4EP4A

Thermus thermophilus ruvc structure
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
166
Chain Sequence
MVVAGIDPGITHLGLGVVAVEGKGALKARLLHGEVVKTSPQEPAKERVGRIHARVLEVLHRFRPEAVAVEEQFFYRQNELAYKVGWALGAVLVAAFEAGVPVYAYGPMQVKQALAGHGHAAKEEVALMVRGILGLKEAPRPSHLADALAIALTHAFYARMGTAKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural asymmetry in the Thermus thermophilus RuvC dimer suggests a basis for sequential strand cleavages during Holliday junction resolution.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Crossover junction endodeoxyribonuclease RuvC
total genus 54
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature ec 3.1.22.4: Crossover junction endodeoxyribonuclease.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02075 RuvC Crossover junction endodeoxyribonuclease RuvC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ep4A00
1N5YA 1ZBLA 1Q8IA 2B5JA 4KPYA 3VQ6A 4W5OA 2ZD1A 3LPUA 3WNHA 1ASUA 4CGIA 1RTJA 4OGCA 3HJFA 2EHGA 4KHSA 4CF1A 3H08A 4KKOA 4RW8A 1W9HA 3QNOA 5J1EA 1HQEA 3TAGA 4ELVA 3AVCA 1A5XA 1LAWA 2IOCA 3V6DA 4E7IA 4DSJA 1JL1A 1T03A 4DTUA 3V81A 1LAVA 4PQUA 3S3NA 3ZT1A 1JL2A 3O3HA 4Z4GA 4FYDA 3F9KA 3PUFA 2P1JA 1IKWA 1I39A 2HB5A 1S1UA 2PYLA 1KTQA 2FBTA 3QO9A 1J9AA 4CF9A 4FK4A 2HHWA 4CJPA 4DFJA 4B9UA 2HHUA 1TAUA 3HP9A 3MEDA 3A2FA 4EP4A 4EZ6A 4CEFA 2XRIA 4CEBA 2ATQA 2I5JA 3VQAA 4CGGA 4B08A 3AVKA 3VA0A 3V9SA 1TKZA 3LP1A 3SNNA 1BI4B 3EYZA 2Z1JA 3L2WA 1XC9A 3T1AA 4CFBA 3AO1A 2OYQA 4CJQA 4EZ9A 3ZSQA 2D0CA 4DTPA 4PUOA 2X6SA 1JXBA 1TK5A 4OPJA 3TR8A 4J2EA 4Q0BA 5EU7A 3VQCA 3SYZA 1HJRA 3AVBA 3KLHA 3DRRA 4BDZA 4CJWA 3NBPA 1S6PA 4F3OA 1YT3A 3KJVA 1FXXA 3QETA 2WONA 3K5OA 4CF2A 4FLTA 1RBTA 1NK6A 1TKTA 3ZSOA 4FZZA 1EXQA 5KTQA 4CEOA 5KRSA 3AVLA 1NK5A 2YHBA 3VQDA 3M8SA 4FLXA 4ZTJA 2QKBA 3P5JA 3T19A 1VSMA 3EY1A 3SQ2A 1ASVA 4AH9A 3QESA 2ZE2A 3LP3A 4B9NA 1KFSA 2G8WA 4CGJA 1ASWA 3CM5A 4KTZA 1T7PA 2XY6A 3L2VA 1TL1A 3OYKA 3SQ1A 3CFOA 2G8HA 5C42A 3O3GA 5I3UA 1UA0A 1XHZA 4E1NA 5CZ2A 1XI1A 1GOAA 3NGIA 2G8KA 4Z4IA 3PO4A 1XHXA 3IAYA 3QLHA 1IKYA 3L2RA 4DS5A 4CJ4A 4EP5A 3ITHA 3K5NA 3V9WA 4DTSA 3O4QA 3HVRA 4LSNA 4M3UA 4FJ5A 4PWDA 3SQ4A 3LALA 4E19A 1JLEA 3NF8A 1JLFA 3U6FA 1RT5A 3TABA 3LWMA 1C6VA 1MU2A 4MQ3A 1UOCA 1ZBFA 1LWCA 2JLEA 3VQ7A 1HNIA 5HRPA 3V9ZA 2B6AA 4I2PA 1QSLA 4FJHA 2OA8A 1IH7A 1O1WA 3AA5X 3TARA 4DTNA 3DM2A 4FJXA 3V1QA 3KD1E 3DMJA 3RR8A 4FLUA 3VQQA 3SCXA 1RT6A 1DLOA 4Z4FA 4CJUA 3PY8A 4HCBA 1JKHA 4DQIA 4DMNA 4OJRA 4N5SA 1QQCA 1WSEA 2QXFA 3OJSA 3VQPA 4BACA 4MFBA 4CJLA 4HUGA 1Z26A 4JS4A 2KFNA 4B8AB 4RW4A 4E7JA 1LWEA 3KK2A 4PY5A 4CFAA 4DLEA 3SZ2A 4B8CA 3OYAA 2G8VA 4FJIA 4DSIA 4H8KA 4KHWA 3P1GA 4KHNA 4CJFA 4OVLA 4ICLA 3QIPA 4FK0A 3VA3A 4HCCA 3HXMA 2ZQBA 3MEEA 2O4IA 3G10A 3KTQA 4NCAA 4BDYA 5FRNA 4DSEA 3AVFA 4DTJA 4LSLA 4C8MA 4J2AA 4M3YA 4GW6A 2XHBA 3KLFA 1VK0A 4FJ7A 4O0JA 3M8RA 3TAEA 4CJKA 2KFZA 2GUIA 2YNFA 3AVAA 1VSFA 3DLHA 1S6QA 1VRTA 4AHSA 1YVUA 3QNNA 1RT4A 1TL3A 1L5UA 3SV4A 1RTDA 4E1MA 3AVIA 3NCIA 4J2DA 4CFCA 3RRGA 1C0MA 3I0RA 1BQNA 4E7LA 1ZYQA 3MECA 4CJEA 4DFPA 4OKKA 1A5WA 4F2SA 3CG7A 3LZIA 1JXEA 2D0AA 2A1RA 2YV0X 4ELUA 4W5TA 1WSJA 4GMJB 3OJUA 1X9SA 4FW2A 3HPGA 1LW2A 4FXDA 3NHGA 3OVNA 1DTQA 3LWLA 1F21A 3D0PA 1JLAA 2X6NA 1QTMA 4NYNA 4DQPA 3FFIA 5KGWA 4CGFA 1WAFA 3S3MA 3HO1A 3QEIA 2OPRA 1LWFA 4LH4A 3KK1A 2W42A 1HPZA 1VSEA 1VSKA 4JLHA 3U3YA 1L3TA 1KLMA 4B9MA 4KRFA 2EX3A 4IFVA 4Q5VA 2Y1IA 3O3FA 4DU4A 4JS5A 3AVJA 1BIUA 1K6YA 3HPOA 3TWHA 1ITGA 1TKXA 4KB1A 1KFDA 1D8YA 1KCFA 3AVMA 3NDKA 3RMAA 5FRMA 4C8NA 1J53A 2G8IA 4HHTA 2F8SA 3L3VA 1B92A 2RF2A 2XY5A 3OS2A 4B9TA 4FCYA 3B6PA 3P83D 2E6MA 3OYGA 1JLQA 4AHRA 3K59A 1NK7A 1SL2A 3K5MA 1X9MA 2HNZA 1SKRA 4B9SA 2X78A 3AA2A 3PX4A 3IRXA 3NH1A 3RMCA 4CK1A 4CJRA 1N6QA 4KHYA 3HM9A 2P5GA 4C8KA 1GOCA 4PA1A 5HROA 4DG1A 3LANA 2VG7A 4FJ8A 3CYMA 3SUPA 4IKFA 3ZSZA 1SUQA 4YFUA 5C25A 4BE2A 1QS4A 1BISA 3DOLA 5FROA 1TV6A 3MXJA 4XIUA 1SL0A 3SJJA 5J2QA 2BANA 3DLKA 5T7BA 1SKWA 4CHNA 1FKPA 4E0DA 3QIOA 4K8ZA 1QE1A 3ZT3A 3RMBA 3CFPA 1G15A 4DS4A 1NJYA 2BDPA 2Z1IA 4Z4EA 3KLIA 2RPIA 1BL3A 3LDSA 4RW6A 3K2PA 4FZXC 3VQEA 4FLYA 4KI4A 3HT3A 1BI4A 1J54A 1VSLA 5E41A 3SUOA 3NE6A 3OYMA 4QAGA 1VSJA 3KK3A 4DFMA 3RMDA 3PX0A 3AA3A 1VSDA 3NAEA 4DTOA 1C1BA 1U4BA 2HHVA 2AJQA 2HMIA 3DI6A 4M42A 3QEWA 2P5OA 1NKBA 4OKJA 3BGRA 2F96A 1KSPA 1X1PA 1KVAA 2WOMA 4OLAA 2DTUA 2YKNA 4DQQA 4RG8A 1UAXA 4CGHA 2OZMA 4KO0A 1HYVA 1BIZA 1ZBIA 3AVGA 1HYZA 3KIOA 4KHQA 4H4MA 4I9LA 2XY8A 1NKEA 3V4IA 2PZSA 4CJ5A 5SWMA 5HRSA 1Q9XA 2Z1HA 2F8TA 4FJJA 3QEXA 3OYCA 3ZT4A 1RT1A 5HP1A 2ETJA 4O55A 1XWLA 4BWMA 2HNYA 4O5BA 3SUQA 2XY7A 1Y97A 4DF4A 3HK2A 5CY4A 4FM1A 4RW9A 4DF8A 2BE2A 4NYFA 1A5VA 3AO3A 4BWJA 4Z4HA 2D5RA 4HUFA 4FLZA 4FJMA 4M45A 4CJSA 4M41A 1KVBA 4KB0A 2HHQA 4BE0A 4UQGA 4CJ3A 1S5JA 1B9FA 4FK2A 3OYFA 1RDBA 3VQ4A 3ZSRA 4N41A 3QINA 2DFFA 2OPPA 3VN5A 3ZT0A 1NKCA 2VG5A 4Z0UA 2VWJA 3SI6A 1VSIA 3ZSXA 3DLGA 1RT3A 3ZT2A 1DTTA 4AHUA 3F73A 4FLVA 2RKIA 3S9HA 4CJVA 4YNQA 1EKEA 1D9FA 3VQ9A 3AO2A 3LAMA 5KRTA 3CM6A 1TK0A 1VSHA 3DRSA 3ZSWA 3NH2A 1RTIA 1QSSA 3ALYA 4CF8A 4DWIA 1SKSA 3OYLA 3ZSYA 3UIQA 3HL8A 1HQUA 1RILA 4AHTA 4KAZA 3QEVA 4OKEA 1WSHA 4CE9A 4KHUA 1RTHA 3HPHA 2X74A 4K8XA 1EETA 4F3TA 3KKRA 4CK2A 4CHPA 3V9UA 3L8BA 2DFEA 3ASMA 1RBSA 3CFRA 1R0AA 3HSTB 4M3ZA 4DTXA 1NJXA 1KRPA 1UA1A 5CYQA 3M8QA 3KLGA 1CZBA 1Z25A 3MEGA 3PX6A 1NJWA 4TSXA 2YHAA 3OYNA 3QERA 4DLGA 1RT2A 3AVNA 3KKSA 1SV5A 1U47A 1CLQA 4H4OA 2HW3A 3JSMA 4CIEA 1EX4A 3C95A 5J2NA 3K57A 2GBZA 3I0SA 2R7YA 1RBUA 1CXUA 5FDLA 4IG3A 4HUEA 4BDPA 4CEAA 4B9VA 1RDDA 3NF7A 4O0IA 4KREA 1LW0A 1U48A 2IDOA 3IS9A 3TAMA 3NGZA 2D0BA 3TAPA 3LPTA 3V1RA 4QOZB 2YKMA 3AO4A 2YNHA 1NK8A 1BCOA 1IO2A 3U3GA 3MXMA 3OYDA 1C0UA 4FVMA 1TGOA 3L2QA 1RNHA 1UWBA 4FJGA 1NOZA 2KQ2A 3S3OA 1TVRA 3AVHA 2XO7A 1NK4A 1C1CA 2E4LA 3ZSVA 3CQ8A 4HVJA 1JLCA 1W0HA 2FBYA 3DLEA 5DMRA 4DTMA 4NCBA 1SL1A 1S1XA 4CERA 3AO5A 4CK3A 3MAQA 3LP0A 4CHQA 3NFAA 1U45A 4DU1A 2O4GA 3K58A 4OGEA 4DSLA 4ID5A 4I9QA 2BGGA 3LAKA 3I8DA 4IFYA 1KLNA 3L3UA 4E7KA 1JLBA 3D45A 4FM0A 3RRHA 1GOBA 4Z4CA 4FLWA 1KVCA 2IAJA 5CYMA 4M3RA 1L3VA 4ELTA 1IKXA 3C94A 5DK5A 5D3GA 4B3OA 5KI6A 2IC3A 4FJKA 1VRUA 2G8UA 4Y1DA 5SZTA 1RDAA 1BCMA 3OYIA 4FM2A 3SPYA 2QKKA 3G0ZA 3HP6A 1EP4A 3B6OA 4FJ9A 1LV5A 2HVIA 4J2BA 2HHSA 2KZZA 2YNGA 4DSFA 4O44A 4N47A 4OPKA 3EZ5A 5J2MA 5HLFA 1WSGA 2OPSA 1RDCA 3SQ0A 1BQMA 4F4KA 1RT7A 4ZHRA 3K5LA 4CCHA 2P51A 3LP2A 4N56A 4DQSA 2QK9A 3WNGA 3THVA 5C24A 3BDPA 3TI0A 4CJTA 2HNDA 5JS2A 3OYBA 3RWUA 3OYHA 3NF6A 3JYTA 2PY5A 1WLJA 1X9WA 2A1SA 4KV8A 2Z1GA 4CHZA 1U04A 1RBRA 4C8LA 1WSIA 4W5NA 4DSKA 2KZMA 4RW7A 4BE1A 1NJZA 4KTQA 4KFBA 3VQBA 2OZSA 1T05A 1IKVA 2Q3SA 2YNIA 4IBNA 1U49A 3WNFA 3OS1A 4CEDA 2PYJA 3C6TA 4E89A 1B9DA 2JGUA 4ZTFA 4KTWA 2RN2A 1ZBUA 3OYEA 4B9LA 4O4GA 1S1TA 2IS3A 3ULDA 1TKDA 4FW1A 1CZ9A 1S9GA 1WSFA 3NF9A 4CECA 3PV8A 1S1WA 2VG6A 4HTUA 1FK9A 5K14A 1RCHA 3M8PA 2E6LA 5KGXA 1D9DA 1Q9YA 1WNSA 3RR7A 3PO5A 4M3TA 1NK0A 2FBVA 2GV9A 2HVHA 2FC0A 4I2QA 4CEQA 2Y1JA 5I42A 4C8OA 3DOKA 4ID1A 3OS0A 1RBVA 1YTAA 3QEPA 2NUBA 1HYSA 1BHLA 5J2PA 2OPQA 4G1QA 4AHCA 2B4JA 1HRHA 1QSYA 4R5PA 4M3WA 1QHTA 2KW4A 3V1OA 4CFDA 1S1VA 3IG1A 1L3UA 4WE1A 2LSNA 4QCLA 3O4NA 1C0TA 2ITGA 3HVTA 4CESA 3KLEA 4IDKA 3SV3A 4DTRA 1IG9A 1REVA 3AV9A 4LH5A 1L3SA 2KTQA 5HRRA 1HNVA 4DFKA 4JRPA 1TK8A 2DY4A 3WNEA 3ZCMA 1I3AA 4DU3A 3NGYA 1JLGA 4W5QA 1WN7A 4W5RA 3DLBA 4FJLA 5HRNA 1NOYA 4CEZA 4N76A 4KI6A 5CZ1A 2HHTA 4FJNA 4AHVA 4LY7A 3V9XA 3E01A 4OLBA 1ZBHA 3AA4A 3DRPA 4I7FA 4JRQA 3C6UA 4CGDA 4DQRA 1TAQA 1HMVA 3DLRA 4CIFA 3NH0A 3TANA 4F8RA 4FZYA 4CF0A 4E7HA 4AILC 1YTUA 2HHXA 3VQ5A 4LD0A 1J5OA 1CXQA 4CHYA 2DFHA 2VWKA 3OY9A 3LZJA 4GVMA 4CHOA 4CIGA 4M3XA 3SUNA 3OYJA 1D5AA 1BGXT 3RTVA 3MXIA 3T3FA 4Y1CA 4CEEA 3ISNC 1T8EA 4NCGA 3TAFA 2G8FA 1NK9A 3SPZA 1FKOA 4E3SA 4F2RA 5HBMA 1WAJA 3KD5E 3VQ8A 3L2UA 4L8RB 1C1AA 2FBXA 2IGIA 3DYAA 1S9EA 3TAQA 4IG0A 5JS1A 3HYFA
chains in the Genus database with same CATH superfamily
5LMUK 2B5JA 4BRDA 4JNEA 1XQSC 4OGCA 2O8CB 2EHGA 4KKOA 2YHWA 2ZJPL 4E7IA 4DSJA 2ZGZA 3VOVA 2E1ZA 1JL2A 3DWLA 4C1NK 3VGKA 4F9OA 1KTQA 2FBTA 2NRRA 2HHWA 2W6LA 5BR8K 4B9UA 1TAUA 4CEFA 2O8EA 3IDHA 3AVKA 5HOOA 3G4SN 4CJ7A 2KKZA 4CJQA 4EZ9A 1HUXA 1GLAG 5AQUA 1TK5A 3CQYA 4OPJA 3WQTA 2YHYA 3DRRA 2QWQA 1S6PA 3BEXA 4F3OA 2WONA 4BGBA 4EHTA 1RBTA 1NK6A 3ZSOA 2YHBA 3VQDA 3M8SA 4FLXA 4ZTJA 3FZLA 3T19A 1ASVA 4AH9A 3QESA 2ZE2A 2F9WA 3HI0A 3ENHA 3LP3A 2QWNA 1ASWA 4KTZA 1VAZA 3OYKA 3CFOA 3PIOL 2G8HA 3C65A 1BDGA 5CZ2A 2G8KA 2YJFA 3UE5A 3IAYA 4LF8K 1K8KA 3K5NA 3V9WA 3O4QA 1HKCA 3CJ7A 1QZ6A 1RT5A 1BUPA 2PFUA 5HRPA 5AQVA 1HNIA 4LFCK 2B6AA 1H1VA 3KZBA 2OTJN 3A5LC 3DMJA 2KLAA 4FLUA 3SCXA 1DLOA 4Z4FA 4CJUA 4CZEA 1DEJA 4HCBA 1VHXA 4BACA 2E88A 3C0BA 4HUGA 4RW4A 5AQMA 4FWPA 3KK2A 4DR6K 2V51B 3MN7A 2O8FB 4H8KA 3QIPA 4FK0A 3QFUA 3VA3A 3HXMA 3CERA 1RFQA 2UXBK 1VK0A 5FLXO 4BRLA 3M8RA 1YF5L 3AVAA 1S6QA 3O4WA 5IWAK 1YVUA 4OPHA 2O8CA 3GG4A 3TSQA 4J2DA 4CFCA 2QWMA 4DR2K 4OKKA 2O8DA 4GKKK 3A0IX 4BG9A 4BRPA 1WSJA 1X9SA 3O8MA 3MCAB 3NHGA 1DTQA 3LWLA 1F21A 3D0PA 4NYNA 4DQPA 1YUWA 5KGWA 1ILYA 1VQON 1T3VA 2VCPA 4FWQA 5TKWA 2UYTA 2IVOA 1KFDA 3AVMA 1J53A 1J5EK 1CZAN 3L3VA 2RF2A 2XY5A 3DXKB 5AZJB 2NRXA 5M1NA 1GLEG 4FVUA 1JLQA 3WEEB 3K59A 3K5MA 4X62K 3CJAA 3NH1A 4DG1A 4YFUA 4GKJK 1QS4A 3TTDA 2RE2A 5JLHA 1NG9A 3D7EO 1TV6A 1MWKA 3ZX0A 4JN4A 4LC9B 3DLKA 5AQXA 4CZGA 1FKPA 4NXMK 1QE1A 4DR5K 1NJYA 1VQNN 3IMXA 2ZF5O 4Z4EA 3LDSA 4DCHA 3Q7CA 2YHXA 3VEOA 3A5NC 3WEEA 1FJGK 4Y0WA 4U7BA 1BI4A 1J54A 3HT3A 3SUOA 3QBWA 5GAHP 3NE6A 3OYMA 1VSJA 4WQ4C 3AA3A 3WQUA 2P5OA 2F96A 1X1PA 2WOMA 3A5MC 4RG8A 5AQLA 1BIZA 1HYZA 4H4MA 2QM1A 2XY8A 3V4IA 3M6GA 5HRSA 3CETA 2F8TA 3ZT4A 1RT1A 4O55A 3H1QA 1Y97A 1T6DA 4DF8A 3MXIA 1A5VA 5I9EB 4JI3K 4M45A 4M41A 3Q7BA 4BE0A 5EOYA 4UQGA 4CJ3A 1S5JA 4FK2A 3OYFA 3EE9A 3VQ4A 2GUPA 1NKCA 2VG5A 4Z0UA 2V7YA 2VWJA 3DLGA 3OW2M 3E66A 3JXUA 2VGNA 4JK8A 3S9HA 4MDAA 4YNQA 3AO2A 3LAMA 5JVGL 2HOEA 3NH2A 5LMNK 4DWIA 3RVCA 4MO5A 3HL8A 3WXKA 1QHAA 3F2KA 5EX5A 1NNEA 4KHUA 1RTHA 4F3TA 5JMVA 1LCUA 3CFRA 2W40A 4DTXA 5CYQA 4JI0K 1ZXOA 5BN8A 1RT2A 3KKSA 4BG8A 4JD2B 3SBGA 3CC4N 1EX4A 3C95A 2NRHA 2YJEA 3J7YP 4FPBA 1RBUA 4DKWA 4KREA 1LW0A 2IDOA 1WB9A 3THWB 3MXMA 3OYDA 3TPQA 4FVMA 1NJIO 1RNHA 3LL3A 3UKRA 1TVRA 2XO7A 4LF9K 2FSJA 1C1CA 2E4LA 4HVJA 1JLCA 2FBYA 4DTMA 3THXB 3CD6N 1SL1A 4XH5A 1YITN 2UXCK 1U45A 2Q0RA 4DU1A 2O4GA 3K58A 4DSLA 3LAKA 1IBLK 5AQFA 4JKCA 1JLBA 3D45A 2BTFA 3RRHA 1GOBA 5C12A 4FLWA 5CYMA 4ELTA 3I55N 5D3GA 5KI6A 3CMAN 5SZTA 3BP8A 1LOTB 2NLXA 3U9DA 3J81O 4FJ9A 2HVIA 4J2BA 1OVYA 3T1YK 2YNGA 3EZ5A 4A61A 1WSGA 3SQ0A 1BQMA 1EWQA 3OBYA 1NGDA 3T7ZA 2HBLA 1HKGA 4N56A 5AFUH 3LM9A 3BDPA 3J7ZO 2HNDA 5JS2A 3VESA 4EFHA 3C7NA 3JYTA 4KV8A 4CHZA 4C8LA 2A5XA 5AQNA 4RW7A 4IO8A 3G71N 5AQYA 3CCQN 3VQBA 4OPAA 2YNIA 2Q3SA 1K8AO 3N4QA 4CEDA 2PYJA 3L4QA 2RN2A 1ZBUA 4C1NI 1NU0A 4B3MK 4O4GA 4JKDA 2IS3A 1TKDA 4FW1A 1X9JA 1CZ9A 1WSFA 4A2AA 4HTUA 1YI2N 1RCHA 5KGXA 2GV9A 4H0YB 4WF9L 3AAQA 3CCVN 1YXQA 4FWNA 4I2QA 4CEQA 2Y1JA 4IOXA 4C8OA 3VF6A 1JCGA 3QEPA 4M7YA 5GIPA 1TUUA 1VQ6N 3ZX3A 3KHYA 4R5PA 4A2BA 1QHTA 2DPNA 4CI6A 4AQYK 1N34K 1YAGA 1L3UA 2LSNA 3O4NA 3VTIA 3KLEA 4CESA 4IDKA 2GELA 3SV3A 1IG9A 5C15A 1MDUB 2FLOA 3E9OA 1TK8A 4JKAA 3WNEA 4E1JA 4DU3A 3KWGA 1WN7A 5HRNA 4DR4K 5AQQA 4CEZA 3QDKA 1BA1A 1ZBHA 3AA4A 2W41A 4I7FA 5CE3A 1IV0A 2VGMA 4FZYA 4CF0A 2HHXA 4KH5A 3CCRN 3R1XA 4BRQA 4CIGA 4M3XA 3SUNA 1NGHA 3RTVA 1DGKN 3H46O 3O80A 4FWSA 3TAFA 2EWSA 3SPZA 5HBMA 2E20A 4M3TA 3VQ8A 3L2UA 2HVHA 2IGIA 5CY4A 5I3UA 3HYFA 3MN5A 1ZBLA 1RDUA 4FWRA 3KK7A 4KPYA 4W5OA 2ZD1A 3WNHA 3O08A 4BRHA 1HJOA 4B1WB 1N36K 4KHSA 5BRDA 5J1EA 1HQEA 2FF6A 3FZFA 3V6DA 4DV4K 2P9IB 2H3GX 1E3MA 4FWOA 1LAVA 5C2FA 4FYDA 1IKWA 1I39A 2HB5A 3M1FA 2PYLA 5M1FA 3QO9A 1J9AA 4DFJA 3CHWA 3MEDA 4CEBA 5FPEA 2ATQA 4AM6A 2I5JA 3VQAA 3VA0A 1TKZA 1BI4B 3EYZA 3MMVA 5BRFA 3AO1A 2OYQA 2D0CA 3LDOA 4DTPA 2X6SA 5F0XA 1BOTO 5EU7A 1DKGD 1HJRA 3KLHA 4CJWA 3NBPA 3SMPA 1FXXA 3VETA 3K5OA 4FLTA 1SAZA 5KRSA 4CZLA 3HBTA 1VSMA 4HWIA 1KFSA 3A5OC 3VGLA 2XY6A 3BZKA 4KH6A 2FSKA 5AZJA 1XHZA 4WQ5C 4E1NA 3PO4A 1XHXA 4DS5A 1XMOK 4CJ4A 3O9SA 3ITHA 3HVRA 2J4RA 4PWDA 2VQFK 4YDUC 2PBDA 3TABA 1C6VA 5M1QA 4X64K 1UOCA 1ZBFA 2JLEA 4H0OA 3VQ7A 5AJ3K 2HSTA 4I2PA 4FO0A 4FJHA 3RSEB 2V52B 3AA5X 3DM2A 3KD1E 3VQQA 5A2QO 4RTFD 4CZFA 4DQIA 1WSEA 4O8UA 3ZX2A 1Z26A 4B8AB 4E7JA 1LWEA 4CFAA 1BWFO 4DLEA 2G8VA 1RGIA 4FJIA 4DSIA 3VERA 3RSEA 4OVLA 2NZTA 4HCCA 3DAWA 3KTQA 4BDYA 2WC9A 4DSEA 4C8MA 3C7NB 5KPZA 1NGJA 4GW6A 4JKEA 5FPDA 2XHBA 3HRGA 3TAEA 5B8HA 3CCUN 3DLHA 3GE1A 1VRTA 3QNNA 1L5UA 3SV4A 3W0LA 3SMSA 4E1MA 3RRGA 1V4TA 1C0MA 1BQNA 3GBTA 1ZYQA 2IVNA 4JI5K 4DFPA 4BC3A 4IJAA 3CG7A 2Q0UA 2A1RA 4NXNK 4A57A 4FW2A 3HPGA 1XNRK 4FXDA 3OVNA 1OH8A 3S41A 2GWKA 4ISFA 3FFIA 2A42A 1WAFA 4CGFA 3HO1A 3QEIA 1I94K 3KK1A 2W42A 1VSKA 4Q5VA 1BIUA 3TWHA 1ITGA 1W7AA 2GTDA 4JI2K 4BR0A 4C8NA 2F8SA 5AQZA 1NGEA 1HNWK 4B9TA 2F7TA 1X9MA 2HNZA 3TTCA 3AA2A 3RMCA 1N6QA 2YX6A 3HM9A 1KXPA 1VQ9N 1GOCA 5HROA 4FJ8A 4IKFA 4BE2A 3D2EB 5C25A 1M90O 3P39A 4XIUA 4JD2A 1JJ2M 3ENBA 3QFPA 1N8RO 4E0DA 4X65K 3M5RA 3ZETB 3CFPA 3KLIA 1BL3A 3E1YA 1SQKA 1S72N 1IBMK 4QAGA 1VQ8N 3KK3A 4DFMA 3RMDA 1VSDA 5HL7L 4B1UB 3GL1A 3HTVA 1U4BA 4LF6K 1GLJO 4M42A 3THYA 4FOIA 2HBJA 2VYPA 4CD1A 4CGHA 1UAXA 4BC5A 3CF5L 1YIJN 2P9NB 4KHQA 4CJ5A 1XUPO 3H45C 4FJJA 3QEXA 4DR7K 3OYCA 4BWMA 3SUQA 3D2FA 3CQXA 4O5BA 4DF4A 2NRWA 4FM1A 1ZC6A 4RW9A 1BG3A 3W3DA 4NYFA 3HK2A 4ILGB 4FLZA 4CJSA 4BVPA 1KVBA 1NGBA 4BQLA 1FW6A 5KQ8A 3BF1A 3J8AA 3QINA 1HR0K 1X3NA 3OHRA 3EZWA 1VSIA 3ZSXA 1RT3A 3ZT2A 3ZEUB 4FLVA 3F9MA 1D9FA 3VQ9A 1DT9A 1BU6O 3CM6A 3DXMA 1TK0A 1VSHA 3ZSWA 1QSSA 1QVFM 3O9TA 4CF8A 3UIQA 3QB0A 1HQUA 1RILA 4AHTA 4KAZA 1S22A 2ASOA 3U4LA 4FPAA 4K8XA 1EETA 2P9LA 3KKRA 1HX1A 4FWLA 2BUPA 4CHPA 2NRVA 1RBSA 1R0AA 3HSTB 5GAEP 1NJXA 1UA1A 3KLGA 1Z25A 3K9JA 4WFAL 2YHAA 3JAMO 3AVNA 4EIAA 1SV5A 2QXLA 1CLQA 3CI5A 3BF3A 5J2NA 4V19S 4K41A 1CXUA 5FDLA 4BDPA 4HUEA 1SS6A 4WQ5A 2E1YA 3TAPA 1ATNA 4QOZB 3V1RA 2YNHA 3MCPA 4WFBL 3U3GA 4DV3K 1TGOA 1M1KO 3VGMA 2FSNA 1NOZA 3BZCA 2KQ2A 1QQMA 3AVHA 1NK4A 3I8BA 2P9SA 4BRIA 2E2NA 1S1XA 1TYQA 2P9UA 3NFAA 2OCEA 3VTHA 4H0TB 4OGEA 4ID5A 2IIRA 3I8DA 5LJWA 4IFYA 1K73O 3THXA 4PKGA 4EHUA 3L3UA 4JYAK 4E7KA 4CBXA 4FM0A 1NMDA 4Z4CA 5AQKA 1NGAA 4M3RA 1IKXA 5JLFA 4FJKA 1RDAA 3PSIA 3OYIA 3SPYA 3P4IA 1LV5A 1VQ7N 4N47A 4OPKA 4BRCA 4IEIA 2I7NA 2OPSA 1RDCA 4OO1J 4ZHRA 4J8FA 2FF3B 2P51A 4DQSA 5AQPA 2ZGYA 2QK9A 3WNGA 2Q31A 5BPLA 4BR7A 4CZMA 1WSIA 4W5NA 4DSKA 2P9PA 2A3ZA 2KZMA 4H5WA 5AQRA 2OZSA 3VEXA 1KC8O 2ZWHA 3WNFA 3C6TA 4E89A 2JGUA 3ZYYX 4B9LA 4GVEA 5H1SQ 4CECA 3NF9A 5E84A 2VG6A 5K14A 5FPNA 2UXDK 2E6LA 1D9DA 3B8AX 4BRAA 3PO5A 3VF2A 4YOWA 1NK0A 2FBVA 1OH5A 4B3SK 4QS7A 4GV9A 3O9QA 2GWJA 1IJJA 3DOKA 2NUBA 4JKGA 4DV5K 1HYSA 5ADXH 2B4JA 4M3WA 3V1OA 4BRFA 1S1VA 1C0TA 3CJCA 3CCEN 4JI8K 2AP1A 2O8BB 3E9LA 1HNVA 3ATVA 4JRPA 1HPMA 2DY4A 2I7PA 3QMLA 5FPMA 3DLBA 4FJLA 2F9TA 4LY7A 4I6MB 4OLBA 4JRQA 3C6UA 4CGDA 4CZKA 3TANA 3NH0A 4NLBA 3VQ5A 2FXUA 3H1VX 4LD0A 1J5OA 1CXQA 4CHYA 1BA0A 2VWKA 3LZJA 3OYJA 3CC2N 3ISNC 2O8EB 4NCGA 2G8FA 1NK9A 5EVZA 3HJFA 3FZHA 1WAJA 3KD5E 3WXLA 4CJTA 4BROA 1Q8IA 4WCEL 5F1XA 4CGIA 1RTJA 2PAVA 3IUCA 4DR3K 4CF1A 3H08A 4RW8A 1W9HA 3TAGA 4BQZA 1A5XA 4FL9A 4B9QA 2IOCA 3CJ9A 1T03A 3SJHA 4Z4GA 5EXWA 4ISEA 3LDLA 2P1JA 1S1UA 4YDUA 4FK4A 4CJPA 3HP9A 3A2FA 3UKUA 4JEPA 3MX2A 4CGGA 4BR4A 4B08A 3AARA 4JI6K 3LP1A 3E9PA 2Z1JA 3L2WA 1XC9A 1KD1O 3T1AA 3SK3A 1O13A 4O8KA 4PUOA 4H5NA 4J2EA 4H03B 1MWMA 4PL8A 4YOVA 4R79A 2GX9A 2HHHK 4Q0BA 5M1OA 1KAZA 3VQCA 3AVBA 3SYZA 4BDZA 3L6QA 4IOCL 1YT3A 3QETA 1V4SA 1TKTA 4FZZA 1EXQA 3AVLA 1NK5A 2QKBA 2UUCK 2JWKA 3EY1A 1KAXA 4EAHD 4CGJA 3KWIA 4GNIA 3G6EN 3UKUB 3L2VA 3GOIA 5C42A 3O3GA 4JKFA 1XI1A 1QQOA 4Z4IA 3QLHA 1IKYA 3L2RA 4DTSA 4MLHA 4YHHK 5AQWA 4PL7A 3SQ4A 4E19A 1JLEA 1JLFA 2QW9A 3JS6A 1LWCA 4BR2A 1YJWN 1KQSM 2OA8A 1IH7A 4DTNA 3V1QA 3GDQA 1RT6A 2UU9K 4N5SA 5GIOA 3VQPA 4JS4A 3CCMN 1Z6RA 3O1BA 2OTLN 1GLFO 1JCFA 3P1GA 4KHNA 4ICLA 1J6ZA 3G10A 3WT0A 4NCAA 5FRNA 3AVFA 4LSLA 4M3YA 3DXMB 3TSUA 2P9IA 3KLFA 4O0JA 2GUIA 4AHSA 1TL3A 1RTDA 3AVIA 4GV6A 3I0RA 4E7LA 3MECA 1A5WA 4F2SA 3LZIA 4ELUA 4KH4A 1LW2A 4RCHA 4B1XB 3P38A 3QICA 1NGFA 4CZJA 1LWFA 4LH4A 1HPZA 1VSEA 3TU5A 3U3YA 4WYBA 2EX3A 2Y1IA 4DU4A 3AVJA 3MX5A 1K6YA 3R8EA 1TKXA 1D8YA 1KCFA 5FRMA 2G8IA 2E2QA 1B92A 3KVGA 3P83D 2E6MA 2Q1NA 3ENOA 1NGGA 2O8BA 1SL2A 4AHRA 1NK7A 4B9SA 3PX4A 4CK1A 3J80O 4C8KA 3LANA 2VG7A 3ZSZA 4IXCA 3DOLA 4DV6K 1X3MA 1Z05A 5FROA 2GEMA 3FE1A 1SL0A 3SJJA 5J2QA 5TKYA 2BANA 4CHNA 1OH6A 3VEVA 4YOXA 3ZT3A 1WOQA 1G15A 4DS4A 2Z1IA 4U67L 3SBTA 5AQTA 2RPIA 4O5FA 4RW6A 3WXMB 4FZXC 3VQEA 4KI4A 5E41A 2D4WA 1VSLA 3VMFB 1XC3A 5ADXA 3H3NO 3NAEA 1C1BA 2AJQA 2CGJA 5DM7L 2HMIA 3QEWA 4JI1K 4CZIA 4IWVA 1NKBA 3TTFA 3EE8A 2RHKA 1KSPA 4OLAA 1KVAA 5BREA 2YKNA 2CGKA 3K0SA 4CZHA 2OZMA 1TUYA 1HYVA 1EQYA 4JHDB 3AVGA 1ZBIA 3KIOA 4I9LA 2PZSA 5CHIA 1VQ5N 1Q9XA 2Z1HA 2WUSA 2D0PA 2ETJA 1Q86O 4GY2B 1GLDG 4BGAA 2BE2A 4Z4HA 4HTLA 3AO3A 4HUFA 3L0QA 3EO3A 2HHQA 2YI1A 5LJVA 1B9FA 1Q81O 3AY9A 4N41A 2DFFA 2OPPA 3ID6A 3DXKA 3VN5A 1XNQK 3SI6A 4B1ZA 2RKIA 1EKEA 4BR5A 4G9ZA 3DRSA 1RTIA 4FOEA 4I6MA 3EEQA 3LDPA 5KPRA 1SKSA 5KQDA 3OYLA 2ITMA 2JWLA 3QEVA 4K43A 1WSHA 2X74A 3UKRB 1Q7YO 3U8XA 3L8BA 2DFEA 3ASMA 2HHSA 5C10A 1KRPA 3M8QA 2O8DB 4TSXA 3OYNA 3QERA 4JKBA 4NB4A 3D2FB 3EL2A 1U47A 2HW3A 5CR4A 4JAXA 4CIEA 3K57A 3DJCA 3I0SA 1NLVA 4AF1A 2HF3A 4B9VA 4IG3A 2A40A 4CEAA 3EN9A 1RDDA 4O0IA 4GV3A 4DV1K 1U48A 2D0BA 2YKMA 3AO4A 3VPZA 1NK8A 1BCOA 5DM6L 1G99A 2P9KA 4B3RK 1S3XA 1NGIA 5LY3A 3ZSVA 3CQ8A 1W0HA 3DLEA 5DMRA 4NCBA 2CH5A 3OTOK 4CERA 3MAQA 4JHDA 1NBWA 5AZIA 4YORA 4I9QA 3WXJA 2BGGA 3A8YA 4XH4A 3PLAA 2ZM6K 2UUBK 4WFNL 4OX9K 2IC3A 5GINA 3SAGA 1BCMA 3MDQA 3VEZA 3G0ZA 1EP4A 3B6OA 3O9UA 1ATSA 3D6RA 2KZZA 5J2MA 4O44A 5HLFA 4K25A 1RT7A 3K5LA 3HOSA 4X66K 3RWUA 3NF6A 5C0YA 5AZIB 1NMNA 2A1SA 2Z1GA 4KTQA 1R59O 1TYQB 4JK9A 2WFBA 3O6WA 4KFBA 4K0KK 4NO7A 1HNZK 1T05A 1IKVA 3OBWA 1HKBA 1B9DA 4ZTFA 3AAPA 2P9KB 3OYEA 2HBMA 2A41A 4Z94A 4DQ8A 3NMUA 1S9GA 5AQJA 5M1KA 1S1WA 4FWMA 5ELZA 3M8PA 1Y64A 1WNSA 1Q9YA 4LFBK 4BRKA 5I42A 4ID1A 1YTAA 3MWPA 1BHLA 5J2PA 4G1QA 1HRHA 5AFUA 2KW4A 4FSVA 3IG1A 4QS9A 1EWRA 3AGKA 2ITGA 3HVTA 2VQEK 3AV9A 2P9LB 3FZMA 1L3SA 2KTQA 1U2VB 4YOYA 3PIPL 4LF7K 1JLGA 4W5QA 1QQNA 3HZ6A 4W5RA 4KI6A 3CJBA 2HHTA 4FJNA 4AHVA 3V9XA 3E01A 4DQRA 1TAQA 3DLRA 4CIFA 4F8RA 4RWTA 3OA9A 4AILC 3IFRA 3QBXA 4A59A 2DFHA 1YHQN 3BUZB 4CBUA 4CHOA 2E2PA 4PKHA 3H6EA 3ATUA 1D5AA 3P31A 3T3FA 2ZJQL 4CEEA 1T8EA 3J7AP 1T6CA 2FBXA 4IG0A 4ILHA 1N5YA 3NVKA 3VQ6A 3LPUA 1ASUA 2QWOA 2P9PB 3CCJN 4A62A 4MDBA 3QNOA 4A5BA 4DR1K 4ELVA 3AVCA 1LAWA 4PKIA 3MWTA 4DV2K 1JL1A 4DTUA 3V81A 4PQUA 4A5AA 3S3NA 3ZT1A 3O3HA 3F9KA 4BRNA 3PUFA 4CF9A 2CGLA 2HHUA 4EZ6A 4EP4A 1P90A 2XRIA 1QVGM 2O8FA 1P8ZA 4L3QA 3IKMA 3V9SA 2KHOA 3SLCA 3SNNA 3WUHA 3CC7N 4IJNA 3FGUA 4CFBA 1W97L 3ZSQA 1JXBA 5F2RA 3TR8A 3LDQA 4CD3A 3CCLN 4IDHA 1WBDA 4BRMA 4WQ4A 3VEYA 3KJVA 5GADP 4CF2A 5KTQA 4CEOA 1GLCG 3VEWA 4C23A 2WBNA 3P5JA 1VQMN 3SQ2A 4B9NA 2P9SB 4UY8O 3DLLL 2G8WA 3N4PA 3T1HK 1T7PA 3CM5A 4MO4A 1TL1A 3SQ1A 4YOUA 1UA0A 2D1KA 3LDNA 1GOAA 3NGIA 4CVNE 1E4GT 3H3OB 5AQGA 4EP5A 2QEXN 2HF4A 3CIPA 4JKGB 4LSNA 4FJ5A 4M3UA 3LALA 3CCSN 2W6KA 3NF8A 3U6FA 4IOAL 3LWMA 1MU2A 4MQ3A 3V9ZA 5LL6Z 1QSLA 5JICA 1O1WA 2BH1A 3TARA 4FJXA 2Q97A 4CW7B 1WUAA 3RR8A 3EKSA 2A6AA 4JV5K 3VENA 3PY8A 1JKHA 4DMNA 4OJRA 1GLLO 1QQCA 3CPWM 2QXFA 3OJSA 4MFBA 2NRZA 4CJLA 2KFNA 4PY5A 3FR0A 2E2OA 3SZ2A 3TSPA 4B8CA 3OYAA 1Q82O 4KHWA 4CJFA 2ZQBA 3MEEA 4IFEA 2O4IA 4BC2A 4DTJA 3THWA 4M63C 4J2AA 3CXCM 1K9MO 4FJ7A 4CJKA 2KFZA 2YNFA 1VSFA 4BC4A 1N32K 2F4VK 1RT4A 3NCIA 5BN9A 4B3TK 3FLCO 4CJEA 3LM2A 5GAGP 4YOTA 5MLCQ 2QWRA 3C6HA 5AQSA 4JI4K 1JXEA 2D0AA 2YV0X 4W5TA 3O5BA 4GMJB 4NLCA 3OJUA 4LFAK 3G25A 4BY9C 4H0XB 5KPTA 1JLAA 2X6NA 4B1VA 4PHTX 1QTMA 4IO9L 2NRTA 3S3MA 2OPRA 2P9NA 1C0FA 3PSFA 4JLHA 1L3TA 3I33A 1KLMA 4B9MA 4KRFA 3ID8A 4IFVA 3O3FA 4JS5A 3HPOA 5BRHA 3ULEA 4KB1A 3NDKA 3RMAA 3WXIA 4DV7K 4HHTA 1RDWX 2VWBA 3OS2A 4CBWA 4FCYA 2UUAK 3R9PA 3B6PA 3EKUA 3OYGA 1SKRA 2X78A 3IRXA 4XEIA 4CJRA 4KHYA 4JK7A 2P5GA 3ZETA 5IT9O 1GLBG 3AGRA 4PA1A 3CYMA 3SUPA 1SUQA 1BISA 1NWKA 4YY3K 4BRGA 4DUYK 2ZJRL 3MXJA 3FZKA 3D2EA 1QZ5A 5T7BA 1SKWA 4K8ZA 4DUZK 3QIOA 3RMBA 3SAFA 1HNXK 2BDPA 2ASMA 3K2PA 1OKJA 4FLYA 2YCHA 3PX0A 1BO5O 4QS8A 4DTOA 2HHVA 3DI6A 1VQLN 4OKJA 3BGRA 2DTUA 4DQQA 4KO0A 1E4FT 3ZEUA 1NKEA 5SWMA 1U2VA 4MLEA 3MN9A 5JVHL 4ISGA 3BY5A 5AQHA 5HP1A 1XWLA 2HNYA 3NVMA 1WBBA 2XY7A 4B1YB 4BWJA 2D5RA 4FJMA 4KB0A 3F5TA 3U9ZA 1RDBA 1SZ2A 4H0PA 3ZSRA 3ZT0A 2WTUA 1KAYA 1DTTA 4AHUA 1VQKN 3F73A 1EO1A 4CJVA 4BVOA 2QWLA 5KRTA 5M1PA 3ALYA 1NM1A 3T69A 5AR0A 3ZSYA 2E8AA 1MA9B 1T44A 4OKEA 3HM8A 4CE9A 3HPHA 3UB5A 3V9UA 4CK2A 4M3ZA 3ZLJA 3HSCA 1CZBA 3PX6A 3MEGA 1NJWA 1NGCA 4DLGA 4H4OA 3JSMA 1XMQK 1C0GA 2GBZA 2R7YA 1N33K 5EY4A 3NF7A 4DHYA 3IS9A 3TAMA 4IEEA 3NGZA 3LPTA 3MK6A 1ATRA 2HBKA 4BR9A 1IO2A 4M7XA 1C0UA 4DV0K 3L2QA 4FJGA 1UWBA 4BREA 2E5LK 3S3OA 3O9RA 2QA4N 3SAHA 3VF4A 3AO5A 4CK3A 3LP0A 4CHQA 5E26A 5BPNA 2P9UB 4LF4K 1ZBSA 1KLNA 3THYB 3M3ZA 1KVCA 2IAJA 1L3VA 3C94A 5DK5A 3CMEN 4B3OA 1VRUA 2G8UA 4Y1DA 4IZ9A 2QI2A 4FM2A 2QKKA 2IVPA 5BR9A 3HP6A 2AA4A 4DSFA 2V7ZA 4F4KA 3MN6A 4CCHA 2ASPA 3LP2A 3C6AA 3THVA 5C24A 4H0VB 1JCEA 3TI0A 3OYBA 3O1WA 3OYHA 1Q18A 4XH1A 2PY5A 1WLJA 4ILJA 4K42A 1X9WA 1U04A 1RBRA 4JKHA 4LF5K 4BE1A 1NJZA 5AQIA 4IBNA 2QTDA 1U49A 3OS1A 5AQOA 1OVQA 1IBKK 3I56N 4KTWA 5BPMA 4AM7A 2QWPA 1S1TA 3ULDA 4KHPK 4JI7K 3PV8A 2CH6A 4KBOA 1FK9A 2Q2RA 3RR7A 1U6ZA 1YJNN 4H5RA 2FC0A 3R3LA 5C2DA 2Q36A 1VQPN 3OS0A 1RBVA 1HLUA 2OPQA 4FWKA 3K9KA 4AHCA 1QSYA 4CFDA 4WE1A 4QCLA 1VQ4N 3CJ1A 4DTRA 1REVA 1IG8A 4LH5A 5HRRA 3FFKB 4DFKA 3ZCMA 4H5VA 1I3AA 3NGYA 1NOYA 4N76A 3ULEB 5CZ1A 2NNWA 1YVNA 4H5TA 3DRPA 3HOTA 1HMVA 4DB3A 1OH7A 2OANA 3L4IA 4E7HA 1YTUA 3CPEA 3OY9A 4GVMA 1K8KB 1W2BM 1BGXT 4Y1CA 1YJ9N 1FKOA 2HMPA 4E3SA 4F2RA 3R6MA 1ESVA 1C1AA 3DYAA 2D0OA 3TAQA 1S9EA 4L8RB 5JS1A 1D4XA
chains in the Genus database with same CATH topology
1N5YA 1ZBLA 1Q8IA 2B5JA 4KPYA 3VQ6A 4W5OA 2ZD1A 3LPUA 3WNHA 1ASUA 4CGIA 1RTJA 4OGCA 3HJFA 2EHGA 4KHSA 4CF1A 3H08A 4KKOA 4RW8A 1W9HA 3QNOA 5J1EA 1HQEA 3TAGA 4ELVA 3AVCA 1A5XA 1LAWA 2IOCA 3V6DA 4E7IA 4DSJA 1JL1A 1T03A 4DTUA 3V81A 1LAVA 4PQUA 3S3NA 3ZT1A 1JL2A 3O3HA 4Z4GA 4FYDA 3F9KA 3PUFA 2P1JA 1IKWA 1I39A 2HB5A 1S1UA 2PYLA 1KTQA 2FBTA 3QO9A 1J9AA 4CF9A 4FK4A 2HHWA 4CJPA 4DFJA 4B9UA 2HHUA 1TAUA 3HP9A 3MEDA 3A2FA 4EP4A 4EZ6A 4CEFA 2XRIA 4CEBA 2ATQA 2I5JA 3VQAA 4CGGA 4B08A 3AVKA 3VA0A 3V9SA 1TKZA 3LP1A 3SNNA 1BI4B 3EYZA 2Z1JA 3L2WA 1XC9A 3T1AA 4CFBA 3AO1A 2OYQA 4CJQA 4EZ9A 3ZSQA 2D0CA 4DTPA 4PUOA 2X6SA 1JXBA 1TK5A 4OPJA 3TR8A 4J2EA 4Q0BA 5EU7A 3VQCA 3SYZA 1HJRA 3AVBA 3KLHA 3DRRA 4BDZA 4CJWA 3NBPA 1S6PA 4F3OA 1YT3A 3KJVA 1FXXA 3QETA 2WONA 3K5OA 4CF2A 4FLTA 1RBTA 1NK6A 1TKTA 3ZSOA 4FZZA 1EXQA 5KTQA 4CEOA 5KRSA 3AVLA 1NK5A 2YHBA 3VQDA 3M8SA 4FLXA 4ZTJA 2QKBA 3P5JA 3T19A 1VSMA 3EY1A 3SQ2A 1ASVA 4AH9A 3QESA 2ZE2A 3LP3A 4B9NA 1KFSA 2G8WA 4CGJA 1ASWA 3CM5A 4KTZA 1T7PA 2XY6A 3L2VA 1TL1A 3OYKA 3SQ1A 3CFOA 2G8HA 5C42A 3O3GA 5I3UA 1UA0A 1XHZA 4E1NA 5CZ2A 1XI1A 1GOAA 3NGIA 2G8KA 4Z4IA 3PO4A 1XHXA 3IAYA 3QLHA 1IKYA 3L2RA 4DS5A 4CJ4A 4EP5A 3ITHA 3K5NA 3V9WA 4DTSA 3O4QA 3HVRA 4LSNA 4M3UA 4FJ5A 4PWDA 3SQ4A 3LALA 4E19A 1JLEA 3NF8A 1JLFA 3U6FA 1RT5A 3TABA 3LWMA 1C6VA 1MU2A 4MQ3A 1UOCA 1ZBFA 1LWCA 2JLEA 3VQ7A 1HNIA 5HRPA 3V9ZA 2B6AA 4I2PA 1QSLA 4FJHA 2OA8A 1IH7A 1O1WA 3AA5X 3TARA 4DTNA 3DM2A 4FJXA 3V1QA 3KD1E 3DMJA 3RR8A 4FLUA 3VQQA 3SCXA 1RT6A 1DLOA 4Z4FA 4CJUA 3PY8A 4HCBA 1JKHA 4DQIA 4DMNA 4OJRA 4N5SA 1QQCA 1WSEA 2QXFA 3OJSA 3VQPA 4BACA 4MFBA 4CJLA 4HUGA 1Z26A 4JS4A 2KFNA 4B8AB 4RW4A 4E7JA 1LWEA 3KK2A 4PY5A 4CFAA 4DLEA 3SZ2A 4B8CA 3OYAA 2G8VA 4FJIA 4DSIA 4H8KA 4KHWA 3P1GA 4KHNA 4CJFA 4OVLA 4ICLA 3QIPA 4FK0A 3VA3A 4HCCA 3HXMA 2ZQBA 3MEEA 2O4IA 3G10A 3KTQA 4NCAA 4BDYA 5FRNA 4DSEA 3AVFA 4DTJA 4LSLA 4C8MA 4J2AA 4M3YA 4GW6A 2XHBA 3KLFA 1VK0A 4FJ7A 4O0JA 3M8RA 3TAEA 4CJKA 2KFZA 2GUIA 2YNFA 3AVAA 1VSFA 3DLHA 1S6QA 1VRTA 4AHSA 1YVUA 3QNNA 1RT4A 1TL3A 1L5UA 3SV4A 1RTDA 4E1MA 3AVIA 3NCIA 4J2DA 4CFCA 3RRGA 1C0MA 3I0RA 1BQNA 4E7LA 1ZYQA 3MECA 4CJEA 4DFPA 4OKKA 1A5WA 4F2SA 3CG7A 3LZIA 1JXEA 2D0AA 2A1RA 2YV0X 4ELUA 4W5TA 1WSJA 4GMJB 3OJUA 1X9SA 4FW2A 3HPGA 1LW2A 4FXDA 3NHGA 3OVNA 1DTQA 3LWLA 1F21A 3D0PA 1JLAA 2X6NA 1QTMA 4NYNA 4DQPA 3FFIA 5KGWA 4CGFA 1WAFA 3S3MA 3HO1A 3QEIA 2OPRA 1LWFA 4LH4A 3KK1A 2W42A 1HPZA 1VSEA 1VSKA 4JLHA 3U3YA 1L3TA 1KLMA 4B9MA 4KRFA 2EX3A 4IFVA 4Q5VA 2Y1IA 3O3FA 4DU4A 4JS5A 3AVJA 1BIUA 1K6YA 3HPOA 3TWHA 1ITGA 1TKXA 4KB1A 1KFDA 1D8YA 1KCFA 3AVMA 3NDKA 3RMAA 5FRMA 4C8NA 1J53A 2G8IA 4HHTA 2F8SA 3L3VA 1B92A 2RF2A 2XY5A 3OS2A 4B9TA 4FCYA 3B6PA 3P83D 2E6MA 3OYGA 1JLQA 4AHRA 3K59A 1NK7A 1SL2A 3K5MA 1X9MA 2HNZA 1SKRA 4B9SA 2X78A 3AA2A 3PX4A 3IRXA 3NH1A 3RMCA 4CK1A 4CJRA 1N6QA 4KHYA 3HM9A 2P5GA 4C8KA 1GOCA 4PA1A 5HROA 4DG1A 3LANA 2VG7A 4FJ8A 3CYMA 3SUPA 4IKFA 3ZSZA 1SUQA 4YFUA 5C25A 4BE2A 1QS4A 1BISA 3DOLA 5FROA 1TV6A 3MXJA 4XIUA 1SL0A 3SJJA 5J2QA 2BANA 3DLKA 5T7BA 1SKWA 4CHNA 1FKPA 4E0DA 3QIOA 4K8ZA 1QE1A 3ZT3A 3RMBA 3CFPA 1G15A 4DS4A 1NJYA 2BDPA 2Z1IA 4Z4EA 3KLIA 2RPIA 1BL3A 3LDSA 4RW6A 3K2PA 4FZXC 3VQEA 4FLYA 4KI4A 3HT3A 1BI4A 1J54A 1VSLA 5E41A 3SUOA 3NE6A 3OYMA 4QAGA 1VSJA 3KK3A 4DFMA 3RMDA 3PX0A 3AA3A 1VSDA 3NAEA 4DTOA 1C1BA 1U4BA 2HHVA 2AJQA 2HMIA 3DI6A 4M42A 3QEWA 2P5OA 1NKBA 4OKJA 3BGRA 2F96A 1KSPA 1X1PA 1KVAA 2WOMA 4OLAA 2DTUA 2YKNA 4DQQA 4RG8A 1UAXA 4CGHA 2OZMA 4KO0A 1HYVA 1BIZA 1ZBIA 3AVGA 1HYZA 3KIOA 4KHQA 4H4MA 4I9LA 2XY8A 1NKEA 3V4IA 2PZSA 4CJ5A 5SWMA 5HRSA 1Q9XA 2Z1HA 2F8TA 4FJJA 3QEXA 3OYCA 3ZT4A 1RT1A 5HP1A 2ETJA 4O55A 1XWLA 4BWMA 2HNYA 4O5BA 3SUQA 2XY7A 1Y97A 4DF4A 3HK2A 5CY4A 4FM1A 4RW9A 4DF8A 2BE2A 4NYFA 1A5VA 3AO3A 4BWJA 4Z4HA 2D5RA 4HUFA 4FLZA 4FJMA 4M45A 4CJSA 4M41A 1KVBA 4KB0A 2HHQA 4BE0A 4UQGA 4CJ3A 1S5JA 1B9FA 4FK2A 3OYFA 1RDBA 3VQ4A 3ZSRA 4N41A 3QINA 2DFFA 2OPPA 3VN5A 3ZT0A 1NKCA 2VG5A 4Z0UA 2VWJA 3SI6A 1VSIA 3ZSXA 3DLGA 1RT3A 3ZT2A 1DTTA 4AHUA 3F73A 4FLVA 2RKIA 3S9HA 4CJVA 4YNQA 1EKEA 1D9FA 3VQ9A 3AO2A 3LAMA 5KRTA 3CM6A 1TK0A 1VSHA 3DRSA 3ZSWA 3NH2A 1RTIA 1QSSA 3ALYA 4CF8A 4DWIA 1SKSA 3OYLA 3ZSYA 3UIQA 3HL8A 1HQUA 1RILA 4AHTA 4KAZA 3QEVA 4OKEA 1WSHA 4CE9A 4KHUA 1RTHA 3HPHA 2X74A 4K8XA 1EETA 4F3TA 3KKRA 4CK2A 4CHPA 3V9UA 3L8BA 2DFEA 3ASMA 1RBSA 3CFRA 1R0AA 3HSTB 4M3ZA 4DTXA 1NJXA 1KRPA 1UA1A 5CYQA 3M8QA 3KLGA 1CZBA 1Z25A 3MEGA 3PX6A 1NJWA 4TSXA 2YHAA 3OYNA 3QERA 4DLGA 1RT2A 3AVNA 3KKSA 1SV5A 1U47A 1CLQA 4H4OA 2HW3A 3JSMA 4CIEA 1EX4A 3C95A 5J2NA 3K57A 2GBZA 3I0SA 2R7YA 1RBUA 1CXUA 5FDLA 4IG3A 4HUEA 4BDPA 4CEAA 4B9VA 1RDDA 3NF7A 4O0IA 4KREA 1LW0A 1U48A 2IDOA 3IS9A 3TAMA 3NGZA 2D0BA 3TAPA 3LPTA 3V1RA 4QOZB 2YKMA 3AO4A 2YNHA 1NK8A 1BCOA 1IO2A 3U3GA 3MXMA 3OYDA 1C0UA 4FVMA 1TGOA 3L2QA 1RNHA 1UWBA 4FJGA 1NOZA 2KQ2A 3S3OA 1TVRA 3AVHA 2XO7A 1NK4A 1C1CA 2E4LA 3ZSVA 3CQ8A 4HVJA 1JLCA 1W0HA 2FBYA 3DLEA 5DMRA 4DTMA 4NCBA 1SL1A 1S1XA 4CERA 3AO5A 4CK3A 3MAQA 3LP0A 4CHQA 3NFAA 1U45A 4DU1A 2O4GA 3K58A 4OGEA 4DSLA 4ID5A 4I9QA 2BGGA 3LAKA 3I8DA 4IFYA 1KLNA 3L3UA 4E7KA 1JLBA 3D45A 4FM0A 3RRHA 1GOBA 4Z4CA 4FLWA 1KVCA 2IAJA 5CYMA 4M3RA 1L3VA 4ELTA 1IKXA 3C94A 5DK5A 5D3GA 4B3OA 5KI6A 2IC3A 4FJKA 1VRUA 2G8UA 4Y1DA 5SZTA 1RDAA 1BCMA 3OYIA 4FM2A 3SPYA 2QKKA 3G0ZA 3HP6A 1EP4A 3B6OA 4FJ9A 1LV5A 2HVIA 4J2BA 2HHSA 2KZZA 2YNGA 4DSFA 4O44A 4N47A 4OPKA 3EZ5A 5J2MA 5HLFA 1WSGA 2OPSA 1RDCA 3SQ0A 1BQMA 4F4KA 1RT7A 4ZHRA 3K5LA 4CCHA 2P51A 3LP2A 4N56A 4DQSA 2QK9A 3WNGA 3THVA 5C24A 3BDPA 3TI0A 4CJTA 2HNDA 5JS2A 3OYBA 3RWUA 3OYHA 3NF6A 3JYTA 2PY5A 1WLJA 1X9WA 2A1SA 4KV8A 2Z1GA 4CHZA 1U04A 1RBRA 4C8LA 1WSIA 4W5NA 4DSKA 2KZMA 4RW7A 4BE1A 1NJZA 4KTQA 4KFBA 3VQBA 2OZSA 1T05A 1IKVA 2Q3SA 2YNIA 4IBNA 1U49A 3WNFA 3OS1A 4CEDA 2PYJA 3C6TA 4E89A 1B9DA 2JGUA 4ZTFA 4KTWA 2RN2A 1ZBUA 3OYEA 4B9LA 4O4GA 1S1TA 2IS3A 3ULDA 1TKDA 4FW1A 1CZ9A 1S9GA 1WSFA 3NF9A 4CECA 3PV8A 1S1WA 2VG6A 4HTUA 1FK9A 5K14A 1RCHA 3M8PA 2E6LA 5KGXA 1D9DA 1Q9YA 1WNSA 3RR7A 3PO5A 4M3TA 1NK0A 2FBVA 2GV9A 2HVHA 2FC0A 4I2QA 4CEQA 2Y1JA 5I42A 4C8OA 3DOKA 4ID1A 3OS0A 1RBVA 1YTAA 3QEPA 2NUBA 1HYSA 1BHLA 5J2PA 2OPQA 4G1QA 4AHCA 2B4JA 1HRHA 1QSYA 4R5PA 4M3WA 1QHTA 2KW4A 3V1OA 4CFDA 1S1VA 3IG1A 1L3UA 4WE1A 2LSNA 4QCLA 3O4NA 1C0TA 2ITGA 3HVTA 4CESA 3KLEA 4IDKA 3SV3A 4DTRA 1IG9A 1REVA 3AV9A 4LH5A 1L3SA 2KTQA 5HRRA 1HNVA 4DFKA 4JRPA 1TK8A 2DY4A 3WNEA 3ZCMA 1I3AA 4DU3A 3NGYA 1JLGA 4W5QA 1WN7A 4W5RA 3DLBA 4FJLA 5HRNA 1NOYA 4CEZA 4N76A 4KI6A 5CZ1A 2HHTA 4FJNA 4AHVA 4LY7A 3V9XA 3E01A 4OLBA 1ZBHA 3AA4A 3DRPA 4I7FA 4JRQA 3C6UA 4CGDA 4DQRA 1TAQA 1HMVA 3DLRA 4CIFA 3NH0A 3TANA 4F8RA 4FZYA 4CF0A 4E7HA 4AILC 1YTUA 2HHXA 3VQ5A 4LD0A 1J5OA 1CXQA 4CHYA 2DFHA 2VWKA 3OY9A 3LZJA 4GVMA 4CHOA 4CIGA 4M3XA 3SUNA 3OYJA 1D5AA 1BGXT 3RTVA 3MXIA 3T3FA 4Y1CA 4CEEA 3ISNC 1T8EA 4NCGA 3TAFA 2G8FA 1NK9A 3SPZA 1FKOA 4E3SA 4F2RA 5HBMA 1WAJA 3KD5E 3VQ8A 3L2UA 4L8RB 1C1AA 2FBXA 2IGIA 3DYAA 1S9EA 3TAQA 4IG0A 5JS1A 3HYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5Y A;  1ZBL A;  1Q8I A;  2B5J A;  4KPY A;  3VQ6 A;  4W5O A;  2ZD1 A;  3LPU A;  3WNH A;  1ASU A;  4CGI A;  1RTJ A;  4OGC A;  3HJF A;  2EHG A;  4KHS A;  4CF1 A;  3H08 A;  4KKO A;  4RW8 A;  1W9H A;  3QNO A;  5J1E A;  1HQE A;  3TAG A;  4ELV A;  3AVC A;  1A5X A;  1LAW A;  2IOC A;  3V6D A;  4E7I A;  4DSJ A;  1JL1 A;  1T03 A;  4DTU A;  3V81 A;  1LAV A;  4PQU A;  3S3N A;  3ZT1 A;  1JL2 A;  3O3H A;  4Z4G A;  4FYD A;  3F9K A;  3PUF A;  2P1J A;  1IKW A;  1I39 A;  2HB5 A;  1S1U A;  2PYL A;  1KTQ A;  2FBT A;  3QO9 A;  1J9A A;  4CF9 A;  4FK4 A;  2HHW A;  4CJP A;  4DFJ A;  4B9U A;  2HHU A;  1TAU A;  3HP9 A;  3MED A;  3A2F A;  4EP4 A;  4EZ6 A;  4CEF A;  2XRI A;  4CEB A;  2ATQ A;  2I5J A;  3VQA A;  4CGG A;  4B08 A;  3AVK A;  3VA0 A;  3V9S A;  1TKZ A;  3LP1 A;  3SNN A;  1BI4 B;  3EYZ A;  2Z1J A;  3L2W A;  1XC9 A;  3T1A A;  4CFB A;  3AO1 A;  2OYQ A;  4CJQ A;  4EZ9 A;  3ZSQ A;  2D0C A;  4DTP A;  4PUO A;  2X6S A;  1JXB A;  1TK5 A;  4OPJ A;  3TR8 A;  4J2E A;  4Q0B A;  5EU7 A;  3VQC A;  3SYZ A;  1HJR A;  3AVB A;  3KLH A;  3DRR A;  4BDZ A;  4CJW A;  3NBP A;  1S6P A;  4F3O A;  1YT3 A;  3KJV A;  1FXX A;  3QET A;  2WON A;  3K5O A;  4CF2 A;  4FLT A;  1RBT A;  1NK6 A;  1TKT A;  3ZSO A;  4FZZ A;  1EXQ A;  5KTQ A;  4CEO A;  5KRS A;  3AVL A;  1NK5 A;  2YHB A;  3VQD A;  3M8S A;  4FLX A;  4ZTJ A;  2QKB A;  3P5J A;  3T19 A;  1VSM A;  3EY1 A;  3SQ2 A;  1ASV A;  4AH9 A;  3QES A;  2ZE2 A;  3LP3 A;  4B9N A;  1KFS A;  2G8W A;  4CGJ A;  1ASW A;  3CM5 A;  4KTZ A;  1T7P A;  2XY6 A;  3L2V A;  1TL1 A;  3OYK A;  3SQ1 A;  3CFO A;  2G8H A;  5C42 A;  3O3G A;  5I3U A;  1UA0 A;  1XHZ A;  4E1N A;  5CZ2 A;  1XI1 A;  1GOA A;  3NGI A;  2G8K A;  4Z4I A;  3PO4 A;  1XHX A;  3IAY A;  3QLH A;  1IKY A;  3L2R A;  4DS5 A;  4CJ4 A;  4EP5 A;  3ITH A;  3K5N A;  3V9W A;  4DTS A;  3O4Q A;  3HVR A;  4LSN A;  4M3U A;  4FJ5 A;  4PWD A;  3SQ4 A;  3LAL A;  4E19 A;  1JLE A;  3NF8 A;  1JLF A;  3U6F A;  1RT5 A;  3TAB A;  3LWM A;  1C6V A;  1MU2 A;  4MQ3 A;  1UOC A;  1ZBF A;  1LWC A;  2JLE A;  3VQ7 A;  1HNI A;  5HRP A;  3V9Z A;  2B6A A;  4I2P A;  1QSL A;  4FJH A;  2OA8 A;  1IH7 A;  1O1W A;  3AA5 X;  3TAR A;  4DTN A;  3DM2 A;  4FJX A;  3V1Q A;  3KD1 E;  3DMJ A;  3RR8 A;  4FLU A;  3VQQ A;  3SCX A;  1RT6 A;  1DLO A;  4Z4F A;  4CJU A;  3PY8 A;  4HCB A;  1JKH A;  4DQI A;  4DMN A;  4OJR A;  4N5S A;  1QQC A;  1WSE A;  2QXF A;  3OJS A;  3VQP A;  4BAC A;  4MFB A;  4CJL A;  4HUG A;  1Z26 A;  4JS4 A;  2KFN A;  4B8A B;  4RW4 A;  4E7J A;  1LWE A;  3KK2 A;  4PY5 A;  4CFA A;  4DLE A;  3SZ2 A;  4B8C A;  3OYA A;  2G8V A;  4FJI A;  4DSI A;  4H8K A;  4KHW A;  3P1G A;  4KHN A;  4CJF A;  4OVL A;  4ICL A;  3QIP A;  4FK0 A;  3VA3 A;  4HCC A;  3HXM A;  2ZQB A;  3MEE A;  2O4I A;  3G10 A;  3KTQ A;  4NCA A;  4BDY A;  5FRN A;  4DSE A;  3AVF A;  4DTJ A;  4LSL A;  4C8M A;  4J2A A;  4M3Y A;  4GW6 A;  2XHB A;  3KLF A;  1VK0 A;  4FJ7 A;  4O0J A;  3M8R A;  3TAE A;  4CJK A;  2KFZ A;  2GUI A;  2YNF A;  3AVA A;  1VSF A;  3DLH A;  1S6Q A;  1VRT A;  4AHS A;  1YVU A;  3QNN A;  1RT4 A;  1TL3 A;  1L5U A;  3SV4 A;  1RTD A;  4E1M A;  3AVI A;  3NCI A;  4J2D A;  4CFC A;  3RRG A;  1C0M A;  3I0R A;  1BQN A;  4E7L A;  1ZYQ A;  3MEC A;  4CJE A;  4DFP A;  4OKK A;  1A5W A;  4F2S A;  3CG7 A;  3LZI A;  1JXE A;  2D0A A;  2A1R A;  2YV0 X;  4ELU A;  4W5T A;  1WSJ A;  4GMJ B;  3OJU A;  1X9S A;  4FW2 A;  3HPG A;  1LW2 A;  4FXD A;  3NHG A;  3OVN A;  1DTQ A;  3LWL A;  1F21 A;  3D0P A;  1JLA A;  2X6N A;  1QTM A;  4NYN A;  4DQP A;  3FFI A;  5KGW A;  4CGF A;  1WAF A;  3S3M A;  3HO1 A;  3QEI A;  2OPR A;  1LWF A;  4LH4 A;  3KK1 A;  2W42 A;  1HPZ A;  1VSE A;  1VSK A;  4JLH A;  3U3Y A;  1L3T A;  1KLM A;  4B9M A;  4KRF A;  2EX3 A;  4IFV A;  4Q5V A;  2Y1I A;  3O3F A;  4DU4 A;  4JS5 A;  3AVJ A;  1BIU A;  1K6Y A;  3HPO A;  3TWH A;  1ITG A;  1TKX A;  4KB1 A;  1KFD A;  1D8Y A;  1KCF A;  3AVM A;  3NDK A;  3RMA A;  5FRM A;  4C8N A;  1J53 A;  2G8I A;  4HHT A;  2F8S A;  3L3V A;  1B92 A;  2RF2 A;  2XY5 A;  3OS2 A;  4B9T A;  4FCY A;  3B6P A;  3P83 D;  2E6M A;  3OYG A;  1JLQ A;  4AHR A;  3K59 A;  1NK7 A;  1SL2 A;  3K5M A;  1X9M A;  2HNZ A;  1SKR A;  4B9S A;  2X78 A;  3AA2 A;  3PX4 A;  3IRX A;  3NH1 A;  3RMC A;  4CK1 A;  4CJR A;  1N6Q A;  4KHY A;  3HM9 A;  2P5G A;  4C8K A;  1GOC A;  4PA1 A;  5HRO A;  4DG1 A;  3LAN A;  2VG7 A;  4FJ8 A;  3CYM A;  3SUP A;  4IKF A;  3ZSZ A;  1SUQ A;  4YFU A;  5C25 A;  4BE2 A;  1QS4 A;  1BIS A;  3DOL A;  5FRO A;  1TV6 A;  3MXJ A;  4XIU A;  1SL0 A;  3SJJ A;  5J2Q A;  2BAN A;  3DLK A;  5T7B A;  1SKW A;  4CHN A;  1FKP A;  4E0D A;  3QIO A;  4K8Z A;  1QE1 A;  3ZT3 A;  3RMB A;  3CFP A;  1G15 A;  4DS4 A;  1NJY A;  2BDP A;  2Z1I A;  4Z4E A;  3KLI A;  2RPI A;  1BL3 A;  3LDS A;  4RW6 A;  3K2P A;  4FZX C;  3VQE A;  4FLY A;  4KI4 A;  3HT3 A;  1BI4 A;  1J54 A;  1VSL A;  5E41 A;  3SUO A;  3NE6 A;  3OYM A;  4QAG A;  1VSJ A;  3KK3 A;  4DFM A;  3RMD A;  3PX0 A;  3AA3 A;  1VSD A;  3NAE A;  4DTO A;  1C1B A;  1U4B A;  2HHV A;  2AJQ A;  2HMI A;  3DI6 A;  4M42 A;  3QEW A;  2P5O A;  1NKB A;  4OKJ A;  3BGR A;  2F96 A;  1KSP A;  1X1P A;  1KVA A;  2WOM A;  4OLA A;  2DTU A;  2YKN A;  4DQQ A;  4RG8 A;  1UAX A;  4CGH A;  2OZM A;  4KO0 A;  1HYV A;  1BIZ A;  1ZBI A;  3AVG A;  1HYZ A;  3KIO A;  4KHQ A;  4H4M A;  4I9L A;  2XY8 A;  1NKE A;  3V4I A;  2PZS A;  4CJ5 A;  5SWM A;  5HRS A;  1Q9X A;  2Z1H A;  2F8T A;  4FJJ A;  3QEX A;  3OYC A;  3ZT4 A;  1RT1 A;  5HP1 A;  2ETJ A;  4O55 A;  1XWL A;  4BWM A;  2HNY A;  4O5B A;  3SUQ A;  2XY7 A;  1Y97 A;  4DF4 A;  3HK2 A;  5CY4 A;  4FM1 A;  4RW9 A;  4DF8 A;  2BE2 A;  4NYF A;  1A5V A;  3AO3 A;  4BWJ A;  4Z4H A;  2D5R A;  4HUF A;  4FLZ A;  4FJM A;  4M45 A;  4CJS A;  4M41 A;  1KVB A;  4KB0 A;  2HHQ A;  4BE0 A;  4UQG A;  4CJ3 A;  1S5J A;  1B9F A;  4FK2 A;  3OYF A;  1RDB A;  3VQ4 A;  3ZSR A;  4N41 A;  3QIN A;  2DFF A;  2OPP A;  3VN5 A;  3ZT0 A;  1NKC A;  2VG5 A;  4Z0U A;  2VWJ A;  3SI6 A;  1VSI A;  3ZSX A;  3DLG A;  1RT3 A;  3ZT2 A;  1DTT A;  4AHU A;  3F73 A;  4FLV A;  2RKI A;  3S9H A;  4CJV A;  4YNQ A;  1EKE A;  1D9F A;  3VQ9 A;  3AO2 A;  3LAM A;  5KRT A;  3CM6 A;  1TK0 A;  1VSH A;  3DRS A;  3ZSW A;  3NH2 A;  1RTI A;  1QSS A;  3ALY A;  4CF8 A;  4DWI A;  1SKS A;  3OYL A;  3ZSY A;  3UIQ A;  3HL8 A;  1HQU A;  1RIL A;  4AHT A;  4KAZ A;  3QEV A;  4OKE A;  1WSH A;  4CE9 A;  4KHU A;  1RTH A;  3HPH A;  2X74 A;  4K8X A;  1EET A;  4F3T A;  3KKR A;  4CK2 A;  4CHP A;  3V9U A;  3L8B A;  2DFE A;  3ASM A;  1RBS A;  3CFR A;  1R0A A;  3HST B;  4M3Z A;  4DTX A;  1NJX A;  1KRP A;  1UA1 A;  5CYQ A;  3M8Q A;  3KLG A;  1CZB A;  1Z25 A;  3MEG A;  3PX6 A;  1NJW A;  4TSX A;  2YHA A;  3OYN A;  3QER A;  4DLG A;  1RT2 A;  3AVN A;  3KKS A;  1SV5 A;  1U47 A;  1CLQ A;  4H4O A;  2HW3 A;  3JSM A;  4CIE A;  1EX4 A;  3C95 A;  5J2N A;  3K57 A;  2GBZ A;  3I0S A;  2R7Y A;  1RBU A;  1CXU A;  5FDL A;  4IG3 A;  4HUE A;  4BDP A;  4CEA A;  4B9V A;  1RDD A;  3NF7 A;  4O0I A;  4KRE A;  1LW0 A;  1U48 A;  2IDO A;  3IS9 A;  3TAM A;  3NGZ A;  2D0B A;  3TAP A;  3LPT A;  3V1R A;  4QOZ B;  2YKM A;  3AO4 A;  2YNH A;  1NK8 A;  1BCO A;  1IO2 A;  3U3G A;  3MXM A;  3OYD A;  1C0U A;  4FVM A;  1TGO A;  3L2Q A;  1RNH A;  1UWB A;  4FJG A;  1NOZ A;  2KQ2 A;  3S3O A;  1TVR A;  3AVH A;  2XO7 A;  1NK4 A;  1C1C A;  2E4L A;  3ZSV A;  3CQ8 A;  4HVJ A;  1JLC A;  1W0H A;  2FBY A;  3DLE A;  5DMR A;  4DTM A;  4NCB A;  1SL1 A;  1S1X A;  4CER A;  3AO5 A;  4CK3 A;  3MAQ A;  3LP0 A;  4CHQ A;  3NFA A;  1U45 A;  4DU1 A;  2O4G A;  3K58 A;  4OGE A;  4DSL A;  4ID5 A;  4I9Q A;  2BGG A;  3LAK A;  3I8D A;  4IFY A;  1KLN A;  3L3U A;  4E7K A;  1JLB A;  3D45 A;  4FM0 A;  3RRH A;  1GOB A;  4Z4C A;  4FLW A;  1KVC A;  2IAJ A;  5CYM A;  4M3R A;  1L3V A;  4ELT A;  1IKX A;  3C94 A;  5DK5 A;  5D3G A;  4B3O A;  5KI6 A;  2IC3 A;  4FJK A;  1VRU A;  2G8U A;  4Y1D A;  5SZT A;  1RDA A;  1BCM A;  3OYI A;  4FM2 A;  3SPY A;  2QKK A;  3G0Z A;  3HP6 A;  1EP4 A;  3B6O A;  4FJ9 A;  1LV5 A;  2HVI A;  4J2B A;  2HHS A;  2KZZ A;  2YNG A;  4DSF A;  4O44 A;  4N47 A;  4OPK A;  3EZ5 A;  5J2M A;  5HLF A;  1WSG A;  2OPS A;  1RDC A;  3SQ0 A;  1BQM A;  4F4K A;  1RT7 A;  4ZHR A;  3K5L A;  4CCH A;  2P51 A;  3LP2 A;  4N56 A;  4DQS A;  2QK9 A;  3WNG A;  3THV A;  5C24 A;  3BDP A;  3TI0 A;  4CJT A;  2HND A;  5JS2 A;  3OYB A;  3RWU A;  3OYH A;  3NF6 A;  3JYT A;  2PY5 A;  1WLJ A;  1X9W A;  2A1S A;  4KV8 A;  2Z1G A;  4CHZ A;  1U04 A;  1RBR A;  4C8L A;  1WSI A;  4W5N A;  4DSK A;  2KZM A;  4RW7 A;  4BE1 A;  1NJZ A;  4KTQ A;  4KFB A;  3VQB A;  2OZS A;  1T05 A;  1IKV A;  2Q3S A;  2YNI A;  4IBN A;  1U49 A;  3WNF A;  3OS1 A;  4CED A;  2PYJ A;  3C6T A;  4E89 A;  1B9D A;  2JGU A;  4ZTF A;  4KTW A;  2RN2 A;  1ZBU A;  3OYE A;  4B9L A;  4O4G A;  1S1T A;  2IS3 A;  3ULD A;  1TKD A;  4FW1 A;  1CZ9 A;  1S9G A;  1WSF A;  3NF9 A;  4CEC A;  3PV8 A;  1S1W A;  2VG6 A;  4HTU A;  1FK9 A;  5K14 A;  1RCH A;  3M8P A;  2E6L A;  5KGX A;  1D9D A;  1Q9Y A;  1WNS A;  3RR7 A;  3PO5 A;  4M3T A;  1NK0 A;  2FBV A;  2GV9 A;  2HVH A;  2FC0 A;  4I2Q A;  4CEQ A;  2Y1J A;  5I42 A;  4C8O A;  3DOK A;  4ID1 A;  3OS0 A;  1RBV A;  1YTA A;  3QEP A;  2NUB A;  1HYS A;  1BHL A;  5J2P A;  2OPQ A;  4G1Q A;  4AHC A;  2B4J A;  1HRH A;  1QSY A;  4R5P A;  4M3W A;  1QHT A;  2KW4 A;  3V1O A;  4CFD A;  1S1V A;  3IG1 A;  1L3U A;  4WE1 A;  2LSN A;  4QCL A;  3O4N A;  1C0T A;  2ITG A;  3HVT A;  4CES A;  3KLE A;  4IDK A;  3SV3 A;  4DTR A;  1IG9 A;  1REV A;  3AV9 A;  4LH5 A;  1L3S A;  2KTQ A;  5HRR A;  1HNV A;  4DFK A;  4JRP A;  1TK8 A;  2DY4 A;  3WNE A;  3ZCM A;  1I3A A;  4DU3 A;  3NGY A;  1JLG A;  4W5Q A;  1WN7 A;  4W5R A;  3DLB A;  4FJL A;  5HRN A;  1NOY A;  4CEZ A;  4N76 A;  4KI6 A;  5CZ1 A;  2HHT A;  4FJN A;  4AHV A;  4LY7 A;  3V9X A;  3E01 A;  4OLB A;  1ZBH A;  3AA4 A;  3DRP A;  4I7F A;  4JRQ A;  3C6U A;  4CGD A;  4DQR A;  1TAQ A;  1HMV A;  3DLR A;  4CIF A;  3NH0 A;  3TAN A;  4F8R A;  4FZY A;  4CF0 A;  4E7H A;  4AIL C;  1YTU A;  2HHX A;  3VQ5 A;  4LD0 A;  1J5O A;  1CXQ A;  4CHY A;  2DFH A;  2VWK A;  3OY9 A;  3LZJ A;  4GVM A;  4CHO A;  4CIG A;  4M3X A;  3SUN A;  3OYJ A;  1D5A A;  1BGX T;  3RTV A;  3MXI A;  3T3F A;  4Y1C A;  4CEE A;  3ISN C;  1T8E A;  4NCG A;  3TAF A;  2G8F A;  1NK9 A;  3SPZ A;  1FKO A;  4E3S A;  4F2R A;  5HBM A;  1WAJ A;  3KD5 E;  3VQ8 A;  3L2U A;  4L8R B;  1C1A A;  2FBX A;  2IGI A;  3DYA A;  1S9E A;  3TAQ A;  4IG0 A;  5JS1 A;  3HYF A; 
#chains in the Genus database with same CATH topology
 5LMU K;  2B5J A;  4BRD A;  4JNE A;  1XQS C;  4OGC A;  2O8C B;  2EHG A;  4KKO A;  2YHW A;  2ZJP L;  4E7I A;  4DSJ A;  2ZGZ A;  3VOV A;  2E1Z A;  1JL2 A;  3DWL A;  4C1N K;  3VGK A;  4F9O A;  1KTQ A;  2FBT A;  2NRR A;  2HHW A;  2W6L A;  5BR8 K;  4B9U A;  1TAU A;  4CEF A;  2O8E A;  3IDH A;  3AVK A;  5HOO A;  3G4S N;  4CJ7 A;  2KKZ A;  4CJQ A;  4EZ9 A;  1HUX A;  1GLA G;  5AQU A;  1TK5 A;  3CQY A;  4OPJ A;  3WQT A;  2YHY A;  3DRR A;  2QWQ A;  1S6P A;  3BEX A;  4F3O A;  2WON A;  4BGB A;  4EHT A;  1RBT A;  1NK6 A;  3ZSO A;  2YHB A;  3VQD A;  3M8S A;  4FLX A;  4ZTJ A;  3FZL A;  3T19 A;  1ASV A;  4AH9 A;  3QES A;  2ZE2 A;  2F9W A;  3HI0 A;  3ENH A;  3LP3 A;  2QWN A;  1ASW A;  4KTZ A;  1VAZ A;  3OYK A;  3CFO A;  3PIO L;  2G8H A;  3C65 A;  1BDG A;  5CZ2 A;  2G8K A;  2YJF A;  3UE5 A;  3IAY A;  4LF8 K;  1K8K A;  3K5N A;  3V9W A;  3O4Q A;  1HKC A;  3CJ7 A;  1QZ6 A;  1RT5 A;  1BUP A;  2PFU A;  5HRP A;  5AQV A;  1HNI A;  4LFC K;  2B6A A;  1H1V A;  3KZB A;  2OTJ N;  3A5L C;  3DMJ A;  2KLA A;  4FLU A;  3SCX A;  1DLO A;  4Z4F A;  4CJU A;  4CZE A;  1DEJ A;  4HCB A;  1VHX A;  4BAC A;  2E88 A;  3C0B A;  4HUG A;  4RW4 A;  5AQM A;  4FWP A;  3KK2 A;  4DR6 K;  2V51 B;  3MN7 A;  2O8F B;  4H8K A;  3QIP A;  4FK0 A;  3QFU A;  3VA3 A;  3HXM A;  3CER A;  1RFQ A;  2UXB K;  1VK0 A;  5FLX O;  4BRL A;  3M8R A;  1YF5 L;  3AVA A;  1S6Q A;  3O4W A;  5IWA K;  1YVU A;  4OPH A;  2O8C A;  3GG4 A;  3TSQ A;  4J2D A;  4CFC A;  2QWM A;  4DR2 K;  4OKK A;  2O8D A;  4GKK K;  3A0I X;  4BG9 A;  4BRP A;  1WSJ A;  1X9S A;  3O8M A;  3MCA B;  3NHG A;  1DTQ A;  3LWL A;  1F21 A;  3D0P A;  4NYN A;  4DQP A;  1YUW A;  5KGW A;  1ILY A;  1VQO N;  1T3V A;  2VCP A;  4FWQ A;  5TKW A;  2UYT A;  2IVO A;  1KFD A;  3AVM A;  1J53 A;  1J5E K;  1CZA N;  3L3V A;  2RF2 A;  2XY5 A;  3DXK B;  5AZJ B;  2NRX A;  5M1N A;  1GLE G;  4FVU A;  1JLQ A;  3WEE B;  3K59 A;  3K5M A;  4X62 K;  3CJA A;  3NH1 A;  4DG1 A;  4YFU A;  4GKJ K;  1QS4 A;  3TTD A;  2RE2 A;  5JLH A;  1NG9 A;  3D7E O;  1TV6 A;  1MWK A;  3ZX0 A;  4JN4 A;  4LC9 B;  3DLK A;  5AQX A;  4CZG A;  1FKP A;  4NXM K;  1QE1 A;  4DR5 K;  1NJY A;  1VQN N;  3IMX A;  2ZF5 O;  4Z4E A;  3LDS A;  4DCH A;  3Q7C A;  2YHX A;  3VEO A;  3A5N C;  3WEE A;  1FJG K;  4Y0W A;  4U7B A;  1BI4 A;  1J54 A;  3HT3 A;  3SUO A;  3QBW A;  5GAH P;  3NE6 A;  3OYM A;  1VSJ A;  4WQ4 C;  3AA3 A;  3WQU A;  2P5O A;  2F96 A;  1X1P A;  2WOM A;  3A5M C;  4RG8 A;  5AQL A;  1BIZ A;  1HYZ A;  4H4M A;  2QM1 A;  2XY8 A;  3V4I A;  3M6G A;  5HRS A;  3CET A;  2F8T A;  3ZT4 A;  1RT1 A;  4O55 A;  3H1Q A;  1Y97 A;  1T6D A;  4DF8 A;  3MXI A;  1A5V A;  5I9E B;  4JI3 K;  4M45 A;  4M41 A;  3Q7B A;  4BE0 A;  5EOY A;  4UQG A;  4CJ3 A;  1S5J A;  4FK2 A;  3OYF A;  3EE9 A;  3VQ4 A;  2GUP A;  1NKC A;  2VG5 A;  4Z0U A;  2V7Y A;  2VWJ A;  3DLG A;  3OW2 M;  3E66 A;  3JXU A;  2VGN A;  4JK8 A;  3S9H A;  4MDA A;  4YNQ A;  3AO2 A;  3LAM A;  5JVG L;  2HOE A;  3NH2 A;  5LMN K;  4DWI A;  3RVC A;  4MO5 A;  3HL8 A;  3WXK A;  1QHA A;  3F2K A;  5EX5 A;  1NNE A;  4KHU A;  1RTH A;  4F3T A;  5JMV A;  1LCU A;  3CFR A;  2W40 A;  4DTX A;  5CYQ A;  4JI0 K;  1ZXO A;  5BN8 A;  1RT2 A;  3KKS A;  4BG8 A;  4JD2 B;  3SBG A;  3CC4 N;  1EX4 A;  3C95 A;  2NRH A;  2YJE A;  3J7Y P;  4FPB A;  1RBU A;  4DKW A;  4KRE A;  1LW0 A;  2IDO A;  1WB9 A;  3THW B;  3MXM A;  3OYD A;  3TPQ A;  4FVM A;  1NJI O;  1RNH A;  3LL3 A;  3UKR A;  1TVR A;  2XO7 A;  4LF9 K;  2FSJ A;  1C1C A;  2E4L A;  4HVJ A;  1JLC A;  2FBY A;  4DTM A;  3THX B;  3CD6 N;  1SL1 A;  4XH5 A;  1YIT N;  2UXC K;  1U45 A;  2Q0R A;  4DU1 A;  2O4G A;  3K58 A;  4DSL A;  3LAK A;  1IBL K;  5AQF A;  4JKC A;  1JLB A;  3D45 A;  2BTF A;  3RRH A;  1GOB A;  5C12 A;  4FLW A;  5CYM A;  4ELT A;  3I55 N;  5D3G A;  5KI6 A;  3CMA N;  5SZT A;  3BP8 A;  1LOT B;  2NLX A;  3U9D A;  3J81 O;  4FJ9 A;  2HVI A;  4J2B A;  1OVY A;  3T1Y K;  2YNG A;  3EZ5 A;  4A61 A;  1WSG A;  3SQ0 A;  1BQM A;  1EWQ A;  3OBY A;  1NGD A;  3T7Z A;  2HBL A;  1HKG A;  4N56 A;  5AFU H;  3LM9 A;  3BDP A;  3J7Z O;  2HND A;  5JS2 A;  3VES A;  4EFH A;  3C7N A;  3JYT A;  4KV8 A;  4CHZ A;  4C8L A;  2A5X A;  5AQN A;  4RW7 A;  4IO8 A;  3G71 N;  5AQY A;  3CCQ N;  3VQB A;  4OPA A;  2YNI A;  2Q3S A;  1K8A O;  3N4Q A;  4CED A;  2PYJ A;  3L4Q A;  2RN2 A;  1ZBU A;  4C1N I;  1NU0 A;  4B3M K;  4O4G A;  4JKD A;  2IS3 A;  1TKD A;  4FW1 A;  1X9J A;  1CZ9 A;  1WSF A;  4A2A A;  4HTU A;  1YI2 N;  1RCH A;  5KGX A;  2GV9 A;  4H0Y B;  4WF9 L;  3AAQ A;  3CCV N;  1YXQ A;  4FWN A;  4I2Q A;  4CEQ A;  2Y1J A;  4IOX A;  4C8O A;  3VF6 A;  1JCG A;  3QEP A;  4M7Y A;  5GIP A;  1TUU A;  1VQ6 N;  3ZX3 A;  3KHY A;  4R5P A;  4A2B A;  1QHT A;  2DPN A;  4CI6 A;  4AQY K;  1N34 K;  1YAG A;  1L3U A;  2LSN A;  3O4N A;  3VTI A;  3KLE A;  4CES A;  4IDK A;  2GEL A;  3SV3 A;  1IG9 A;  5C15 A;  1MDU B;  2FLO A;  3E9O A;  1TK8 A;  4JKA A;  3WNE A;  4E1J A;  4DU3 A;  3KWG A;  1WN7 A;  5HRN A;  4DR4 K;  5AQQ A;  4CEZ A;  3QDK A;  1BA1 A;  1ZBH A;  3AA4 A;  2W41 A;  4I7F A;  5CE3 A;  1IV0 A;  2VGM A;  4FZY A;  4CF0 A;  2HHX A;  4KH5 A;  3CCR N;  3R1X A;  4BRQ A;  4CIG A;  4M3X A;  3SUN A;  1NGH A;  3RTV A;  1DGK N;  3H46 O;  3O80 A;  4FWS A;  3TAF A;  2EWS A;  3SPZ A;  5HBM A;  2E20 A;  4M3T A;  3VQ8 A;  3L2U A;  2HVH A;  2IGI A;  5CY4 A;  5I3U A;  3HYF A;  3MN5 A;  1ZBL A;  1RDU A;  4FWR A;  3KK7 A;  4KPY A;  4W5O A;  2ZD1 A;  3WNH A;  3O08 A;  4BRH A;  1HJO A;  4B1W B;  1N36 K;  4KHS A;  5BRD A;  5J1E A;  1HQE A;  2FF6 A;  3FZF A;  3V6D A;  4DV4 K;  2P9I B;  2H3G X;  1E3M A;  4FWO A;  1LAV A;  5C2F A;  4FYD A;  1IKW A;  1I39 A;  2HB5 A;  3M1F A;  2PYL A;  5M1F A;  3QO9 A;  1J9A A;  4DFJ A;  3CHW A;  3MED A;  4CEB A;  5FPE A;  2ATQ A;  4AM6 A;  2I5J A;  3VQA A;  3VA0 A;  1TKZ A;  1BI4 B;  3EYZ A;  3MMV A;  5BRF A;  3AO1 A;  2OYQ A;  2D0C A;  3LDO A;  4DTP A;  2X6S A;  5F0X A;  1BOT O;  5EU7 A;  1DKG D;  1HJR A;  3KLH A;  4CJW A;  3NBP A;  3SMP A;  1FXX A;  3VET A;  3K5O A;  4FLT A;  1SAZ A;  5KRS A;  4CZL A;  3HBT A;  1VSM A;  4HWI A;  1KFS A;  3A5O C;  3VGL A;  2XY6 A;  3BZK A;  4KH6 A;  2FSK A;  5AZJ A;  1XHZ A;  4WQ5 C;  4E1N A;  3PO4 A;  1XHX A;  4DS5 A;  1XMO K;  4CJ4 A;  3O9S A;  3ITH A;  3HVR A;  2J4R A;  4PWD A;  2VQF K;  4YDU C;  2PBD A;  3TAB A;  1C6V A;  5M1Q A;  4X64 K;  1UOC A;  1ZBF A;  2JLE A;  4H0O A;  3VQ7 A;  5AJ3 K;  2HST A;  4I2P A;  4FO0 A;  4FJH A;  3RSE B;  2V52 B;  3AA5 X;  3DM2 A;  3KD1 E;  3VQQ A;  5A2Q O;  4RTF D;  4CZF A;  4DQI A;  1WSE A;  4O8U A;  3ZX2 A;  1Z26 A;  4B8A B;  4E7J A;  1LWE A;  4CFA A;  1BWF O;  4DLE A;  2G8V A;  1RGI A;  4FJI A;  4DSI A;  3VER A;  3RSE A;  4OVL A;  2NZT A;  4HCC A;  3DAW A;  3KTQ A;  4BDY A;  2WC9 A;  4DSE A;  4C8M A;  3C7N B;  5KPZ A;  1NGJ A;  4GW6 A;  4JKE A;  5FPD A;  2XHB A;  3HRG A;  3TAE A;  5B8H A;  3CCU N;  3DLH A;  3GE1 A;  1VRT A;  3QNN A;  1L5U A;  3SV4 A;  3W0L A;  3SMS A;  4E1M A;  3RRG A;  1V4T A;  1C0M A;  1BQN A;  3GBT A;  1ZYQ A;  2IVN A;  4JI5 K;  4DFP A;  4BC3 A;  4IJA A;  3CG7 A;  2Q0U A;  2A1R A;  4NXN K;  4A57 A;  4FW2 A;  3HPG A;  1XNR K;  4FXD A;  3OVN A;  1OH8 A;  3S41 A;  2GWK A;  4ISF A;  3FFI A;  2A42 A;  1WAF A;  4CGF A;  3HO1 A;  3QEI A;  1I94 K;  3KK1 A;  2W42 A;  1VSK A;  4Q5V A;  1BIU A;  3TWH A;  1ITG A;  1W7A A;  2GTD A;  4JI2 K;  4BR0 A;  4C8N A;  2F8S A;  5AQZ A;  1NGE A;  1HNW K;  4B9T A;  2F7T A;  1X9M A;  2HNZ A;  3TTC A;  3AA2 A;  3RMC A;  1N6Q A;  2YX6 A;  3HM9 A;  1KXP A;  1VQ9 N;  1GOC A;  5HRO A;  4FJ8 A;  4IKF A;  4BE2 A;  3D2E B;  5C25 A;  1M90 O;  3P39 A;  4XIU A;  4JD2 A;  1JJ2 M;  3ENB A;  3QFP A;  1N8R O;  4E0D A;  4X65 K;  3M5R A;  3ZET B;  3CFP A;  3KLI A;  1BL3 A;  3E1Y A;  1SQK A;  1S72 N;  1IBM K;  4QAG A;  1VQ8 N;  3KK3 A;  4DFM A;  3RMD A;  1VSD A;  5HL7 L;  4B1U B;  3GL1 A;  3HTV A;  1U4B A;  4LF6 K;  1GLJ O;  4M42 A;  3THY A;  4FOI A;  2HBJ A;  2VYP A;  4CD1 A;  4CGH A;  1UAX A;  4BC5 A;  3CF5 L;  1YIJ N;  2P9N B;  4KHQ A;  4CJ5 A;  1XUP O;  3H45 C;  4FJJ A;  3QEX A;  4DR7 K;  3OYC A;  4BWM A;  3SUQ A;  3D2F A;  3CQX A;  4O5B A;  4DF4 A;  2NRW A;  4FM1 A;  1ZC6 A;  4RW9 A;  1BG3 A;  3W3D A;  4NYF A;  3HK2 A;  4ILG B;  4FLZ A;  4CJS A;  4BVP A;  1KVB A;  1NGB A;  4BQL A;  1FW6 A;  5KQ8 A;  3BF1 A;  3J8A A;  3QIN A;  1HR0 K;  1X3N A;  3OHR A;  3EZW A;  1VSI A;  3ZSX A;  1RT3 A;  3ZT2 A;  3ZEU B;  4FLV A;  3F9M A;  1D9F A;  3VQ9 A;  1DT9 A;  1BU6 O;  3CM6 A;  3DXM A;  1TK0 A;  1VSH A;  3ZSW A;  1QSS A;  1QVF M;  3O9T A;  4CF8 A;  3UIQ A;  3QB0 A;  1HQU A;  1RIL A;  4AHT A;  4KAZ A;  1S22 A;  2ASO A;  3U4L A;  4FPA A;  4K8X A;  1EET A;  2P9L A;  3KKR A;  1HX1 A;  4FWL A;  2BUP A;  4CHP A;  2NRV A;  1RBS A;  1R0A A;  3HST B;  5GAE P;  1NJX A;  1UA1 A;  3KLG A;  1Z25 A;  3K9J A;  4WFA L;  2YHA A;  3JAM O;  3AVN A;  4EIA A;  1SV5 A;  2QXL A;  1CLQ A;  3CI5 A;  3BF3 A;  5J2N A;  4V19 S;  4K41 A;  1CXU A;  5FDL A;  4BDP A;  4HUE A;  1SS6 A;  4WQ5 A;  2E1Y A;  3TAP A;  1ATN A;  4QOZ B;  3V1R A;  2YNH A;  3MCP A;  4WFB L;  3U3G A;  4DV3 K;  1TGO A;  1M1K O;  3VGM A;  2FSN A;  1NOZ A;  3BZC A;  2KQ2 A;  1QQM A;  3AVH A;  1NK4 A;  3I8B A;  2P9S A;  4BRI A;  2E2N A;  1S1X A;  1TYQ A;  2P9U A;  3NFA A;  2OCE A;  3VTH A;  4H0T B;  4OGE A;  4ID5 A;  2IIR A;  3I8D A;  5LJW A;  4IFY A;  1K73 O;  3THX A;  4PKG A;  4EHU A;  3L3U A;  4JYA K;  4E7K A;  4CBX A;  4FM0 A;  1NMD A;  4Z4C A;  5AQK A;  1NGA A;  4M3R A;  1IKX A;  5JLF A;  4FJK A;  1RDA A;  3PSI A;  3OYI A;  3SPY A;  3P4I A;  1LV5 A;  1VQ7 N;  4N47 A;  4OPK A;  4BRC A;  4IEI A;  2I7N A;  2OPS A;  1RDC A;  4OO1 J;  4ZHR A;  4J8F A;  2FF3 B;  2P51 A;  4DQS A;  5AQP A;  2ZGY A;  2QK9 A;  3WNG A;  2Q31 A;  5BPL A;  4BR7 A;  4CZM A;  1WSI A;  4W5N A;  4DSK A;  2P9P A;  2A3Z A;  2KZM A;  4H5W A;  5AQR A;  2OZS A;  3VEX A;  1KC8 O;  2ZWH A;  3WNF A;  3C6T A;  4E89 A;  2JGU A;  3ZYY X;  4B9L A;  4GVE A;  5H1S Q;  4CEC A;  3NF9 A;  5E84 A;  2VG6 A;  5K14 A;  5FPN A;  2UXD K;  2E6L A;  1D9D A;  3B8A X;  4BRA A;  3PO5 A;  3VF2 A;  4YOW A;  1NK0 A;  2FBV A;  1OH5 A;  4B3S K;  4QS7 A;  4GV9 A;  3O9Q A;  2GWJ A;  1IJJ A;  3DOK A;  2NUB A;  4JKG A;  4DV5 K;  1HYS A;  5ADX H;  2B4J A;  4M3W A;  3V1O A;  4BRF A;  1S1V A;  1C0T A;  3CJC A;  3CCE N;  4JI8 K;  2AP1 A;  2O8B B;  3E9L A;  1HNV A;  3ATV A;  4JRP A;  1HPM A;  2DY4 A;  2I7P A;  3QML A;  5FPM A;  3DLB A;  4FJL A;  2F9T A;  4LY7 A;  4I6M B;  4OLB A;  4JRQ A;  3C6U A;  4CGD A;  4CZK A;  3TAN A;  3NH0 A;  4NLB A;  3VQ5 A;  2FXU A;  3H1V X;  4LD0 A;  1J5O A;  1CXQ A;  4CHY A;  1BA0 A;  2VWK A;  3LZJ A;  3OYJ A;  3CC2 N;  3ISN C;  2O8E B;  4NCG A;  2G8F A;  1NK9 A;  5EVZ A;  3HJF A;  3FZH A;  1WAJ A;  3KD5 E;  3WXL A;  4CJT A;  4BRO A;  1Q8I A;  4WCE L;  5F1X A;  4CGI A;  1RTJ A;  2PAV A;  3IUC A;  4DR3 K;  4CF1 A;  3H08 A;  4RW8 A;  1W9H A;  3TAG A;  4BQZ A;  1A5X A;  4FL9 A;  4B9Q A;  2IOC A;  3CJ9 A;  1T03 A;  3SJH A;  4Z4G A;  5EXW A;  4ISE A;  3LDL A;  2P1J A;  1S1U A;  4YDU A;  4FK4 A;  4CJP A;  3HP9 A;  3A2F A;  3UKU A;  4JEP A;  3MX2 A;  4CGG A;  4BR4 A;  4B08 A;  3AAR A;  4JI6 K;  3LP1 A;  3E9P A;  2Z1J A;  3L2W A;  1XC9 A;  1KD1 O;  3T1A A;  3SK3 A;  1O13 A;  4O8K A;  4PUO A;  4H5N A;  4J2E A;  4H03 B;  1MWM A;  4PL8 A;  4YOV A;  4R79 A;  2GX9 A;  2HHH K;  4Q0B A;  5M1O A;  1KAZ A;  3VQC A;  3AVB A;  3SYZ A;  4BDZ A;  3L6Q A;  4IOC L;  1YT3 A;  3QET A;  1V4S A;  1TKT A;  4FZZ A;  1EXQ A;  3AVL A;  1NK5 A;  2QKB A;  2UUC K;  2JWK A;  3EY1 A;  1KAX A;  4EAH D;  4CGJ A;  3KWI A;  4GNI A;  3G6E N;  3UKU B;  3L2V A;  3GOI A;  5C42 A;  3O3G A;  4JKF A;  1XI1 A;  1QQO A;  4Z4I A;  3QLH A;  1IKY A;  3L2R A;  4DTS A;  4MLH A;  4YHH K;  5AQW A;  4PL7 A;  3SQ4 A;  4E19 A;  1JLE A;  1JLF A;  2QW9 A;  3JS6 A;  1LWC A;  4BR2 A;  1YJW N;  1KQS M;  2OA8 A;  1IH7 A;  4DTN A;  3V1Q A;  3GDQ A;  1RT6 A;  2UU9 K;  4N5S A;  5GIO A;  3VQP A;  4JS4 A;  3CCM N;  1Z6R A;  3O1B A;  2OTL N;  1GLF O;  1JCF A;  3P1G A;  4KHN A;  4ICL A;  1J6Z A;  3G10 A;  3WT0 A;  4NCA A;  5FRN A;  3AVF A;  4LSL A;  4M3Y A;  3DXM B;  3TSU A;  2P9I A;  3KLF A;  4O0J A;  2GUI A;  4AHS A;  1TL3 A;  1RTD A;  3AVI A;  4GV6 A;  3I0R A;  4E7L A;  3MEC A;  1A5W A;  4F2S A;  3LZI A;  4ELU A;  4KH4 A;  1LW2 A;  4RCH A;  4B1X B;  3P38 A;  3QIC A;  1NGF A;  4CZJ A;  1LWF A;  4LH4 A;  1HPZ A;  1VSE A;  3TU5 A;  3U3Y A;  4WYB A;  2EX3 A;  2Y1I A;  4DU4 A;  3AVJ A;  3MX5 A;  1K6Y A;  3R8E A;  1TKX A;  1D8Y A;  1KCF A;  5FRM A;  2G8I A;  2E2Q A;  1B92 A;  3KVG A;  3P83 D;  2E6M A;  2Q1N A;  3ENO A;  1NGG A;  2O8B A;  1SL2 A;  4AHR A;  1NK7 A;  4B9S A;  3PX4 A;  4CK1 A;  3J80 O;  4C8K A;  3LAN A;  2VG7 A;  3ZSZ A;  4IXC A;  3DOL A;  4DV6 K;  1X3M A;  1Z05 A;  5FRO A;  2GEM A;  3FE1 A;  1SL0 A;  3SJJ A;  5J2Q A;  5TKY A;  2BAN A;  4CHN A;  1OH6 A;  3VEV A;  4YOX A;  3ZT3 A;  1WOQ A;  1G15 A;  4DS4 A;  2Z1I A;  4U67 L;  3SBT A;  5AQT A;  2RPI A;  4O5F A;  4RW6 A;  3WXM B;  4FZX C;  3VQE A;  4KI4 A;  5E41 A;  2D4W A;  1VSL A;  3VMF B;  1XC3 A;  5ADX A;  3H3N O;  3NAE A;  1C1B A;  2AJQ A;  2CGJ A;  5DM7 L;  2HMI A;  3QEW A;  4JI1 K;  4CZI A;  4IWV A;  1NKB A;  3TTF A;  3EE8 A;  2RHK A;  1KSP A;  4OLA A;  1KVA A;  5BRE A;  2YKN A;  2CGK A;  3K0S A;  4CZH A;  2OZM A;  1TUY A;  1HYV A;  1EQY A;  4JHD B;  3AVG A;  1ZBI A;  3KIO A;  4I9L A;  2PZS A;  5CHI A;  1VQ5 N;  1Q9X A;  2Z1H A;  2WUS A;  2D0P A;  2ETJ A;  1Q86 O;  4GY2 B;  1GLD G;  4BGA A;  2BE2 A;  4Z4H A;  4HTL A;  3AO3 A;  4HUF A;  3L0Q A;  3EO3 A;  2HHQ A;  2YI1 A;  5LJV A;  1B9F A;  1Q81 O;  3AY9 A;  4N41 A;  2DFF A;  2OPP A;  3ID6 A;  3DXK A;  3VN5 A;  1XNQ K;  3SI6 A;  4B1Z A;  2RKI A;  1EKE A;  4BR5 A;  4G9Z A;  3DRS A;  1RTI A;  4FOE A;  4I6M A;  3EEQ A;  3LDP A;  5KPR A;  1SKS A;  5KQD A;  3OYL A;  2ITM A;  2JWL A;  3QEV A;  4K43 A;  1WSH A;  2X74 A;  3UKR B;  1Q7Y O;  3U8X A;  3L8B A;  2DFE A;  3ASM A;  2HHS A;  5C10 A;  1KRP A;  3M8Q A;  2O8D B;  4TSX A;  3OYN A;  3QER A;  4JKB A;  4NB4 A;  3D2F B;  3EL2 A;  1U47 A;  2HW3 A;  5CR4 A;  4JAX A;  4CIE A;  3K57 A;  3DJC A;  3I0S A;  1NLV A;  4AF1 A;  2HF3 A;  4B9V A;  4IG3 A;  2A40 A;  4CEA A;  3EN9 A;  1RDD A;  4O0I A;  4GV3 A;  4DV1 K;  1U48 A;  2D0B A;  2YKM A;  3AO4 A;  3VPZ A;  1NK8 A;  1BCO A;  5DM6 L;  1G99 A;  2P9K A;  4B3R K;  1S3X A;  1NGI A;  5LY3 A;  3ZSV A;  3CQ8 A;  1W0H A;  3DLE A;  5DMR A;  4NCB A;  2CH5 A;  3OTO K;  4CER A;  3MAQ A;  4JHD A;  1NBW A;  5AZI A;  4YOR A;  4I9Q A;  3WXJ A;  2BGG A;  3A8Y A;  4XH4 A;  3PLA A;  2ZM6 K;  2UUB K;  4WFN L;  4OX9 K;  2IC3 A;  5GIN A;  3SAG A;  1BCM A;  3MDQ A;  3VEZ A;  3G0Z A;  1EP4 A;  3B6O A;  3O9U A;  1ATS A;  3D6R A;  2KZZ A;  5J2M A;  4O44 A;  5HLF A;  4K25 A;  1RT7 A;  3K5L A;  3HOS A;  4X66 K;  3RWU A;  3NF6 A;  5C0Y A;  5AZI B;  1NMN A;  2A1S A;  2Z1G A;  4KTQ A;  1R59 O;  1TYQ B;  4JK9 A;  2WFB A;  3O6W A;  4KFB A;  4K0K K;  4NO7 A;  1HNZ K;  1T05 A;  1IKV A;  3OBW A;  1HKB A;  1B9D A;  4ZTF A;  3AAP A;  2P9K B;  3OYE A;  2HBM A;  2A41 A;  4Z94 A;  4DQ8 A;  3NMU A;  1S9G A;  5AQJ A;  5M1K A;  1S1W A;  4FWM A;  5ELZ A;  3M8P A;  1Y64 A;  1WNS A;  1Q9Y A;  4LFB K;  4BRK A;  5I42 A;  4ID1 A;  1YTA A;  3MWP A;  1BHL A;  5J2P A;  4G1Q A;  1HRH A;  5AFU A;  2KW4 A;  4FSV A;  3IG1 A;  4QS9 A;  1EWR A;  3AGK A;  2ITG A;  3HVT A;  2VQE K;  3AV9 A;  2P9L B;  3FZM A;  1L3S A;  2KTQ A;  1U2V B;  4YOY A;  3PIP L;  4LF7 K;  1JLG A;  4W5Q A;  1QQN A;  3HZ6 A;  4W5R A;  4KI6 A;  3CJB A;  2HHT A;  4FJN A;  4AHV A;  3V9X A;  3E01 A;  4DQR A;  1TAQ A;  3DLR A;  4CIF A;  4F8R A;  4RWT A;  3OA9 A;  4AIL C;  3IFR A;  3QBX A;  4A59 A;  2DFH A;  1YHQ N;  3BUZ B;  4CBU A;  4CHO A;  2E2P A;  4PKH A;  3H6E A;  3ATU A;  1D5A A;  3P31 A;  3T3F A;  2ZJQ L;  4CEE A;  1T8E A;  3J7A P;  1T6C A;  2FBX A;  4IG0 A;  4ILH A;  1N5Y A;  3NVK A;  3VQ6 A;  3LPU A;  1ASU A;  2QWO A;  2P9P B;  3CCJ N;  4A62 A;  4MDB A;  3QNO A;  4A5B A;  4DR1 K;  4ELV A;  3AVC A;  1LAW A;  4PKI A;  3MWT A;  4DV2 K;  1JL1 A;  4DTU A;  3V81 A;  4PQU A;  4A5A A;  3S3N A;  3ZT1 A;  3O3H A;  3F9K A;  4BRN A;  3PUF A;  4CF9 A;  2CGL A;  2HHU A;  4EZ6 A;  4EP4 A;  1P90 A;  2XRI A;  1QVG M;  2O8F A;  1P8Z A;  4L3Q A;  3IKM A;  3V9S A;  2KHO A;  3SLC A;  3SNN A;  3WUH A;  3CC7 N;  4IJN A;  3FGU A;  4CFB A;  1W97 L;  3ZSQ A;  1JXB A;  5F2R A;  3TR8 A;  3LDQ A;  4CD3 A;  3CCL N;  4IDH A;  1WBD A;  4BRM A;  4WQ4 A;  3VEY A;  3KJV A;  5GAD P;  4CF2 A;  5KTQ A;  4CEO A;  1GLC G;  3VEW A;  4C23 A;  2WBN A;  3P5J A;  1VQM N;  3SQ2 A;  4B9N A;  2P9S B;  4UY8 O;  3DLL L;  2G8W A;  3N4P A;  3T1H K;  1T7P A;  3CM5 A;  4MO4 A;  1TL1 A;  3SQ1 A;  4YOU A;  1UA0 A;  2D1K A;  3LDN A;  1GOA A;  3NGI A;  4CVN E;  1E4G T;  3H3O B;  5AQG A;  4EP5 A;  2QEX N;  2HF4 A;  3CIP A;  4JKG B;  4LSN A;  4FJ5 A;  4M3U A;  3LAL A;  3CCS N;  2W6K A;  3NF8 A;  3U6F A;  4IOA L;  3LWM A;  1MU2 A;  4MQ3 A;  3V9Z A;  5LL6 Z;  1QSL A;  5JIC A;  1O1W A;  2BH1 A;  3TAR A;  4FJX A;  2Q97 A;  4CW7 B;  1WUA A;  3RR8 A;  3EKS A;  2A6A A;  4JV5 K;  3VEN A;  3PY8 A;  1JKH A;  4DMN A;  4OJR A;  1GLL O;  1QQC A;  3CPW M;  2QXF A;  3OJS A;  4MFB A;  2NRZ A;  4CJL A;  2KFN A;  4PY5 A;  3FR0 A;  2E2O A;  3SZ2 A;  3TSP A;  4B8C A;  3OYA A;  1Q82 O;  4KHW A;  4CJF A;  2ZQB A;  3MEE A;  4IFE A;  2O4I A;  4BC2 A;  4DTJ A;  3THW A;  4M63 C;  4J2A A;  3CXC M;  1K9M O;  4FJ7 A;  4CJK A;  2KFZ A;  2YNF A;  1VSF A;  4BC4 A;  1N32 K;  2F4V K;  1RT4 A;  3NCI A;  5BN9 A;  4B3T K;  3FLC O;  4CJE A;  3LM2 A;  5GAG P;  4YOT A;  5MLC Q;  2QWR A;  3C6H A;  5AQS A;  4JI4 K;  1JXE A;  2D0A A;  2YV0 X;  4W5T A;  3O5B A;  4GMJ B;  4NLC A;  3OJU A;  4LFA K;  3G25 A;  4BY9 C;  4H0X B;  5KPT A;  1JLA A;  2X6N A;  4B1V A;  4PHT X;  1QTM A;  4IO9 L;  2NRT A;  3S3M A;  2OPR A;  2P9N A;  1C0F A;  3PSF A;  4JLH A;  1L3T A;  3I33 A;  1KLM A;  4B9M A;  4KRF A;  3ID8 A;  4IFV A;  3O3F A;  4JS5 A;  3HPO A;  5BRH A;  3ULE A;  4KB1 A;  3NDK A;  3RMA A;  3WXI A;  4DV7 K;  4HHT A;  1RDW X;  2VWB A;  3OS2 A;  4CBW A;  4FCY A;  2UUA K;  3R9P A;  3B6P A;  3EKU A;  3OYG A;  1SKR A;  2X78 A;  3IRX A;  4XEI A;  4CJR A;  4KHY A;  4JK7 A;  2P5G A;  3ZET A;  5IT9 O;  1GLB G;  3AGR A;  4PA1 A;  3CYM A;  3SUP A;  1SUQ A;  1BIS A;  1NWK A;  4YY3 K;  4BRG A;  4DUY K;  2ZJR L;  3MXJ A;  3FZK A;  3D2E A;  1QZ5 A;  5T7B A;  1SKW A;  4K8Z A;  4DUZ K;  3QIO A;  3RMB A;  3SAF A;  1HNX K;  2BDP A;  2ASM A;  3K2P A;  1OKJ A;  4FLY A;  2YCH A;  3PX0 A;  1BO5 O;  4QS8 A;  4DTO A;  2HHV A;  3DI6 A;  1VQL N;  4OKJ A;  3BGR A;  2DTU A;  4DQQ A;  4KO0 A;  1E4F T;  3ZEU A;  1NKE A;  5SWM A;  1U2V A;  4MLE A;  3MN9 A;  5JVH L;  4ISG A;  3BY5 A;  5AQH A;  5HP1 A;  1XWL A;  2HNY A;  3NVM A;  1WBB A;  2XY7 A;  4B1Y B;  4BWJ A;  2D5R A;  4FJM A;  4KB0 A;  3F5T A;  3U9Z A;  1RDB A;  1SZ2 A;  4H0P A;  3ZSR A;  3ZT0 A;  2WTU A;  1KAY A;  1DTT A;  4AHU A;  1VQK N;  3F73 A;  1EO1 A;  4CJV A;  4BVO A;  2QWL A;  5KRT A;  5M1P A;  3ALY A;  1NM1 A;  3T69 A;  5AR0 A;  3ZSY A;  2E8A A;  1MA9 B;  1T44 A;  4OKE A;  3HM8 A;  4CE9 A;  3HPH A;  3UB5 A;  3V9U A;  4CK2 A;  4M3Z A;  3ZLJ A;  3HSC A;  1CZB A;  3PX6 A;  3MEG A;  1NJW A;  1NGC A;  4DLG A;  4H4O A;  3JSM A;  1XMQ K;  1C0G A;  2GBZ A;  2R7Y A;  1N33 K;  5EY4 A;  3NF7 A;  4DHY A;  3IS9 A;  3TAM A;  4IEE A;  3NGZ A;  3LPT A;  3MK6 A;  1ATR A;  2HBK A;  4BR9 A;  1IO2 A;  4M7X A;  1C0U A;  4DV0 K;  3L2Q A;  4FJG A;  1UWB A;  4BRE A;  2E5L K;  3S3O A;  3O9R A;  2QA4 N;  3SAH A;  3VF4 A;  3AO5 A;  4CK3 A;  3LP0 A;  4CHQ A;  5E26 A;  5BPN A;  2P9U B;  4LF4 K;  1ZBS A;  1KLN A;  3THY B;  3M3Z A;  1KVC A;  2IAJ A;  1L3V A;  3C94 A;  5DK5 A;  3CME N;  4B3O A;  1VRU A;  2G8U A;  4Y1D A;  4IZ9 A;  2QI2 A;  4FM2 A;  2QKK A;  2IVP A;  5BR9 A;  3HP6 A;  2AA4 A;  4DSF A;  2V7Z A;  4F4K A;  3MN6 A;  4CCH A;  2ASP A;  3LP2 A;  3C6A A;  3THV A;  5C24 A;  4H0V B;  1JCE A;  3TI0 A;  3OYB A;  3O1W A;  3OYH A;  1Q18 A;  4XH1 A;  2PY5 A;  1WLJ A;  4ILJ A;  4K42 A;  1X9W A;  1U04 A;  1RBR A;  4JKH A;  4LF5 K;  4BE1 A;  1NJZ A;  5AQI A;  4IBN A;  2QTD A;  1U49 A;  3OS1 A;  5AQO A;  1OVQ A;  1IBK K;  3I56 N;  4KTW A;  5BPM A;  4AM7 A;  2QWP A;  1S1T A;  3ULD A;  4KHP K;  4JI7 K;  3PV8 A;  2CH6 A;  4KBO A;  1FK9 A;  2Q2R A;  3RR7 A;  1U6Z A;  1YJN N;  4H5R A;  2FC0 A;  3R3L A;  5C2D A;  2Q36 A;  1VQP N;  3OS0 A;  1RBV A;  1HLU A;  2OPQ A;  4FWK A;  3K9K A;  4AHC A;  1QSY A;  4CFD A;  4WE1 A;  4QCL A;  1VQ4 N;  3CJ1 A;  4DTR A;  1REV A;  1IG8 A;  4LH5 A;  5HRR A;  3FFK B;  4DFK A;  3ZCM A;  4H5V A;  1I3A A;  3NGY A;  1NOY A;  4N76 A;  3ULE B;  5CZ1 A;  2NNW A;  1YVN A;  4H5T A;  3DRP A;  3HOT A;  1HMV A;  4DB3 A;  1OH7 A;  2OAN A;  3L4I A;  4E7H A;  1YTU A;  3CPE A;  3OY9 A;  4GVM A;  1K8K B;  1W2B M;  1BGX T;  4Y1C A;  1YJ9 N;  1FKO A;  2HMP A;  4E3S A;  4F2R A;  3R6M A;  1ESV A;  1C1A A;  3DYA A;  2D0O A;  3TAQ A;  1S9E A;  4L8R B;  5JS1 A;  1D4X A; 
#chains in the Genus database with same CATH homology
 1N5Y A;  1ZBL A;  1Q8I A;  2B5J A;  4KPY A;  3VQ6 A;  4W5O A;  2ZD1 A;  3LPU A;  3WNH A;  1ASU A;  4CGI A;  1RTJ A;  4OGC A;  3HJF A;  2EHG A;  4KHS A;  4CF1 A;  3H08 A;  4KKO A;  4RW8 A;  1W9H A;  3QNO A;  5J1E A;  1HQE A;  3TAG A;  4ELV A;  3AVC A;  1A5X A;  1LAW A;  2IOC A;  3V6D A;  4E7I A;  4DSJ A;  1JL1 A;  1T03 A;  4DTU A;  3V81 A;  1LAV A;  4PQU A;  3S3N A;  3ZT1 A;  1JL2 A;  3O3H A;  4Z4G A;  4FYD A;  3F9K A;  3PUF A;  2P1J A;  1IKW A;  1I39 A;  2HB5 A;  1S1U A;  2PYL A;  1KTQ A;  2FBT A;  3QO9 A;  1J9A A;  4CF9 A;  4FK4 A;  2HHW A;  4CJP A;  4DFJ A;  4B9U A;  2HHU A;  1TAU A;  3HP9 A;  3MED A;  3A2F A;  4EP4 A;  4EZ6 A;  4CEF A;  2XRI A;  4CEB A;  2ATQ A;  2I5J A;  3VQA A;  4CGG A;  4B08 A;  3AVK A;  3VA0 A;  3V9S A;  1TKZ A;  3LP1 A;  3SNN A;  1BI4 B;  3EYZ A;  2Z1J A;  3L2W A;  1XC9 A;  3T1A A;  4CFB A;  3AO1 A;  2OYQ A;  4CJQ A;  4EZ9 A;  3ZSQ A;  2D0C A;  4DTP A;  4PUO A;  2X6S A;  1JXB A;  1TK5 A;  4OPJ A;  3TR8 A;  4J2E A;  4Q0B A;  5EU7 A;  3VQC A;  3SYZ A;  1HJR A;  3AVB A;  3KLH A;  3DRR A;  4BDZ A;  4CJW A;  3NBP A;  1S6P A;  4F3O A;  1YT3 A;  3KJV A;  1FXX A;  3QET A;  2WON A;  3K5O A;  4CF2 A;  4FLT A;  1RBT A;  1NK6 A;  1TKT A;  3ZSO A;  4FZZ A;  1EXQ A;  5KTQ A;  4CEO A;  5KRS A;  3AVL A;  1NK5 A;  2YHB A;  3VQD A;  3M8S A;  4FLX A;  4ZTJ A;  2QKB A;  3P5J A;  3T19 A;  1VSM A;  3EY1 A;  3SQ2 A;  1ASV A;  4AH9 A;  3QES A;  2ZE2 A;  3LP3 A;  4B9N A;  1KFS A;  2G8W A;  4CGJ A;  1ASW A;  3CM5 A;  4KTZ A;  1T7P A;  2XY6 A;  3L2V A;  1TL1 A;  3OYK A;  3SQ1 A;  3CFO A;  2G8H A;  5C42 A;  3O3G A;  5I3U A;  1UA0 A;  1XHZ A;  4E1N A;  5CZ2 A;  1XI1 A;  1GOA A;  3NGI A;  2G8K A;  4Z4I A;  3PO4 A;  1XHX A;  3IAY A;  3QLH A;  1IKY A;  3L2R A;  4DS5 A;  4CJ4 A;  4EP5 A;  3ITH A;  3K5N A;  3V9W A;  4DTS A;  3O4Q A;  3HVR A;  4LSN A;  4M3U A;  4FJ5 A;  4PWD A;  3SQ4 A;  3LAL A;  4E19 A;  1JLE A;  3NF8 A;  1JLF A;  3U6F A;  1RT5 A;  3TAB A;  3LWM A;  1C6V A;  1MU2 A;  4MQ3 A;  1UOC A;  1ZBF A;  1LWC A;  2JLE A;  3VQ7 A;  1HNI A;  5HRP A;  3V9Z A;  2B6A A;  4I2P A;  1QSL A;  4FJH A;  2OA8 A;  1IH7 A;  1O1W A;  3AA5 X;  3TAR A;  4DTN A;  3DM2 A;  4FJX A;  3V1Q A;  3KD1 E;  3DMJ A;  3RR8 A;  4FLU A;  3VQQ A;  3SCX A;  1RT6 A;  1DLO A;  4Z4F A;  4CJU A;  3PY8 A;  4HCB A;  1JKH A;  4DQI A;  4DMN A;  4OJR A;  4N5S A;  1QQC A;  1WSE A;  2QXF A;  3OJS A;  3VQP A;  4BAC A;  4MFB A;  4CJL A;  4HUG A;  1Z26 A;  4JS4 A;  2KFN A;  4B8A B;  4RW4 A;  4E7J A;  1LWE A;  3KK2 A;  4PY5 A;  4CFA A;  4DLE A;  3SZ2 A;  4B8C A;  3OYA A;  2G8V A;  4FJI A;  4DSI A;  4H8K A;  4KHW A;  3P1G A;  4KHN A;  4CJF A;  4OVL A;  4ICL A;  3QIP A;  4FK0 A;  3VA3 A;  4HCC A;  3HXM A;  2ZQB A;  3MEE A;  2O4I A;  3G10 A;  3KTQ A;  4NCA A;  4BDY A;  5FRN A;  4DSE A;  3AVF A;  4DTJ A;  4LSL A;  4C8M A;  4J2A A;  4M3Y A;  4GW6 A;  2XHB A;  3KLF A;  1VK0 A;  4FJ7 A;  4O0J A;  3M8R A;  3TAE A;  4CJK A;  2KFZ A;  2GUI A;  2YNF A;  3AVA A;  1VSF A;  3DLH A;  1S6Q A;  1VRT A;  4AHS A;  1YVU A;  3QNN A;  1RT4 A;  1TL3 A;  1L5U A;  3SV4 A;  1RTD A;  4E1M A;  3AVI A;  3NCI A;  4J2D A;  4CFC A;  3RRG A;  1C0M A;  3I0R A;  1BQN A;  4E7L A;  1ZYQ A;  3MEC A;  4CJE A;  4DFP A;  4OKK A;  1A5W A;  4F2S A;  3CG7 A;  3LZI A;  1JXE A;  2D0A A;  2A1R A;  2YV0 X;  4ELU A;  4W5T A;  1WSJ A;  4GMJ B;  3OJU A;  1X9S A;  4FW2 A;  3HPG A;  1LW2 A;  4FXD A;  3NHG A;  3OVN A;  1DTQ A;  3LWL A;  1F21 A;  3D0P A;  1JLA A;  2X6N A;  1QTM A;  4NYN A;  4DQP A;  3FFI A;  5KGW A;  4CGF A;  1WAF A;  3S3M A;  3HO1 A;  3QEI A;  2OPR A;  1LWF A;  4LH4 A;  3KK1 A;  2W42 A;  1HPZ A;  1VSE A;  1VSK A;  4JLH A;  3U3Y A;  1L3T A;  1KLM A;  4B9M A;  4KRF A;  2EX3 A;  4IFV A;  4Q5V A;  2Y1I A;  3O3F A;  4DU4 A;  4JS5 A;  3AVJ A;  1BIU A;  1K6Y A;  3HPO A;  3TWH A;  1ITG A;  1TKX A;  4KB1 A;  1KFD A;  1D8Y A;  1KCF A;  3AVM A;  3NDK A;  3RMA A;  5FRM A;  4C8N A;  1J53 A;  2G8I A;  4HHT A;  2F8S A;  3L3V A;  1B92 A;  2RF2 A;  2XY5 A;  3OS2 A;  4B9T A;  4FCY A;  3B6P A;  3P83 D;  2E6M A;  3OYG A;  1JLQ A;  4AHR A;  3K59 A;  1NK7 A;  1SL2 A;  3K5M A;  1X9M A;  2HNZ A;  1SKR A;  4B9S A;  2X78 A;  3AA2 A;  3PX4 A;  3IRX A;  3NH1 A;  3RMC A;  4CK1 A;  4CJR A;  1N6Q A;  4KHY A;  3HM9 A;  2P5G A;  4C8K A;  1GOC A;  4PA1 A;  5HRO A;  4DG1 A;  3LAN A;  2VG7 A;  4FJ8 A;  3CYM A;  3SUP A;  4IKF A;  3ZSZ A;  1SUQ A;  4YFU A;  5C25 A;  4BE2 A;  1QS4 A;  1BIS A;  3DOL A;  5FRO A;  1TV6 A;  3MXJ A;  4XIU A;  1SL0 A;  3SJJ A;  5J2Q A;  2BAN A;  3DLK A;  5T7B A;  1SKW A;  4CHN A;  1FKP A;  4E0D A;  3QIO A;  4K8Z A;  1QE1 A;  3ZT3 A;  3RMB A;  3CFP A;  1G15 A;  4DS4 A;  1NJY A;  2BDP A;  2Z1I A;  4Z4E A;  3KLI A;  2RPI A;  1BL3 A;  3LDS A;  4RW6 A;  3K2P A;  4FZX C;  3VQE A;  4FLY A;  4KI4 A;  3HT3 A;  1BI4 A;  1J54 A;  1VSL A;  5E41 A;  3SUO A;  3NE6 A;  3OYM A;  4QAG A;  1VSJ A;  3KK3 A;  4DFM A;  3RMD A;  3PX0 A;  3AA3 A;  1VSD A;  3NAE A;  4DTO A;  1C1B A;  1U4B A;  2HHV A;  2AJQ A;  2HMI A;  3DI6 A;  4M42 A;  3QEW A;  2P5O A;  1NKB A;  4OKJ A;  3BGR A;  2F96 A;  1KSP A;  1X1P A;  1KVA A;  2WOM A;  4OLA A;  2DTU A;  2YKN A;  4DQQ A;  4RG8 A;  1UAX A;  4CGH A;  2OZM A;  4KO0 A;  1HYV A;  1BIZ A;  1ZBI A;  3AVG A;  1HYZ A;  3KIO A;  4KHQ A;  4H4M A;  4I9L A;  2XY8 A;  1NKE A;  3V4I A;  2PZS A;  4CJ5 A;  5SWM A;  5HRS A;  1Q9X A;  2Z1H A;  2F8T A;  4FJJ A;  3QEX A;  3OYC A;  3ZT4 A;  1RT1 A;  5HP1 A;  2ETJ A;  4O55 A;  1XWL A;  4BWM A;  2HNY A;  4O5B A;  3SUQ A;  2XY7 A;  1Y97 A;  4DF4 A;  3HK2 A;  5CY4 A;  4FM1 A;  4RW9 A;  4DF8 A;  2BE2 A;  4NYF A;  1A5V A;  3AO3 A;  4BWJ A;  4Z4H A;  2D5R A;  4HUF A;  4FLZ A;  4FJM A;  4M45 A;  4CJS A;  4M41 A;  1KVB A;  4KB0 A;  2HHQ A;  4BE0 A;  4UQG A;  4CJ3 A;  1S5J A;  1B9F A;  4FK2 A;  3OYF A;  1RDB A;  3VQ4 A;  3ZSR A;  4N41 A;  3QIN A;  2DFF A;  2OPP A;  3VN5 A;  3ZT0 A;  1NKC A;  2VG5 A;  4Z0U A;  2VWJ A;  3SI6 A;  1VSI A;  3ZSX A;  3DLG A;  1RT3 A;  3ZT2 A;  1DTT A;  4AHU A;  3F73 A;  4FLV A;  2RKI A;  3S9H A;  4CJV A;  4YNQ A;  1EKE A;  1D9F A;  3VQ9 A;  3AO2 A;  3LAM A;  5KRT A;  3CM6 A;  1TK0 A;  1VSH A;  3DRS A;  3ZSW A;  3NH2 A;  1RTI A;  1QSS A;  3ALY A;  4CF8 A;  4DWI A;  1SKS A;  3OYL A;  3ZSY A;  3UIQ A;  3HL8 A;  1HQU A;  1RIL A;  4AHT A;  4KAZ A;  3QEV A;  4OKE A;  1WSH A;  4CE9 A;  4KHU A;  1RTH A;  3HPH A;  2X74 A;  4K8X A;  1EET A;  4F3T A;  3KKR A;  4CK2 A;  4CHP A;  3V9U A;  3L8B A;  2DFE A;  3ASM A;  1RBS A;  3CFR A;  1R0A A;  3HST B;  4M3Z A;  4DTX A;  1NJX A;  1KRP A;  1UA1 A;  5CYQ A;  3M8Q A;  3KLG A;  1CZB A;  1Z25 A;  3MEG A;  3PX6 A;  1NJW A;  4TSX A;  2YHA A;  3OYN A;  3QER A;  4DLG A;  1RT2 A;  3AVN A;  3KKS A;  1SV5 A;  1U47 A;  1CLQ A;  4H4O A;  2HW3 A;  3JSM A;  4CIE A;  1EX4 A;  3C95 A;  5J2N A;  3K57 A;  2GBZ A;  3I0S A;  2R7Y A;  1RBU A;  1CXU A;  5FDL A;  4IG3 A;  4HUE A;  4BDP A;  4CEA A;  4B9V A;  1RDD A;  3NF7 A;  4O0I A;  4KRE A;  1LW0 A;  1U48 A;  2IDO A;  3IS9 A;  3TAM A;  3NGZ A;  2D0B A;  3TAP A;  3LPT A;  3V1R A;  4QOZ B;  2YKM A;  3AO4 A;  2YNH A;  1NK8 A;  1BCO A;  1IO2 A;  3U3G A;  3MXM A;  3OYD A;  1C0U A;  4FVM A;  1TGO A;  3L2Q A;  1RNH A;  1UWB A;  4FJG A;  1NOZ A;  2KQ2 A;  3S3O A;  1TVR A;  3AVH A;  2XO7 A;  1NK4 A;  1C1C A;  2E4L A;  3ZSV A;  3CQ8 A;  4HVJ A;  1JLC A;  1W0H A;  2FBY A;  3DLE A;  5DMR A;  4DTM A;  4NCB A;  1SL1 A;  1S1X A;  4CER A;  3AO5 A;  4CK3 A;  3MAQ A;  3LP0 A;  4CHQ A;  3NFA A;  1U45 A;  4DU1 A;  2O4G A;  3K58 A;  4OGE A;  4DSL A;  4ID5 A;  4I9Q A;  2BGG A;  3LAK A;  3I8D A;  4IFY A;  1KLN A;  3L3U A;  4E7K A;  1JLB A;  3D45 A;  4FM0 A;  3RRH A;  1GOB A;  4Z4C A;  4FLW A;  1KVC A;  2IAJ A;  5CYM A;  4M3R A;  1L3V A;  4ELT A;  1IKX A;  3C94 A;  5DK5 A;  5D3G A;  4B3O A;  5KI6 A;  2IC3 A;  4FJK A;  1VRU A;  2G8U A;  4Y1D A;  5SZT A;  1RDA A;  1BCM A;  3OYI A;  4FM2 A;  3SPY A;  2QKK A;  3G0Z A;  3HP6 A;  1EP4 A;  3B6O A;  4FJ9 A;  1LV5 A;  2HVI A;  4J2B A;  2HHS A;  2KZZ A;  2YNG A;  4DSF A;  4O44 A;  4N47 A;  4OPK A;  3EZ5 A;  5J2M A;  5HLF A;  1WSG A;  2OPS A;  1RDC A;  3SQ0 A;  1BQM A;  4F4K A;  1RT7 A;  4ZHR A;  3K5L A;  4CCH A;  2P51 A;  3LP2 A;  4N56 A;  4DQS A;  2QK9 A;  3WNG A;  3THV A;  5C24 A;  3BDP A;  3TI0 A;  4CJT A;  2HND A;  5JS2 A;  3OYB A;  3RWU A;  3OYH A;  3NF6 A;  3JYT A;  2PY5 A;  1WLJ A;  1X9W A;  2A1S A;  4KV8 A;  2Z1G A;  4CHZ A;  1U04 A;  1RBR A;  4C8L A;  1WSI A;  4W5N A;  4DSK A;  2KZM A;  4RW7 A;  4BE1 A;  1NJZ A;  4KTQ A;  4KFB A;  3VQB A;  2OZS A;  1T05 A;  1IKV A;  2Q3S A;  2YNI A;  4IBN A;  1U49 A;  3WNF A;  3OS1 A;  4CED A;  2PYJ A;  3C6T A;  4E89 A;  1B9D A;  2JGU A;  4ZTF A;  4KTW A;  2RN2 A;  1ZBU A;  3OYE A;  4B9L A;  4O4G A;  1S1T A;  2IS3 A;  3ULD A;  1TKD A;  4FW1 A;  1CZ9 A;  1S9G A;  1WSF A;  3NF9 A;  4CEC A;  3PV8 A;  1S1W A;  2VG6 A;  4HTU A;  1FK9 A;  5K14 A;  1RCH A;  3M8P A;  2E6L A;  5KGX A;  1D9D A;  1Q9Y A;  1WNS A;  3RR7 A;  3PO5 A;  4M3T A;  1NK0 A;  2FBV A;  2GV9 A;  2HVH A;  2FC0 A;  4I2Q A;  4CEQ A;  2Y1J A;  5I42 A;  4C8O A;  3DOK A;  4ID1 A;  3OS0 A;  1RBV A;  1YTA A;  3QEP A;  2NUB A;  1HYS A;  1BHL A;  5J2P A;  2OPQ A;  4G1Q A;  4AHC A;  2B4J A;  1HRH A;  1QSY A;  4R5P A;  4M3W A;  1QHT A;  2KW4 A;  3V1O A;  4CFD A;  1S1V A;  3IG1 A;  1L3U A;  4WE1 A;  2LSN A;  4QCL A;  3O4N A;  1C0T A;  2ITG A;  3HVT A;  4CES A;  3KLE A;  4IDK A;  3SV3 A;  4DTR A;  1IG9 A;  1REV A;  3AV9 A;  4LH5 A;  1L3S A;  2KTQ A;  5HRR A;  1HNV A;  4DFK A;  4JRP A;  1TK8 A;  2DY4 A;  3WNE A;  3ZCM A;  1I3A A;  4DU3 A;  3NGY A;  1JLG A;  4W5Q A;  1WN7 A;  4W5R A;  3DLB A;  4FJL A;  5HRN A;  1NOY A;  4CEZ A;  4N76 A;  4KI6 A;  5CZ1 A;  2HHT A;  4FJN A;  4AHV A;  4LY7 A;  3V9X A;  3E01 A;  4OLB A;  1ZBH A;  3AA4 A;  3DRP A;  4I7F A;  4JRQ A;  3C6U A;  4CGD A;  4DQR A;  1TAQ A;  1HMV A;  3DLR A;  4CIF A;  3NH0 A;  3TAN A;  4F8R A;  4FZY A;  4CF0 A;  4E7H A;  4AIL C;  1YTU A;  2HHX A;  3VQ5 A;  4LD0 A;  1J5O A;  1CXQ A;  4CHY A;  2DFH A;  2VWK A;  3OY9 A;  3LZJ A;  4GVM A;  4CHO A;  4CIG A;  4M3X A;  3SUN A;  3OYJ A;  1D5A A;  1BGX T;  3RTV A;  3MXI A;  3T3F A;  4Y1C A;  4CEE A;  3ISN C;  1T8E A;  4NCG A;  3TAF A;  2G8F A;  1NK9 A;  3SPZ A;  1FKO A;  4E3S A;  4F2R A;  5HBM A;  1WAJ A;  3KD5 E;  3VQ8 A;  3L2U A;  4L8R B;  1C1A A;  2FBX A;  2IGI A;  3DYA A;  1S9E A;  3TAQ A;  4IG0 A;  5JS1 A;  3HYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...