4EP4A

Thermus thermophilus ruvc structure
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
166
Chain Sequence
MVVAGIDPGITHLGLGVVAVEGKGALKARLLHGEVVKTSPQEPAKERVGRIHARVLEVLHRFRPEAVAVEEQFFYRQNELAYKVGWALGAVLVAAFEAGVPVYAYGPMQVKQALAGHGHAAKEEVALMVRGILGLKEAPRPSHLADALAIALTHAFYARMGTAKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural asymmetry in the Thermus thermophilus RuvC dimer suggests a basis for sequential strand cleavages during Holliday junction resolution.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Crossover junction endodeoxyribonuclease RuvC
total genus 54
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature ec 3.1.22.4: Crossover junction endodeoxyribonuclease.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02075 RuvC Crossover junction endodeoxyribonuclease RuvC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ep4A00
2IDOA 2OZSA 3KK2A 3NDKA 4CJKA 3OYFA 3VQDA 2ITGA 5J1EA 1TV6A 1RTHA 3MEEA 4N56A 2X6SA 3QETA 4DMNA 3KD5E 4DTXA 3TANA 4B3OA 3NAEA 4FK0A 1TVRA 1TAQA 3AO4A 2W42A 1LWCA 4FJIA 3OYDA 1IKWA 4FW2A 3OYKA 1L3SA 3MECA 4ELTA 1DTTA 3AV9A 1KCFA 4KB1A 2KFNA 1RBTA 1UWBA 2RF2A 4FJKA 2IOCA 2VWKA 4C8MA 4AILC 2OPPA 3P83D 4Z4HA 1BL3A 1U49A 4I9LA 1TL3A 1X9SA 4KKOA 4CFDA 1IO2A 2B4JA 3NHGA 4CHNA 3QEVA 1ZYQA 4M42A 4HVJA 1I39A 4B08A 3L2UA 1TGOA 3AO5A 4FW1A 3SI6A 2ATQA 3MAQA 3MXIA 1WNSA 2XY7A 3SPYA 4B8CA 3M8SA 3ALYA 3OYBA 2WONA 3KTQA 3D0PA 3HPHA 2ZD1A 3LAMA 4WE1A 1N5YA 1U48A 4KHUA 3OYEA 4BWMA 3L3VA 4LSNA 3O3GA 4NCBA 1T7PA 4B9NA 3CG7A 4DS5A 3OYGA 4DF4A 1ZBHA 4DU4A 2P1JA 3PUFA 3K58A 4GW6A 1O1WA 1BGXT 2Z1HA 4DTNA 3C94A 4CJEA 3SUOA 1NK0A 3L8BA 5T7BA 3SZ2A 1D8YA 3V9WA 3C95A 1NOZA 1NKEA 4M3YA 1LWFA 1I3AA 2F96A 1ASVA 1QSYA 1QS4A 1T03A 3QIPA 2HB5A 4DTJA 3SNNA 4KHSA 4DSLA 4O0IA 4BDYA 4FM1A 4CGHA 3S3MA 2B6AA 1HRHA 3HK2A 4OKEA 1BQNA 4H8KA 5CYQA 2YNFA 4DQQA 5EU7A 3RMAA 3QEXA 3SCXA 1SL2A 3VQ7A 3VQPA 2PYLA 3HPGA 3DLBA 1VRUA 4Q5VA 1A5VA 3F9KA 4CESA 3AVHA 4O5BA 1GOCA 1KLMA 1WSHA 3V9ZA 1XI1A 1IKVA 1ZBIA 1S1VA 3NF6A 3I8DA 2P5OA 4F3TA 3PX0A 4OJRA 1RBRA 3BGRA 3QERA 1BQMA 1RNHA 2HHVA 1L5UA 1SKWA 2XY5A 1VSMA 3I0RA 5KI6A 1NK4A 4G1QA 1HMVA 3OS0A 1RT2A 4NYFA 1UA1A 3CYMA 3OY9A 1FXXA 1UA0A 1HQEA 4EZ6A 1KFDA 3HPOA 1XWLA 3O4NA 3KKSA 2X74A 4CF9A 3V6DA 3JYTA 1JLAA 2RN2A 4ZTFA 1L3TA 4LSLA 3NGIA 1YTUA 4CIFA 3CM6A 2Y1JA 2G8HA 2XRIA 4C8OA 2FBTA 2XY8A 5FRNA 4CE9A 2Y1IA 5I3UA 3VQ5A 3VQQA 4LY7A 4FXDA 4KHYA 4BE1A 1UAXA 4HUGA 2G8UA 1C1AA 2E6MA 1QTMA 2EX3A 2GBZA 1VSLA 3QEWA 2NUBA 2R7YA 3MXMA 1RDAA 3VQCA 4FJJA 5HRRA 3UIQA 1GOAA 4FLTA 4QAGA 4DSJA 2RPIA 1JXBA 1CXQA 3LZJA 1ZBLA 3SQ0A 4KHQA 4CEDA 3SV3A 3DLKA 4B9TA 5DK5A 4ID5A 2FBVA 2QK9A 2OPQA 2YHAA 4KTWA 3K57A 3NF7A 3DM2A 4OKJA 1L3VA 1D9DA 4ELVA 4FLYA 1XHXA 3O4QA 3LWLA 1ZBUA 2HW3A 1SV5A 2JLEA 3DRRA 5KRTA 2VG7A 5HBMA 2G8WA 3AVIA 2YHBA 1ITGA 4AHRA 1B9DA 4B8AB 4W5QA 1QSSA 4FZYA 4KB0A 1BI4A 1SL0A 4FJHA 1JXEA 3NBPA 4CHZA 1K6YA 2FC0A 4TSXA 1S9EA 4Y1CA 4CJPA 4CF2A 3K5MA 3TWHA 1VSKA 1U45A 4E1NA 4CGGA 4RW4A 4HTUA 2QKBA 2HHUA 4J2DA 4OGEA 1BIUA 4H4MA 4KFBA 3NFAA 4LD0A 3THVA 2F8TA 1TK8A 3WNFA 3OYHA 2BDPA 4OVLA 5JS1A 1C6VA 3EYZA 4XIUA 4M3XA 4DSKA 4ZTJA 1BCOA 4KV8A 4N76A 2HNDA 5KRSA 4OLBA 4FCYA 3K59A 3PV8A 5K14A 1D9FA 4C8KA 4BE2A 1J9AA 3AA3A 3TAFA 4F4KA 4CEBA 4DTOA 1RT5A 1SKSA 3HO1A 1BISA 2QXFA 3FFIA 4DQIA 2BE2A 3U3GA 3V9SA 3SUNA 3AVLA 4CHOA 2VG6A 3PX4A 1RBVA 4DU3A 3QEIA 3SUPA 3DLGA 3VQEA 1S6QA 2DY4A 3OJUA 2HHWA 4PA1A 3O3HA 3K5NA 1CLQA 1JLEA 2D5RA 3LALA 1EXQA 1NK6A 1TKDA 4FLVA 2GUIA 1WN7A 3KJVA 4CJQA 3VQ8A 1HYVA 2YNHA 2HVIA 4JS5A 3VA0A 1Q9YA 2G8FA 1YT3A 3TAQA 2IS3A 3AVFA 5HROA 2DTUA 3VQAA 3S3NA 4M3WA 3WNHA 4AH9A 3T1AA 3KLHA 1BI4B 4IG0A 4LH5A 4FM2A 2KW4A 3QEPA 3OYIA 3T19A 2DFHA 1TKXA 1VSHA 3OYAA 4Z4EA 4E7JA 1SL1A 3DMJA 3PY8A 4BACA 1TKZA 4NCGA 3CFPA 1RBSA 4E7KA 1C0UA 3M8PA 3KKRA 3T3FA 4CIGA 3D45A 4BWJA 3AVGA 1JLCA 2DFEA 4CJ4A 4CFBA 1XHZA 1B9FA 5CY4A 3VA3A 1KVAA 1S1XA 3L2WA 3V1OA 4IFYA 3MXJA 5D3GA 1UOCA 5SZTA 2B5JA 2Z1JA 3VQ9A 1XC9A 3B6PA 3AA2A 4DLEA 2HNZA 2XO7A 1KFSA 3NF8A 4W5NA 3NE6A 1TKTA 2DFFA 4E3SA 1NOYA 2EHGA 4CJLA 4M3TA 1ZBFA 4CIEA 4E7LA 1HJRA 1J53A 3SUQA 4Q0BA 2YKMA 3ISNC 3TAPA 4F8RA 5J2PA 1HQUA 4OPJA 4UQGA 3SQ1A 4IKFA 1JLBA 3B6OA 4J2AA 2P5GA 1VSEA 2KZMA 3LP3A 4DWIA 4Z4FA 4N47A 4C8LA 1YTAA 5C25A 4F3OA 4B9UA 1YVUA 1C1CA 3M8RA 3VN5A 2D0AA 1JKHA 3LAKA 4O4GA 4FJMA 4Z4IA 4HHTA 1S5JA 1U04A 3SYZA 1QE1A 3PO5A 4DFMA 1D5AA 4CEOA 4OKKA 4ZHRA 4W5RA 4BDPA 3AVAA 3QNNA 1LWEA 2VG5A 1RCHA 3ZSWA 1NK8A 4RW8A 1Q9XA 4YNQA 1G15A 4FLXA 3IG1A 2PY5A 3ZT2A 4PQUA 4CEFA 2PZSA 4PUOA 3HM9A 3ZSVA 2XHBA 4DSEA 1J5OA 2FBYA 1X1PA 4FM0A 4DTSA 4I7FA 1FKOA 2YNGA 1NJXA 1KLNA 3PO4A 2KQ2A 2OYQA 1KVCA 3ZSYA 2E4LA 3LP0A 1A5XA 3ZSQA 4KI4A 5J2NA 4DS4A 2O4IA 4Y1DA 3V1RA 1U4BA 1KVBA 4QOZB 1CZBA 4LH4A 4RW6A 3V4IA 3KK3A 1NKCA 1VSFA 1Z26A 2IAJA 5I42A 1W0HA 2X78A 3CFRA 3EZ5A 4FYDA 3RRHA 5HRPA 3CFOA 4FJLA 2D0CA 3ZT3A 2XY6A 4FJXA 4FVMA 4KTQA 3DRPA 4DF8A 5FDLA 4FJ5A 4J2BA 4CK2A 3ZT4A 3HP6A 3VQ4A 2Q3SA 1KSPA 4FZZA 1NK5A 4I2PA 4CHQA 3RRGA 3I0SA 3ITHA 1WLJA 1REVA 1RDBA 1Y97A 4R5PA 1JLFA 1RT4A 3ULDA 4RG8A 4DSFA 3F73A 4RW9A 4CFCA 1C1BA 4FJGA 3JSMA 5KGXA 3ZSRA 3IS9A 4DLGA 3E01A 1HYSA 1RILA 1CXUA 1RT7A 4MQ3A 1VK0A 2GV9A 4AHTA 2G8IA 2FBXA 5HLFA 3VQ6A 5JS2A 1S1WA 4HUEA 2PYJA 5CYMA 4CFAA 4CF0A 1RT6A 3DLEA 4EZ9A 1Q8IA 4M45A 4KTZA 5CZ2A 4CJ5A 4CF1A 3HVRA 1DLOA 2O4GA 3H08A 4OPKA 3RWUA 4FLWA 4DFKA 4CERA 5C42A 4YFUA 3DRSA 4CJTA 1WSFA 1RT1A 3L2QA 2ETJA 3QO9A 4FLZA 4L8RB 1JLGA 1EX4A 4NYNA 3WNGA 3LDSA 1WSEA 3S3OA 4K8XA 3AA4A 4BE0A 1RBUA 1HPZA 3P5JA 4O0JA 3CQ8A 4F2RA 4CJSA 3DLRA 2BANA 5KGWA 3HXMA 3LPUA 1NKBA 4QCLA 2BGGA 2YKNA 5HRSA 2A1SA 1EETA 1WSIA 2F8SA 1EKEA 1JL1A 1IH7A 2OPRA 1FKPA 3C6TA 3K5OA 4E1MA 4CGJA 3SV4A 3NH0A 4B9MA 1TK5A 4DTRA 2D0BA 3L3UA 2HHTA 2A1RA 4H4OA 4I2QA 4AHCA 4K8ZA 4DTMA 1U47A 4DQRA 1LAVA 3HT3A 3V1QA 4M3RA 1A5WA 4CEAA 3OVNA 1EP4A 4E0DA 4M41A 4PWDA 1X9MA 1J54A 3HVTA 4OLAA 2HHXA 1BIZA 3AVCA 4F2SA 4FK2A 3OJSA 5HRNA 5C24A 3K2PA 4AHUA 3V81A 1RTIA 4DG1A 3KD1E 3OS2A 1NJZA 3NGZA 3RR8A 2P51A 1ASWA 1RDDA 1Z25A 3AVBA 4KPYA 4KHWA 3PX6A 3LWMA 1T05A 3LP2A 2G8KA 2G8VA 1TK0A 4Z4GA 3LPTA 4CJVA 2Z1GA 4M3ZA 4DQSA 1SUQA 2E6LA 1SKRA 3KIOA 4CGFA 3NH1A 3L2RA 2OA8A 3OYMA 4KI6A 1S6PA 3HP9A 4HUFA 1RTDA 1B92A 1QQCA 4KRFA 4CK3A 1VSIA 3DOKA 4OGCA 2HHQA 1S9GA 4HCCA 4Z0UA 1IKYA 3LZIA 3DOLA 4M3UA 4CEQA 2OZMA 4FJ8A 5FRMA 4CECA 1LV5A 4HCBA 3HJFA 3O3FA 2KZZA 4AHVA 1LW0A 3C6UA 4C8NA 3TR8A 3BDPA 4CJUA 3AVNA 3ZT1A 3ZT0A 3KLEA 3NF9A 1R0AA 3EY1A 1FK9A 3VQBA 3TARA 3ASMA 4AHSA 1N6QA 4FJ9A 1S1TA 4CHYA 5FROA 3AVJA 3IRXA 4MFBA 4CJRA 3RMBA 3SJJA 3V9UA 1MU2A 4E7HA 4E19A 2Z1IA 3S9HA 1NK7A 1NJWA 4B9SA 2KFZA 4DFJA 4CCHA 3OS1A 1HNVA 2X6NA 1IKXA 2RKIA 1GOBA 3DI6A 3HYFA 4IG3A 4IDKA 4N5SA 4BDZA 3RMDA 3IAYA 4FZXC 4Z4CA 1KRPA 3A2FA 1RTJA 3P1GA 3KLGA 3AO2A 2ZQBA 3G10A 1WSJA 1QSLA 4N41A 3AO1A 1JLQA 1HNIA 3U6FA 3TABA 2HNYA 1VRTA 3SQ4A 4NCAA 3QINA 3DLHA 3U3YA 2IGIA 3M8QA 3QIOA 2HHSA 4DTUA 5KTQA 3AVKA 2HMIA 1VSJA 3QLHA 1LW2A 4FJ7A 3DYAA 1TL1A 3OYNA 3LANA 4CJ3A 4CJFA 4CK1A 4ID1A 2AJQA 2I5JA 1JL2A 3RTVA 4KAZA 4RW7A 4FK4A 2YNIA 4FLUA 3NGYA 3G0ZA 4DU1A 1KTQA 5HP1A 1X9WA 1LAWA 2LSNA 3HL8A 4JS4A 1VSDA 1WSGA 2KTQA 4O55A 1IG9A 4KREA 4O44A 3OYLA 4E7IA 5E41A 1CZ9A 3AVMA 2JGUA 1C0MA 3QNOA 1NJYA 1DTQA 3TAEA 2QKKA 3RR7A 4DQPA 1BCMA 3KLIA 4CF8A 4ELUA 2HVHA 1WAFA 4JRQA 3WNEA 4IBNA 5CZ1A 3LP1A 3CM5A 3TAGA 3ZSZA 1C0TA 4ICLA 3KLFA 1W9HA 1T8EA 4W5TA 3QESA 3L2VA 4W5OA 1RDCA 2WOMA 3MEGA 3ZSOA 4JRPA 4FJNA 4EP5A 4KHNA 4J2EA 4PY5A 3KK1A 1NK9A 3AA5X 5SWMA 1WAJA 2OPSA 3AO3A 3NH2A 3RMCA 4CGDA 3MEDA 3ZSXA 3NCIA 5DMRA 3OYCA 4GVMA 4JLHA 4CEEA 3K5LA 3TI0A 4EP4A 2IC3A 4KO0A 5J2QA 2ZE2A 4DSIA 4CGIA 4GMJB 4IFVA 4E89A 1HYZA 1QHTA 1F21A 1S1UA 3HSTB 4CHPA 4B9LA 3TAMA 3ZCMA 3SPZA 5J2MA 3OYJA 4DFPA 1BHLA 1ASUA 4DTPA 2YV0X 4B9VA 3V9XA 4I9QA 1TAUA 1RT3A 3SQ2A 1L3UA 4CEZA 2VWJA 4CJWA
chains in the Genus database with same CATH superfamily
2OZSA 2H3GX 3VQDA 5J1EA 3MEEA 3J81O 4DMNA 4DTXA 3M6GA 3NAEA 1TAQA 3AO4A 1SAZA 1IKWA 3OYKA 1Q18A 1GLDG 2KFNA 1RBTA 4IJNA 2OPPA 4MO4A 1U49A 4JKDA 3OTOK 1TYQA 1YJ9N 1I39A 1VQNN 5GAGP 3SI6A 3MXIA 4RTFD 3DJCA 1DEJA 1N5YA 4NCBA 4PKIA 1S22A 1BU6O 4DF4A 3K58A 2QWNA 4DTNA 1NK0A 5LY3A 1D8YA 1LWFA 3OW2M 3MX5A 2F96A 1ASVA 4DR6K 1KQSM 5AQXA 4LF4K 2A6AA 1T03A 2IIRA 1M1KO 3SNNA 4O0IA 3PIOL 4DR3K 4FM1A 4CZKA 4DQQA 2Q31A 5CYQA 2PYLA 3HPGA 3DLBA 4CESA 2IVOA 4O5BA 1ESVA 4M7XA 1XI1A 5IWAK 4JV5K 3MCAB 1RT2A 3OS0A 3OY9A 2P9LA 3O9QA 3N4PA 1KFDA 2X74A 4CF9A 1JJ2M 4EIAA 1RDUA 4LSLA 3NGIA 3CPWM 1YTUA 3CM6A 2Y1JA 2XRIA 3OA9A 3OBYA 2Y1IA 3VQQA 3NVMA 4HUGA 1QTMA 1VSLA 2NUBA 5CR4A 3MXMA 3VQCA 1GOAA 1MDUB 4FLTA 4ILJA 4O5FA 1ZBLA 1CXQA 3LZJA 4F9OA 4KTWA 3NF7A 4PL7A 4ELVA 4FLYA 5KPTA 2E5LK 2HW3A 2O8FB 1SV5A 3FE1A 1YITN 2G8WA 4B8AB 3A0IX 2ZJPL 3F5TA 3NVKA 3NBPA 4CHZA 1K6YA 4Y1CA 4YOUA 5AFUA 4CF2A 1U45A 4XH5A 1BIUA 1EWRA 4CZMA 1C6VA 4M3XA 4XEIA 5FPEA 4N76A 3PSFA 3IFRA 3CJ7A 3K59A 5K14A 4BE2A 3AA3A 5ADXA 4F4KA 4CEBA 3HO1A 3FFIA 1X9JA 2BE2A 3O1WA 2VGNA 4PKGA 2VG6A 3ID8A 2BH1A 1RBVA 5DM6L 1VQLN 3SUPA 1S72N 3DLGA 4XH1A 3MCPA 3VQEA 1S6QA 2HHWA 5M1FA 5FLXO 3KVGA 2E20A 1NK6A 1TKDA 3KJVA 1U6ZA 4YDUA 1HYVA 1IBLK 4JS5A 1Q9YA 3AVFA 5M1NA 5FPMA 4CW7B 4JN4A 1BI4B 4LH5A 1Y64A 4CBUA 3QEPA 4Z4EA 5KPRA 4NCGA 3CFPA 1C0UA 3T3FA 4BWJA 5AQNA 1NNEA 5JVGL 4O8KA 1S1XA 5D3GA 3LL3A 2B5JA 2Z1JA 1XC9A 3AA2A 2HNZA 3J7YP 3NF8A 1KFSA 4W5NA 3NE6A 1TKTA 1XC3A 2HF4A 4CJLA 1ZBFA 4E7LA 1HJRA 3SUQA 1NGJA 2E1ZA 2YKMA 2HMPA 3C6HA 4K43A 5J2PA 1HQUA 3B6OA 3DAWA 2Q1NA 3FFKB 4C8LA 1YTAA 1GLCG 4B9UA 1LOTB 1C1CA 4HHTA 1S5JA 4GKKK 3QICA 4ZHRA 3QNNA 1LWEA 1Q9XA 3MWPA 1DT9A 1G15A 3G25A 2V7ZA 4KH4A 1M90O 3HM9A 4DSEA 1J5OA 1YAGA 2FBYA 4LF6K 2KKZA 3EN9A 4IDHA 4I7FA 4FM0A 2YNGA 1KLNA 4FWPA 3CD6N 4BRCA 3LP0A 4K42A 4KI4A 5J2NA 4Y1DA 3V1RA 1U4BA 3SMSA 3VENA 3KK3A 3WQTA 5I42A 5LJVA 2VGMA 4FYDA 4FJLA 3ZT3A 5BRHA 4FJ5A 1YHQN 1VQ6N 1NK5A 4I2PA 3D2EB 1O13A 3RRGA 2ZF5O 1WLJA 1REVA 4R5PA 4RG8A 2UXBK 3PIPL 3F2KA 1C1BA 3JSMA 4DLGA 3ZSRA 4BRGA 1RT7A 3IDHA 4AHTA 2P9LB 1T44A 3VQ6A 2W6KA 4CFAA 2NRXA 1RT6A 5AZIB 4CF1A 5LJWA 1GLLO 4CJTA 1WSFA 3WNGA 4K8XA 5KQ8A 5TKWA 4WFNL 4CZHA 3P5JA 1XMOK 4F2RA 3DLRA 1MWKA 2YKNA 5HRSA 1WSIA 1JL1A 2OPRA 3CIPA 3WQUA 4LFBK 2HHTA 2A1RA 4BR0A 4DTMA 1V4SA 1J6ZA 3SBGA 4H5TA 4M41A 4PWDA 3AVCA 4FK2A 2D4WA 3OJSA 5HRNA 5C24A 4DG1A 3J8AA 5GAEP 1T6CA 3RR8A 2P51A 2JWLA 4BR7A 1T05A 3VEOA 3LPTA 1QQNA 1QHAA 2A40A 2E6LA 3R3LA 3E9PA 4FOEA 4DR4K 1QQCA 3ZEUA 3U4LA 1VSIA 4OGCA 3SAGA 2QI2A 4BRHA 3HJFA 3CCUN 3O3FA 3C6UA 3AVNA 2ZWHA 4EAHD 3ZT1A 4DQ8A 3NF9A 4DR2K 3HBTA 2UXDK 3CCRN 1ZBSA 4DR1K 3ASMA 4YOTA 3AVJA 4CJRA 2WC9A 3SJJA 2KFZA 3KWGA 2X6NA 1IKXA 4N5SA 4EFHA 3RMDA 1T3VA 4Z4CA 1KRPA 1RTJA 4WCEL 3KLGA 5BREA 2ZQBA 2QTDA 5GADP 4N41A 3T1HK 3AO1A 1HNIA 2D1KA 3HOSA 3DLHA 3FZKA 5KTQA 2HMIA 3DYAA 4CK1A 4ID1A 3H1VX 2I5JA 3RTVA 2OANA 3G0ZA 1KTQA 5HP1A 2LSNA 1VSDA 4BRNA 1Q7YO 5IT9O 4CZLA 4DB3A 4WF9L 1NJYA 3TAEA 4XH4A 4X64K 1WAFA 4JRQA 4OO1J 4IBNA 5CZ1A 5JMVA 3CM5A 3ZSZA 3RVCA 4ICLA 1W9HA 1KXPA 2BUPA 3CJBA 4JRPA 5BR9A 5HOOA 4LFAK 3CQXA 1Q86O 5B8HA 3NH2A 2OPSA 3RMCA 4CGDA 1LCUA 3MEDA 3VEXA 1MWMA 3THYA 3O8MA 3TI0A 4E89A 4U67L 4Y0WA 2VWBA 4BRLA 5M1KA 5J2MA 2FSNA 3WXLA 4DKWA 3Q7BA 4YOXA 4DTPA 1BG3A 4B9VA 3V9XA 3EE8A 1TAUA 3GBTA 3CMAN 2VWJA 1K8AO 1TV6A 2FSKA 4FK0A 1LWCA 5AR0A 3OYDA 4FW2A 1DGKN 3CCSN 3K0SA 3THWA 1DTTA 2I7NA 4MLEA 3AV9A 4BRKA 4FJKA 2IOCA 2VWKA 4AILC 3P83D 1BL3A 5F2RA 1TL3A 4KKOA 4M42A 2D0PA 3RSEA 1HUXA 3ZETA 5F1XA 2ATQA 3CETA 3SPYA 3ALYA 3C65A 2WONA 5GINA 1NMNA 2ZD1A 2YHWA 5AQLA 4WE1A 4KHUA 1R59O 3OYEA 1VQON 2O8DA 3W0LA 5GIPA 4DS5A 1ZBHA 4BRPA 3PUFA 3WXMB 3CHWA 4K25A 1O1WA 1BGXT 2Z1HA 3ATVA 3SUOA 3V9WA 3C95A 4M3YA 1I3AA 3QIPA 4KHSA 4CVNE 4BDYA 4CGHA 4BR9A 1QVGM 5CE3A 2B6AA 3HK2A 1BQNA 4LF5K 1KC8O 5EU7A 4IZ9A 3K9JA 3VQPA 1VRUA 4Q5VA 3GOIA 3F9KA 3MN6A 3AVHA 3CCEN 3BUZB 1WSHA 1GOCA 1KLMA 3V9ZA 4H0XB 1S1VA 2O8BA 4KHPK 2KHOA 1RNHA 1L5UA 1SKWA 3O6WA 1P8ZA 2NLXA 1NK4A 4NLBA 1NGHA 3ZX0A 1QZ5A 3THXB 4H5VA 3HSCA 1RGIA 3BZKA 5ADXH 4EZ6A 4A5BA 4B9QA 3HPOA 1NKCA 1L3TA 1WUAA 4JI4K 4YDUC 4LY7A 2NZTA 1NM1A 4BRQA 2EX3A 5JLFA 1N32K 4A62A 2R7YA 3TTCA 4FJJA 5I9EB 5HRRA 1RFQA 3UIQA 3ZYYX 3VEVA 4QAGA 2PBDA 2RPIA 1JXBA 3DXMB 5DK5A 2OPQA 3DM2A 1IBKK 1XHXA 3LWLA 1ZBUA 5KRTA 2VG7A 2YHBA 1ITGA 1QSSA 1B9DA 4KB0A 3SLCA 1SL0A 4FJHA 3DXKB 2FC0A 3TWHA 5M1PA 2G8UA 4DR7K 1VSKA 4HTUA 4JI7K 3THVA 4KFBA 3NFAA 3WNFA 2O8CA 4OVLA 3AAPA 3LDNA 4ZTJA 5KRSA 3VTHA 3PV8A 4C8KA 1J9AA 4GV6A 1RT5A 3V9SA 4G9ZA 2E88A 3SUNA 5AQWA 1JCEA 2DY4A 3OJUA 2E8AA 1CLQA 2NRHA 3LALA 4ISFA 1EXQA 3VERA 2GUIA 4CJQA 3VQ8A 4BVPA 2HSTA 4V19S 2NRRA 2G8FA 3TAQA 1HJOA 2IS3A 5HROA 3VQAA 3S3NA 4M3WA 5AQTA 3KLHA 3SK3A 3OYIA 3H3NO 3OYAA 1TKZA 3VEWA 4E7KA 3VF4A 1NGEA 1B9FA 3VA3A 2UUBK 3MXJA 4CBXA 1XQSC 4DLEA 2Q36A 5BRFA 2DFFA 1NOYA 5AQFA 1J53A 1TUUA 2NRVA 2QA4N 3TAPA 1NGBA 3SQ1A 1JLBA 4FWOA 2KZMA 3I8BA 1VQKN 3FGUA 5TKYA 1YVUA 3M8RA 3VN5A 2D0AA 1JKHA 4FWLA 4FWQA 1U04A 3SYZA 1QE1A 5AQMA 3PO5A 2D0OA 3CERA 4GV3A 3ZSWA 4BRAA 1E3MA 3IG1A 3A5OC 3CMEN 3ENHA 4CEFA 1ATSA 2HBJA 1FW6A 3ZSVA 2XHBA 4U7BA 4GY2B 1NGIA 4DTSA 3H6EA 1NJXA 1FKOA 2AA4A 5AFUH 1KVCA 3ZSYA 2E4LA 1A5XA 5BRDA 4AM7A 2O4IA 4QOZB 1CZBA 4LH4A 4RW6A 3BF3A 4B1ZA 2X78A 3CFOA 3C7NB 1QQOA 4PHTX 4KTQA 4DF8A 5FDLA 4KBOA 4J2BA 3ZT4A 4JI3K 2Q3SA 5AQPA 3I0SA 1OVYA 5LL6Z 3CF5L 3F73A 4CFCA 4FJGA 5KGXA 5JVHL 4EHUA 3E01A 1HYSA 4WYBA 1CXUA 4MQ3A 1VK0A 2GV9A 3THXA 1GLBG 5HLFA 5JS2A 2PYJA 3DWLA 4UY8O 1Q8IA 4DR5K 4CJ5A 5AQYA 3HVRA 1DLOA 3H08A 4BGBA 4YFUA 2YX6A 3QBXA 4WQ5C 3L2QA 1RT1A 4H0PA 3AA4A 3T7ZA 1HPZA 4FSVA 1I94K 2BANA 5KGWA 3HXMA 3LPUA 3L4QA 4K41A 2BGGA 1EETA 1IH7A 1K9MO 4LF8K 1FKPA 3K5OA 4E1MA 3NH0A 4B9MA 1OH8A 1HNWK 4DTRA 1EWQA 1T6DA 4I2QA 5BR8K 1U47A 1LAVA 1ZXOA 1A5WA 4DV5K 3J7ZO 1V4TA 3NMUA 3HVTA 3O9RA 2HHXA 4F2SA 5AQVA 3VGLA 3MWTA 4M7YA 3VPZA 3LDQA 4FWMA 1ASWA 3AVBA 3PX6A 3BF1A 4Z4GA 3F9MA 4LF9K 4JI5K 1QVFM 1YIJN 2Z1GA 1SUQA 3VMFB 2P9PA 5AJ3K 3AGKA 5C2FA 4OX9K 2PAVA 4CGFA 1K8KB 5BPLA 3L2RA 2OA8A 2HHHK 3OYMA 1NWKA 2IVPA 1B92A 4CK3A 3JXUA 4C1NK 3DOKA 5C0YA 2HHQA 1IKYA 3LZIA 3HZ6A 2UYTA 4YHHK 3IMXA 4JNEA 4CEQA 4ILGB 4ILHA 4BR2A 3DXKA 4FJ8A 2KZZA 3TR8A 5C10A 4CD3A 4JKHA 3ZETB 1HNZK 3VQBA 3D2FB 4CHYA 4MFBA 4QS9A 3RMBA 3V9UA 1NK7A 4B9SA 4IXCA 4DFJA 4IG3A 1GOBA 1IV0A 2DPNA 4FZXC 2O8FA 5AZJA 3OBWA 1WSJA 1QSLA 2FXUA 3U9DA 1VRTA 3U3YA 2IGIA 2HHSA 1VSJA 4X62K 4BY9C 4YOYA 1DKGD 3OYNA 1VQ5N 4CJ3A 3CQYA 3PSIA 1OH6A 1JL2A 3UKUA 2YNIA 3NGYA 5CHIA 2BTFA 4JS4A 3HL8A 5BN8A 3Q7CA 1WSGA 2KTQA 1IG9A 4KREA 4H5NA 4O44A 5C2DA 1C0MA 4BG8A 2QKKA 3RR7A 1BCMA 3KLIA 4CF8A 2HVHA 3GL1A 1WB9A 2W41A 3VETA 3G71N 3TAGA 1EQYA 3ULEB 1G99A 5A2QO 4JI6K 3TTFA 1RDCA 3LDPA 3ZSOA 4FJNA 4R79A 2Q97A 2W6LA 3BP8A 1WAJA 3AO3A 3NCIA 4CEEA 5J2QA 2AP1A 4GMJB 2YJFA 1HYZA 4DHYA 5JLHA 1QHTA 1F21A 3O9TA 3OYJA 1N8RO 2YV0X 4K0KK 4I9QA 3SQ2A 3SAFA 4FWSA 4FWNA 4CJKA 3OYFA 3QETA 4N56A 3KD5E 2X6SA 4FJIA 2W42A 1L3SA 3MECA 1WBDA 3VGKA 1HKCA 2HOEA 4B3SK 4B3RK 4KB1A 2RF2A 4C8MA 3AAQA 3C7NA 1X9SA 4CFDA 1IO2A 3NHGA 4CHNA 3ID6A 1K73O 3AARA 3AY9A 4B08A 3L2UA 5E84A 3MAQA 3QB0A 2CH6A 4B8CA 3EZWA 3VTIA 3KZBA 4B1VA 3DLLL 3KTQA 3D0PA 3HPHA 4IO8A 3LAMA 1Q82O 1NGFA 4JHDA 4BWMA 4LSNA 1T7PA 3VF6A 1W7AA 4B9NA 3CG7A 5BPNA 2P1JA 4DU4A 4GW6A 4CJ7A 2Q0UA 2Q2RA 3C94A 1NGCA 4MDBA 3L8BA 5T7BA 3O08A 4IFEA 3E66A 4GNIA 1HRHA 1H1VA 3R9PA 3OHRA 4H8KA 2YNFA 3RMAA 3SCXA 4E1JA 3VQ7A 1SL2A 3UKRA 3EL2A 3T1YK 4FVUA 4B3TK 5AQHA 1ZBIA 4F3TA 4IOCL 1RBRA 3QERA 1VQ4N 1BQMA 2P9SB 2XY5A 3I0RA 3CJAA 2YJEA 2KLAA 3G6EN 4G1QA 1VAZA 2FSJA 3O9SA 1HMVA 4JK7A 3SAHA 5AQUA 1UA0A 1HQEA 2WFBA 3TSQA 2QWLA 3KKSA 3O9UA 3CC4N 1NGDA 3JYTA 1JLAA 2RN2A 4ZTFA 3W3DA 4C8OA 2G8HA 4GV9A 5FRNA 2FBTA 5I3UA 2NNWA 3VQ5A 1BO5O 4FXDA 4KHYA 4BE1A 2CGJA 3T69A 3FZLA 1OVQA 4RWTA 3QEWA 1K8KA 1J5EK 1RDAA 3G4SN 1W2BM 1BA1A 4DSJA 5EOYA 4JI2K 3SQ0A 4KHQA 4B1XB 3SV3A 1OKJA 2FBVA 3H45C 3K57A 1D9DA 1L3VA 4OKJA 2E2QA 1Z05A 3O4QA 1VQ9N 3EKSA 2JLEA 2BDPA 3H3OB 2Q0RA 4WFAL 4W5QA 3E1YA 1BI4A 3P38A 3CCMN 3K5MA 2V7YA 1S9EA 2O8DB 2QKBA 4E1NA 4CGGA 4RW4A 2HHUA 4OGEA 5AQGA 4LD0A 2ZJQL 1TK8A 4NXMK 5EX5A 4BREA 3EYZA 4JI0K 5AQZA 4XIUA 1HR0K 1BDGA 4AF1A 4OLBA 4FL9A 4FCYA 1NGGA 2HBLA 4A61A 1D9FA 4DV2K 5AZJB 3TAFA 3L4IA 1BISA 4WQ5A 3WXJA 4BGAA 3E9LA 1U2VB 3PX4A 3AGRA 5LMUK 4DU3A 2P9NA 3QEIA 5EY4A 4PA1A 2NRZA 4YOVA 3K5NA 4RCHA 2D5RA 1YVNA 1JCFA 4WQ4A 2UUCK 1WN7A 3WEEA 4CZIA 2UXCK 1YT3A 5EXWA 4JK8A 2KW4A 4FM2A 3T19A 2DFHA 1TKXA 1VSHA 3EE9A 1WBBA 4E7JA 1SL1A 3DMJA 5C12A 4BACA 1RBSA 3KKRA 3D45A 2DFEA 3A5LC 4CJ4A 3I33A 1XHZA 5CY4A 3L2WA 3V1OA 4IFYA 4JI1K 5GIOA 5SZTA 3CPEA 5M1QA 1XNRK 2EHGA 4M3TA 4CIEA 3JS6A 3ISNC 1MA9B 4OPHA 4F8RA 4OPJA 4UQGA 4IKFA 4MO5A 4J2AA 4Z4FA 1N33K 1CZAN 1XNQK 5AQIA 5M1OA 2A5XA 4FWRA 4O4GA 4Z4IA 4DFMA 4CEOA 4W5RA 4BDPA 3B8AX 2J4RA 2PY5A 4YNQA 4FLXA 3ZT2A 2PZSA 4PUOA 4YORA 2P9IA 3BY5A 1N34K 3FZFA 3CJCA 2F9TA 2KQ2A 2OYQA 2QM1A 3LM9A 4DS4A 2P9KB 2GEMA 2GX9A 3V4IA 2HF3A 2IAJA 1W0HA 3LM2A 5BN9A 3CFRA 2I7PA 4JKEA 3RRHA 5HRPA 3VEYA 4NB4A 2XY6A 4FVMA 3DRPA 2UUAK 4CK2A 3HP6A 4FZZA 1W97L 3VQ4A 4M63C 4CHQA 2FF6A 1RDBA 1RT4A 3ULDA 3WUHA 3IS9A 3THYB 3UKUB 2QWMA 3UE5A 3I55N 4EZ9A 4M45A 4KTZA 5CZ2A 2O4GA 3E9OA 3RSEB 3RWUA 4JI8K 4FLWA 4JD2A 4CERA 4DFKA 3CC2N 4CZJA 5C42A 4QS7A 4H0TB 5ELZA 4WFBL 2ETJA 2YCHA 4FLZA 1JLGA 4NYNA 1VQ7N 3S3OA 1WSEA 3ZEUB 1E4GT 3P4IA 1RBUA 3CCJN 4BE0A 3CQ8A 3R1XA 2RE2A 1NKBA 4BRDA 2A1SA 3QDKA 1EKEA 4PKHA 3LDLA 2YHXA 3C6TA 3P39A 3SV4A 1XUPO 4H03B 1TK5A 2D0BA 3L3UA 5AQQA 3M1FA 1VHXA 1NMDA 4JKGB 1FJGK 3HT3A 1C0FA 4B3MK 2YI1A 4CZEA 4CEAA 3OVNA 1EP4A 4OLAA 4IJAA 3V81A 3K2PA 2F9WA 3HTVA 3FLCO 4H5RA 1HKGA 3NGZA 1Z25A 1RDWX 3EEQA 4KHWA 3LP2A 4IEIA 3ZX3A 1WOQA 5AQSA 4B1UB 4M3ZA 4DQSA 2PFUA 1SKRA 1TUYA 2ASOA 3C6AA 3KIOA 2E2PA 2VCPA 4KRFA 3HP9A 4I6MB 2OTLN 1GLFO 2ZGYA 4HCCA 4Z0UA 3HOTA 4A5AA 4HCBA 1LW0A 3BDPA 2HBMA 2GELA 1QQMA 1R0AA 1YI2N 3MN9A 4NLCA 4FJ9A 1N6QA 1IG8A 1S1TA 5FROA 3IRXA 2EWSA 1MU2A 3S9HA 4NO7A 4CCHA 3GG4A 1HNVA 3DI6A 2RKIA 2P9SA 4BDZA 2CGLA 1NJIO 3IAYA 1GLJO 3K9KA 3A2FA 3P1GA 1GLEG 3G10A 1JLQA 2P9UA 3TABA 3SQ4A 4NCAA 3QINA 3QIOA 3AVKA 3QLHA 3CCQN 1LW2A 4BQLA 4FJ7A 3LANA 1ILYA 4KAZA 4BRIA 2V52B 4MDAA 4DU1A 1X9WA 1LAWA 1NU0A 3FZMA 2GUPA 4E7IA 5E41A 1CZ9A 3AVMA 2W40A 3MX2A 4HTLA 3QFUA 3QNOA 1VQPN 1DTQA 1X3MA 4ELUA 4AQYK 1C0TA 3D2EA 4LC9B 3LDOA 3MN5A 1T8EA 4W5TA 4W5OA 3VESA 2A42A 1HLUA 4EP5A 4J2EA 3ZLJA 3AA5X 5SWMA 4BC5A 5DMRA 3OYCA 4GVMA 2IC3A 2ZE2A 1SZ2A 4CGIA 4IFVA 1YJNN 2V51B 2A3ZA 3EKUA 2ASMA 4B9LA 3TAMA 3SPZA 3M3ZA 4DFPA 3CJ9A 1BHLA 1ASUA 2VYPA 1RT3A 3GDQA 1P90A 1BA0A 1L3UA 4JAXA 1BUPA 2IDOA 3KK2A 3NDKA 3S3MA 2ITGA 1RTHA 2NRWA 1U2VA 4BRMA 3TANA 4A2BA 4B3OA 1TVRA 5BPMA 5MLCQ 4ELTA 3N4QA 1KCFA 2O8EB 3QBWA 1UWBA 3TSPA 4Z4HA 3SBTA 4DV7K 4I9LA 3VGMA 2B4JA 4JK9A 3QEVA 1ZYQA 4HVJA 2CH5A 1TGOA 3AO5A 4FW1A 1WNSA 2XY7A 3M8SA 4BRFA 3OYBA 4JKBA 4FPBA 5GAHP 1U48A 2QWRA 3L3VA 4BC3A 3O3GA 1ZC6A 3OYGA 2FF3B 3WXKA 4CJEA 3SZ2A 4GKJK 1NOZA 5C15A 1NKEA 4JKAA 1QSYA 1QS4A 4JKCA 3A5MC 4DTJA 2HB5A 4DSLA 1ATNA 4OKEA 3D6RA 4DV1K 3QEXA 3R8EA 1A5VA 4QS8A 3O1BA 3ENBA 1BWFO 2QWQA 1IKVA 3I8DA 3NF6A 3UB5A 2P5OA 3PX0A 4OJRA 3P31A 3BGRA 2HHVA 1VSMA 4JEPA 5KI6A 4DV3K 5KPZA 4NYFA 1UA1A 3CYMA 1FXXA 4CD1A 3VOVA 4OPAA 1XWLA 3O4NA 3V6DA 4CIFA 2XY8A 4CE9A 3IUCA 1UAXA 3WT0A 3QMLA 1C1AA 2E6MA 1Z6RA 3O5BA 4HWIA 2GBZA 3L6QA 2WBNA 4I6MA 4JKFA 5LMNK 3TSUA 4DUYK 4CEDA 3DLKA 4B9TA 4ID5A 2QK9A 2YHAA 3D7EO 4AM6A 3DRRA 1OH5A 2P9KA 5HBMA 3AVIA 4FZYA 4AHRA 2ITMA 1JXEA 3SJHA 4TSXA 4CJPA 2FLOA 5E26A 4J2DA 2F8TA 4H4MA 3OYHA 5JS1A 2RHKA 3MDQA 1SQKA 4DSKA 1BCOA 4KV8A 1TYQB 2HNDA 4C23A 3BEXA 3S41A 3KWIA 1SKSA 4DTOA 2QXFA 4YOWA 4O8UA 4DQIA 1NLVA 3U3GA 3UKRB 3AVLA 4CHOA 1YUWA 3U9ZA 5DM7L 3FZHA 3DXMA 3O3HA 1JLEA 4FLVA 1Q81O 2NRTA 4CZGA 2YNHA 3D2FA 2HVIA 3A5NC 3VA0A 2DTUA 2A41A 3WNHA 4AH9A 3T1AA 4IG0A 3THWB 3PY8A 3ENOA 4A59A 3M8PA 4CIGA 3AVGA 3HM8A 1JLCA 3CXCM 1HX1A 5HL7L 4CFBA 3KK7A 1KVAA 5AZIA 2F4VK 4JKGA 1UOCA 4C1NI 2QXLA 1EO1A 3VQ9A 3B6PA 4GVEA 5JICA 2XO7A 3CI5A 4DV6K 4E3SA 4Q0BA 4L3QA 2QW9A 3O4WA 5AQKA 4KH6A 2OTJN 5KQDA 3CCVN 2P5GA 1VSEA 4IWVA 3LP3A 4DWIA 3CCLN 4N47A 4ISEA 2WTUA 1KAXA 1S3XA 5C25A 4F3OA 1NGAA 3BZCA 3IKMA 4A2AA 1NG9A 4FJMA 3LAKA 2JWKA 1D5AA 5AQJA 4OKKA 4Z94A 4YY3K 3AVAA 2VG5A 1RCHA 4BVOA 3ZX2A 4RW8A 1NK8A 4PQUA 5F0XA 1HKBA 5EVZA 1X1PA 2IVNA 3TPQA 3PO4A 3ZSQA 1ATRA 1KVBA 1IJJA 1VSFA 1Z26A 4B1YB 4LF7K 2HBKA 3EZ5A 4H0YB 4IOAL 2E2NA 1XMQK 2D0CA 3R6MA 3L0QA 4FJXA 4NXNK 1KSPA 2ZJRL 3O80A 4BC4A 5AQOA 3ITHA 1Y97A 1JLFA 4DSFA 2P9UB 4RW9A 3J7AP 1JCGA 4CZFA 1RILA 2G8IA 1KAZA 4FOIA 2FBXA 4BC2A 3CJ1A 1S1WA 3JAMO 4HUEA 5CYMA 3C0BA 4CF0A 4BR4A 3DLEA 4WQ4C 4IEEA 5FPNA 4OPKA 2P9PB 3GE1A 4CI6A 1E4FT 3DRSA 1GLAG 4L8RB 3QO9A 3HI0A 4FWKA 1EX4A 4PL8A 3LDSA 2YHYA 2VQEK 4JHDB 4IOXA 4O0JA 4CJSA 3VF2A 4QCLA 1HPMA 2F8SA 4IO9L 2UU9K 4CGJA 4H4OA 4AHCA 2E1YA 4K8ZA 4DQRA 3V1QA 4M3RA 3PLAA 4ISGA 1SS6A 3H46O 4E0DA 3EO3A 3MN7A 1X9MA 1J54A 1BIZA 1KAYA 1VQ8N 4AHUA 1RTIA 3KD1E 2P9IB 4BG9A 3OS2A 1NJZA 1D4XA 1RDDA 4KPYA 3LWMA 2G8KA 2O8CB 2G8VA 2GWKA 1TK0A 4CJVA 4X66K 1KD1O 4J8FA 3HRGA 4BQZA 3NH1A 4KI6A 1S6PA 1RTDA 4HUFA 1YJWN 4MLHA 1S9GA 1VQMN 1NBWA 3DOLA 3CC7N 4M3UA 2O8EA 2OZMA 5FRMA 4CECA 1LV5A 1YXQA 4AHVA 2ZGZA 4C8NA 2ZM6K 4CJUA 3ZT0A 3KLEA 2GTDA 4X65K 2OCEA 3EY1A 1FK9A 4BR5A 3TARA 1C0GA 4DV4K 4AHSA 5FPDA 4FPAA 1IBMK 1HNXK 4E7HA 4LFCK 3ULEA 4E19A 2Z1IA 1NJWA 3WXIA 3OS1A 2WUSA 4EHTA 3HYFA 1OH7A 4IDKA 4H0VB 3U8XA 4B1WB 3TU5A 4JD2B 5H1SQ 3MK6A 3AO2A 3U6FA 2HNYA 3FR0A 3KHYA 3M8QA 4DTUA 2CGKA 4A57A 5AQRA 1TL1A 3J80O 4CJFA 2AJQA 4H5WA 4RW7A 3M5RA 3I56N 4FLUA 4FK4A 1X3NA 3TTDA 1N36K 3QFPA 3A8YA 4O55A 3OYLA 4DUZK 1QZ6A 2F7TA 2VQFK 2JGUA 2QWPA 3H1QA 3SMPA 4DQPA 4JYAK 4CBWA 3WNEA 2E2OA 3LP1A 1YF5L 3MMVA 3KLFA 4DV0K 3QESA 3L2VA 2WOMA 3MEGA 3WEEB 4KHNA 4PY5A 3KK1A 1NK9A 2GWJA 2ASPA 3ATUA 2O8BB 2QWOA 3ZSXA 4JLHA 2QEXN 4KH5A 3K5LA 4EP4A 4KO0A 4DSIA 1S1UA 3HSTB 4CHPA 1BOTO 4H0OA 3VEZA 4DCHA 3ZCMA 4BROA 4FO0A 2P9NB 4CEZA 4CJWA
chains in the Genus database with same CATH topology
2IDOA 2OZSA 3KK2A 3NDKA 4CJKA 3OYFA 3VQDA 2ITGA 5J1EA 1TV6A 1RTHA 3MEEA 4N56A 2X6SA 3QETA 4DMNA 3KD5E 4DTXA 3TANA 4B3OA 3NAEA 4FK0A 1TVRA 1TAQA 3AO4A 2W42A 1LWCA 4FJIA 3OYDA 1IKWA 4FW2A 3OYKA 1L3SA 3MECA 4ELTA 1DTTA 3AV9A 1KCFA 4KB1A 2KFNA 1RBTA 1UWBA 2RF2A 4FJKA 2IOCA 2VWKA 4C8MA 4AILC 2OPPA 3P83D 4Z4HA 1BL3A 1U49A 4I9LA 1TL3A 1X9SA 4KKOA 4CFDA 1IO2A 2B4JA 3NHGA 4CHNA 3QEVA 1ZYQA 4M42A 4HVJA 1I39A 4B08A 3L2UA 1TGOA 3AO5A 4FW1A 3SI6A 2ATQA 3MAQA 3MXIA 1WNSA 2XY7A 3SPYA 4B8CA 3M8SA 3ALYA 3OYBA 2WONA 3KTQA 3D0PA 3HPHA 2ZD1A 3LAMA 4WE1A 1N5YA 1U48A 4KHUA 3OYEA 4BWMA 3L3VA 4LSNA 3O3GA 4NCBA 1T7PA 4B9NA 3CG7A 4DS5A 3OYGA 4DF4A 1ZBHA 4DU4A 2P1JA 3PUFA 3K58A 4GW6A 1O1WA 1BGXT 2Z1HA 4DTNA 3C94A 4CJEA 3SUOA 1NK0A 3L8BA 5T7BA 3SZ2A 1D8YA 3V9WA 3C95A 1NOZA 1NKEA 4M3YA 1LWFA 1I3AA 2F96A 1ASVA 1QSYA 1QS4A 1T03A 3QIPA 2HB5A 4DTJA 3SNNA 4KHSA 4DSLA 4O0IA 4BDYA 4FM1A 4CGHA 3S3MA 2B6AA 1HRHA 3HK2A 4OKEA 1BQNA 4H8KA 5CYQA 2YNFA 4DQQA 5EU7A 3RMAA 3QEXA 3SCXA 1SL2A 3VQ7A 3VQPA 2PYLA 3HPGA 3DLBA 1VRUA 4Q5VA 1A5VA 3F9KA 4CESA 3AVHA 4O5BA 1GOCA 1KLMA 1WSHA 3V9ZA 1XI1A 1IKVA 1ZBIA 1S1VA 3NF6A 3I8DA 2P5OA 4F3TA 3PX0A 4OJRA 1RBRA 3BGRA 3QERA 1BQMA 1RNHA 2HHVA 1L5UA 1SKWA 2XY5A 1VSMA 3I0RA 5KI6A 1NK4A 4G1QA 1HMVA 3OS0A 1RT2A 4NYFA 1UA1A 3CYMA 3OY9A 1FXXA 1UA0A 1HQEA 4EZ6A 1KFDA 3HPOA 1XWLA 3O4NA 3KKSA 2X74A 4CF9A 3V6DA 3JYTA 1JLAA 2RN2A 4ZTFA 1L3TA 4LSLA 3NGIA 1YTUA 4CIFA 3CM6A 2Y1JA 2G8HA 2XRIA 4C8OA 2FBTA 2XY8A 5FRNA 4CE9A 2Y1IA 5I3UA 3VQ5A 3VQQA 4LY7A 4FXDA 4KHYA 4BE1A 1UAXA 4HUGA 2G8UA 1C1AA 2E6MA 1QTMA 2EX3A 2GBZA 1VSLA 3QEWA 2NUBA 2R7YA 3MXMA 1RDAA 3VQCA 4FJJA 5HRRA 3UIQA 1GOAA 4FLTA 4QAGA 4DSJA 2RPIA 1JXBA 1CXQA 3LZJA 1ZBLA 3SQ0A 4KHQA 4CEDA 3SV3A 3DLKA 4B9TA 5DK5A 4ID5A 2FBVA 2QK9A 2OPQA 2YHAA 4KTWA 3K57A 3NF7A 3DM2A 4OKJA 1L3VA 1D9DA 4ELVA 4FLYA 1XHXA 3O4QA 3LWLA 1ZBUA 2HW3A 1SV5A 2JLEA 3DRRA 5KRTA 2VG7A 5HBMA 2G8WA 3AVIA 2YHBA 1ITGA 4AHRA 1B9DA 4B8AB 4W5QA 1QSSA 4FZYA 4KB0A 1BI4A 1SL0A 4FJHA 1JXEA 3NBPA 4CHZA 1K6YA 2FC0A 4TSXA 1S9EA 4Y1CA 4CJPA 4CF2A 3K5MA 3TWHA 1VSKA 1U45A 4E1NA 4CGGA 4RW4A 4HTUA 2QKBA 2HHUA 4J2DA 4OGEA 1BIUA 4H4MA 4KFBA 3NFAA 4LD0A 3THVA 2F8TA 1TK8A 3WNFA 3OYHA 2BDPA 4OVLA 5JS1A 1C6VA 3EYZA 4XIUA 4M3XA 4DSKA 4ZTJA 1BCOA 4KV8A 4N76A 2HNDA 5KRSA 4OLBA 4FCYA 3K59A 3PV8A 5K14A 1D9FA 4C8KA 4BE2A 1J9AA 3AA3A 3TAFA 4F4KA 4CEBA 4DTOA 1RT5A 1SKSA 3HO1A 1BISA 2QXFA 3FFIA 4DQIA 2BE2A 3U3GA 3V9SA 3SUNA 3AVLA 4CHOA 2VG6A 3PX4A 1RBVA 4DU3A 3QEIA 3SUPA 3DLGA 3VQEA 1S6QA 2DY4A 3OJUA 2HHWA 4PA1A 3O3HA 3K5NA 1CLQA 1JLEA 2D5RA 3LALA 1EXQA 1NK6A 1TKDA 4FLVA 2GUIA 1WN7A 3KJVA 4CJQA 3VQ8A 1HYVA 2YNHA 2HVIA 4JS5A 3VA0A 1Q9YA 2G8FA 1YT3A 3TAQA 2IS3A 3AVFA 5HROA 2DTUA 3VQAA 3S3NA 4M3WA 3WNHA 4AH9A 3T1AA 3KLHA 1BI4B 4IG0A 4LH5A 4FM2A 2KW4A 3QEPA 3OYIA 3T19A 2DFHA 1TKXA 1VSHA 3OYAA 4Z4EA 4E7JA 1SL1A 3DMJA 3PY8A 4BACA 1TKZA 4NCGA 3CFPA 1RBSA 4E7KA 1C0UA 3M8PA 3KKRA 3T3FA 4CIGA 3D45A 4BWJA 3AVGA 1JLCA 2DFEA 4CJ4A 4CFBA 1XHZA 1B9FA 5CY4A 3VA3A 1KVAA 1S1XA 3L2WA 3V1OA 4IFYA 3MXJA 5D3GA 1UOCA 5SZTA 2B5JA 2Z1JA 3VQ9A 1XC9A 3B6PA 3AA2A 4DLEA 2HNZA 2XO7A 1KFSA 3NF8A 4W5NA 3NE6A 1TKTA 2DFFA 4E3SA 1NOYA 2EHGA 4CJLA 4M3TA 1ZBFA 4CIEA 4E7LA 1HJRA 1J53A 3SUQA 4Q0BA 2YKMA 3ISNC 3TAPA 4F8RA 5J2PA 1HQUA 4OPJA 4UQGA 3SQ1A 4IKFA 1JLBA 3B6OA 4J2AA 2P5GA 1VSEA 2KZMA 3LP3A 4DWIA 4Z4FA 4N47A 4C8LA 1YTAA 5C25A 4F3OA 4B9UA 1YVUA 1C1CA 3M8RA 3VN5A 2D0AA 1JKHA 3LAKA 4O4GA 4FJMA 4Z4IA 4HHTA 1S5JA 1U04A 3SYZA 1QE1A 3PO5A 4DFMA 1D5AA 4CEOA 4OKKA 4ZHRA 4W5RA 4BDPA 3AVAA 3QNNA 1LWEA 2VG5A 1RCHA 3ZSWA 1NK8A 4RW8A 1Q9XA 4YNQA 1G15A 4FLXA 3IG1A 2PY5A 3ZT2A 4PQUA 4CEFA 2PZSA 4PUOA 3HM9A 3ZSVA 2XHBA 4DSEA 1J5OA 2FBYA 1X1PA 4FM0A 4DTSA 4I7FA 1FKOA 2YNGA 1NJXA 1KLNA 3PO4A 2KQ2A 2OYQA 1KVCA 3ZSYA 2E4LA 3LP0A 1A5XA 3ZSQA 4KI4A 5J2NA 4DS4A 2O4IA 4Y1DA 3V1RA 1U4BA 1KVBA 4QOZB 1CZBA 4LH4A 4RW6A 3V4IA 3KK3A 1NKCA 1VSFA 1Z26A 2IAJA 5I42A 1W0HA 2X78A 3CFRA 3EZ5A 4FYDA 3RRHA 5HRPA 3CFOA 4FJLA 2D0CA 3ZT3A 2XY6A 4FJXA 4FVMA 4KTQA 3DRPA 4DF8A 5FDLA 4FJ5A 4J2BA 4CK2A 3ZT4A 3HP6A 3VQ4A 2Q3SA 1KSPA 4FZZA 1NK5A 4I2PA 4CHQA 3RRGA 3I0SA 3ITHA 1WLJA 1REVA 1RDBA 1Y97A 4R5PA 1JLFA 1RT4A 3ULDA 4RG8A 4DSFA 3F73A 4RW9A 4CFCA 1C1BA 4FJGA 3JSMA 5KGXA 3ZSRA 3IS9A 4DLGA 3E01A 1HYSA 1RILA 1CXUA 1RT7A 4MQ3A 1VK0A 2GV9A 4AHTA 2G8IA 2FBXA 5HLFA 3VQ6A 5JS2A 1S1WA 4HUEA 2PYJA 5CYMA 4CFAA 4CF0A 1RT6A 3DLEA 4EZ9A 1Q8IA 4M45A 4KTZA 5CZ2A 4CJ5A 4CF1A 3HVRA 1DLOA 2O4GA 3H08A 4OPKA 3RWUA 4FLWA 4DFKA 4CERA 5C42A 4YFUA 3DRSA 4CJTA 1WSFA 1RT1A 3L2QA 2ETJA 3QO9A 4FLZA 4L8RB 1JLGA 1EX4A 4NYNA 3WNGA 3LDSA 1WSEA 3S3OA 4K8XA 3AA4A 4BE0A 1RBUA 1HPZA 3P5JA 4O0JA 3CQ8A 4F2RA 4CJSA 3DLRA 2BANA 5KGWA 3HXMA 3LPUA 1NKBA 4QCLA 2BGGA 2YKNA 5HRSA 2A1SA 1EETA 1WSIA 2F8SA 1EKEA 1JL1A 1IH7A 2OPRA 1FKPA 3C6TA 3K5OA 4E1MA 4CGJA 3SV4A 3NH0A 4B9MA 1TK5A 4DTRA 2D0BA 3L3UA 2HHTA 2A1RA 4H4OA 4I2QA 4AHCA 4K8ZA 4DTMA 1U47A 4DQRA 1LAVA 3HT3A 3V1QA 4M3RA 1A5WA 4CEAA 3OVNA 1EP4A 4E0DA 4M41A 4PWDA 1X9MA 1J54A 3HVTA 4OLAA 2HHXA 1BIZA 3AVCA 4F2SA 4FK2A 3OJSA 5HRNA 5C24A 3K2PA 4AHUA 3V81A 1RTIA 4DG1A 3KD1E 3OS2A 1NJZA 3NGZA 3RR8A 2P51A 1ASWA 1RDDA 1Z25A 3AVBA 4KPYA 4KHWA 3PX6A 3LWMA 1T05A 3LP2A 2G8KA 2G8VA 1TK0A 4Z4GA 3LPTA 4CJVA 2Z1GA 4M3ZA 4DQSA 1SUQA 2E6LA 1SKRA 3KIOA 4CGFA 3NH1A 3L2RA 2OA8A 3OYMA 4KI6A 1S6PA 3HP9A 4HUFA 1RTDA 1B92A 1QQCA 4KRFA 4CK3A 1VSIA 3DOKA 4OGCA 2HHQA 1S9GA 4HCCA 4Z0UA 1IKYA 3LZIA 3DOLA 4M3UA 4CEQA 2OZMA 4FJ8A 5FRMA 4CECA 1LV5A 4HCBA 3HJFA 3O3FA 2KZZA 4AHVA 1LW0A 3C6UA 4C8NA 3TR8A 3BDPA 4CJUA 3AVNA 3ZT1A 3ZT0A 3KLEA 3NF9A 1R0AA 3EY1A 1FK9A 3VQBA 3TARA 3ASMA 4AHSA 1N6QA 4FJ9A 1S1TA 4CHYA 5FROA 3AVJA 3IRXA 4MFBA 4CJRA 3RMBA 3SJJA 3V9UA 1MU2A 4E7HA 4E19A 2Z1IA 3S9HA 1NK7A 1NJWA 4B9SA 2KFZA 4DFJA 4CCHA 3OS1A 1HNVA 2X6NA 1IKXA 2RKIA 1GOBA 3DI6A 3HYFA 4IG3A 4IDKA 4N5SA 4BDZA 3RMDA 3IAYA 4FZXC 4Z4CA 1KRPA 3A2FA 1RTJA 3P1GA 3KLGA 3AO2A 2ZQBA 3G10A 1WSJA 1QSLA 4N41A 3AO1A 1JLQA 1HNIA 3U6FA 3TABA 2HNYA 1VRTA 3SQ4A 4NCAA 3QINA 3DLHA 3U3YA 2IGIA 3M8QA 3QIOA 2HHSA 4DTUA 5KTQA 3AVKA 2HMIA 1VSJA 3QLHA 1LW2A 4FJ7A 3DYAA 1TL1A 3OYNA 3LANA 4CJ3A 4CJFA 4CK1A 4ID1A 2AJQA 2I5JA 1JL2A 3RTVA 4KAZA 4RW7A 4FK4A 2YNIA 4FLUA 3NGYA 3G0ZA 4DU1A 1KTQA 5HP1A 1X9WA 1LAWA 2LSNA 3HL8A 4JS4A 1VSDA 1WSGA 2KTQA 4O55A 1IG9A 4KREA 4O44A 3OYLA 4E7IA 5E41A 1CZ9A 3AVMA 2JGUA 1C0MA 3QNOA 1NJYA 1DTQA 3TAEA 2QKKA 3RR7A 4DQPA 1BCMA 3KLIA 4CF8A 4ELUA 2HVHA 1WAFA 4JRQA 3WNEA 4IBNA 5CZ1A 3LP1A 3CM5A 3TAGA 3ZSZA 1C0TA 4ICLA 3KLFA 1W9HA 1T8EA 4W5TA 3QESA 3L2VA 4W5OA 1RDCA 2WOMA 3MEGA 3ZSOA 4JRPA 4FJNA 4EP5A 4KHNA 4J2EA 4PY5A 3KK1A 1NK9A 3AA5X 5SWMA 1WAJA 2OPSA 3AO3A 3NH2A 3RMCA 4CGDA 3MEDA 3ZSXA 3NCIA 5DMRA 3OYCA 4GVMA 4JLHA 4CEEA 3K5LA 3TI0A 4EP4A 2IC3A 4KO0A 5J2QA 2ZE2A 4DSIA 4CGIA 4GMJB 4IFVA 4E89A 1HYZA 1QHTA 1F21A 1S1UA 3HSTB 4CHPA 4B9LA 3TAMA 3ZCMA 3SPZA 5J2MA 3OYJA 4DFPA 1BHLA 1ASUA 4DTPA 2YV0X 4B9VA 3V9XA 4I9QA 1TAUA 1RT3A 3SQ2A 1L3UA 4CEZA 2VWJA 4CJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IDO A;  2OZS A;  3KK2 A;  3NDK A;  4CJK A;  3OYF A;  3VQD A;  2ITG A;  5J1E A;  1TV6 A;  1RTH A;  3MEE A;  4N56 A;  2X6S A;  3QET A;  4DMN A;  3KD5 E;  4DTX A;  3TAN A;  4B3O A;  3NAE A;  4FK0 A;  1TVR A;  1TAQ A;  3AO4 A;  2W42 A;  1LWC A;  4FJI A;  3OYD A;  1IKW A;  4FW2 A;  3OYK A;  1L3S A;  3MEC A;  4ELT A;  1DTT A;  3AV9 A;  1KCF A;  4KB1 A;  2KFN A;  1RBT A;  1UWB A;  2RF2 A;  4FJK A;  2IOC A;  2VWK A;  4C8M A;  4AIL C;  2OPP A;  3P83 D;  4Z4H A;  1BL3 A;  1U49 A;  4I9L A;  1TL3 A;  1X9S A;  4KKO A;  4CFD A;  1IO2 A;  2B4J A;  3NHG A;  4CHN A;  3QEV A;  1ZYQ A;  4M42 A;  4HVJ A;  1I39 A;  4B08 A;  3L2U A;  1TGO A;  3AO5 A;  4FW1 A;  3SI6 A;  2ATQ A;  3MAQ A;  3MXI A;  1WNS A;  2XY7 A;  3SPY A;  4B8C A;  3M8S A;  3ALY A;  3OYB A;  2WON A;  3KTQ A;  3D0P A;  3HPH A;  2ZD1 A;  3LAM A;  4WE1 A;  1N5Y A;  1U48 A;  4KHU A;  3OYE A;  4BWM A;  3L3V A;  4LSN A;  3O3G A;  4NCB A;  1T7P A;  4B9N A;  3CG7 A;  4DS5 A;  3OYG A;  4DF4 A;  1ZBH A;  4DU4 A;  2P1J A;  3PUF A;  3K58 A;  4GW6 A;  1O1W A;  1BGX T;  2Z1H A;  4DTN A;  3C94 A;  4CJE A;  3SUO A;  1NK0 A;  3L8B A;  5T7B A;  3SZ2 A;  1D8Y A;  3V9W A;  3C95 A;  1NOZ A;  1NKE A;  4M3Y A;  1LWF A;  1I3A A;  2F96 A;  1ASV A;  1QSY A;  1QS4 A;  1T03 A;  3QIP A;  2HB5 A;  4DTJ A;  3SNN A;  4KHS A;  4DSL A;  4O0I A;  4BDY A;  4FM1 A;  4CGH A;  3S3M A;  2B6A A;  1HRH A;  3HK2 A;  4OKE A;  1BQN A;  4H8K A;  5CYQ A;  2YNF A;  4DQQ A;  5EU7 A;  3RMA A;  3QEX A;  3SCX A;  1SL2 A;  3VQ7 A;  3VQP A;  2PYL A;  3HPG A;  3DLB A;  1VRU A;  4Q5V A;  1A5V A;  3F9K A;  4CES A;  3AVH A;  4O5B A;  1GOC A;  1KLM A;  1WSH A;  3V9Z A;  1XI1 A;  1IKV A;  1ZBI A;  1S1V A;  3NF6 A;  3I8D A;  2P5O A;  4F3T A;  3PX0 A;  4OJR A;  1RBR A;  3BGR A;  3QER A;  1BQM A;  1RNH A;  2HHV A;  1L5U A;  1SKW A;  2XY5 A;  1VSM A;  3I0R A;  5KI6 A;  1NK4 A;  4G1Q A;  1HMV A;  3OS0 A;  1RT2 A;  4NYF A;  1UA1 A;  3CYM A;  3OY9 A;  1FXX A;  1UA0 A;  1HQE A;  4EZ6 A;  1KFD A;  3HPO A;  1XWL A;  3O4N A;  3KKS A;  2X74 A;  4CF9 A;  3V6D A;  3JYT A;  1JLA A;  2RN2 A;  4ZTF A;  1L3T A;  4LSL A;  3NGI A;  1YTU A;  4CIF A;  3CM6 A;  2Y1J A;  2G8H A;  2XRI A;  4C8O A;  2FBT A;  2XY8 A;  5FRN A;  4CE9 A;  2Y1I A;  5I3U A;  3VQ5 A;  3VQQ A;  4LY7 A;  4FXD A;  4KHY A;  4BE1 A;  1UAX A;  4HUG A;  2G8U A;  1C1A A;  2E6M A;  1QTM A;  2EX3 A;  2GBZ A;  1VSL A;  3QEW A;  2NUB A;  2R7Y A;  3MXM A;  1RDA A;  3VQC A;  4FJJ A;  5HRR A;  3UIQ A;  1GOA A;  4FLT A;  4QAG A;  4DSJ A;  2RPI A;  1JXB A;  1CXQ A;  3LZJ A;  1ZBL A;  3SQ0 A;  4KHQ A;  4CED A;  3SV3 A;  3DLK A;  4B9T A;  5DK5 A;  4ID5 A;  2FBV A;  2QK9 A;  2OPQ A;  2YHA A;  4KTW A;  3K57 A;  3NF7 A;  3DM2 A;  4OKJ A;  1L3V A;  1D9D A;  4ELV A;  4FLY A;  1XHX A;  3O4Q A;  3LWL A;  1ZBU A;  2HW3 A;  1SV5 A;  2JLE A;  3DRR A;  5KRT A;  2VG7 A;  5HBM A;  2G8W A;  3AVI A;  2YHB A;  1ITG A;  4AHR A;  1B9D A;  4B8A B;  4W5Q A;  1QSS A;  4FZY A;  4KB0 A;  1BI4 A;  1SL0 A;  4FJH A;  1JXE A;  3NBP A;  4CHZ A;  1K6Y A;  2FC0 A;  4TSX A;  1S9E A;  4Y1C A;  4CJP A;  4CF2 A;  3K5M A;  3TWH A;  1VSK A;  1U45 A;  4E1N A;  4CGG A;  4RW4 A;  4HTU A;  2QKB A;  2HHU A;  4J2D A;  4OGE A;  1BIU A;  4H4M A;  4KFB A;  3NFA A;  4LD0 A;  3THV A;  2F8T A;  1TK8 A;  3WNF A;  3OYH A;  2BDP A;  4OVL A;  5JS1 A;  1C6V A;  3EYZ A;  4XIU A;  4M3X A;  4DSK A;  4ZTJ A;  1BCO A;  4KV8 A;  4N76 A;  2HND A;  5KRS A;  4OLB A;  4FCY A;  3K59 A;  3PV8 A;  5K14 A;  1D9F A;  4C8K A;  4BE2 A;  1J9A A;  3AA3 A;  3TAF A;  4F4K A;  4CEB A;  4DTO A;  1RT5 A;  1SKS A;  3HO1 A;  1BIS A;  2QXF A;  3FFI A;  4DQI A;  2BE2 A;  3U3G A;  3V9S A;  3SUN A;  3AVL A;  4CHO A;  2VG6 A;  3PX4 A;  1RBV A;  4DU3 A;  3QEI A;  3SUP A;  3DLG A;  3VQE A;  1S6Q A;  2DY4 A;  3OJU A;  2HHW A;  4PA1 A;  3O3H A;  3K5N A;  1CLQ A;  1JLE A;  2D5R A;  3LAL A;  1EXQ A;  1NK6 A;  1TKD A;  4FLV A;  2GUI A;  1WN7 A;  3KJV A;  4CJQ A;  3VQ8 A;  1HYV A;  2YNH A;  2HVI A;  4JS5 A;  3VA0 A;  1Q9Y A;  2G8F A;  1YT3 A;  3TAQ A;  2IS3 A;  3AVF A;  5HRO A;  2DTU A;  3VQA A;  3S3N A;  4M3W A;  3WNH A;  4AH9 A;  3T1A A;  3KLH A;  1BI4 B;  4IG0 A;  4LH5 A;  4FM2 A;  2KW4 A;  3QEP A;  3OYI A;  3T19 A;  2DFH A;  1TKX A;  1VSH A;  3OYA A;  4Z4E A;  4E7J A;  1SL1 A;  3DMJ A;  3PY8 A;  4BAC A;  1TKZ A;  4NCG A;  3CFP A;  1RBS A;  4E7K A;  1C0U A;  3M8P A;  3KKR A;  3T3F A;  4CIG A;  3D45 A;  4BWJ A;  3AVG A;  1JLC A;  2DFE A;  4CJ4 A;  4CFB A;  1XHZ A;  1B9F A;  5CY4 A;  3VA3 A;  1KVA A;  1S1X A;  3L2W A;  3V1O A;  4IFY A;  3MXJ A;  5D3G A;  1UOC A;  5SZT A;  2B5J A;  2Z1J A;  3VQ9 A;  1XC9 A;  3B6P A;  3AA2 A;  4DLE A;  2HNZ A;  2XO7 A;  1KFS A;  3NF8 A;  4W5N A;  3NE6 A;  1TKT A;  2DFF A;  4E3S A;  1NOY A;  2EHG A;  4CJL A;  4M3T A;  1ZBF A;  4CIE A;  4E7L A;  1HJR A;  1J53 A;  3SUQ A;  4Q0B A;  2YKM A;  3ISN C;  3TAP A;  4F8R A;  5J2P A;  1HQU A;  4OPJ A;  4UQG A;  3SQ1 A;  4IKF A;  1JLB A;  3B6O A;  4J2A A;  2P5G A;  1VSE A;  2KZM A;  3LP3 A;  4DWI A;  4Z4F A;  4N47 A;  4C8L A;  1YTA A;  5C25 A;  4F3O A;  4B9U A;  1YVU A;  1C1C A;  3M8R A;  3VN5 A;  2D0A A;  1JKH A;  3LAK A;  4O4G A;  4FJM A;  4Z4I A;  4HHT A;  1S5J A;  1U04 A;  3SYZ A;  1QE1 A;  3PO5 A;  4DFM A;  1D5A A;  4CEO A;  4OKK A;  4ZHR A;  4W5R A;  4BDP A;  3AVA A;  3QNN A;  1LWE A;  2VG5 A;  1RCH A;  3ZSW A;  1NK8 A;  4RW8 A;  1Q9X A;  4YNQ A;  1G15 A;  4FLX A;  3IG1 A;  2PY5 A;  3ZT2 A;  4PQU A;  4CEF A;  2PZS A;  4PUO A;  3HM9 A;  3ZSV A;  2XHB A;  4DSE A;  1J5O A;  2FBY A;  1X1P A;  4FM0 A;  4DTS A;  4I7F A;  1FKO A;  2YNG A;  1NJX A;  1KLN A;  3PO4 A;  2KQ2 A;  2OYQ A;  1KVC A;  3ZSY A;  2E4L A;  3LP0 A;  1A5X A;  3ZSQ A;  4KI4 A;  5J2N A;  4DS4 A;  2O4I A;  4Y1D A;  3V1R A;  1U4B A;  1KVB A;  4QOZ B;  1CZB A;  4LH4 A;  4RW6 A;  3V4I A;  3KK3 A;  1NKC A;  1VSF A;  1Z26 A;  2IAJ A;  5I42 A;  1W0H A;  2X78 A;  3CFR A;  3EZ5 A;  4FYD A;  3RRH A;  5HRP A;  3CFO A;  4FJL A;  2D0C A;  3ZT3 A;  2XY6 A;  4FJX A;  4FVM A;  4KTQ A;  3DRP A;  4DF8 A;  5FDL A;  4FJ5 A;  4J2B A;  4CK2 A;  3ZT4 A;  3HP6 A;  3VQ4 A;  2Q3S A;  1KSP A;  4FZZ A;  1NK5 A;  4I2P A;  4CHQ A;  3RRG A;  3I0S A;  3ITH A;  1WLJ A;  1REV A;  1RDB A;  1Y97 A;  4R5P A;  1JLF A;  1RT4 A;  3ULD A;  4RG8 A;  4DSF A;  3F73 A;  4RW9 A;  4CFC A;  1C1B A;  4FJG A;  3JSM A;  5KGX A;  3ZSR A;  3IS9 A;  4DLG A;  3E01 A;  1HYS A;  1RIL A;  1CXU A;  1RT7 A;  4MQ3 A;  1VK0 A;  2GV9 A;  4AHT A;  2G8I A;  2FBX A;  5HLF A;  3VQ6 A;  5JS2 A;  1S1W A;  4HUE A;  2PYJ A;  5CYM A;  4CFA A;  4CF0 A;  1RT6 A;  3DLE A;  4EZ9 A;  1Q8I A;  4M45 A;  4KTZ A;  5CZ2 A;  4CJ5 A;  4CF1 A;  3HVR A;  1DLO A;  2O4G A;  3H08 A;  4OPK A;  3RWU A;  4FLW A;  4DFK A;  4CER A;  5C42 A;  4YFU A;  3DRS A;  4CJT A;  1WSF A;  1RT1 A;  3L2Q A;  2ETJ A;  3QO9 A;  4FLZ A;  4L8R B;  1JLG A;  1EX4 A;  4NYN A;  3WNG A;  3LDS A;  1WSE A;  3S3O A;  4K8X A;  3AA4 A;  4BE0 A;  1RBU A;  1HPZ A;  3P5J A;  4O0J A;  3CQ8 A;  4F2R A;  4CJS A;  3DLR A;  2BAN A;  5KGW A;  3HXM A;  3LPU A;  1NKB A;  4QCL A;  2BGG A;  2YKN A;  5HRS A;  2A1S A;  1EET A;  1WSI A;  2F8S A;  1EKE A;  1JL1 A;  1IH7 A;  2OPR A;  1FKP A;  3C6T A;  3K5O A;  4E1M A;  4CGJ A;  3SV4 A;  3NH0 A;  4B9M A;  1TK5 A;  4DTR A;  2D0B A;  3L3U A;  2HHT A;  2A1R A;  4H4O A;  4I2Q A;  4AHC A;  4K8Z A;  4DTM A;  1U47 A;  4DQR A;  1LAV A;  3HT3 A;  3V1Q A;  4M3R A;  1A5W A;  4CEA A;  3OVN A;  1EP4 A;  4E0D A;  4M41 A;  4PWD A;  1X9M A;  1J54 A;  3HVT A;  4OLA A;  2HHX A;  1BIZ A;  3AVC A;  4F2S A;  4FK2 A;  3OJS A;  5HRN A;  5C24 A;  3K2P A;  4AHU A;  3V81 A;  1RTI A;  4DG1 A;  3KD1 E;  3OS2 A;  1NJZ A;  3NGZ A;  3RR8 A;  2P51 A;  1ASW A;  1RDD A;  1Z25 A;  3AVB A;  4KPY A;  4KHW A;  3PX6 A;  3LWM A;  1T05 A;  3LP2 A;  2G8K A;  2G8V A;  1TK0 A;  4Z4G A;  3LPT A;  4CJV A;  2Z1G A;  4M3Z A;  4DQS A;  1SUQ A;  2E6L A;  1SKR A;  3KIO A;  4CGF A;  3NH1 A;  3L2R A;  2OA8 A;  3OYM A;  4KI6 A;  1S6P A;  3HP9 A;  4HUF A;  1RTD A;  1B92 A;  1QQC A;  4KRF A;  4CK3 A;  1VSI A;  3DOK A;  4OGC A;  2HHQ A;  1S9G A;  4HCC A;  4Z0U A;  1IKY A;  3LZI A;  3DOL A;  4M3U A;  4CEQ A;  2OZM A;  4FJ8 A;  5FRM A;  4CEC A;  1LV5 A;  4HCB A;  3HJF A;  3O3F A;  2KZZ A;  4AHV A;  1LW0 A;  3C6U A;  4C8N A;  3TR8 A;  3BDP A;  4CJU A;  3AVN A;  3ZT1 A;  3ZT0 A;  3KLE A;  3NF9 A;  1R0A A;  3EY1 A;  1FK9 A;  3VQB A;  3TAR A;  3ASM A;  4AHS A;  1N6Q A;  4FJ9 A;  1S1T A;  4CHY A;  5FRO A;  3AVJ A;  3IRX A;  4MFB A;  4CJR A;  3RMB A;  3SJJ A;  3V9U A;  1MU2 A;  4E7H A;  4E19 A;  2Z1I A;  3S9H A;  1NK7 A;  1NJW A;  4B9S A;  2KFZ A;  4DFJ A;  4CCH A;  3OS1 A;  1HNV A;  2X6N A;  1IKX A;  2RKI A;  1GOB A;  3DI6 A;  3HYF A;  4IG3 A;  4IDK A;  4N5S A;  4BDZ A;  3RMD A;  3IAY A;  4FZX C;  4Z4C A;  1KRP A;  3A2F A;  1RTJ A;  3P1G A;  3KLG A;  3AO2 A;  2ZQB A;  3G10 A;  1WSJ A;  1QSL A;  4N41 A;  3AO1 A;  1JLQ A;  1HNI A;  3U6F A;  3TAB A;  2HNY A;  1VRT A;  3SQ4 A;  4NCA A;  3QIN A;  3DLH A;  3U3Y A;  2IGI A;  3M8Q A;  3QIO A;  2HHS A;  4DTU A;  5KTQ A;  3AVK A;  2HMI A;  1VSJ A;  3QLH A;  1LW2 A;  4FJ7 A;  3DYA A;  1TL1 A;  3OYN A;  3LAN A;  4CJ3 A;  4CJF A;  4CK1 A;  4ID1 A;  2AJQ A;  2I5J A;  1JL2 A;  3RTV A;  4KAZ A;  4RW7 A;  4FK4 A;  2YNI A;  4FLU A;  3NGY A;  3G0Z A;  4DU1 A;  1KTQ A;  5HP1 A;  1X9W A;  1LAW A;  2LSN A;  3HL8 A;  4JS4 A;  1VSD A;  1WSG A;  2KTQ A;  4O55 A;  1IG9 A;  4KRE A;  4O44 A;  3OYL A;  4E7I A;  5E41 A;  1CZ9 A;  3AVM A;  2JGU A;  1C0M A;  3QNO A;  1NJY A;  1DTQ A;  3TAE A;  2QKK A;  3RR7 A;  4DQP A;  1BCM A;  3KLI A;  4CF8 A;  4ELU A;  2HVH A;  1WAF A;  4JRQ A;  3WNE A;  4IBN A;  5CZ1 A;  3LP1 A;  3CM5 A;  3TAG A;  3ZSZ A;  1C0T A;  4ICL A;  3KLF A;  1W9H A;  1T8E A;  4W5T A;  3QES A;  3L2V A;  4W5O A;  1RDC A;  2WOM A;  3MEG A;  3ZSO A;  4JRP A;  4FJN A;  4EP5 A;  4KHN A;  4J2E A;  4PY5 A;  3KK1 A;  1NK9 A;  3AA5 X;  5SWM A;  1WAJ A;  2OPS A;  3AO3 A;  3NH2 A;  3RMC A;  4CGD A;  3MED A;  3ZSX A;  3NCI A;  5DMR A;  3OYC A;  4GVM A;  4JLH A;  4CEE A;  3K5L A;  3TI0 A;  4EP4 A;  2IC3 A;  4KO0 A;  5J2Q A;  2ZE2 A;  4DSI A;  4CGI A;  4GMJ B;  4IFV A;  4E89 A;  1HYZ A;  1QHT A;  1F21 A;  1S1U A;  3HST B;  4CHP A;  4B9L A;  3TAM A;  3ZCM A;  3SPZ A;  5J2M A;  3OYJ A;  4DFP A;  1BHL A;  1ASU A;  4DTP A;  2YV0 X;  4B9V A;  3V9X A;  4I9Q A;  1TAU A;  1RT3 A;  3SQ2 A;  1L3U A;  4CEZ A;  2VWJ A;  4CJW A; 
#chains in the Genus database with same CATH topology
 2OZS A;  2H3G X;  3VQD A;  5J1E A;  3MEE A;  3J81 O;  4DMN A;  4DTX A;  3M6G A;  3NAE A;  1TAQ A;  3AO4 A;  1SAZ A;  1IKW A;  3OYK A;  1Q18 A;  1GLD G;  2KFN A;  1RBT A;  4IJN A;  2OPP A;  4MO4 A;  1U49 A;  4JKD A;  3OTO K;  1TYQ A;  1YJ9 N;  1I39 A;  1VQN N;  5GAG P;  3SI6 A;  3MXI A;  4RTF D;  3DJC A;  1DEJ A;  1N5Y A;  4NCB A;  4PKI A;  1S22 A;  1BU6 O;  4DF4 A;  3K58 A;  2QWN A;  4DTN A;  1NK0 A;  5LY3 A;  1D8Y A;  1LWF A;  3OW2 M;  3MX5 A;  2F96 A;  1ASV A;  4DR6 K;  1KQS M;  5AQX A;  4LF4 K;  2A6A A;  1T03 A;  2IIR A;  1M1K O;  3SNN A;  4O0I A;  3PIO L;  4DR3 K;  4FM1 A;  4CZK A;  4DQQ A;  2Q31 A;  5CYQ A;  2PYL A;  3HPG A;  3DLB A;  4CES A;  2IVO A;  4O5B A;  1ESV A;  4M7X A;  1XI1 A;  5IWA K;  4JV5 K;  3MCA B;  1RT2 A;  3OS0 A;  3OY9 A;  2P9L A;  3O9Q A;  3N4P A;  1KFD A;  2X74 A;  4CF9 A;  1JJ2 M;  4EIA A;  1RDU A;  4LSL A;  3NGI A;  3CPW M;  1YTU A;  3CM6 A;  2Y1J A;  2XRI A;  3OA9 A;  3OBY A;  2Y1I A;  3VQQ A;  3NVM A;  4HUG A;  1QTM A;  1VSL A;  2NUB A;  5CR4 A;  3MXM A;  3VQC A;  1GOA A;  1MDU B;  4FLT A;  4ILJ A;  4O5F A;  1ZBL A;  1CXQ A;  3LZJ A;  4F9O A;  4KTW A;  3NF7 A;  4PL7 A;  4ELV A;  4FLY A;  5KPT A;  2E5L K;  2HW3 A;  2O8F B;  1SV5 A;  3FE1 A;  1YIT N;  2G8W A;  4B8A B;  3A0I X;  2ZJP L;  3F5T A;  3NVK A;  3NBP A;  4CHZ A;  1K6Y A;  4Y1C A;  4YOU A;  5AFU A;  4CF2 A;  1U45 A;  4XH5 A;  1BIU A;  1EWR A;  4CZM A;  1C6V A;  4M3X A;  4XEI A;  5FPE A;  4N76 A;  3PSF A;  3IFR A;  3CJ7 A;  3K59 A;  5K14 A;  4BE2 A;  3AA3 A;  5ADX A;  4F4K A;  4CEB A;  3HO1 A;  3FFI A;  1X9J A;  2BE2 A;  3O1W A;  2VGN A;  4PKG A;  2VG6 A;  3ID8 A;  2BH1 A;  1RBV A;  5DM6 L;  1VQL N;  3SUP A;  1S72 N;  3DLG A;  4XH1 A;  3MCP A;  3VQE A;  1S6Q A;  2HHW A;  5M1F A;  5FLX O;  3KVG A;  2E20 A;  1NK6 A;  1TKD A;  3KJV A;  1U6Z A;  4YDU A;  1HYV A;  1IBL K;  4JS5 A;  1Q9Y A;  3AVF A;  5M1N A;  5FPM A;  4CW7 B;  4JN4 A;  1BI4 B;  4LH5 A;  1Y64 A;  4CBU A;  3QEP A;  4Z4E A;  5KPR A;  4NCG A;  3CFP A;  1C0U A;  3T3F A;  4BWJ A;  5AQN A;  1NNE A;  5JVG L;  4O8K A;  1S1X A;  5D3G A;  3LL3 A;  2B5J A;  2Z1J A;  1XC9 A;  3AA2 A;  2HNZ A;  3J7Y P;  3NF8 A;  1KFS A;  4W5N A;  3NE6 A;  1TKT A;  1XC3 A;  2HF4 A;  4CJL A;  1ZBF A;  4E7L A;  1HJR A;  3SUQ A;  1NGJ A;  2E1Z A;  2YKM A;  2HMP A;  3C6H A;  4K43 A;  5J2P A;  1HQU A;  3B6O A;  3DAW A;  2Q1N A;  3FFK B;  4C8L A;  1YTA A;  1GLC G;  4B9U A;  1LOT B;  1C1C A;  4HHT A;  1S5J A;  4GKK K;  3QIC A;  4ZHR A;  3QNN A;  1LWE A;  1Q9X A;  3MWP A;  1DT9 A;  1G15 A;  3G25 A;  2V7Z A;  4KH4 A;  1M90 O;  3HM9 A;  4DSE A;  1J5O A;  1YAG A;  2FBY A;  4LF6 K;  2KKZ A;  3EN9 A;  4IDH A;  4I7F A;  4FM0 A;  2YNG A;  1KLN A;  4FWP A;  3CD6 N;  4BRC A;  3LP0 A;  4K42 A;  4KI4 A;  5J2N A;  4Y1D A;  3V1R A;  1U4B A;  3SMS A;  3VEN A;  3KK3 A;  3WQT A;  5I42 A;  5LJV A;  2VGM A;  4FYD A;  4FJL A;  3ZT3 A;  5BRH A;  4FJ5 A;  1YHQ N;  1VQ6 N;  1NK5 A;  4I2P A;  3D2E B;  1O13 A;  3RRG A;  2ZF5 O;  1WLJ A;  1REV A;  4R5P A;  4RG8 A;  2UXB K;  3PIP L;  3F2K A;  1C1B A;  3JSM A;  4DLG A;  3ZSR A;  4BRG A;  1RT7 A;  3IDH A;  4AHT A;  2P9L B;  1T44 A;  3VQ6 A;  2W6K A;  4CFA A;  2NRX A;  1RT6 A;  5AZI B;  4CF1 A;  5LJW A;  1GLL O;  4CJT A;  1WSF A;  3WNG A;  4K8X A;  5KQ8 A;  5TKW A;  4WFN L;  4CZH A;  3P5J A;  1XMO K;  4F2R A;  3DLR A;  1MWK A;  2YKN A;  5HRS A;  1WSI A;  1JL1 A;  2OPR A;  3CIP A;  3WQU A;  4LFB K;  2HHT A;  2A1R A;  4BR0 A;  4DTM A;  1V4S A;  1J6Z A;  3SBG A;  4H5T A;  4M41 A;  4PWD A;  3AVC A;  4FK2 A;  2D4W A;  3OJS A;  5HRN A;  5C24 A;  4DG1 A;  3J8A A;  5GAE P;  1T6C A;  3RR8 A;  2P51 A;  2JWL A;  4BR7 A;  1T05 A;  3VEO A;  3LPT A;  1QQN A;  1QHA A;  2A40 A;  2E6L A;  3R3L A;  3E9P A;  4FOE A;  4DR4 K;  1QQC A;  3ZEU A;  3U4L A;  1VSI A;  4OGC A;  3SAG A;  2QI2 A;  4BRH A;  3HJF A;  3CCU N;  3O3F A;  3C6U A;  3AVN A;  2ZWH A;  4EAH D;  3ZT1 A;  4DQ8 A;  3NF9 A;  4DR2 K;  3HBT A;  2UXD K;  3CCR N;  1ZBS A;  4DR1 K;  3ASM A;  4YOT A;  3AVJ A;  4CJR A;  2WC9 A;  3SJJ A;  2KFZ A;  3KWG A;  2X6N A;  1IKX A;  4N5S A;  4EFH A;  3RMD A;  1T3V A;  4Z4C A;  1KRP A;  1RTJ A;  4WCE L;  3KLG A;  5BRE A;  2ZQB A;  2QTD A;  5GAD P;  4N41 A;  3T1H K;  3AO1 A;  1HNI A;  2D1K A;  3HOS A;  3DLH A;  3FZK A;  5KTQ A;  2HMI A;  3DYA A;  4CK1 A;  4ID1 A;  3H1V X;  2I5J A;  3RTV A;  2OAN A;  3G0Z A;  1KTQ A;  5HP1 A;  2LSN A;  1VSD A;  4BRN A;  1Q7Y O;  5IT9 O;  4CZL A;  4DB3 A;  4WF9 L;  1NJY A;  3TAE A;  4XH4 A;  4X64 K;  1WAF A;  4JRQ A;  4OO1 J;  4IBN A;  5CZ1 A;  5JMV A;  3CM5 A;  3ZSZ A;  3RVC A;  4ICL A;  1W9H A;  1KXP A;  2BUP A;  3CJB A;  4JRP A;  5BR9 A;  5HOO A;  4LFA K;  3CQX A;  1Q86 O;  5B8H A;  3NH2 A;  2OPS A;  3RMC A;  4CGD A;  1LCU A;  3MED A;  3VEX A;  1MWM A;  3THY A;  3O8M A;  3TI0 A;  4E89 A;  4U67 L;  4Y0W A;  2VWB A;  4BRL A;  5M1K A;  5J2M A;  2FSN A;  3WXL A;  4DKW A;  3Q7B A;  4YOX A;  4DTP A;  1BG3 A;  4B9V A;  3V9X A;  3EE8 A;  1TAU A;  3GBT A;  3CMA N;  2VWJ A;  1K8A O;  1TV6 A;  2FSK A;  4FK0 A;  1LWC A;  5AR0 A;  3OYD A;  4FW2 A;  1DGK N;  3CCS N;  3K0S A;  3THW A;  1DTT A;  2I7N A;  4MLE A;  3AV9 A;  4BRK A;  4FJK A;  2IOC A;  2VWK A;  4AIL C;  3P83 D;  1BL3 A;  5F2R A;  1TL3 A;  4KKO A;  4M42 A;  2D0P A;  3RSE A;  1HUX A;  3ZET A;  5F1X A;  2ATQ A;  3CET A;  3SPY A;  3ALY A;  3C65 A;  2WON A;  5GIN A;  1NMN A;  2ZD1 A;  2YHW A;  5AQL A;  4WE1 A;  4KHU A;  1R59 O;  3OYE A;  1VQO N;  2O8D A;  3W0L A;  5GIP A;  4DS5 A;  1ZBH A;  4BRP A;  3PUF A;  3WXM B;  3CHW A;  4K25 A;  1O1W A;  1BGX T;  2Z1H A;  3ATV A;  3SUO A;  3V9W A;  3C95 A;  4M3Y A;  1I3A A;  3QIP A;  4KHS A;  4CVN E;  4BDY A;  4CGH A;  4BR9 A;  1QVG M;  5CE3 A;  2B6A A;  3HK2 A;  1BQN A;  4LF5 K;  1KC8 O;  5EU7 A;  4IZ9 A;  3K9J A;  3VQP A;  1VRU A;  4Q5V A;  3GOI A;  3F9K A;  3MN6 A;  3AVH A;  3CCE N;  3BUZ B;  1WSH A;  1GOC A;  1KLM A;  3V9Z A;  4H0X B;  1S1V A;  2O8B A;  4KHP K;  2KHO A;  1RNH A;  1L5U A;  1SKW A;  3O6W A;  1P8Z A;  2NLX A;  1NK4 A;  4NLB A;  1NGH A;  3ZX0 A;  1QZ5 A;  3THX B;  4H5V A;  3HSC A;  1RGI A;  3BZK A;  5ADX H;  4EZ6 A;  4A5B A;  4B9Q A;  3HPO A;  1NKC A;  1L3T A;  1WUA A;  4JI4 K;  4YDU C;  4LY7 A;  2NZT A;  1NM1 A;  4BRQ A;  2EX3 A;  5JLF A;  1N32 K;  4A62 A;  2R7Y A;  3TTC A;  4FJJ A;  5I9E B;  5HRR A;  1RFQ A;  3UIQ A;  3ZYY X;  3VEV A;  4QAG A;  2PBD A;  2RPI A;  1JXB A;  3DXM B;  5DK5 A;  2OPQ A;  3DM2 A;  1IBK K;  1XHX A;  3LWL A;  1ZBU A;  5KRT A;  2VG7 A;  2YHB A;  1ITG A;  1QSS A;  1B9D A;  4KB0 A;  3SLC A;  1SL0 A;  4FJH A;  3DXK B;  2FC0 A;  3TWH A;  5M1P A;  2G8U A;  4DR7 K;  1VSK A;  4HTU A;  4JI7 K;  3THV A;  4KFB A;  3NFA A;  3WNF A;  2O8C A;  4OVL A;  3AAP A;  3LDN A;  4ZTJ A;  5KRS A;  3VTH A;  3PV8 A;  4C8K A;  1J9A A;  4GV6 A;  1RT5 A;  3V9S A;  4G9Z A;  2E88 A;  3SUN A;  5AQW A;  1JCE A;  2DY4 A;  3OJU A;  2E8A A;  1CLQ A;  2NRH A;  3LAL A;  4ISF A;  1EXQ A;  3VER A;  2GUI A;  4CJQ A;  3VQ8 A;  4BVP A;  2HST A;  4V19 S;  2NRR A;  2G8F A;  3TAQ A;  1HJO A;  2IS3 A;  5HRO A;  3VQA A;  3S3N A;  4M3W A;  5AQT A;  3KLH A;  3SK3 A;  3OYI A;  3H3N O;  3OYA A;  1TKZ A;  3VEW A;  4E7K A;  3VF4 A;  1NGE A;  1B9F A;  3VA3 A;  2UUB K;  3MXJ A;  4CBX A;  1XQS C;  4DLE A;  2Q36 A;  5BRF A;  2DFF A;  1NOY A;  5AQF A;  1J53 A;  1TUU A;  2NRV A;  2QA4 N;  3TAP A;  1NGB A;  3SQ1 A;  1JLB A;  4FWO A;  2KZM A;  3I8B A;  1VQK N;  3FGU A;  5TKY A;  1YVU A;  3M8R A;  3VN5 A;  2D0A A;  1JKH A;  4FWL A;  4FWQ A;  1U04 A;  3SYZ A;  1QE1 A;  5AQM A;  3PO5 A;  2D0O A;  3CER A;  4GV3 A;  3ZSW A;  4BRA A;  1E3M A;  3IG1 A;  3A5O C;  3CME N;  3ENH A;  4CEF A;  1ATS A;  2HBJ A;  1FW6 A;  3ZSV A;  2XHB A;  4U7B A;  4GY2 B;  1NGI A;  4DTS A;  3H6E A;  1NJX A;  1FKO A;  2AA4 A;  5AFU H;  1KVC A;  3ZSY A;  2E4L A;  1A5X A;  5BRD A;  4AM7 A;  2O4I A;  4QOZ B;  1CZB A;  4LH4 A;  4RW6 A;  3BF3 A;  4B1Z A;  2X78 A;  3CFO A;  3C7N B;  1QQO A;  4PHT X;  4KTQ A;  4DF8 A;  5FDL A;  4KBO A;  4J2B A;  3ZT4 A;  4JI3 K;  2Q3S A;  5AQP A;  3I0S A;  1OVY A;  5LL6 Z;  3CF5 L;  3F73 A;  4CFC A;  4FJG A;  5KGX A;  5JVH L;  4EHU A;  3E01 A;  1HYS A;  4WYB A;  1CXU A;  4MQ3 A;  1VK0 A;  2GV9 A;  3THX A;  1GLB G;  5HLF A;  5JS2 A;  2PYJ A;  3DWL A;  4UY8 O;  1Q8I A;  4DR5 K;  4CJ5 A;  5AQY A;  3HVR A;  1DLO A;  3H08 A;  4BGB A;  4YFU A;  2YX6 A;  3QBX A;  4WQ5 C;  3L2Q A;  1RT1 A;  4H0P A;  3AA4 A;  3T7Z A;  1HPZ A;  4FSV A;  1I94 K;  2BAN A;  5KGW A;  3HXM A;  3LPU A;  3L4Q A;  4K41 A;  2BGG A;  1EET A;  1IH7 A;  1K9M O;  4LF8 K;  1FKP A;  3K5O A;  4E1M A;  3NH0 A;  4B9M A;  1OH8 A;  1HNW K;  4DTR A;  1EWQ A;  1T6D A;  4I2Q A;  5BR8 K;  1U47 A;  1LAV A;  1ZXO A;  1A5W A;  4DV5 K;  3J7Z O;  1V4T A;  3NMU A;  3HVT A;  3O9R A;  2HHX A;  4F2S A;  5AQV A;  3VGL A;  3MWT A;  4M7Y A;  3VPZ A;  3LDQ A;  4FWM A;  1ASW A;  3AVB A;  3PX6 A;  3BF1 A;  4Z4G A;  3F9M A;  4LF9 K;  4JI5 K;  1QVF M;  1YIJ N;  2Z1G A;  1SUQ A;  3VMF B;  2P9P A;  5AJ3 K;  3AGK A;  5C2F A;  4OX9 K;  2PAV A;  4CGF A;  1K8K B;  5BPL A;  3L2R A;  2OA8 A;  2HHH K;  3OYM A;  1NWK A;  2IVP A;  1B92 A;  4CK3 A;  3JXU A;  4C1N K;  3DOK A;  5C0Y A;  2HHQ A;  1IKY A;  3LZI A;  3HZ6 A;  2UYT A;  4YHH K;  3IMX A;  4JNE A;  4CEQ A;  4ILG B;  4ILH A;  4BR2 A;  3DXK A;  4FJ8 A;  2KZZ A;  3TR8 A;  5C10 A;  4CD3 A;  4JKH A;  3ZET B;  1HNZ K;  3VQB A;  3D2F B;  4CHY A;  4MFB A;  4QS9 A;  3RMB A;  3V9U A;  1NK7 A;  4B9S A;  4IXC A;  4DFJ A;  4IG3 A;  1GOB A;  1IV0 A;  2DPN A;  4FZX C;  2O8F A;  5AZJ A;  3OBW A;  1WSJ A;  1QSL A;  2FXU A;  3U9D A;  1VRT A;  3U3Y A;  2IGI A;  2HHS A;  1VSJ A;  4X62 K;  4BY9 C;  4YOY A;  1DKG D;  3OYN A;  1VQ5 N;  4CJ3 A;  3CQY A;  3PSI A;  1OH6 A;  1JL2 A;  3UKU A;  2YNI A;  3NGY A;  5CHI A;  2BTF A;  4JS4 A;  3HL8 A;  5BN8 A;  3Q7C A;  1WSG A;  2KTQ A;  1IG9 A;  4KRE A;  4H5N A;  4O44 A;  5C2D A;  1C0M A;  4BG8 A;  2QKK A;  3RR7 A;  1BCM A;  3KLI A;  4CF8 A;  2HVH A;  3GL1 A;  1WB9 A;  2W41 A;  3VET A;  3G71 N;  3TAG A;  1EQY A;  3ULE B;  1G99 A;  5A2Q O;  4JI6 K;  3TTF A;  1RDC A;  3LDP A;  3ZSO A;  4FJN A;  4R79 A;  2Q97 A;  2W6L A;  3BP8 A;  1WAJ A;  3AO3 A;  3NCI A;  4CEE A;  5J2Q A;  2AP1 A;  4GMJ B;  2YJF A;  1HYZ A;  4DHY A;  5JLH A;  1QHT A;  1F21 A;  3O9T A;  3OYJ A;  1N8R O;  2YV0 X;  4K0K K;  4I9Q A;  3SQ2 A;  3SAF A;  4FWS A;  4FWN A;  4CJK A;  3OYF A;  3QET A;  4N56 A;  3KD5 E;  2X6S A;  4FJI A;  2W42 A;  1L3S A;  3MEC A;  1WBD A;  3VGK A;  1HKC A;  2HOE A;  4B3S K;  4B3R K;  4KB1 A;  2RF2 A;  4C8M A;  3AAQ A;  3C7N A;  1X9S A;  4CFD A;  1IO2 A;  3NHG A;  4CHN A;  3ID6 A;  1K73 O;  3AAR A;  3AY9 A;  4B08 A;  3L2U A;  5E84 A;  3MAQ A;  3QB0 A;  2CH6 A;  4B8C A;  3EZW A;  3VTI A;  3KZB A;  4B1V A;  3DLL L;  3KTQ A;  3D0P A;  3HPH A;  4IO8 A;  3LAM A;  1Q82 O;  1NGF A;  4JHD A;  4BWM A;  4LSN A;  1T7P A;  3VF6 A;  1W7A A;  4B9N A;  3CG7 A;  5BPN A;  2P1J A;  4DU4 A;  4GW6 A;  4CJ7 A;  2Q0U A;  2Q2R A;  3C94 A;  1NGC A;  4MDB A;  3L8B A;  5T7B A;  3O08 A;  4IFE A;  3E66 A;  4GNI A;  1HRH A;  1H1V A;  3R9P A;  3OHR A;  4H8K A;  2YNF A;  3RMA A;  3SCX A;  4E1J A;  3VQ7 A;  1SL2 A;  3UKR A;  3EL2 A;  3T1Y K;  4FVU A;  4B3T K;  5AQH A;  1ZBI A;  4F3T A;  4IOC L;  1RBR A;  3QER A;  1VQ4 N;  1BQM A;  2P9S B;  2XY5 A;  3I0R A;  3CJA A;  2YJE A;  2KLA A;  3G6E N;  4G1Q A;  1VAZ A;  2FSJ A;  3O9S A;  1HMV A;  4JK7 A;  3SAH A;  5AQU A;  1UA0 A;  1HQE A;  2WFB A;  3TSQ A;  2QWL A;  3KKS A;  3O9U A;  3CC4 N;  1NGD A;  3JYT A;  1JLA A;  2RN2 A;  4ZTF A;  3W3D A;  4C8O A;  2G8H A;  4GV9 A;  5FRN A;  2FBT A;  5I3U A;  2NNW A;  3VQ5 A;  1BO5 O;  4FXD A;  4KHY A;  4BE1 A;  2CGJ A;  3T69 A;  3FZL A;  1OVQ A;  4RWT A;  3QEW A;  1K8K A;  1J5E K;  1RDA A;  3G4S N;  1W2B M;  1BA1 A;  4DSJ A;  5EOY A;  4JI2 K;  3SQ0 A;  4KHQ A;  4B1X B;  3SV3 A;  1OKJ A;  2FBV A;  3H45 C;  3K57 A;  1D9D A;  1L3V A;  4OKJ A;  2E2Q A;  1Z05 A;  3O4Q A;  1VQ9 N;  3EKS A;  2JLE A;  2BDP A;  3H3O B;  2Q0R A;  4WFA L;  4W5Q A;  3E1Y A;  1BI4 A;  3P38 A;  3CCM N;  3K5M A;  2V7Y A;  1S9E A;  2O8D B;  2QKB A;  4E1N A;  4CGG A;  4RW4 A;  2HHU A;  4OGE A;  5AQG A;  4LD0 A;  2ZJQ L;  1TK8 A;  4NXM K;  5EX5 A;  4BRE A;  3EYZ A;  4JI0 K;  5AQZ A;  4XIU A;  1HR0 K;  1BDG A;  4AF1 A;  4OLB A;  4FL9 A;  4FCY A;  1NGG A;  2HBL A;  4A61 A;  1D9F A;  4DV2 K;  5AZJ B;  3TAF A;  3L4I A;  1BIS A;  4WQ5 A;  3WXJ A;  4BGA A;  3E9L A;  1U2V B;  3PX4 A;  3AGR A;  5LMU K;  4DU3 A;  2P9N A;  3QEI A;  5EY4 A;  4PA1 A;  2NRZ A;  4YOV A;  3K5N A;  4RCH A;  2D5R A;  1YVN A;  1JCF A;  4WQ4 A;  2UUC K;  1WN7 A;  3WEE A;  4CZI A;  2UXC K;  1YT3 A;  5EXW A;  4JK8 A;  2KW4 A;  4FM2 A;  3T19 A;  2DFH A;  1TKX A;  1VSH A;  3EE9 A;  1WBB A;  4E7J A;  1SL1 A;  3DMJ A;  5C12 A;  4BAC A;  1RBS A;  3KKR A;  3D45 A;  2DFE A;  3A5L C;  4CJ4 A;  3I33 A;  1XHZ A;  5CY4 A;  3L2W A;  3V1O A;  4IFY A;  4JI1 K;  5GIO A;  5SZT A;  3CPE A;  5M1Q A;  1XNR K;  2EHG A;  4M3T A;  4CIE A;  3JS6 A;  3ISN C;  1MA9 B;  4OPH A;  4F8R A;  4OPJ A;  4UQG A;  4IKF A;  4MO5 A;  4J2A A;  4Z4F A;  1N33 K;  1CZA N;  1XNQ K;  5AQI A;  5M1O A;  2A5X A;  4FWR A;  4O4G A;  4Z4I A;  4DFM A;  4CEO A;  4W5R A;  4BDP A;  3B8A X;  2J4R A;  2PY5 A;  4YNQ A;  4FLX A;  3ZT2 A;  2PZS A;  4PUO A;  4YOR A;  2P9I A;  3BY5 A;  1N34 K;  3FZF A;  3CJC A;  2F9T A;  2KQ2 A;  2OYQ A;  2QM1 A;  3LM9 A;  4DS4 A;  2P9K B;  2GEM A;  2GX9 A;  3V4I A;  2HF3 A;  2IAJ A;  1W0H A;  3LM2 A;  5BN9 A;  3CFR A;  2I7P A;  4JKE A;  3RRH A;  5HRP A;  3VEY A;  4NB4 A;  2XY6 A;  4FVM A;  3DRP A;  2UUA K;  4CK2 A;  3HP6 A;  4FZZ A;  1W97 L;  3VQ4 A;  4M63 C;  4CHQ A;  2FF6 A;  1RDB A;  1RT4 A;  3ULD A;  3WUH A;  3IS9 A;  3THY B;  3UKU B;  2QWM A;  3UE5 A;  3I55 N;  4EZ9 A;  4M45 A;  4KTZ A;  5CZ2 A;  2O4G A;  3E9O A;  3RSE B;  3RWU A;  4JI8 K;  4FLW A;  4JD2 A;  4CER A;  4DFK A;  3CC2 N;  4CZJ A;  5C42 A;  4QS7 A;  4H0T B;  5ELZ A;  4WFB L;  2ETJ A;  2YCH A;  4FLZ A;  1JLG A;  4NYN A;  1VQ7 N;  3S3O A;  1WSE A;  3ZEU B;  1E4G T;  3P4I A;  1RBU A;  3CCJ N;  4BE0 A;  3CQ8 A;  3R1X A;  2RE2 A;  1NKB A;  4BRD A;  2A1S A;  3QDK A;  1EKE A;  4PKH A;  3LDL A;  2YHX A;  3C6T A;  3P39 A;  3SV4 A;  1XUP O;  4H03 B;  1TK5 A;  2D0B A;  3L3U A;  5AQQ A;  3M1F A;  1VHX A;  1NMD A;  4JKG B;  1FJG K;  3HT3 A;  1C0F A;  4B3M K;  2YI1 A;  4CZE A;  4CEA A;  3OVN A;  1EP4 A;  4OLA A;  4IJA A;  3V81 A;  3K2P A;  2F9W A;  3HTV A;  3FLC O;  4H5R A;  1HKG A;  3NGZ A;  1Z25 A;  1RDW X;  3EEQ A;  4KHW A;  3LP2 A;  4IEI A;  3ZX3 A;  1WOQ A;  5AQS A;  4B1U B;  4M3Z A;  4DQS A;  2PFU A;  1SKR A;  1TUY A;  2ASO A;  3C6A A;  3KIO A;  2E2P A;  2VCP A;  4KRF A;  3HP9 A;  4I6M B;  2OTL N;  1GLF O;  2ZGY A;  4HCC A;  4Z0U A;  3HOT A;  4A5A A;  4HCB A;  1LW0 A;  3BDP A;  2HBM A;  2GEL A;  1QQM A;  1R0A A;  1YI2 N;  3MN9 A;  4NLC A;  4FJ9 A;  1N6Q A;  1IG8 A;  1S1T A;  5FRO A;  3IRX A;  2EWS A;  1MU2 A;  3S9H A;  4NO7 A;  4CCH A;  3GG4 A;  1HNV A;  3DI6 A;  2RKI A;  2P9S A;  4BDZ A;  2CGL A;  1NJI O;  3IAY A;  1GLJ O;  3K9K A;  3A2F A;  3P1G A;  1GLE G;  3G10 A;  1JLQ A;  2P9U A;  3TAB A;  3SQ4 A;  4NCA A;  3QIN A;  3QIO A;  3AVK A;  3QLH A;  3CCQ N;  1LW2 A;  4BQL A;  4FJ7 A;  3LAN A;  1ILY A;  4KAZ A;  4BRI A;  2V52 B;  4MDA A;  4DU1 A;  1X9W A;  1LAW A;  1NU0 A;  3FZM A;  2GUP A;  4E7I A;  5E41 A;  1CZ9 A;  3AVM A;  2W40 A;  3MX2 A;  4HTL A;  3QFU A;  3QNO A;  1VQP N;  1DTQ A;  1X3M A;  4ELU A;  4AQY K;  1C0T A;  3D2E A;  4LC9 B;  3LDO A;  3MN5 A;  1T8E A;  4W5T A;  4W5O A;  3VES A;  2A42 A;  1HLU A;  4EP5 A;  4J2E A;  3ZLJ A;  3AA5 X;  5SWM A;  4BC5 A;  5DMR A;  3OYC A;  4GVM A;  2IC3 A;  2ZE2 A;  1SZ2 A;  4CGI A;  4IFV A;  1YJN N;  2V51 B;  2A3Z A;  3EKU A;  2ASM A;  4B9L A;  3TAM A;  3SPZ A;  3M3Z A;  4DFP A;  3CJ9 A;  1BHL A;  1ASU A;  2VYP A;  1RT3 A;  3GDQ A;  1P90 A;  1BA0 A;  1L3U A;  4JAX A;  1BUP A;  2IDO A;  3KK2 A;  3NDK A;  3S3M A;  2ITG A;  1RTH A;  2NRW A;  1U2V A;  4BRM A;  3TAN A;  4A2B A;  4B3O A;  1TVR A;  5BPM A;  5MLC Q;  4ELT A;  3N4Q A;  1KCF A;  2O8E B;  3QBW A;  1UWB A;  3TSP A;  4Z4H A;  3SBT A;  4DV7 K;  4I9L A;  3VGM A;  2B4J A;  4JK9 A;  3QEV A;  1ZYQ A;  4HVJ A;  2CH5 A;  1TGO A;  3AO5 A;  4FW1 A;  1WNS A;  2XY7 A;  3M8S A;  4BRF A;  3OYB A;  4JKB A;  4FPB A;  5GAH P;  1U48 A;  2QWR A;  3L3V A;  4BC3 A;  3O3G A;  1ZC6 A;  3OYG A;  2FF3 B;  3WXK A;  4CJE A;  3SZ2 A;  4GKJ K;  1NOZ A;  5C15 A;  1NKE A;  4JKA A;  1QSY A;  1QS4 A;  4JKC A;  3A5M C;  4DTJ A;  2HB5 A;  4DSL A;  1ATN A;  4OKE A;  3D6R A;  4DV1 K;  3QEX A;  3R8E A;  1A5V A;  4QS8 A;  3O1B A;  3ENB A;  1BWF O;  2QWQ A;  1IKV A;  3I8D A;  3NF6 A;  3UB5 A;  2P5O A;  3PX0 A;  4OJR A;  3P31 A;  3BGR A;  2HHV A;  1VSM A;  4JEP A;  5KI6 A;  4DV3 K;  5KPZ A;  4NYF A;  1UA1 A;  3CYM A;  1FXX A;  4CD1 A;  3VOV A;  4OPA A;  1XWL A;  3O4N A;  3V6D A;  4CIF A;  2XY8 A;  4CE9 A;  3IUC A;  1UAX A;  3WT0 A;  3QML A;  1C1A A;  2E6M A;  1Z6R A;  3O5B A;  4HWI A;  2GBZ A;  3L6Q A;  2WBN A;  4I6M A;  4JKF A;  5LMN K;  3TSU A;  4DUY K;  4CED A;  3DLK A;  4B9T A;  4ID5 A;  2QK9 A;  2YHA A;  3D7E O;  4AM6 A;  3DRR A;  1OH5 A;  2P9K A;  5HBM A;  3AVI A;  4FZY A;  4AHR A;  2ITM A;  1JXE A;  3SJH A;  4TSX A;  4CJP A;  2FLO A;  5E26 A;  4J2D A;  2F8T A;  4H4M A;  3OYH A;  5JS1 A;  2RHK A;  3MDQ A;  1SQK A;  4DSK A;  1BCO A;  4KV8 A;  1TYQ B;  2HND A;  4C23 A;  3BEX A;  3S41 A;  3KWI A;  1SKS A;  4DTO A;  2QXF A;  4YOW A;  4O8U A;  4DQI A;  1NLV A;  3U3G A;  3UKR B;  3AVL A;  4CHO A;  1YUW A;  3U9Z A;  5DM7 L;  3FZH A;  3DXM A;  3O3H A;  1JLE A;  4FLV A;  1Q81 O;  2NRT A;  4CZG A;  2YNH A;  3D2F A;  2HVI A;  3A5N C;  3VA0 A;  2DTU A;  2A41 A;  3WNH A;  4AH9 A;  3T1A A;  4IG0 A;  3THW B;  3PY8 A;  3ENO A;  4A59 A;  3M8P A;  4CIG A;  3AVG A;  3HM8 A;  1JLC A;  3CXC M;  1HX1 A;  5HL7 L;  4CFB A;  3KK7 A;  1KVA A;  5AZI A;  2F4V K;  4JKG A;  1UOC A;  4C1N I;  2QXL A;  1EO1 A;  3VQ9 A;  3B6P A;  4GVE A;  5JIC A;  2XO7 A;  3CI5 A;  4DV6 K;  4E3S A;  4Q0B A;  4L3Q A;  2QW9 A;  3O4W A;  5AQK A;  4KH6 A;  2OTJ N;  5KQD A;  3CCV N;  2P5G A;  1VSE A;  4IWV A;  3LP3 A;  4DWI A;  3CCL N;  4N47 A;  4ISE A;  2WTU A;  1KAX A;  1S3X A;  5C25 A;  4F3O A;  1NGA A;  3BZC A;  3IKM A;  4A2A A;  1NG9 A;  4FJM A;  3LAK A;  2JWK A;  1D5A A;  5AQJ A;  4OKK A;  4Z94 A;  4YY3 K;  3AVA A;  2VG5 A;  1RCH A;  4BVO A;  3ZX2 A;  4RW8 A;  1NK8 A;  4PQU A;  5F0X A;  1HKB A;  5EVZ A;  1X1P A;  2IVN A;  3TPQ A;  3PO4 A;  3ZSQ A;  1ATR A;  1KVB A;  1IJJ A;  1VSF A;  1Z26 A;  4B1Y B;  4LF7 K;  2HBK A;  3EZ5 A;  4H0Y B;  4IOA L;  2E2N A;  1XMQ K;  2D0C A;  3R6M A;  3L0Q A;  4FJX A;  4NXN K;  1KSP A;  2ZJR L;  3O80 A;  4BC4 A;  5AQO A;  3ITH A;  1Y97 A;  1JLF A;  4DSF A;  2P9U B;  4RW9 A;  3J7A P;  1JCG A;  4CZF A;  1RIL A;  2G8I A;  1KAZ A;  4FOI A;  2FBX A;  4BC2 A;  3CJ1 A;  1S1W A;  3JAM O;  4HUE A;  5CYM A;  3C0B A;  4CF0 A;  4BR4 A;  3DLE A;  4WQ4 C;  4IEE A;  5FPN A;  4OPK A;  2P9P B;  3GE1 A;  4CI6 A;  1E4F T;  3DRS A;  1GLA G;  4L8R B;  3QO9 A;  3HI0 A;  4FWK A;  1EX4 A;  4PL8 A;  3LDS A;  2YHY A;  2VQE K;  4JHD B;  4IOX A;  4O0J A;  4CJS A;  3VF2 A;  4QCL A;  1HPM A;  2F8S A;  4IO9 L;  2UU9 K;  4CGJ A;  4H4O A;  4AHC A;  2E1Y A;  4K8Z A;  4DQR A;  3V1Q A;  4M3R A;  3PLA A;  4ISG A;  1SS6 A;  3H46 O;  4E0D A;  3EO3 A;  3MN7 A;  1X9M A;  1J54 A;  1BIZ A;  1KAY A;  1VQ8 N;  4AHU A;  1RTI A;  3KD1 E;  2P9I B;  4BG9 A;  3OS2 A;  1NJZ A;  1D4X A;  1RDD A;  4KPY A;  3LWM A;  2G8K A;  2O8C B;  2G8V A;  2GWK A;  1TK0 A;  4CJV A;  4X66 K;  1KD1 O;  4J8F A;  3HRG A;  4BQZ A;  3NH1 A;  4KI6 A;  1S6P A;  1RTD A;  4HUF A;  1YJW N;  4MLH A;  1S9G A;  1VQM N;  1NBW A;  3DOL A;  3CC7 N;  4M3U A;  2O8E A;  2OZM A;  5FRM A;  4CEC A;  1LV5 A;  1YXQ A;  4AHV A;  2ZGZ A;  4C8N A;  2ZM6 K;  4CJU A;  3ZT0 A;  3KLE A;  2GTD A;  4X65 K;  2OCE A;  3EY1 A;  1FK9 A;  4BR5 A;  3TAR A;  1C0G A;  4DV4 K;  4AHS A;  5FPD A;  4FPA A;  1IBM K;  1HNX K;  4E7H A;  4LFC K;  3ULE A;  4E19 A;  2Z1I A;  1NJW A;  3WXI A;  3OS1 A;  2WUS A;  4EHT A;  3HYF A;  1OH7 A;  4IDK A;  4H0V B;  3U8X A;  4B1W B;  3TU5 A;  4JD2 B;  5H1S Q;  3MK6 A;  3AO2 A;  3U6F A;  2HNY A;  3FR0 A;  3KHY A;  3M8Q A;  4DTU A;  2CGK A;  4A57 A;  5AQR A;  1TL1 A;  3J80 O;  4CJF A;  2AJQ A;  4H5W A;  4RW7 A;  3M5R A;  3I56 N;  4FLU A;  4FK4 A;  1X3N A;  3TTD A;  1N36 K;  3QFP A;  3A8Y A;  4O55 A;  3OYL A;  4DUZ K;  1QZ6 A;  2F7T A;  2VQF K;  2JGU A;  2QWP A;  3H1Q A;  3SMP A;  4DQP A;  4JYA K;  4CBW A;  3WNE A;  2E2O A;  3LP1 A;  1YF5 L;  3MMV A;  3KLF A;  4DV0 K;  3QES A;  3L2V A;  2WOM A;  3MEG A;  3WEE B;  4KHN A;  4PY5 A;  3KK1 A;  1NK9 A;  2GWJ A;  2ASP A;  3ATU A;  2O8B B;  2QWO A;  3ZSX A;  4JLH A;  2QEX N;  4KH5 A;  3K5L A;  4EP4 A;  4KO0 A;  4DSI A;  1S1U A;  3HST B;  4CHP A;  1BOT O;  4H0O A;  3VEZ A;  4DCH A;  3ZCM A;  4BRO A;  4FO0 A;  2P9N B;  4CEZ A;  4CJW A; 
#chains in the Genus database with same CATH homology
 2IDO A;  2OZS A;  3KK2 A;  3NDK A;  4CJK A;  3OYF A;  3VQD A;  2ITG A;  5J1E A;  1TV6 A;  1RTH A;  3MEE A;  4N56 A;  2X6S A;  3QET A;  4DMN A;  3KD5 E;  4DTX A;  3TAN A;  4B3O A;  3NAE A;  4FK0 A;  1TVR A;  1TAQ A;  3AO4 A;  2W42 A;  1LWC A;  4FJI A;  3OYD A;  1IKW A;  4FW2 A;  3OYK A;  1L3S A;  3MEC A;  4ELT A;  1DTT A;  3AV9 A;  1KCF A;  4KB1 A;  2KFN A;  1RBT A;  1UWB A;  2RF2 A;  4FJK A;  2IOC A;  2VWK A;  4C8M A;  4AIL C;  2OPP A;  3P83 D;  4Z4H A;  1BL3 A;  1U49 A;  4I9L A;  1TL3 A;  1X9S A;  4KKO A;  4CFD A;  1IO2 A;  2B4J A;  3NHG A;  4CHN A;  3QEV A;  1ZYQ A;  4M42 A;  4HVJ A;  1I39 A;  4B08 A;  3L2U A;  1TGO A;  3AO5 A;  4FW1 A;  3SI6 A;  2ATQ A;  3MAQ A;  3MXI A;  1WNS A;  2XY7 A;  3SPY A;  4B8C A;  3M8S A;  3ALY A;  3OYB A;  2WON A;  3KTQ A;  3D0P A;  3HPH A;  2ZD1 A;  3LAM A;  4WE1 A;  1N5Y A;  1U48 A;  4KHU A;  3OYE A;  4BWM A;  3L3V A;  4LSN A;  3O3G A;  4NCB A;  1T7P A;  4B9N A;  3CG7 A;  4DS5 A;  3OYG A;  4DF4 A;  1ZBH A;  4DU4 A;  2P1J A;  3PUF A;  3K58 A;  4GW6 A;  1O1W A;  1BGX T;  2Z1H A;  4DTN A;  3C94 A;  4CJE A;  3SUO A;  1NK0 A;  3L8B A;  5T7B A;  3SZ2 A;  1D8Y A;  3V9W A;  3C95 A;  1NOZ A;  1NKE A;  4M3Y A;  1LWF A;  1I3A A;  2F96 A;  1ASV A;  1QSY A;  1QS4 A;  1T03 A;  3QIP A;  2HB5 A;  4DTJ A;  3SNN A;  4KHS A;  4DSL A;  4O0I A;  4BDY A;  4FM1 A;  4CGH A;  3S3M A;  2B6A A;  1HRH A;  3HK2 A;  4OKE A;  1BQN A;  4H8K A;  5CYQ A;  2YNF A;  4DQQ A;  5EU7 A;  3RMA A;  3QEX A;  3SCX A;  1SL2 A;  3VQ7 A;  3VQP A;  2PYL A;  3HPG A;  3DLB A;  1VRU A;  4Q5V A;  1A5V A;  3F9K A;  4CES A;  3AVH A;  4O5B A;  1GOC A;  1KLM A;  1WSH A;  3V9Z A;  1XI1 A;  1IKV A;  1ZBI A;  1S1V A;  3NF6 A;  3I8D A;  2P5O A;  4F3T A;  3PX0 A;  4OJR A;  1RBR A;  3BGR A;  3QER A;  1BQM A;  1RNH A;  2HHV A;  1L5U A;  1SKW A;  2XY5 A;  1VSM A;  3I0R A;  5KI6 A;  1NK4 A;  4G1Q A;  1HMV A;  3OS0 A;  1RT2 A;  4NYF A;  1UA1 A;  3CYM A;  3OY9 A;  1FXX A;  1UA0 A;  1HQE A;  4EZ6 A;  1KFD A;  3HPO A;  1XWL A;  3O4N A;  3KKS A;  2X74 A;  4CF9 A;  3V6D A;  3JYT A;  1JLA A;  2RN2 A;  4ZTF A;  1L3T A;  4LSL A;  3NGI A;  1YTU A;  4CIF A;  3CM6 A;  2Y1J A;  2G8H A;  2XRI A;  4C8O A;  2FBT A;  2XY8 A;  5FRN A;  4CE9 A;  2Y1I A;  5I3U A;  3VQ5 A;  3VQQ A;  4LY7 A;  4FXD A;  4KHY A;  4BE1 A;  1UAX A;  4HUG A;  2G8U A;  1C1A A;  2E6M A;  1QTM A;  2EX3 A;  2GBZ A;  1VSL A;  3QEW A;  2NUB A;  2R7Y A;  3MXM A;  1RDA A;  3VQC A;  4FJJ A;  5HRR A;  3UIQ A;  1GOA A;  4FLT A;  4QAG A;  4DSJ A;  2RPI A;  1JXB A;  1CXQ A;  3LZJ A;  1ZBL A;  3SQ0 A;  4KHQ A;  4CED A;  3SV3 A;  3DLK A;  4B9T A;  5DK5 A;  4ID5 A;  2FBV A;  2QK9 A;  2OPQ A;  2YHA A;  4KTW A;  3K57 A;  3NF7 A;  3DM2 A;  4OKJ A;  1L3V A;  1D9D A;  4ELV A;  4FLY A;  1XHX A;  3O4Q A;  3LWL A;  1ZBU A;  2HW3 A;  1SV5 A;  2JLE A;  3DRR A;  5KRT A;  2VG7 A;  5HBM A;  2G8W A;  3AVI A;  2YHB A;  1ITG A;  4AHR A;  1B9D A;  4B8A B;  4W5Q A;  1QSS A;  4FZY A;  4KB0 A;  1BI4 A;  1SL0 A;  4FJH A;  1JXE A;  3NBP A;  4CHZ A;  1K6Y A;  2FC0 A;  4TSX A;  1S9E A;  4Y1C A;  4CJP A;  4CF2 A;  3K5M A;  3TWH A;  1VSK A;  1U45 A;  4E1N A;  4CGG A;  4RW4 A;  4HTU A;  2QKB A;  2HHU A;  4J2D A;  4OGE A;  1BIU A;  4H4M A;  4KFB A;  3NFA A;  4LD0 A;  3THV A;  2F8T A;  1TK8 A;  3WNF A;  3OYH A;  2BDP A;  4OVL A;  5JS1 A;  1C6V A;  3EYZ A;  4XIU A;  4M3X A;  4DSK A;  4ZTJ A;  1BCO A;  4KV8 A;  4N76 A;  2HND A;  5KRS A;  4OLB A;  4FCY A;  3K59 A;  3PV8 A;  5K14 A;  1D9F A;  4C8K A;  4BE2 A;  1J9A A;  3AA3 A;  3TAF A;  4F4K A;  4CEB A;  4DTO A;  1RT5 A;  1SKS A;  3HO1 A;  1BIS A;  2QXF A;  3FFI A;  4DQI A;  2BE2 A;  3U3G A;  3V9S A;  3SUN A;  3AVL A;  4CHO A;  2VG6 A;  3PX4 A;  1RBV A;  4DU3 A;  3QEI A;  3SUP A;  3DLG A;  3VQE A;  1S6Q A;  2DY4 A;  3OJU A;  2HHW A;  4PA1 A;  3O3H A;  3K5N A;  1CLQ A;  1JLE A;  2D5R A;  3LAL A;  1EXQ A;  1NK6 A;  1TKD A;  4FLV A;  2GUI A;  1WN7 A;  3KJV A;  4CJQ A;  3VQ8 A;  1HYV A;  2YNH A;  2HVI A;  4JS5 A;  3VA0 A;  1Q9Y A;  2G8F A;  1YT3 A;  3TAQ A;  2IS3 A;  3AVF A;  5HRO A;  2DTU A;  3VQA A;  3S3N A;  4M3W A;  3WNH A;  4AH9 A;  3T1A A;  3KLH A;  1BI4 B;  4IG0 A;  4LH5 A;  4FM2 A;  2KW4 A;  3QEP A;  3OYI A;  3T19 A;  2DFH A;  1TKX A;  1VSH A;  3OYA A;  4Z4E A;  4E7J A;  1SL1 A;  3DMJ A;  3PY8 A;  4BAC A;  1TKZ A;  4NCG A;  3CFP A;  1RBS A;  4E7K A;  1C0U A;  3M8P A;  3KKR A;  3T3F A;  4CIG A;  3D45 A;  4BWJ A;  3AVG A;  1JLC A;  2DFE A;  4CJ4 A;  4CFB A;  1XHZ A;  1B9F A;  5CY4 A;  3VA3 A;  1KVA A;  1S1X A;  3L2W A;  3V1O A;  4IFY A;  3MXJ A;  5D3G A;  1UOC A;  5SZT A;  2B5J A;  2Z1J A;  3VQ9 A;  1XC9 A;  3B6P A;  3AA2 A;  4DLE A;  2HNZ A;  2XO7 A;  1KFS A;  3NF8 A;  4W5N A;  3NE6 A;  1TKT A;  2DFF A;  4E3S A;  1NOY A;  2EHG A;  4CJL A;  4M3T A;  1ZBF A;  4CIE A;  4E7L A;  1HJR A;  1J53 A;  3SUQ A;  4Q0B A;  2YKM A;  3ISN C;  3TAP A;  4F8R A;  5J2P A;  1HQU A;  4OPJ A;  4UQG A;  3SQ1 A;  4IKF A;  1JLB A;  3B6O A;  4J2A A;  2P5G A;  1VSE A;  2KZM A;  3LP3 A;  4DWI A;  4Z4F A;  4N47 A;  4C8L A;  1YTA A;  5C25 A;  4F3O A;  4B9U A;  1YVU A;  1C1C A;  3M8R A;  3VN5 A;  2D0A A;  1JKH A;  3LAK A;  4O4G A;  4FJM A;  4Z4I A;  4HHT A;  1S5J A;  1U04 A;  3SYZ A;  1QE1 A;  3PO5 A;  4DFM A;  1D5A A;  4CEO A;  4OKK A;  4ZHR A;  4W5R A;  4BDP A;  3AVA A;  3QNN A;  1LWE A;  2VG5 A;  1RCH A;  3ZSW A;  1NK8 A;  4RW8 A;  1Q9X A;  4YNQ A;  1G15 A;  4FLX A;  3IG1 A;  2PY5 A;  3ZT2 A;  4PQU A;  4CEF A;  2PZS A;  4PUO A;  3HM9 A;  3ZSV A;  2XHB A;  4DSE A;  1J5O A;  2FBY A;  1X1P A;  4FM0 A;  4DTS A;  4I7F A;  1FKO A;  2YNG A;  1NJX A;  1KLN A;  3PO4 A;  2KQ2 A;  2OYQ A;  1KVC A;  3ZSY A;  2E4L A;  3LP0 A;  1A5X A;  3ZSQ A;  4KI4 A;  5J2N A;  4DS4 A;  2O4I A;  4Y1D A;  3V1R A;  1U4B A;  1KVB A;  4QOZ B;  1CZB A;  4LH4 A;  4RW6 A;  3V4I A;  3KK3 A;  1NKC A;  1VSF A;  1Z26 A;  2IAJ A;  5I42 A;  1W0H A;  2X78 A;  3CFR A;  3EZ5 A;  4FYD A;  3RRH A;  5HRP A;  3CFO A;  4FJL A;  2D0C A;  3ZT3 A;  2XY6 A;  4FJX A;  4FVM A;  4KTQ A;  3DRP A;  4DF8 A;  5FDL A;  4FJ5 A;  4J2B A;  4CK2 A;  3ZT4 A;  3HP6 A;  3VQ4 A;  2Q3S A;  1KSP A;  4FZZ A;  1NK5 A;  4I2P A;  4CHQ A;  3RRG A;  3I0S A;  3ITH A;  1WLJ A;  1REV A;  1RDB A;  1Y97 A;  4R5P A;  1JLF A;  1RT4 A;  3ULD A;  4RG8 A;  4DSF A;  3F73 A;  4RW9 A;  4CFC A;  1C1B A;  4FJG A;  3JSM A;  5KGX A;  3ZSR A;  3IS9 A;  4DLG A;  3E01 A;  1HYS A;  1RIL A;  1CXU A;  1RT7 A;  4MQ3 A;  1VK0 A;  2GV9 A;  4AHT A;  2G8I A;  2FBX A;  5HLF A;  3VQ6 A;  5JS2 A;  1S1W A;  4HUE A;  2PYJ A;  5CYM A;  4CFA A;  4CF0 A;  1RT6 A;  3DLE A;  4EZ9 A;  1Q8I A;  4M45 A;  4KTZ A;  5CZ2 A;  4CJ5 A;  4CF1 A;  3HVR A;  1DLO A;  2O4G A;  3H08 A;  4OPK A;  3RWU A;  4FLW A;  4DFK A;  4CER A;  5C42 A;  4YFU A;  3DRS A;  4CJT A;  1WSF A;  1RT1 A;  3L2Q A;  2ETJ A;  3QO9 A;  4FLZ A;  4L8R B;  1JLG A;  1EX4 A;  4NYN A;  3WNG A;  3LDS A;  1WSE A;  3S3O A;  4K8X A;  3AA4 A;  4BE0 A;  1RBU A;  1HPZ A;  3P5J A;  4O0J A;  3CQ8 A;  4F2R A;  4CJS A;  3DLR A;  2BAN A;  5KGW A;  3HXM A;  3LPU A;  1NKB A;  4QCL A;  2BGG A;  2YKN A;  5HRS A;  2A1S A;  1EET A;  1WSI A;  2F8S A;  1EKE A;  1JL1 A;  1IH7 A;  2OPR A;  1FKP A;  3C6T A;  3K5O A;  4E1M A;  4CGJ A;  3SV4 A;  3NH0 A;  4B9M A;  1TK5 A;  4DTR A;  2D0B A;  3L3U A;  2HHT A;  2A1R A;  4H4O A;  4I2Q A;  4AHC A;  4K8Z A;  4DTM A;  1U47 A;  4DQR A;  1LAV A;  3HT3 A;  3V1Q A;  4M3R A;  1A5W A;  4CEA A;  3OVN A;  1EP4 A;  4E0D A;  4M41 A;  4PWD A;  1X9M A;  1J54 A;  3HVT A;  4OLA A;  2HHX A;  1BIZ A;  3AVC A;  4F2S A;  4FK2 A;  3OJS A;  5HRN A;  5C24 A;  3K2P A;  4AHU A;  3V81 A;  1RTI A;  4DG1 A;  3KD1 E;  3OS2 A;  1NJZ A;  3NGZ A;  3RR8 A;  2P51 A;  1ASW A;  1RDD A;  1Z25 A;  3AVB A;  4KPY A;  4KHW A;  3PX6 A;  3LWM A;  1T05 A;  3LP2 A;  2G8K A;  2G8V A;  1TK0 A;  4Z4G A;  3LPT A;  4CJV A;  2Z1G A;  4M3Z A;  4DQS A;  1SUQ A;  2E6L A;  1SKR A;  3KIO A;  4CGF A;  3NH1 A;  3L2R A;  2OA8 A;  3OYM A;  4KI6 A;  1S6P A;  3HP9 A;  4HUF A;  1RTD A;  1B92 A;  1QQC A;  4KRF A;  4CK3 A;  1VSI A;  3DOK A;  4OGC A;  2HHQ A;  1S9G A;  4HCC A;  4Z0U A;  1IKY A;  3LZI A;  3DOL A;  4M3U A;  4CEQ A;  2OZM A;  4FJ8 A;  5FRM A;  4CEC A;  1LV5 A;  4HCB A;  3HJF A;  3O3F A;  2KZZ A;  4AHV A;  1LW0 A;  3C6U A;  4C8N A;  3TR8 A;  3BDP A;  4CJU A;  3AVN A;  3ZT1 A;  3ZT0 A;  3KLE A;  3NF9 A;  1R0A A;  3EY1 A;  1FK9 A;  3VQB A;  3TAR A;  3ASM A;  4AHS A;  1N6Q A;  4FJ9 A;  1S1T A;  4CHY A;  5FRO A;  3AVJ A;  3IRX A;  4MFB A;  4CJR A;  3RMB A;  3SJJ A;  3V9U A;  1MU2 A;  4E7H A;  4E19 A;  2Z1I A;  3S9H A;  1NK7 A;  1NJW A;  4B9S A;  2KFZ A;  4DFJ A;  4CCH A;  3OS1 A;  1HNV A;  2X6N A;  1IKX A;  2RKI A;  1GOB A;  3DI6 A;  3HYF A;  4IG3 A;  4IDK A;  4N5S A;  4BDZ A;  3RMD A;  3IAY A;  4FZX C;  4Z4C A;  1KRP A;  3A2F A;  1RTJ A;  3P1G A;  3KLG A;  3AO2 A;  2ZQB A;  3G10 A;  1WSJ A;  1QSL A;  4N41 A;  3AO1 A;  1JLQ A;  1HNI A;  3U6F A;  3TAB A;  2HNY A;  1VRT A;  3SQ4 A;  4NCA A;  3QIN A;  3DLH A;  3U3Y A;  2IGI A;  3M8Q A;  3QIO A;  2HHS A;  4DTU A;  5KTQ A;  3AVK A;  2HMI A;  1VSJ A;  3QLH A;  1LW2 A;  4FJ7 A;  3DYA A;  1TL1 A;  3OYN A;  3LAN A;  4CJ3 A;  4CJF A;  4CK1 A;  4ID1 A;  2AJQ A;  2I5J A;  1JL2 A;  3RTV A;  4KAZ A;  4RW7 A;  4FK4 A;  2YNI A;  4FLU A;  3NGY A;  3G0Z A;  4DU1 A;  1KTQ A;  5HP1 A;  1X9W A;  1LAW A;  2LSN A;  3HL8 A;  4JS4 A;  1VSD A;  1WSG A;  2KTQ A;  4O55 A;  1IG9 A;  4KRE A;  4O44 A;  3OYL A;  4E7I A;  5E41 A;  1CZ9 A;  3AVM A;  2JGU A;  1C0M A;  3QNO A;  1NJY A;  1DTQ A;  3TAE A;  2QKK A;  3RR7 A;  4DQP A;  1BCM A;  3KLI A;  4CF8 A;  4ELU A;  2HVH A;  1WAF A;  4JRQ A;  3WNE A;  4IBN A;  5CZ1 A;  3LP1 A;  3CM5 A;  3TAG A;  3ZSZ A;  1C0T A;  4ICL A;  3KLF A;  1W9H A;  1T8E A;  4W5T A;  3QES A;  3L2V A;  4W5O A;  1RDC A;  2WOM A;  3MEG A;  3ZSO A;  4JRP A;  4FJN A;  4EP5 A;  4KHN A;  4J2E A;  4PY5 A;  3KK1 A;  1NK9 A;  3AA5 X;  5SWM A;  1WAJ A;  2OPS A;  3AO3 A;  3NH2 A;  3RMC A;  4CGD A;  3MED A;  3ZSX A;  3NCI A;  5DMR A;  3OYC A;  4GVM A;  4JLH A;  4CEE A;  3K5L A;  3TI0 A;  4EP4 A;  2IC3 A;  4KO0 A;  5J2Q A;  2ZE2 A;  4DSI A;  4CGI A;  4GMJ B;  4IFV A;  4E89 A;  1HYZ A;  1QHT A;  1F21 A;  1S1U A;  3HST B;  4CHP A;  4B9L A;  3TAM A;  3ZCM A;  3SPZ A;  5J2M A;  3OYJ A;  4DFP A;  1BHL A;  1ASU A;  4DTP A;  2YV0 X;  4B9V A;  3V9X A;  4I9Q A;  1TAU A;  1RT3 A;  3SQ2 A;  1L3U A;  4CEZ A;  2VWJ A;  4CJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...