JRXA 5EZLA 4LCYA 2ZOKB 4U7SA 3NACL 3KPSA 4UIKH 4LLDB 4WEMB 5E8NA 3QIWB 1MLCA 3FQTB 3IVKA 5BZWA 1RZ8A 3X13A 2RHEA 2ZKHL 2JK5A 1T1XB 3D2UA 2ITDA 1CFQB 2NXYC 4Y19D 2HG5B 4W4OC 3NFSL 3BKYH 5IFJB 1DBAL 5E8EA 3ZDXF 1ADQH 4M1CC 4ZFOB 1JYWA 1RZJC 7CGTA 1F90L 3VXTB 2V17H 3NFPA 5EBLA 2M8XA 1KYOJ 1MIEL 4UIMA 3WE6A 2AGJH 5JIHA 1HINH 2WUCL 3UAJD 1CLYH 5EG6C 1ED3A 2C26A 3L95A 5J6GB 2VKWA 4KUZH 5K9JL 4JFDB 4I2XA 1K6QH 4I9WD 2VDKH 1L4IA 5IQ7H 5DK2B 1OB1B 4U4BA 3CZFB 1T3FA 5DJZB 2NR6C 4OGAC 3RKPA 3V5HB 4G3YH 4AJ0A 4LEOA 1U8MA 2PF6A 5KG9B 5F7EL 4JB9H 5HBBA 5BVJA 2Y1VA 5GIRA 3N1FC 4PJ5E 3HRZB 3CPLB 4G43A 5SWZE 3VFMB 1CDCA 1MCKA 3VI4E 3Q48A 4QYOA 3U36B 2Y07H 4S11A 3D3VA 4MNQE 1JTOA 2CXKA 3V0VB 3UTQB 3GFUA 2RGSA 2AK1L 5CP7B 4XGZA 3E3QC 4YBQC 5C0IB 1J7VR 3NCYP 4NQEE 5IESL 2K7PA 3G04A 1QRND 3MROA 3BVNA 1OL0A 1RZKC 1G9ML 4OZIF 2UWEA 3SKOB 2NYYD 4PS4L 1T1ZB 2DLHA 2IALA 1KUMA 5GISL 3RIAF 1U41A 3IKKA 3MRDB 4U1MB 5ACLA 1LP9E 4WENB 2ED8A 3DOSA 3LY6A 3QUXB 1VPOH 3B4NA 1OF2A 4XTRD 1KC5L 1QLFB 4TOYL 3D0VA 5CJOL 5IEKA 1QHPA 4G6FD 4HZLA 3BRDA 1A7OL 2D4FA 5A3ID 5E95B 3EDKA 3L3GB 3VXUA 5C07E 5ADPH 4CVZA 2J1KA 3WEXA 2CIIB 3K74B 2W9EH 3SE3A 1MSPA 1R6VA 1CDJA 3ARDC 3U0PB 3VFRB 5F9WB 3H2WA 2GSGB 3SGKA 3VFGL 4H25A 1KPVA 3ZE1E 3FZUC 1CVSC 2BRRL 5GJTL 3GNMH 4G7VH 4XVJH 5CD5D 3PF2A 3VD7A 4OJFH 5AUMA 3MJ9A 1X7QB 1PZ5A 1S9KC 5I1EL 2VDOH 3FO1B 5FUZH 3QFJD 5BMFL 4J3TA 3QI9A 4K3DL 3MV01 3UBXI 2I07B 4JPVH 3HUJA 5ID1A 3EZJB 1TETL 4HKBB 5FHBH 4L3AA 4GRLB 4QOKD 4WW2C 4XP9H 1FNGA 1J0YA 1G7HB 4L1HA 3WSQL 4H26B 4U2YA 4YDVB 3L3JA 5C6WH 1INQA 2B2XH 3GSNH 3O3DB 2VZ1A 4IRSA 2P5WB 5KSBB 3PHOB 5DHVA 4G9DA 4PRAA 4CNIB 1U91A 1RZJL 4IRJC 1FZJA 1FG9C 1WF5A 2GK0A 5GGVY 4Z6AT 3BISA 3F7YB 1LEIB 1N3NA 5ETUA 1YMME 1F4YH 4KUCD 4QCIA 3RGVC 2X4TA 2IMMA 4F33B 1R3JB 1BBDL 2H2PD 1UZ6F 5CD3B 4LRNL 4WO4A 2WWKO 2GEEA 4X4XB 3I9GH 3QXAB 2CK2A 4S1QH 5DC9B 4OLUH 3I02A 4XPTL 2IG2L 2ICES 3RHWF 4E0RB 4NJAH 2DQTH 2ICWJ 3B9VA 2H3NB 2EECA 1HSBA 4PGCA 4U1HA 1WCQA 2MTPA 1JMXA 5ICYB 2P43B 2AXJA 2DQFB 3KPQB 4LVEA 2NX5A 4F7PA 1H3TA 5E08H 1T21B 1QOKA 1XF5A 2Y06L 2VERN 1CN4A 1WC7B 4F7EB 3Q6FB 5IT2L 4L8SB 3TBVA 3QIWD 1DBBH 4PRNA 1JUFA 5FV2A 1NC2B 2XWJA 4OCSL 1JN6A 1X5IA 1NGQL 1E4XH 4ERSL 4HX1A 3S96B 1FFRA 4M6MH 3CD4A 1BQLH 4OD3L 3F65A 3NCCB 1RZKL 2LV4A 3P0GB 1G9EA 1E28A 3D0LA 1KCRH 3ARVA 1MCBA 5DJ0B 2PYFB 4LFHD 3DPBA 4NO0D 1FH5L 3C8HA 4BZ2H 1CXLA 1R3IL 1RIUH 3QNYA 4PJFB 4Y5XC 4JFDD 1X5GA 4XWOC 5CS7A 4JFYB 3W39B 4NC2B 1ZE3C 4S10A 2SEBB 4UQ2B 4C58B 3WS6A 2FWOA 4X7DC 3WHE0 1AGDB 3O3AA 4PJ9A 4G6KH 2V7NA 3CUPA 3HNTH 3KPLB 2R1XB 1AGBB 2EO1A 1LILA 3LV3B 4NRXB 2BVOB 3RWDB 3EFDL 1LVEA 1T83C 4N0FB 4PG9B 5T3XE 4X83A 4JDVB 1T1WB 3C6LC 4UT6H 4P9HH 2WM0A 5TF1H 4K7PY 3O2VL 5ID0A 5FYJL 5IMOA 5DS8B 2ZOLA 1F4XL 4AZ8A 2VZUA 1WEJL 2WAHA 4BK4A 2JTDA 4RISH 2PTTB 3CMOH 1CF8L 2NY3B 4OCRL 5BXFA 3ZE0E 5CIPH 2Z92B 5T3XH 2NXYB 4PG2C 4Z5RB 4XMKH 4XNXH 3GKZA 1FV1B 1S7VB 2COQA 2ICWI 5L7XH 4LP5A 1IFHL 3QUXD 3LQAH 3Q2CA 4MZ3A 3CDFA 2CO6B 1F3DJ 1NGZB 4YXKH 3HG1B 4KRPC 1DUZA 3KPOB 1KEML 5L6YH 1MH5A 4HWBL 1UM6H 1B4RA 4HIHB 2Z0BA 3AU1A 5C08B 3V5KA 4XNUH 3ILQC 3HNVL 1H5BC 3K7UA 4J6RL 1PYWB 4IDJL 4YK4C 5GGUB 5D71L 1BVKB 1G1CA 1IC4H 4TUKH 3DSFH 3HC0B 4JY5H 4NUJA 3LRGA 3V4VH 4XC3H 2H2SC 3C5SB 1MCPL 2VDNH 4ODHH 5E8OA 3HTLX 3UJIL 3QFDA 1M7XA 1CT8A 4ZD3H 4G7YH 3DVNB 3FRPG 4DOHE 2MWCA 1BQUA 2RCSL 2CKBA 3HR5A 1JF6A 2I9TB 3CLEH 2AQ3A 5L88H 43CAA 4U6TA 4EZMA 1MJJB 2FX8H 2H26A 4I9WE 2Z91B 4G42B 5I74C 3RWFA 1J0HA 3LKRA 5F88A 3M17A 5MENA 4NO5A 3QUZC 3T0ED 1KEGH 4ZTPH 1QR1A 1EGJA 4Z7QE 2ADGA 4GRLD 1FVDB 4PFEA 4UILH 1AXSB 4ZPTA 5E2TH 4P0DA 1C5CH 4OZIA 1MCLA 3IJHB 3T3PF 1P4IH 3BP6A 4JGJA 3AB0B 2P5WD 4FQ1L 3MMEB 3OMZA 2JJSA 4M6OL 2PW2B 4M9PA 2OK0H 5C0ND 2PKDA 4ORZC 1WZKA 2Y5TB 2Y6SD 5IR1B 1VGKA 3H7LA 3KYOB 3BP5A 3FMGL 4YPGB 4LKCA 1MFCH 2BNQD 3GMPB 1IL1B 1QRNE 1N6QL 3GKWL 4U0QB 2DQHH 4WI8A 1IGMH 1FHGA 1NBVL 1HH6B 4NM8L 4AENB 4YWGH 3ARDB 1ZGLM 3SCMB 1S7RB 1OP9A 4ELMA 4TNWK 3VXRB 4TTDC 4LSPH 1RURH 3MRKB 5M95B 3QZWA 1RUAH 3TBTB 4GKNA 4NFDA 3MBXL 2XPGB 1GPOH 4DVRL 1NC2D 2P44B 5EC1B 4ZS6C 2A38A 2XYCA 5FGBA 4P2QA 2VDML 3W9DB 3PQYB 2HKFL 4MWFB 5FDWB 5CEYB 4WW2B 3K3QA 1I7ZB 1RY7B 3ELAT 3SDDA 4HJ0C 3X11A 1PZUB 1RIVH 2NY1C 2DTMH 5CKGA 4H0HB 5C0FB 2WZPD 3VFPB 2E7LC 5DVKA 2W65A 4YO0A 2BSSA 1XH3B 5CGYC 1C1EL 1NFDF 3TNMA 2X9XA 4OGZA 1X3DA 1VKXB 2FATH 4AMKH 2JCCA 2BY3A 4IRJB 4JG1L 2FIRT 4GT7A 1ACZA 4G8FB 5D8JH 1T89A 4U1LA 1XGQA 4M7LH 2V2TA 3C87A 3MYZA 3EYVB 3DV6A 5AZEL 1HHKA 1EO8L 1S5HA 5EIQA 3SGJC 3CCHB 3RGVB 1NEZG 3NCBB 1K2DA 1HE7A 4QOKE 3HKFA 1KCVL 5AWNH 3EJZC 2ILLA 4OM1H 4WHTA 5SX5H 3VGDA 1EK3A 2VXQH 1LO4L 2GUOA 3P4MB 4QRSB 1Z5LA 1IGFH 5BO1H 5EIIA 3SY0B 4YHML 1H3UA 1MJ8H 3SDCC 2GCYA 3MLRL 2WIIA 5IBTL 4RGOH 4OLZL 4ZTOL 1FRGL 5EN2A 4P3WA 1UJ3A 2P8LA 5EZIL 1ZA6A 2NY3D 1JWUA 2ZCHH 1OAKH 3KWWB 4TVSa 1FL3A 2NXYD 5TGBA 1RQ5A 5I1JH 4LHUA 4KKLC 3H9YA 1I9RH 5IG7A 2VDRH 3ZKQD 2G9HB 1LEGB 5SWSA 4D0BA 4OCYL 3Q5YA 3NTCH 5JQHC 1H3GA 4M1CD 4ZDHA 4XPHL 3FQXB 5DI8A 1H3XA 2VSDA 1FYTA 1QUNA 3VWKA 4ODXA 5DMGD 3SGEH 2GIYA 1RK0B 4LKXB 4OCXH 1LQSR 1X5KA 4OAWA 3HG1D 3KPTA 3X12B 2W0LA 1KB5H 3IFNL 4P3CL 4Y5XB 3FT4A 4KVNH 2VQ1A 4K9EH 5C08D 4K7PX 3OGOE 5CJXC 1IC7H 1S7UA 3IAQA 2X05A 5CEXB 4LQ1A 2P24B 5E00A 1IM3A 4OGAD 2L0DA 1AKJB 2WWKT 1OAYL 3O81A 4JPIA 5GZOD 2EIDA 1FL6A 2R0WL 1OM3H 3T0XA 1YA5A 3C8DA 4U05A 4RA0C 3HAEA 1GIGL 4JZNB 1G7PA 3TV3H 3LKNB 3VFTA 2W07A 1F42A 4WY7H 5IV2A 1KPRA 1OHQA 3C6LB 3VFOA 5JHDB 1XFPA 4KH2A 2W9LA 4P57A 1I1AC 4JFDE 4YBQD 3T0WA 4ZOCA 1BFVL 5IB5A 3VG9C 1ORSB 1I8KA 3QQ3B 1DSFL 1QBLL 1A3LL 4X6DB 3UZQA 3DARA 1DQLH 5E94B 3TCLA 3KPPB 2FGWL 3D39A 3N85H 2Z31A 4X5XA 2DQCL 3L3KA 4J1UB 4ODTH 4J8RA 3QQ4A 5GPRA 4MX7A 4A6YA 3HI5L 4MJ5B 4NCC2 1GC1C 3QUMH 1IAII 1T0MB 3KJ4B 3GMNA 3HCVA 1U8IA 3WL9A 1N6VA 3SO3C 3C9NA 5FKPA 4FHBD 4NM4H 5ALCL 4R96A 1I7TB 4W6YB 4JRYB 3QEUA 4GBXA 4U31A 5FA4A 3WUZA 3PWPB 5CILH 3IS0X 3VXQA 5I1CH 5JR1L 2VWEC 4YK4B 4PJHB 1VFBB 4HEPG 4KPHH 1NGPH 1GZPA 1A4KA 1P7QA 2ZUQC 3W0WB 4WI2A 3ARDD 2A6JB 1CGTA 2H9GB 3BD4A 3SCMD 2EH8H 3ZE0F 4RIRA 5FYJD 1MJUH 3VXRD 4WFEE 1AP2A 2FD6H 3KS0J 5ADOH 1OW0C 3LHPL 3FZUD 1XF3A 1KYOK 3WIIL 3KNBB 3QDGA 4X8JB 3T4YB 2WIMA 1EMTH 3HMXH 4KQ4L 4UT7H 2XFXA 3GJFA 4FQQB 3X3GH 5JNYA 3STZB 1Z9LA 3RA7L 4I3RH 2YPKB 3FQWA 3PQYD 3QUZB 5KVMC 4W6XB 3T0DA 2HFGH 3WLWC 4X9IA 5F3HA 5IROC 4DGYL 4D0DB 4MDJA 4PP2A 3L7FB 2G75B 2XRAL 4LFHG 1XGYH 3WXVH 2YK1H 1Q72L 1A4JB 2HWZL 5CINL 1AGFA 2DLFL 1JZ4A 2EO9A 3BDYL 1JWSB 3A67L 1SVCP 1W0WB 4LASL 4ZUVB 4IRJD 2GI7A 2EDJA 4P49A 4Z77A 2VLKA 2VXVH 3OJDA 4GJTB 4OIIH 2FJHB 2P47B 3HB3C 4HWEH 2DKMA 4MA1C 3QO0B 5D7IB 2BOCB 3FONA 3OKKA 4LMQE 3ZT7A 1FG2A 4X6EB 1PKQB 1BZ9B 1TJGH 3DX6B 3OHXB 5F6IC 3U30C 3FQNB 2GFBA 4JDTH 2E27L 2C3VA 2HRPL 4HUXA 3LN5A 4O5LH 1OAQH 3IDNA 3EOTL 3BN9C 1UT9A 2A74A 4Y4FB 4M8QA 3BHBB 5FB8A 2O93L 1T0PB 1A6AB 2HT3C 3IDXL 1WQVT 3PIQB 4JPWH 2G60H 4DGIH 2VAAA 4RX4A 4QRQB 5HDBE 2ESVD 3PWUB 1LE9B 5HGHB 5MEPA 4AT6B 5DTFA 3LKOA 1HZHH 1EHAA 3FB5A 4ODUA 3DI3B 1TMCB 3WNLA 2E8ZA 4F58L 4WW1B 1XIWA 3FB6A 4MD4B 2EC9T 1EFXA 1ZT4B 3EO1A 2NY5C 4OLWH 5DFVC 3RX8A 3HLAA 1OGTA 5DA0B 4ZO9A 1J9CT 2NY1B 3TPUB 5BJTB 1KELH 1KG0B 1ZVSB 4KJYB 5E70A 3TYFB 2Y72A 5F7EH 2ZJSL 4LPTA 1BX2B 1WBXB 1FL5B 3CSYB 1ZLVH 1MRDH 1NFDA 3FN9A 4HJGB 1IGIH 1GC1L 5CHNA 5EU4A 5D1ZC 5KVFL 4ISVB 3RVXC 4OCWL 4LK4A 1D7FA 5GRZA 1AKJD 1VFOA 1T22B 3MFFA 2E7HA 3HE7C 5HHXH 2X4NB 3OGCB 4N8CL 1BECA 1R3KB 4XMLL 1OP5H 4WGVB 2ZUWA 1KTKE 3C6LD 3WBDA 1G9NC 5B3JE 4MCZB 5LBSL 5J57B 4OD2B 4PJIE 1VADB 3SDCB 4PB0H 3FB7B 2BC4A 5FGSA 3SDYH 3ZYOA 3KAAA 2EIBA 1F11A 3CFEA 4UV4H 1S7TA 3DBXA 3CH1A 3TT3L 3U9PL 4X6CE 1DBKH 2CSPA 3BUYB 3DIFA 1LO2L 2PO6C 4PJGA 5LCVL 2CPCA 4JLRB 3NAAH 1K4DB 2E9WA 3VWJA 5GRUH 5F89B 4EOWL 3G6JB 2G2RA 1Y18A 5E56A 4F3FB 3DRQA 3R8QA 2J3SA 4H5SB 5JW4N 1FBIH 2A1WL 1MF2H 1QLRA 3C08H 3C6SB 1U3ZA 3IXAA 5C1MB 3CX2A 3EYOA 1CXHA 3L1OH 4JRYD 3DXAA 3PWPD 3VD9A 3ILQD 2WQRA 1JGLH 4XCEB 3QDAA 5HHPA 2PCPA 4NQDA 4HKJB 5HGAA 3OF6D 3W0WD 3IDJA 4YHYC 4WCYH 4OM0L 3LQZA 1NCWH 4XH2A 5I1DA 4KUCF 1QA9B 1D9KA 2PTUA 1R5VB 5DUBA 4CVXA 1JYNA 2VITA 1I3RB 4LGSB 3A6CH 2EYSA 3E2HB 1U58B 4L4TA 1PG7H 3U7WH 5DLML 3UTPD 1QPXA 3U6RB 1I1AB 4LLWB 1YEGL 1J8KA 4XCNA 1QFWL 3GMRA 4QRRA 3VG9B 1N5AA 4JY4B 3QUZD 4AL8H 1VACB 3OXRA 4L3EA 3PGCB 1SBSH 4U1JA 4N1HB 2I25N 4MHHG 1SYSA 1RIHL 1HKLH 4RMUA 3W82A 2Q6WB 4PJAA 4KDTC 3FRPA 1F8TL 5EORH 5IKCA 3MODL 3EOAB 5DEFA 1BBJA 4N90D 2OMNA 3MNZA 2N1KA 1AD9A 2XT1B 5F7UA 1CFTA 2NY5L 4O4YL 4J4PA 1FFNB 3SO3B 1UWEL 3E3QE 4HGMA 4QY8B 2F54B 4BQ8A 2BY2A 4QHNB 5FXCH 3MA9H 5MERA 3AS2A 3WFCL 5EOCJ 5C71A 3H3BC 4NQCB 4XZUB 2IBBA 3RL1B 4C83B 3UTZB 5DZNA 1KTLA 2BNUA 4XNYL 1KFAH 3O6KH 4PRIB 4DN3H 4Y4FD 4PV9A 3OAZK 4TTDD 3QEHA 4FZ8H 4NZTH 1F3RB 3JUYA 3HE6A 1G7JB 1YNTA 3ECBA 4J12A 1AO7A 1Q94B 3D9AH 5CZVL 3S36H 5H35A 2AEQL 5DJ8A 1RU9H 5CSZB 1G9NL 1FVCB 3MOQA 1P4BH 4ZS6D 4B41A 4YR6A 4N0YL