4EP4A

Thermus thermophilus ruvc structure
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
166
Chain Sequence
MVVAGIDPGITHLGLGVVAVEGKGALKARLLHGEVVKTSPQEPAKERVGRIHARVLEVLHRFRPEAVAVEEQFFYRQNELAYKVGWALGAVLVAAFEAGVPVYAYGPMQVKQALAGHGHAAKEEVALMVRGILGLKEAPRPSHLADALAIALTHAFYARMGTAKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Crossover junction endodeoxyribonuclease RuvC
publication title Structural asymmetry in the Thermus thermophilus RuvC dimer suggests a basis for sequential strand cleavages during Holliday junction resolution.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 54
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature ec 3.1.22.4: Crossover junction endodeoxyribonuclease.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02075 RuvC Crossover junction endodeoxyribonuclease RuvC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ep4A00
4FK0A 2G8VA 4CJVA 4KTZA 1WSJA 5HRRA 4C8NA 4CJTA 1BIZA 3AVCA 5K14A 3V81A 2Z1HA 3AVIA 4OGEA 4DMNA 4FW1A 4CEQA 3I0SA 1NJZA 3CFRA 2XRIA 1HYVA 4FJXA 1TK8A 1JLCA 4B9LA 1GOCA 4F2RA 1DTTA 4DF8A 1CZBA 1FXXA 1R0AA 3L8BA 4PY5A 4N5SA 4CJFA 4CJQA 3EZ5A 3C95A 1ASWA 4RG8A 4CJ5A 2E6LA 1BL3A 4H4MA 2X6SA 3OYLA 2HNYA 4KHUA 5C25A 3RMBA 1KVCA 1NK9A 1F21A 1RBSA 1LW0A 1VSHA 1J54A 2XY8A 3DRSA 4CFBA 1T03A 4FM2A 3LZJA 4B8AB 4DTNA 4E19A 1NJWA 2YNFA 5J2NA 3RWUA 5KGWA 1JXBA 4HUGA 4EZ6A 4CFCA 3KLIA 4N76A 4KTWA 2KFNA 4DSFA 2GV9A 4CFAA 3HP9A 1NOZA 3IS9A 4CEEA 4DQPA 3QEIA 3IAYA 1YTAA 2QKBA 1JLAA 3ASMA 5HBMA 4C8OA 3S9HA 1BI4A 2OPSA 4CHQA 2VWKA 1NKBA 5EU7A 3PO4A 2YV0X 3TR8A 1S9GA 4PA1A 2HNZA 3P83D 4DWIA 5C42A 3CFPA 1HYZA 3NF9A 4CJRA 3C94A 4W5QA 1FKOA 3K2PA 5J2QA 2G8WA 4DTUA 4ELUA 2B6AA 1LAWA 4CESA 4JRQA 4OPJA 4KV8A 3T19A 4BDZA 1ZBFA 3MXIA 1EETA 4H8KA 5J2PA 4FXDA 4IDKA 5FRNA 2IC3A 2NUBA 1WAJA 4DQSA 1BHLA 4NYFA 4QAGA 4CJEA 2O4IA 1U45A 4N41A 2IOCA 4O0IA 1RT2A 4FM0A 4F8RA 1RBTA 4FJKA 4M3TA 4B9VA 4ELVA 4DSLA 4CGHA 4CJSA 4LSNA 3LAMA 3U6FA 1VRTA 3RMCA 5SZTA 4RW9A 3OYHA 4KHYA 1S1UA 4E3SA 4M3RA 3EY1A 2VWJA 3K5NA 1BCOA 3IG1A 3T3FA 1SL2A 1A5VA 1EX4A 1LAVA 4E7LA 3TAPA 4YNQA 5KTQA 1YTUA 4KREA 4OLAA 4AHRA 4CGGA 3AV9A 3AVJA 3QIOA 1IKXA 1VSKA 1Z26A 1J5OA 4M3XA 4Z4IA 4F3TA 2ITGA 4HTUA 1CLQA 4E1MA 1BGXT 4B9UA 1C6VA 3KK3A 1NJYA 3F73A 4DFKA 1ZBHA 1SUQA 1VSEA 4FLVA 1JLGA 3HM9A 4AHVA 2G8UA 1DLOA 4KKOA 2I5JA 1U4BA 1RBVA 1KFSA 2XO7A 2EHGA 4FJ7A 1RT5A 3O3GA 2Y1JA 3QETA 3ZSRA 1S1XA 1XI1A 3B6PA 4I9QA 4PWDA 3C6UA 1KLMA 4I2PA 4B9NA 3O4QA 3AVLA 3DLHA 4KRFA 4CHYA 3QEXA 4CF8A 1T7PA 3KD1E 3QINA 3HJFA 4KHSA 3ZT4A 4Z0UA 3L2VA 4FW2A 1YT3A 3AVMA 1TAQA 3L3UA 4OJRA 2XHBA 3VQ7A 4BE1A 1S6QA 1BQMA 1KFDA 1CXUA 3SNNA 3ZT3A 1RDCA 4EP4A 3SCXA 3SJJA 1UAXA 4G1QA 4RW7A 3HVRA 1Q9XA 3AO1A 4CJLA 3V1QA 2YKNA 3BGRA 4NCBA 3CYMA 1QS4A 4CK3A 5HLFA 1TVRA 4FM1A 1UWBA 3KLEA 1RTDA 4L8RB 1D9DA 2OA8A 1CZ9A 1VSIA 4AHSA 1YVUA 2KTQA 4JS5A 4BACA 1S1TA 3ZSVA 3QNOA 3TABA 2LSNA 3LP1A 2R7YA 1NJXA 1HRHA 3AA5X 1D8YA 1W0HA 2FC0A 2EX3A 2KQ2A 4DQIA 4WE1A 4CF9A 3NDKA 2IS3A 4IFYA 3NGIA 4GW6A 2KZMA 4KAZA 2AJQA 1JXEA 1WN7A 2FBVA 3DLRA 3AA2A 4CJUA 4DS4A 1NK7A 4Z4GA 1G15A 1VK0A 4E7JA 4OLBA 1TAUA 4B08A 2P5OA 4KB0A 4FLUA 4CHZA 3LAKA 5KRTA 5KRSA 1LW2A 1WLJA 2YNHA 4FLTA 4W5OA 3S3NA 4FYDA 2DY4A 1U48A 3TI0A 4C8MA 4R5PA 3TAMA 1B9FA 1RBUA 3SPZA 4M45A 4MFBA 1FK9A 5CZ1A 4KB1A 4EP5A 2HHXA 1D5AA 3DOLA 3SQ0A 1ASUA 1SV5A 1NK0A 4DLGA 1MU2A 3NFAA 3F9KA 4E89A 4DTXA 2BDPA 3U3GA 4DSEA 4DFJA 3AO2A 1HJRA 3G0ZA 3MAQA 3V9UA 3D45A 3OYBA 4FJHA 1LWEA 1RT6A 3THVA 4GVMA 3HXMA 1WSFA 4CHPA 3OYDA 1S9EA 4E0DA 3V9ZA 1SKRA 1UA0A 1TKDA 4FJGA 3LP2A 5FDLA 3K57A 1BIUA 1TKTA 1IG9A 4J2DA 1KRPA 2HHTA 3ZSZA 1LWCA 2D5RA 1JLQA 4TSXA 2HHQA 4Q5VA 2QKKA 2WONA 1TL3A 3OYIA 2HVHA 2OZSA 1TK5A 3AA3A 1L3VA 1XHXA 4BDPA 3DLGA 1A5WA 3CFOA 4PUOA 3NF7A 1NOYA 2X74A 1ITGA 5HRNA 4EZ9A 3O3HA 4DTRA 2VG7A 4OPKA 4DTPA 3CG7A 4IKFA 4KFBA 3P5JA 5DMRA 3OS1A 4B3OA 3VQCA 3KKRA 3OJUA 3VA0A 3MXMA 1RT3A 1K6YA 3S3OA 1GOBA 4HUEA 4M3YA 2QXFA 3K5OA 4LSLA 2RPIA 2YNGA 3CM5A 5CY4A 3TAGA 1JKHA 3SZ2A 2YNIA 2PYJA 3SUOA 1HNVA 2X6NA 3ZSOA 5J1EA 4FJMA 3NH2A 1XHZA 4KI6A 4IBNA 1C0MA 4AILC 1WAFA 2JLEA 2ZE2A 4DU3A 3HK2A 1WSIA 4I9LA 3KK1A 3OVNA 1C1BA 4BWMA 3ZSWA 4BE2A 5CZ2A 4FLYA 1A5XA 3TAEA 1NKCA 3SUNA 2XY6A 2DFEA 4DLEA 1IKVA 1S1VA 3RMAA 1KCFA 1SKWA 2PYLA 1ZBLA 1S5JA 3KIOA 3PX0A 2HMIA 2OPPA 4FLWA 5CYMA 3E01A 4DSKA 1U47A 5KGXA 3CQ8A 3SQ4A 4ID1A 4M3UA 4ID5A 1TL1A 2G8HA 1IO2A 3OYJA 1L3UA 3VQ8A 4DFMA 4BE0A 4FLZA 2X78A 1KVBA 2BE2A 1FKPA 3C6TA 3QNNA 3TAQA 5I42A 4FJNA 3ISNC 2P51A 4LY7A 3L2UA 1X1PA 1NK4A 4AHCA 3G10A 4CIGA 4CECA 4CJ3A 3T1AA 4CJPA 4QOZB 1WSGA 1HYSA 2HHUA 2PZSA 3HP6A 5JS1A 1WNSA 3KLHA 3SYZA 4DQQA 1VSJA 2F96A 2RF2A 2Z1JA 4Y1DA 3O3FA 5HP1A 4K8ZA 3AO5A 1ASVA 3VQQA 3VQEA 1BQNA 2Y1IA 1U49A 1L5UA 2G8FA 3ZCMA 1RTIA 2D0CA 3LPTA 4CK1A 3PUFA 3OJSA 3RR7A 3DOKA 3SI6A 3KD5E 2FBYA 4XIUA 1TKXA 3ZT1A 4IFVA 1I39A 4CGIA 3SQ1A 3VQ4A 4CHNA 3K59A 4MQ3A 4CIFA 4O5BA 2DFFA 3PO5A 4FZYA 4DTSA 2FBTA 4BWJA 3WNFA 3HPOA 3MEEA 2GUIA 3WNHA 3NBPA 4CGJA 3OYCA 3VA3A 4QCLA 3L2RA 2G8KA 3EYZA 4FLXA 1QTMA 4LH4A 4FJIA 2OPQA 5E41A 4C8KA 3AVFA 5J2MA 2YHBA 1RDDA 4B9SA 2HNDA 2PY5A 3KJVA 2D0BA 4OKJA 1B9DA 1HQUA 3AVBA 1X9WA 3V9SA 2WOMA 3QESA 4CFDA 1JLFA 3RRHA 3HYFA 1RNHA 3QEVA 3QLHA 2E6MA 4DTOA 4O0JA 3L2WA 1RDBA 2HHVA 3IRXA 2E4LA 3JSMA 2B4JA 4JLHA 3ZSQA 3V4IA 2GBZA 3DMJA 4M3WA 2DFHA 4E7IA 1EP4A 4ZTFA 3TWHA 2F8TA 4J2BA 4HCBA 4KI4A 1IKYA 4DFPA 1UA1A 1X9SA 4CEDA 1D9FA 4KPYA 1U04A 1Q8IA 3LP0A 3KTQA 3QO9A 4B8CA 4W5RA 1NK5A 3HPHA 2HVIA 4DTJA 4GMJB 2HHWA 1SL0A 5HROA 1VSDA 2D0AA 2KZZA 3NF6A 3VQBA 1Q9YA 2ETJA 1KTQA 3ALYA 4AHUA 1JLBA 3ZT0A 2RN2A 4N47A 3AVKA 1X9MA 2VG6A 4F3OA 3QEWA 2XY7A 4H4OA 4E1NA 4M42A 2P5GA 1HQEA 3AA4A 4BDYA 2XY5A 5HRSA 4DG1A 3BDPA 1BISA 1RT4A 4OKKA 4E7KA 4FVMA 4OKEA 1I3AA 4DTMA 2KW4A 3KKSA 1B92A 3V6DA 1QHTA 3AO3A 3OS0A 4ZTJA 3DYAA 5SWMA 2KFZA 1N6QA 2RKIA 4N56A 3M8SA 5JS2A 4AH9A 2A1RA 3AVAA 2YHAA 1N5YA 4KHWA 1HMVA 1RTHA 1XC9A 3L2QA 3OYFA 4CF0A 3LDSA 4KO0A 5KI6A 3FFIA 4FCYA 3NF8A 2Z1IA 3AVHA 3PX6A 4YFUA 1WSHA 4FJ5A 3ULDA 2FBXA 4IG0A 4CGFA 3RMDA 2DTUA 3OY9A 1TGOA 3VQAA 3RR8A 3K5LA 1VSMA 3OYNA 1NK8A 3VQPA 4FZXC 2F8SA 1BCMA 3ZSYA 5D3GA 3NGYA 5FRMA 1Z25A 3OYEA 3NHGA 3TAFA 3MEGA 4FK2A 4NCAA 4FJ9A 3LP3A 3AVNA 3SV3A 1C0TA 3SUQA 3CM6A 3DLEA 4HUFA 4KTQA 2O4GA 3TANA 2ATQA 4CJKA 3OYAA 1T8EA 1QE1A 3LPUA 1KSPA 2P1JA 4CK2A 1QSSA 4FJJA 3QIPA 4RW8A 2IAJA 1HPZA 3PY8A 2OYQA 3A2FA 1ZBIA 4Z4EA 1IH7A 3K5MA 3D0PA 4NYNA 3HVTA 1KVAA 1REVA 2JGUA 3U3YA 3ZSXA 3LZIA 3LWLA 4CGDA 3HT3A 3QEPA 1UOCA 3WNEA 1EKEA 1HNIA 3V9WA 3HPGA 1JL1A 2B5JA 1SL1A 4ELTA 4F2SA 2BGGA 2HHSA 1ZBUA 4DU1A 4C8LA 4FJLA 1RT7A 4CE9A 3TARA 3O4NA 3P1GA 4Y1CA 5I3UA 4B9TA 3QERA 4KHNA 4FK4A 1JL2A 3VN5A 4HVJA 1TKZA 4UQGA 4KHQA 4FJ8A 1DTQA 1VSLA 3V1RA 3OYGA 3M8PA 1L3SA 3HO1A 2HW3A 3PV8A 1L3TA 4W5NA 3HL8A 4LH5A 2IGIA 3VQ9A 3NH1A 3DRRA 3NE6A 4CEFA 2IDOA 3LANA 1RDAA 4AHTA 4CIEA 4DU4A 1BI4B 4B9MA 4Q0BA 1C1CA 4Z4HA 3KLFA 3KK2A 3SV4A 3OYKA 4RW6A 3NH0A 3M8RA 4CEAA 4CJWA 4DF4A 1Y97A 1QSLA 3NCIA 4DSJA 4K8XA 4Z4FA 1TV6A 3SQ2A 3SUPA 4PQUA 4M41A 3MEDA 2Z1GA 3H08A 3NGZA 3DI6A 4NCGA 4CERA 1C1AA 1LV5A 3PX4A 3JYTA 3DRPA 3MXJA 3VQDA 4ZHRA 4I7FA 4LD0A 3OS2A 3V1OA 1NK6A 2QK9A 1CXQA 1J9AA 2ZQBA 1TK0A 3VQ6A 4E7HA 3L3VA 3AO4A 3DLKA 4RW4A 1KLNA 4JRPA 1ZYQA 1RBRA 2OPRA 4CEZA 1RILA 4JS4A 3RTVA 4CF1A 2OZMA 2Q3SA 1XWLA 1WSEA 3ITHA 3KLGA 3WNGA 1QQCA 4ICLA 5CYQA 3UIQA 3VQ5A 3OYMA 1T05A 4HCCA 4O4GA 4J2AA 4IG3A 2G8IA 2BANA 1VRUA 4CCHA 4W5TA 1W9HA 1VSFA 3I0RA 1RTJA 2A1SA 2ZD1A 4CEBA 3V9XA 4DQRA 4CF2A 4OGCA 3NAEA 3S3MA 5DK5A 2HB5A 4Z4CA 3RRGA 5C24A 1J53A 1O1WA 3M8QA 3MECA 3LWMA 5FROA 1JLEA 1GOAA 1LWFA 5T7BA 3K58A 1SKSA 1NKEA 3DLBA 4M3ZA 4OVLA 4CHOA 1IKWA 4DSIA 1S1WA 4J2EA 4O44A 3I8DA 2VG5A 4O55A 4HHTA 3SPYA 3HSTB 4FZZA 4I2QA 4F4KA 4CEOA 3B6OA 3LALA 4DS5A 5HRPA 1C0UA 1EXQA 1S6PA 3AVGA 1RCHA 1QSYA 2YKMA 1RT1A 4CJ4A 3ZT2A 3DM2A 2W42A
chains in the Genus database with same CATH superfamily
4LF6K 2G8VA 5HRRA 4C8NA 4FW1A 4CEQA 3I0SA 3CFRA 2XRIA 1HYVA 1TK8A 4BRHA 4CJQA 3EZ5A 2E6LA 2V52B 3M6GA 1BL3A 4JKBA 2O8DA 3RMBA 1TUUA 3CCEN 1LW0A 2PBDA 3LZJA 4DTNA 2YNFA 3N4QA 3RWUA 4HUGA 4EZ6A 2GV9A 4B3MK 4XEIA 3QEIA 3IAYA 5HBMA 4C8OA 4ISEA 3W3DA 3S9HA 3ENHA 4CHQA 3PO4A 1SAZA 3PIOL 4IXCA 2HNZA 3THXB 5C42A 4JK7A 3CFPA 4JI6K 4WQ5A 4DTUA 4LF4K 4OPJA 3ZYYX 4H8KA 4PHTX 5FRNA 1VQ8N 4FSVA 2I7NA 3MWPA 3O5BA 4LFAK 4G9ZA 4CBUA 2YCHA 4H5WA 3SAHA 3KVGA 1HNZK 3RMCA 3MCPA 1ATSA 3HBTA 1QQNA 1TUYA 4BRIA 1YVNA 1A5VA 4E7LA 4IZ9A 4JI5K 2ZGZA 3AVJA 1QZ6A 1J5OA 1IKXA 4Z4IA 3CIPA 1CLQA 1BGXT 1C6VA 4DFKA 1VSEA 4FLVA 3HM9A 1DLOA 3OA9A 3I56N 4I6MA 2FF3B 4X66K 2XO7A 2EHGA 4O8KA 1RT5A 2Y1JA 1BA0A 2E8AA 2WBNA 2F9TA 3O80A 4Y0WA 3AVLA 1FW6A 4BGBA 3ZT4A 4Z0UA 1TAQA 3MX5A 3T7ZA 1S6QA 1CXUA 1ATNA 4EP4A 3SCXA 3SJJA 3ZX2A 4CZIA 5A2QO 2ASMA 1TVRA 1RTDA 2QWPA 1SZ2A 1VSIA 4AHSA 3K9JA 5KPRA 1YVUA 4JS5A 3VEYA 3ZSVA 3QNOA 1NJXA 2EX3A 2KQ2A 3CQYA 3CJBA 4WE1A 5BR8K 4NO7A 4GW6A 2HBLA 4JKFA 3M5RA 1WN7A 3A5NC 3DLRA 4CJUA 1C0FA 3AA2A 1VK0A 4OLBA 4KB0A 4LF5K 4CHZA 5KRTA 5KRSA 1WLJA 4WFNL 4FYDA 3S3NA 2CGJA 3TI0A 3TAMA 1B9FA 1OVQA 1RBUA 3SPZA 4HTLA 5I9EB 4KB1A 4MDAA 4EP5A 1NK0A 4DLGA 1MU2A 4E89A 5B8HA 1RDUA 1VQLN 4DSEA 3H3OB 3AO2A 2OANA 1DGKN 4FJHA 1NGFA 4CHPA 1X3MA 4GV6A 1S9EA 4E0DA 1SKRA 3THYA 5FDLA 5AZIA 3C7NA 3CQXA 5M1NA 2HHTA 2YHWA 3ZSZA 1VQMN 1LWCA 1JLQA 3F5TA 4DR2K 3D2FA 1K9MO 3OYIA 4JNEA 4V19S 3AA3A 1L3VA 2V7ZA 5BPNA 4PUOA 4H0PA 2X74A 1ITGA 5HRNA 4EZ9A 3O3HA 2P9PA 4KFBA 1I94K 3KKRA 4FWOA 1RT3A 1RDWX 4HUEA 5C10A 3K5OA 2RPIA 3CM5A 1K8KA 3O9SA 2YNIA 1HNVA 3ATVA 4IJNA 3O08A 4JI4K 3P31A 4AILC 1VQON 1WSIA 4OLAA 4BWMA 5LJVA 4BE2A 3TAEA 4O8UA 4HWIA 1IV0A 1A5XA 5AZJA 1IKVA 1SKWA 1KCFA 5IWAK 2PFUA 3OYJA 3JS6A 4DUYK 1FKPA 3EL2A 1V4SA 5I42A 2VCPA 1NMDA 3U4LA 1BG3A 4CZEA 4AHCA 3WXLA 4CECA 4CJPA 1HYSA 1WSGA 4JN4A 3PSIA 2PZSA 3SYZA 3KLHA 4GV3A 4H03B 3ENBA 1N33K 4DHYA 4BC2A 4CK1A 3DOKA 1JCGA 2BTFA 3KD5E 2ASPA 5JMVA 2NRTA 3K59A 4FZYA 2HHSA 2FBTA 3WNFA 4DR3K 3HPOA 3VA3A 2GUIA 4CZLA 4IO8A 4LH4A 3C65A 4JI1K 5E41A 1RDDA 2PY5A 3ZLJA 5AQMA 4OKJA 4CZJA 3QESA 2WOMA 4CFDA 3MN7A 1T3VA 4DTOA 5AQIA 2O8CA 3IRXA 2NNWA 3JSMA 1ESVA 2DFHA 3TSPA 1BU6O 1EP4A 2A41A 3R8EA 4JYAK 4CZMA 4B1XB 1UA1A 1D9FA 3CC2N 3F2KA 4A2BA 3KTQA 3QO9A 4B8CA 4W5RA 5EXWA 4DTJA 4GMJB 1VSDA 5TKYA 3VQBA 1Q9YA 4BQZA 1Z6RA 4YDUC 3AVKA 1X9MA 1MWMA 2VG6A 4F3OA 2P9IA 3E66A 3UKUB 2P5GA 3OTOK 4MLHA 3BDPA 4PKHA 4CZHA 4YOWA 1QHTA 2RKIA 2GELA 4BROA 4N56A 1H1VA 3J7ZO 3E9PA 1KC8O 1HMVA 3SAFA 3HRGA 1XC9A 3OYFA 4CF0A 3G4SN 4KO0A 5KI6A 4FCYA 2Z1IA 4GKKK 4FJ5A 5AQYA 3WEEA 2FBXA 1S72N 5BN9A 3OY9A 2ZJRL 1TGOA 1MA9B 1VSMA 1FJGK 3R3LA 5DM7L 2F8SA 2OTJN 3SLCA 3MEGA 2W6LA 4NLCA 4FJ9A 1HJOA 3LP3A 3WXIA 1E4GT 3EE8A 1W2BM 1ZC6A 1VQKN 3DXMA 3TPQA 3CJAA 1QSSA 3QIPA 2P9KA 2HF3A 3A2FA 3D0PA 2JGUA 3CERA 3LZIA 5AQHA 1EKEA 3V9WA 3HPGA 2B5JA 1SL1A 4F2SA 2BGGA 4DU1A 4C8LA 4FJLA 5KQDA 1RT7A 3D6RA 3H1VX 3TARA 3P1GA 4Y1CA 2O8DB 3VERA 5I3UA 3QERA 4B9TA 1OKJA 4A5AA 4HVJA 1TKZA 4FJ8A 1DTQA 1VSLA 1CZAN 3M8PA 4K0KK 1YF5L 1NMNA 3AAQA 4LH5A 2IGIA 2D0OA 4MO4A 3RSEA 4FO0A 4CEFA 4KH4A 1RDAA 4BRMA 4CIEA 2NRWA 4RW6A 3D2EA 4NXMK 4CJWA 4DF4A 1ILYA 1TV6A 2Z1GA 3NGZA 1LV5A 1C1AA 3O4WA 3PX4A 4BG9A 3FLCO 4I7FA 3TU5A 1NK6A 1MDUB 1CXQA 1J9AA 3LDOA 4E7HA 3L3VA 3NVKA 3C6AA 4JRPA 2UXDK 3FZFA 4QS9A 3EKSA 2Q3SA 4JK8A 1R59O 1NNEA 1YI2N 3UIQA 3OYMA 4HCCA 3BZKA 4O4GA 4CD1A 2G8IA 2BANA 1VRUA 3M3ZA 4CCHA 1RTJA 4GV9A 4DQRA 3IDHA 5FPMA 1J53A 1O1WA 3M8QA 3MECA 3LWMA 1YHQN 5T7BA 4DSIA 2HBMA 3I8DA 4YOUA 2VG5A 2WTUA 4FL9A 3HSTB 4B3TK 4M7YA 4CEOA 4I6MB 2NRXA 3LALA 5HRPA 4JKCA 1RCHA 3H3NO 4CJ4A 3ZT2A 3WXKA 4CJVA 1WSJA 3T1HK 3V81A 3AVCA 4J8FA 4OGEA 4DMNA 4M3UA 3LDLA 1JLCA 3ZEUA 1DTTA 2E2PA 3L8BA 4H0OA 3VEXA 1S3XA 1KQSM 4XH5A 2P9LA 4AM6A 3ID8A 3CD6N 2XY8A 5AQXA 4GKJK 3L6QA 4B8AB 3QMLA 4CZFA 3KLIA 3VEWA 4CFAA 3HP9A 3A0IX 5C12A 4JI3K 3VTHA 1IBMK 5BPLA 2OPSA 2YV0X 3TR8A 3C94A 1FKOA 3K2PA 4JKHA 4ELUA 2B6AA 4CESA 5AQPA 1EETA 5J2PA 4FXDA 4IDKA 3JAMO 4DQSA 2HBKA 3SBGA 1BHLA 4NYFA 2WFBA 5F2RA 4O0IA 1RT2A 4F8RA 1RBTA 1OH5A 2YHXA 4B9VA 2QWQA 4CGHA 4LSNA 3LAMA 1VRTA 3THYB 2NLXA 5AZIB 5SZTA 3C7NB 1S1UA 3D2FB 3T3FA 3WQTA 1EX4A 5C15A 5KTQA 3O9QA 3H46O 4NXNK 4F3TA 2ITGA 2P9PB 2UYTA 1GLBG 1K8KB 1BOTO 3A5LC 4BVOA 3QETA 1QVFM 1RGIA 2QW9A 4PWDA 3C6UA 4I2PA 4B9NA 1Y64A 3IKMA 4KRFA 4CHYA 2F7TA 4CF8A 1T7PA 5AZJB 3KD1E 3L2VA 2YJFA 1KAXA 4EHUA 3SNNA 4EIAA 1KFDA 4ISFA 4DCHA 1UAXA 4G1QA 5GAHP 3HVRA 1Q9XA 1NBWA 2YKNA 4YY3K 3BEXA 3CYMA 4CK3A 5HLFA 1Q86O 4FM1A 4CW7B 5GINA 1D9DA 2OA8A 1CZ9A 2NRRA 3VF2A 2OTLN 2KTQA 4BACA 1S1TA 3LP1A 1W0HA 2BUPA 3FZKA 4CF9A 3EN9A 4WQ4A 4IFYA 5AQWA 4JKGA 1JXEA 2FBVA 4DS4A 2UXCK 2D1KA 1LCUA 1G15A 1TAUA 4OX9K 3LAKA 4W5OA 1IBKK 4AM7A 1U48A 4C8MA 2GWKA 3EEQA 5CZ1A 1N34K 4BRFA 3DOLA 3SQ0A 1ASUA 1HKGA 3QFPA 5AQJA 3MN5A 2BDPA 2HMPA 4DFJA 3G0ZA 4C1NK 2KLAA 5C0YA 5C2FA 2CH5A 1WSFA 1HNWK 2ZF5O 4H5NA 4BRNA 1UA0A 1BIUA 1TKTA 2O8CB 1KRPA 1RFQA 2HHQA 4Q5VA 1T44A 1JJ2M 2QA4N 2OZSA 3I55N 3CCJN 3DLGA 5AQLA 2OCEA 3E1YA 5CR4A 4OPKA 4DTPA 3NMUA 3CG7A 3MMVA 5DMRA 3P5JA 3ZX0A 3VGKA 3OJUA 3VA0A 1HKCA 3MXMA 3JXUA 3HOTA 3TAGA 1JKHA 3VMFB 5BPMA 4FJMA 3P39A 3NH2A 1XHZA 4KI6A 2P9IB 2ZE2A 2JLEA 1XNRK 1SQKA 5HOOA 3KK1A 3OVNA 1C1BA 5DM6L 5CZ2A 3KZBA 4FLYA 2XY6A 4ILJA 1S1VA 1S5JA 3KIOA 3PX0A 2OPPA 4FLWA 3F9MA 3SMSA 4YOYA 3CQ8A 4ID1A 4ID5A 3CMEN 4DR6K 5AQGA 4DFMA 4BE0A 4FLZA 2X78A 1YITN 1KVBA 3VESA 3C6TA 4FOIA 3QNNA 3TAQA 3WEEB 3L2UA 2GUPA 1GLLO 3PIPL 2KHOA 4YOVA 4BR5A 1VQ7N 3DXKB 4MO5A 5CE3A 5JS1A 1WNSA 5HP1A 3MK6A 1ASVA 3VQQA 3VQEA 4BRGA 1U49A 3OJSA 3HSCA 3SI6A 3DXMB 2HOEA 5LL6Z 2CGKA 2A3ZA 4CGIA 3VQ4A 2P9KB 4CIFA 4CGJA 2G8KA 3EYZA 4FLXA 2Q31A 4C8KA 3CJ9A 5J2MA 4FPAA 3KJVA 3VGLA 1W7AA 2VGMA 1B9DA 4LF8K 3AVBA 1X9WA 3V9SA 3HYFA 3QLHA 4L3QA 4O0JA 3CCMN 1RDBA 2F9WA 2E4LA 2V51B 4JLHA 1NGJA 3V4IA 2GBZA 2I7PA 5JICA 3DMJA 3RSEB 4E7IA 1BUPA 3TWHA 4M63C 4KI4A 1IKYA 4DFPA 4BR7A 1BA1A 4CEDA 3SAGA 5H1SQ 3D2EB 4JKAA 3LP0A 3HPHA 2HHWA 5HROA 2D0AA 2KZZA 4H0XB 2YJEA 2FF6A 1XNQK 1JLBA 2WC9A 4H4OA 3CCSN 2XY5A 5HRSA 3ATUA 4DV4K 4BRCA 1BISA 1HNXK 4PKGA 1D4XA 3KKSA 1B92A 3V6DA 3WXJA 4ZTJA 5SWMA 5AQFA 4KHWA 2YHAA 4IOAL 4BG8A 3LDSA 3NF8A 3PX6A 4YFUA 4GY2B 4U7BA 3ULDA 4IG0A 4MDBA 4CGFA 3RMDA 4BC4A 3K5LA 3OYNA 5D3GA 3NGYA 5FRMA 3TAFA 3CJ1A 2AP1A 4NCAA 3AVNA 3Q7BA 3DLEA 2O4GA 3TANA 3CPEA 3AGRA 4CJKA 4RW8A 1VQ6N 2IAJA 1ZBIA 4Z4EA 1NGBA 3KWGA 2D4WA 4BRPA 3K5MA 4LF9K 3ZEUB 3HT3A 3O6WA 3C0BA 4B3RK 4CE9A 2P9LB 2Q36A 3BF3A 3VN5A 4A62A 2UUBK 5AFUH 2HW3A 3PV8A 3HL8A 3NH1A 2CH6A 2IDOA 3LANA 2VWBA 4Z4HA 3SV4A 1HKBA 3LM9A 3OYKA 4ISGA 4A5BA 3M8RA 3VF6A 1T6DA 2E2OA 1Y97A 4Z4FA 4K25A 1VQNN 3MEDA 1YJ9N 1M90O 3DRPA 3IFRA 4A57A 3V1OA 1GLJO 4CJ7A 3CC4N 3HI0A 3VQ6A 4OPAA 3QBXA 1KLNA 5JVHL 4CEZA 2OZMA 3ITHA 1QQCA 5CYQA 1JCFA 4IDHA 2EWSA 4B1WB 3ENOA 3VGMA 1VSFA 1T6CA 2A1SA 4CEBA 3CCVN 3V9XA 4DR7K 4CF2A 3S3MA 1Q82O 2NRVA 5JVGL 3SZ2A 5FROA 1JLEA 1GOAA 1NKEA 3DLBA 4M3ZA 3O9TA 1IKWA 1S1WA 4O44A 5KQ8A 4JI8K 4O55A 3ULEA 4I2QA 4EHTA 3B6OA 5JLHA 4WF9L 2VQEK 1KD1O 5GAEP 1EXQA 3DLLL 2FSNA 2YKMA 1RT1A 3DM2A 4WYBA 2W42A 2QWNA 4FK0A 4KTZA 1BIZA 1NJZA 1GOCA 4ILGB 4F2RA 3G25A 4DF8A 1CZBA 1VHXA 1R0AA 4PY5A 1JCEA 3CETA 4RG8A 4CJ5A 2E5LK 2A5XA 4H4MA 5C25A 1S22A 1T03A 3TTFA 4CFBA 1J54A 3UKRB 4FM2A 5J2NA 1JXBA 2KFNA 4N76A 4H5TA 3TTDA 3DXKA 3IS9A 3VTIA 4JKGB 4BC5A 2VWKA 3QICA 1S9GA 3P83D 1KXPA 3WUHA 3OBWA 3NF9A 4CJRA 3OBYA 4W5QA 5J2QA 4JRQA 5FLXO 4KV8A 3T19A 4BDZA 3LM2A 2HHHK 2NUBA 5M1PA 4JAXA 1U45A 2E20A 4X65K 1W97L 4N41A 2IOCA 2QI2A 4M3TA 4ELVA 4DSLA 3J8AA 3HOSA 3IMXA 4QS8A 1GLAG 4RW9A 3OYHA 4KHYA 4WCEL 4E3SA 3WT0A 4DV0K 3Q7CA 3EY1A 3K5NA 3IG1A 4KREA 4FPBA 4AHRA 4UY8O 3AV9A 1Z26A 5AQRA 2O8FA 4HTUA 4E1MA 1EWRA 4H0YB 3KK3A 1VQPN 4XH4A 1ZBHA 3K0SA 1SUQA 3GOIA 1JLGA 3A5MC 3T1YK 4KKOA 5M1OA 2I5JA 1U4BA 4WFAL 4BR9A 4FJ7A 1XI1A 1S1XA 4FVUA 3VPZA 3B6PA 1O13A 1N32K 1KLMA 3O4QA 3DLHA 2FLOA 3QEXA 3HJFA 3QINA 3J7AP 3M1FA 4FW2A 3AVMA 5ADXA 2XHBA 3VQ7A 3UE5A 5EY4A 1RDCA 3HTVA 4RW7A 3AO1A 3TSUA 4CJLA 3V1QA 1QS4A 1NGDA 4FWRA 3KLEA 1IJJA 5M1FA 1NG9A 2LSNA 1HRHA 1D8YA 2FC0A 3NGIA 3NDKA 2IS3A 2KZMA 4IOCL 4KAZA 1BWFO 1ATRA 4YDUA 4WFBL 4B08A 4C23A 2P5OA 3O1BA 4FLTA 1HR0K 4E1JA 5IT9O 4R5PA 1FK9A 2HHXA 1D5AA 2D0PA 4JEPA 3NFAA 3F9KA 3EZWA 3HM8A 3U3GA 3V9UA 4BRQA 3WXMB 5EX5A 3NVMA 1LWEA 1RT6A 2DPNA 4GVMA 3MCAB 3HXMA 5ELZA 4A59A 4CZKA 1DKGD 3V9ZA 1EO1A 4FJGA 3LP2A 1IG9A 4KH6A 2E88A 3U9DA 4TSXA 2QKKA 3WQUA 1TYQA 4BRKA 2P9SA 4IEEA 2FXUA 1XHXA 5AR0A 4BDPA 1A5WA 1NOYA 4DTRA 2VG7A 3K9KA 4PKIA 1GLFO 2VQFK 4IKFA 3OS1A 4B3OA 5AQZA 4C1NI 3S3OA 4M3YA 2QXFA 4LSLA 5CY4A 3T69A 1G99A 2PYJA 3MN6A 3ZSOA 3THWA 3QB0A 5BN8A 1C0MA 1WAFA 4WQ5C 4FWLA 4YOXA 4I9LA 3ZSWA 1P8ZA 4GNIA 3LDNA 3L4QA 4BR4A 3E01A 3E9OA 3SQ4A 1EQYA 2A6AA 5HL7L 2IVPA 2G8HA 5M1KA 1IO2A 1HUXA 3VEZA 1L3UA 2QWRA 3VQ8A 3J7YP 3CJCA 4OO1J 5LY3A 2Q0UA 1GLEG 5JLFA 4M7XA 4JKDA 2ZJQL 1X1PA 3G10A 4CIGA 5ADXH 4BREA 5GIOA 4CJ3A 4QOZB 1VQ4N 1OH8A 3LDPA 4DQQA 2F96A 5KPZA 2NZTA 4IJAA 2Y1IA 1BQNA 1L5UA 2G8FA 3LPTA 2D0CA 3RR7A 3PUFA 4IFVA 1I39A 3SQ1A 5BRHA 4CHNA 4MQ3A 4BC3A 4DTSA 4BWJA 3WNHA 2OPQA 2Q97A 1YJWN 1NJIO 3AVFA 2YHBA 5EOYA 2HNDA 2UU9K 4R79A 2D0BA 2A42A 5AQOA 1JLFA 4A2AA 3UKRA 2E6MA 1KAZA 3L2WA 2HHVA 2B4JA 3ZSQA 3R1XA 1Q18A 3UB5A 4ZTFA 4FWQA 4J2BA 4HCBA 1X9SA 1NGGA 4JD2A 4KPYA 1Q8IA 4DR1K 2HVIA 1SL0A 3FE1A 5F1XA 1EWQA 2P9UB 1OH6A 1KTQA 5LMNK 3ALYA 5GAGP 2ZWHA 4AHUA 1QQOA 4BR2A 1HPMA 3G6EN 3QEWA 3AA4A 3LDQA 5AQTA 4BDYA 4DV2K 2O8BA 4DG1A 4OKKA 3VENA 4KHPK 3AAPA 4OKEA 1I3AA 3VOVA 2KW4A 3OS0A 3AO3A 1N6QA 3M8SA 3CMAN 3GDQA 4AH9A 2A1RA 1N5YA 5E26A 1RTHA 3IUCA 3MDQA 3L2QA 2NRHA 1QHAA 1VQ5N 4OPHA 1C0GA 4RCHA 1VAZA 2DTUA 2E1YA 3VQAA 4CVNE 1ZBSA 1U2VA 2P9NA 3ULEB 3VQPA 1BCMA 5AQVA 3ZSYA 2QWMA 4JI7K 3CC7N 1Z25A 5BRDA 4MLEA 3OYEA 3NHGA 3H1QA 4IOXA 4U67L 4FK2A 4K41A 3ZETA 5AJ3K 1Q7YO 3OYAA 5CHIA 2P1JA 3PY8A 1V4TA 4NYNA 1REVA 4YHHK 4RWTA 3WNEA 1HNIA 3CPWM 1JL1A 4ELTA 1ZBUA 3O4NA 4KHNA 4FK4A 5AQSA 3EKUA 2A40A 4UQGA 4A61A 1LOTB 3OYGA 1NLVA 3HO1A 5FPNA 1L3TA 4FWMA 4W5NA 4RTFD 3L4IA 4LC9B 1U6ZA 2V7YA 4DU4A 4Q0BA 4AHTA 3KLFA 3NH0A 4CEAA 4BR0A 5BR9A 4XH1A 1QSLA 2QWLA 3A5OC 3SQ2A 3SUPA 5AFUA 4M41A 3I33A 3H08A 3DI6A 2QTDA 4NCGA 4B9QA 1M1KO 3MXJA 3VQDA 2F4VK 4LD0A 3OS2A 1YJNN 2VGNA 4DV6K 2ZQBA 1TK0A 1NGIA 3DLKA 4RW4A 1NWKA 1ZYQA 2OPRA 3SJHA 3RTVA 1XUPO 4CF1A 1XWLA 3WNGA 3O1WA 5M1QA 3VQ5A 1T05A 2FSKA 4IG3A 4DQ8A 3DWLA 5FPEA 3RVCA 3VF4A 2O8EA 2HB5A 4Z4CA 2O8FB 3CJ7A 4LF7K 3DAWA 3O9RA 1GLDG 4FZZA 4JK9A 4H0TB 2QEXN 4DS5A 1YXQA 3L0QA 4B1YB 1SS6A 3AVGA 1OH7A 4FOEA 3R6MA 4CJTA 5K14A 2Z1HA 3AVIA 4FJXA 2HSTA 2FSJA 4B9LA 3CCUN 1FXXA 4DR5K 1XQSC 4N5SA 3AY9A 4CJFA 3CCRN 3C95A 1ASWA 3I8BA 3CF5L 1P90A 4BQLA 2X6SA 3OYLA 2HNYA 4KHUA 1NK9A 1KVCA 3GE1A 4BRAA 1F21A 1RBSA 1VSHA 3DRSA 1NJWA 4H0VB 4E19A 5KGWA 4B1ZA 4CFCA 4CZGA 3DJCA 4KTWA 4DSFA 2JWLA 4DQPA 1NOZA 4CEEA 1VQ9N 1BDGA 3CCQN 2QKBA 1YTAA 4FWNA 1JLAA 1NGHA 3ASMA 1BI4A 1NKBA 5EU7A 4PA1A 4DWIA 1HYZA 1QVGM 3PSFA 2G8WA 1LAWA 2QXLA 3P4IA 3MXIA 1ZBFA 5LJWA 2IC3A 1WAJA 3E9LA 5AQNA 4PL8A 4KH5A 4QAGA 4CJEA 2O4IA 1E3MA 4JHDA 4FM0A 4FJKA 3CXCM 4CJSA 3U6FA 4LFBK 4M3RA 3N4PA 1SL2A 2VWJA 1BCOA 1LAVA 1YTUA 2YX6A 3TAPA 1TYQB 4YNQA 2P9SB 3BZCA 1K8AO 2Q0RA 4CGGA 3QIOA 1VSKA 4M3XA 4B9UA 1NJYA 3F73A 1YAGA 2H3GX 2W40A 4AHVA 3BY5A 2G8UA 2GX9A 2P9UA 2UXBK 2NRZA 3O9UA 1RBVA 1KFSA 3SMPA 3O3GA 3THWB 3ZSRA 5C2DA 3FZLA 4I9QA 4KHSA 3TTCA 1YT3A 3L3UA 4OJRA 4DUZK 4BE1A 1BQMA 3ZT3A 4DR4K 2W6KA 3BGRA 3LL3A 4NCBA 4ILHA 1UWBA 4L8RB 1X9JA 3EO3A 3TABA 1WOQA 2R7YA 5TKWA 3AA5X 1GLCG 4DQIA 3A8YA 2RHKA 2AJQA 5FPDA 4B1UB 4X64K 4Z4GA 2QWOA 1NK7A 4E7JA 4FWSA 4Z94A 4FLUA 3THXA 1LW2A 2YNHA 3MX2A 3R9PA 2DY4A 4M45A 4MFBA 4F9OA 4AF1A 1SV5A 3SK3A 1J6ZA 4NLBA 4DTXA 4IFEA 4BVPA 2ZM6K 1QQMA 1HJRA 3ZX3A 3MAQA 3D45A 3BUZB 3OYBA 3GG4A 3THVA 4JKEA 3OYDA 1TKDA 2IVNA 3K57A 4J2DA 2D5RA 3VETA 2WONA 5LMUK 1TL3A 4EFHA 2HVHA 4LFCK 1TK5A 1BO5O 3CFOA 3NF7A 3QBWA 3B8AX 4JD2B 1HX1A 5GADP 4X62K 3BP8A 3VQCA 1K6YA 1GOBA 4JI0K 3EE9A 2YNGA 3SUOA 2X6NA 5J1EA 3AGKA 4IBNA 4DV3K 2YHYA 4DU3A 3HK2A 4EAHD 2O8BB 1NKCA 3FGUA 3SUNA 2DFEA 3FZMA 4DLEA 1XC3A 3RMAA 2PYLA 1ZBLA 4KBOA 2HMIA 1OVYA 2ASOA 5CYMA 4DSKA 1U47A 5EVZA 5KGXA 4JV5K 1TL1A 3TSQA 4B1VA 2GEMA 2BE2A 4FJNA 4H5VA 3ISNC 2E2QA 2P51A 4LY7A 3J80O 1NK4A 1U2VB 4BRDA 2P9NB 5AQUA 3T1AA 2Q1NA 3S41A 4FWPA 4DB3A 2HHUA 2W41A 3HP6A 1WBBA 1VSJA 2RF2A 4Y1DA 2Z1JA 4K8ZA 3O3FA 3AO5A 4YOTA 1YIJN 3ZCMA 1RTIA 3ZETB 1DT9A 3KWIA 2FBYA 4XIUA 1TKXA 3ZT1A 4IEIA 4O5BA 2DFFA 3PO5A 3P38A 4O5FA 1N8RO 3MEEA 3OYCA 4QCLA 3NBPA 4FWKA 3L2RA 1QTMA 2UUCK 4FJIA 2IVOA 2ITMA 4QS7A 4DKWA 4B9SA 2E2NA 3FR0A 4H5RA 3H45C 1HQUA 1XMOK 3RRHA 1RNHA 3QEVA 5E84A 4M3WA 2PAVA 4YORA 2F8TA 2IIRA 2RE2A 1E4FT 4DV7K 1U04A 3J81O 1NK5A 2WUSA 4WQ4C 1N36K 3MWTA 3NF6A 2ETJA 2CGLA 4AQYK 3ZT0A 2RN2A 4N47A 1NU0A 2XY7A 4E1NA 4M42A 1HQEA 2JWKA 1RT4A 4E7KA 2KKZA 4FVMA 1DEJA 3ID6A 3QDKA 3U9ZA 1NGCA 2BH1A 4DTMA 3DYAA 2KFZA 1X3NA 5JS2A 3AVAA 2UUAK 4BRLA 3CI5A 1YUWA 3FFIA 2O8EB 1HLUA 4K43A 2GTDA 3AVHA 4CBWA 1WSHA 4PL7A 3PLAA 2ZGYA 3CHWA 4BY9C 1QZ5A 3O8MA 3RR8A 1NK8A 4FZXC 4CI6A 1IG8A 1Q81O 3SV3A 1C0TA 5MLCQ 3CM6A 4K42A 3VEVA 4HUFA 3SUQA 4KTQA 3QFUA 2ATQA 1T8EA 1KSPA 1QE1A 3LPUA 2ZJPL 4CK2A 4FJJA 1HPZA 2OYQA 1IH7A 3HVTA 1KVAA 3U3YA 3ZSXA 3LWLA 4CGDA 3MN9A 3QEPA 1UOCA 4B3SK 1WUAA 3H6EA 3KHYA 3BF1A 5F0XA 1ZXOA 1JL2A 2AA4A 1NM1A 1NGAA 3CCLN 4KHQA 1KAYA 3V1RA 4CBXA 1L3SA 2HF4A 3KK7A 1J5EK 3VQ9A 3DRRA 1XMQK 3NE6A 3SBTA 4BGAA 4DV5K 1BI4B 4B9MA 2QM1A 1C1CA 1Z05A 3KK2A 5BRFA 3G71N 4IWVA 3FZHA 4GVEA 5GIPA 3NCIA 1WB9A 3HZ6A 4DSJA 4K8XA 4PQUA 2J4RA 2HBJA 3OW2M 4CERA 2YI1A 3JYTA 1IBLK 1K73O 4ZHRA 2QK9A 1MWKA 5BREA 2VYPA 3AARA 4JHDB 3UKUA 3AO4A 1RBRA 2GWJA 1RILA 4JS4A 1WSEA 3KLGA 4ICLA 5AQQA 3FFKB 3C6HA 4J2AA 3U8XA 4CD3A 4W5TA 1W9HA 4NB4A 3I0RA 2ZD1A 4OGCA 4JI2K 3NAEA 3VEOA 5DK5A 3RRGA 5C24A 1LWFA 3K58A 1SKSA 3D7EO 2Q2RA 4OVLA 4CHOA 5AQKA 4IO9L 4J2EA 3GBTA 4HHTA 3SPYA 1WBDA 4F4KA 2E1ZA 5KPTA 3W0LA 1NGEA 3OHRA 4DV1K 1C0UA 1S6PA 3GL1A 1QSYA
chains in the Genus database with same CATH topology
4FK0A 2G8VA 4CJVA 4KTZA 1WSJA 5HRRA 4C8NA 4CJTA 1BIZA 3AVCA 5K14A 3V81A 2Z1HA 3AVIA 4OGEA 4DMNA 4FW1A 4CEQA 3I0SA 1NJZA 3CFRA 2XRIA 1HYVA 4FJXA 1TK8A 1JLCA 4B9LA 1GOCA 4F2RA 1DTTA 4DF8A 1CZBA 1FXXA 1R0AA 3L8BA 4PY5A 4N5SA 4CJFA 4CJQA 3EZ5A 3C95A 1ASWA 4RG8A 4CJ5A 2E6LA 1BL3A 4H4MA 2X6SA 3OYLA 2HNYA 4KHUA 5C25A 3RMBA 1KVCA 1NK9A 1F21A 1RBSA 1LW0A 1VSHA 1J54A 2XY8A 3DRSA 4CFBA 1T03A 4FM2A 3LZJA 4B8AB 4DTNA 4E19A 1NJWA 2YNFA 5J2NA 3RWUA 5KGWA 1JXBA 4HUGA 4EZ6A 4CFCA 3KLIA 4N76A 4KTWA 2KFNA 4DSFA 2GV9A 4CFAA 3HP9A 1NOZA 3IS9A 4CEEA 4DQPA 3QEIA 3IAYA 1YTAA 2QKBA 1JLAA 3ASMA 5HBMA 4C8OA 3S9HA 1BI4A 2OPSA 4CHQA 2VWKA 1NKBA 5EU7A 3PO4A 2YV0X 3TR8A 1S9GA 4PA1A 2HNZA 3P83D 4DWIA 5C42A 3CFPA 1HYZA 3NF9A 4CJRA 3C94A 4W5QA 1FKOA 3K2PA 5J2QA 2G8WA 4DTUA 4ELUA 2B6AA 1LAWA 4CESA 4JRQA 4OPJA 4KV8A 3T19A 4BDZA 1ZBFA 3MXIA 1EETA 4H8KA 5J2PA 4FXDA 4IDKA 5FRNA 2IC3A 2NUBA 1WAJA 4DQSA 1BHLA 4NYFA 4QAGA 4CJEA 2O4IA 1U45A 4N41A 2IOCA 4O0IA 1RT2A 4FM0A 4F8RA 1RBTA 4FJKA 4M3TA 4B9VA 4ELVA 4DSLA 4CGHA 4CJSA 4LSNA 3LAMA 3U6FA 1VRTA 3RMCA 5SZTA 4RW9A 3OYHA 4KHYA 1S1UA 4E3SA 4M3RA 3EY1A 2VWJA 3K5NA 1BCOA 3IG1A 3T3FA 1SL2A 1A5VA 1EX4A 1LAVA 4E7LA 3TAPA 4YNQA 5KTQA 1YTUA 4KREA 4OLAA 4AHRA 4CGGA 3AV9A 3AVJA 3QIOA 1IKXA 1VSKA 1Z26A 1J5OA 4M3XA 4Z4IA 4F3TA 2ITGA 4HTUA 1CLQA 4E1MA 1BGXT 4B9UA 1C6VA 3KK3A 1NJYA 3F73A 4DFKA 1ZBHA 1SUQA 1VSEA 4FLVA 1JLGA 3HM9A 4AHVA 2G8UA 1DLOA 4KKOA 2I5JA 1U4BA 1RBVA 1KFSA 2XO7A 2EHGA 4FJ7A 1RT5A 3O3GA 2Y1JA 3QETA 3ZSRA 1S1XA 1XI1A 3B6PA 4I9QA 4PWDA 3C6UA 1KLMA 4I2PA 4B9NA 3O4QA 3AVLA 3DLHA 4KRFA 4CHYA 3QEXA 4CF8A 1T7PA 3KD1E 3QINA 3HJFA 4KHSA 3ZT4A 4Z0UA 3L2VA 4FW2A 1YT3A 3AVMA 1TAQA 3L3UA 4OJRA 2XHBA 3VQ7A 4BE1A 1S6QA 1BQMA 1KFDA 1CXUA 3SNNA 3ZT3A 1RDCA 4EP4A 3SCXA 3SJJA 1UAXA 4G1QA 4RW7A 3HVRA 1Q9XA 3AO1A 4CJLA 3V1QA 2YKNA 3BGRA 4NCBA 3CYMA 1QS4A 4CK3A 5HLFA 1TVRA 4FM1A 1UWBA 3KLEA 1RTDA 4L8RB 1D9DA 2OA8A 1CZ9A 1VSIA 4AHSA 1YVUA 2KTQA 4JS5A 4BACA 1S1TA 3ZSVA 3QNOA 3TABA 2LSNA 3LP1A 2R7YA 1NJXA 1HRHA 3AA5X 1D8YA 1W0HA 2FC0A 2EX3A 2KQ2A 4DQIA 4WE1A 4CF9A 3NDKA 2IS3A 4IFYA 3NGIA 4GW6A 2KZMA 4KAZA 2AJQA 1JXEA 1WN7A 2FBVA 3DLRA 3AA2A 4CJUA 4DS4A 1NK7A 4Z4GA 1G15A 1VK0A 4E7JA 4OLBA 1TAUA 4B08A 2P5OA 4KB0A 4FLUA 4CHZA 3LAKA 5KRTA 5KRSA 1LW2A 1WLJA 2YNHA 4FLTA 4W5OA 3S3NA 4FYDA 2DY4A 1U48A 3TI0A 4C8MA 4R5PA 3TAMA 1B9FA 1RBUA 3SPZA 4M45A 4MFBA 1FK9A 5CZ1A 4KB1A 4EP5A 2HHXA 1D5AA 3DOLA 3SQ0A 1ASUA 1SV5A 1NK0A 4DLGA 1MU2A 3NFAA 3F9KA 4E89A 4DTXA 2BDPA 3U3GA 4DSEA 4DFJA 3AO2A 1HJRA 3G0ZA 3MAQA 3V9UA 3D45A 3OYBA 4FJHA 1LWEA 1RT6A 3THVA 4GVMA 3HXMA 1WSFA 4CHPA 3OYDA 1S9EA 4E0DA 3V9ZA 1SKRA 1UA0A 1TKDA 4FJGA 3LP2A 5FDLA 3K57A 1BIUA 1TKTA 1IG9A 4J2DA 1KRPA 2HHTA 3ZSZA 1LWCA 2D5RA 1JLQA 4TSXA 2HHQA 4Q5VA 2QKKA 2WONA 1TL3A 3OYIA 2HVHA 2OZSA 1TK5A 3AA3A 1L3VA 1XHXA 4BDPA 3DLGA 1A5WA 3CFOA 4PUOA 3NF7A 1NOYA 2X74A 1ITGA 5HRNA 4EZ9A 3O3HA 4DTRA 2VG7A 4OPKA 4DTPA 3CG7A 4IKFA 4KFBA 3P5JA 5DMRA 3OS1A 4B3OA 3VQCA 3KKRA 3OJUA 3VA0A 3MXMA 1RT3A 1K6YA 3S3OA 1GOBA 4HUEA 4M3YA 2QXFA 3K5OA 4LSLA 2RPIA 2YNGA 3CM5A 5CY4A 3TAGA 1JKHA 3SZ2A 2YNIA 2PYJA 3SUOA 1HNVA 2X6NA 3ZSOA 5J1EA 4FJMA 3NH2A 1XHZA 4KI6A 4IBNA 1C0MA 4AILC 1WAFA 2JLEA 2ZE2A 4DU3A 3HK2A 1WSIA 4I9LA 3KK1A 3OVNA 1C1BA 4BWMA 3ZSWA 4BE2A 5CZ2A 4FLYA 1A5XA 3TAEA 1NKCA 3SUNA 2XY6A 2DFEA 4DLEA 1IKVA 1S1VA 3RMAA 1KCFA 1SKWA 2PYLA 1ZBLA 1S5JA 3KIOA 3PX0A 2HMIA 2OPPA 4FLWA 5CYMA 3E01A 4DSKA 1U47A 5KGXA 3CQ8A 3SQ4A 4ID1A 4M3UA 4ID5A 1TL1A 2G8HA 1IO2A 3OYJA 1L3UA 3VQ8A 4DFMA 4BE0A 4FLZA 2X78A 1KVBA 2BE2A 1FKPA 3C6TA 3QNNA 3TAQA 5I42A 4FJNA 3ISNC 2P51A 4LY7A 3L2UA 1X1PA 1NK4A 4AHCA 3G10A 4CIGA 4CECA 4CJ3A 3T1AA 4CJPA 4QOZB 1WSGA 1HYSA 2HHUA 2PZSA 3HP6A 5JS1A 1WNSA 3KLHA 3SYZA 4DQQA 1VSJA 2F96A 2RF2A 2Z1JA 4Y1DA 3O3FA 5HP1A 4K8ZA 3AO5A 1ASVA 3VQQA 3VQEA 1BQNA 2Y1IA 1U49A 1L5UA 2G8FA 3ZCMA 1RTIA 2D0CA 3LPTA 4CK1A 3PUFA 3OJSA 3RR7A 3DOKA 3SI6A 3KD5E 2FBYA 4XIUA 1TKXA 3ZT1A 4IFVA 1I39A 4CGIA 3SQ1A 3VQ4A 4CHNA 3K59A 4MQ3A 4CIFA 4O5BA 2DFFA 3PO5A 4FZYA 4DTSA 2FBTA 4BWJA 3WNFA 3HPOA 3MEEA 2GUIA 3WNHA 3NBPA 4CGJA 3OYCA 3VA3A 4QCLA 3L2RA 2G8KA 3EYZA 4FLXA 1QTMA 4LH4A 4FJIA 2OPQA 5E41A 4C8KA 3AVFA 5J2MA 2YHBA 1RDDA 4B9SA 2HNDA 2PY5A 3KJVA 2D0BA 4OKJA 1B9DA 1HQUA 3AVBA 1X9WA 3V9SA 2WOMA 3QESA 4CFDA 1JLFA 3RRHA 3HYFA 1RNHA 3QEVA 3QLHA 2E6MA 4DTOA 4O0JA 3L2WA 1RDBA 2HHVA 3IRXA 2E4LA 3JSMA 2B4JA 4JLHA 3ZSQA 3V4IA 2GBZA 3DMJA 4M3WA 2DFHA 4E7IA 1EP4A 4ZTFA 3TWHA 2F8TA 4J2BA 4HCBA 4KI4A 1IKYA 4DFPA 1UA1A 1X9SA 4CEDA 1D9FA 4KPYA 1U04A 1Q8IA 3LP0A 3KTQA 3QO9A 4B8CA 4W5RA 1NK5A 3HPHA 2HVIA 4DTJA 4GMJB 2HHWA 1SL0A 5HROA 1VSDA 2D0AA 2KZZA 3NF6A 3VQBA 1Q9YA 2ETJA 1KTQA 3ALYA 4AHUA 1JLBA 3ZT0A 2RN2A 4N47A 3AVKA 1X9MA 2VG6A 4F3OA 3QEWA 2XY7A 4H4OA 4E1NA 4M42A 2P5GA 1HQEA 3AA4A 4BDYA 2XY5A 5HRSA 4DG1A 3BDPA 1BISA 1RT4A 4OKKA 4E7KA 4FVMA 4OKEA 1I3AA 4DTMA 2KW4A 3KKSA 1B92A 3V6DA 1QHTA 3AO3A 3OS0A 4ZTJA 3DYAA 5SWMA 2KFZA 1N6QA 2RKIA 4N56A 3M8SA 5JS2A 4AH9A 2A1RA 3AVAA 2YHAA 1N5YA 4KHWA 1HMVA 1RTHA 1XC9A 3L2QA 3OYFA 4CF0A 3LDSA 4KO0A 5KI6A 3FFIA 4FCYA 3NF8A 2Z1IA 3AVHA 3PX6A 4YFUA 1WSHA 4FJ5A 3ULDA 2FBXA 4IG0A 4CGFA 3RMDA 2DTUA 3OY9A 1TGOA 3VQAA 3RR8A 3K5LA 1VSMA 3OYNA 1NK8A 3VQPA 4FZXC 2F8SA 1BCMA 3ZSYA 5D3GA 3NGYA 5FRMA 1Z25A 3OYEA 3NHGA 3TAFA 3MEGA 4FK2A 4NCAA 4FJ9A 3LP3A 3AVNA 3SV3A 1C0TA 3SUQA 3CM6A 3DLEA 4HUFA 4KTQA 2O4GA 3TANA 2ATQA 4CJKA 3OYAA 1T8EA 1QE1A 3LPUA 1KSPA 2P1JA 4CK2A 1QSSA 4FJJA 3QIPA 4RW8A 2IAJA 1HPZA 3PY8A 2OYQA 3A2FA 1ZBIA 4Z4EA 1IH7A 3K5MA 3D0PA 4NYNA 3HVTA 1KVAA 1REVA 2JGUA 3U3YA 3ZSXA 3LZIA 3LWLA 4CGDA 3HT3A 3QEPA 1UOCA 3WNEA 1EKEA 1HNIA 3V9WA 3HPGA 1JL1A 2B5JA 1SL1A 4ELTA 4F2SA 2BGGA 2HHSA 1ZBUA 4DU1A 4C8LA 4FJLA 1RT7A 4CE9A 3TARA 3O4NA 3P1GA 4Y1CA 5I3UA 4B9TA 3QERA 4KHNA 4FK4A 1JL2A 3VN5A 4HVJA 1TKZA 4UQGA 4KHQA 4FJ8A 1DTQA 1VSLA 3V1RA 3OYGA 3M8PA 1L3SA 3HO1A 2HW3A 3PV8A 1L3TA 4W5NA 3HL8A 4LH5A 2IGIA 3VQ9A 3NH1A 3DRRA 3NE6A 4CEFA 2IDOA 3LANA 1RDAA 4AHTA 4CIEA 4DU4A 1BI4B 4B9MA 4Q0BA 1C1CA 4Z4HA 3KLFA 3KK2A 3SV4A 3OYKA 4RW6A 3NH0A 3M8RA 4CEAA 4CJWA 4DF4A 1Y97A 1QSLA 3NCIA 4DSJA 4K8XA 4Z4FA 1TV6A 3SQ2A 3SUPA 4PQUA 4M41A 3MEDA 2Z1GA 3H08A 3NGZA 3DI6A 4NCGA 4CERA 1C1AA 1LV5A 3PX4A 3JYTA 3DRPA 3MXJA 3VQDA 4ZHRA 4I7FA 4LD0A 3OS2A 3V1OA 1NK6A 2QK9A 1CXQA 1J9AA 2ZQBA 1TK0A 3VQ6A 4E7HA 3L3VA 3AO4A 3DLKA 4RW4A 1KLNA 4JRPA 1ZYQA 1RBRA 2OPRA 4CEZA 1RILA 4JS4A 3RTVA 4CF1A 2OZMA 2Q3SA 1XWLA 1WSEA 3ITHA 3KLGA 3WNGA 1QQCA 4ICLA 5CYQA 3UIQA 3VQ5A 3OYMA 1T05A 4HCCA 4O4GA 4J2AA 4IG3A 2G8IA 2BANA 1VRUA 4CCHA 4W5TA 1W9HA 1VSFA 3I0RA 1RTJA 2A1SA 2ZD1A 4CEBA 3V9XA 4DQRA 4CF2A 4OGCA 3NAEA 3S3MA 5DK5A 2HB5A 4Z4CA 3RRGA 5C24A 1J53A 1O1WA 3M8QA 3MECA 3LWMA 5FROA 1JLEA 1GOAA 1LWFA 5T7BA 3K58A 1SKSA 1NKEA 3DLBA 4M3ZA 4OVLA 4CHOA 1IKWA 4DSIA 1S1WA 4J2EA 4O44A 3I8DA 2VG5A 4O55A 4HHTA 3SPYA 3HSTB 4FZZA 4I2QA 4F4KA 4CEOA 3B6OA 3LALA 4DS5A 5HRPA 1C0UA 1EXQA 1S6PA 3AVGA 1RCHA 1QSYA 2YKMA 1RT1A 4CJ4A 3ZT2A 3DM2A 2W42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FK0 A;  2G8V A;  4CJV A;  4KTZ A;  1WSJ A;  5HRR A;  4C8N A;  4CJT A;  1BIZ A;  3AVC A;  5K14 A;  3V81 A;  2Z1H A;  3AVI A;  4OGE A;  4DMN A;  4FW1 A;  4CEQ A;  3I0S A;  1NJZ A;  3CFR A;  2XRI A;  1HYV A;  4FJX A;  1TK8 A;  1JLC A;  4B9L A;  1GOC A;  4F2R A;  1DTT A;  4DF8 A;  1CZB A;  1FXX A;  1R0A A;  3L8B A;  4PY5 A;  4N5S A;  4CJF A;  4CJQ A;  3EZ5 A;  3C95 A;  1ASW A;  4RG8 A;  4CJ5 A;  2E6L A;  1BL3 A;  4H4M A;  2X6S A;  3OYL A;  2HNY A;  4KHU A;  5C25 A;  3RMB A;  1KVC A;  1NK9 A;  1F21 A;  1RBS A;  1LW0 A;  1VSH A;  1J54 A;  2XY8 A;  3DRS A;  4CFB A;  1T03 A;  4FM2 A;  3LZJ A;  4B8A B;  4DTN A;  4E19 A;  1NJW A;  2YNF A;  5J2N A;  3RWU A;  5KGW A;  1JXB A;  4HUG A;  4EZ6 A;  4CFC A;  3KLI A;  4N76 A;  4KTW A;  2KFN A;  4DSF A;  2GV9 A;  4CFA A;  3HP9 A;  1NOZ A;  3IS9 A;  4CEE A;  4DQP A;  3QEI A;  3IAY A;  1YTA A;  2QKB A;  1JLA A;  3ASM A;  5HBM A;  4C8O A;  3S9H A;  1BI4 A;  2OPS A;  4CHQ A;  2VWK A;  1NKB A;  5EU7 A;  3PO4 A;  2YV0 X;  3TR8 A;  1S9G A;  4PA1 A;  2HNZ A;  3P83 D;  4DWI A;  5C42 A;  3CFP A;  1HYZ A;  3NF9 A;  4CJR A;  3C94 A;  4W5Q A;  1FKO A;  3K2P A;  5J2Q A;  2G8W A;  4DTU A;  4ELU A;  2B6A A;  1LAW A;  4CES A;  4JRQ A;  4OPJ A;  4KV8 A;  3T19 A;  4BDZ A;  1ZBF A;  3MXI A;  1EET A;  4H8K A;  5J2P A;  4FXD A;  4IDK A;  5FRN A;  2IC3 A;  2NUB A;  1WAJ A;  4DQS A;  1BHL A;  4NYF A;  4QAG A;  4CJE A;  2O4I A;  1U45 A;  4N41 A;  2IOC A;  4O0I A;  1RT2 A;  4FM0 A;  4F8R A;  1RBT A;  4FJK A;  4M3T A;  4B9V A;  4ELV A;  4DSL A;  4CGH A;  4CJS A;  4LSN A;  3LAM A;  3U6F A;  1VRT A;  3RMC A;  5SZT A;  4RW9 A;  3OYH A;  4KHY A;  1S1U A;  4E3S A;  4M3R A;  3EY1 A;  2VWJ A;  3K5N A;  1BCO A;  3IG1 A;  3T3F A;  1SL2 A;  1A5V A;  1EX4 A;  1LAV A;  4E7L A;  3TAP A;  4YNQ A;  5KTQ A;  1YTU A;  4KRE A;  4OLA A;  4AHR A;  4CGG A;  3AV9 A;  3AVJ A;  3QIO A;  1IKX A;  1VSK A;  1Z26 A;  1J5O A;  4M3X A;  4Z4I A;  4F3T A;  2ITG A;  4HTU A;  1CLQ A;  4E1M A;  1BGX T;  4B9U A;  1C6V A;  3KK3 A;  1NJY A;  3F73 A;  4DFK A;  1ZBH A;  1SUQ A;  1VSE A;  4FLV A;  1JLG A;  3HM9 A;  4AHV A;  2G8U A;  1DLO A;  4KKO A;  2I5J A;  1U4B A;  1RBV A;  1KFS A;  2XO7 A;  2EHG A;  4FJ7 A;  1RT5 A;  3O3G A;  2Y1J A;  3QET A;  3ZSR A;  1S1X A;  1XI1 A;  3B6P A;  4I9Q A;  4PWD A;  3C6U A;  1KLM A;  4I2P A;  4B9N A;  3O4Q A;  3AVL A;  3DLH A;  4KRF A;  4CHY A;  3QEX A;  4CF8 A;  1T7P A;  3KD1 E;  3QIN A;  3HJF A;  4KHS A;  3ZT4 A;  4Z0U A;  3L2V A;  4FW2 A;  1YT3 A;  3AVM A;  1TAQ A;  3L3U A;  4OJR A;  2XHB A;  3VQ7 A;  4BE1 A;  1S6Q A;  1BQM A;  1KFD A;  1CXU A;  3SNN A;  3ZT3 A;  1RDC A;  4EP4 A;  3SCX A;  3SJJ A;  1UAX A;  4G1Q A;  4RW7 A;  3HVR A;  1Q9X A;  3AO1 A;  4CJL A;  3V1Q A;  2YKN A;  3BGR A;  4NCB A;  3CYM A;  1QS4 A;  4CK3 A;  5HLF A;  1TVR A;  4FM1 A;  1UWB A;  3KLE A;  1RTD A;  4L8R B;  1D9D A;  2OA8 A;  1CZ9 A;  1VSI A;  4AHS A;  1YVU A;  2KTQ A;  4JS5 A;  4BAC A;  1S1T A;  3ZSV A;  3QNO A;  3TAB A;  2LSN A;  3LP1 A;  2R7Y A;  1NJX A;  1HRH A;  3AA5 X;  1D8Y A;  1W0H A;  2FC0 A;  2EX3 A;  2KQ2 A;  4DQI A;  4WE1 A;  4CF9 A;  3NDK A;  2IS3 A;  4IFY A;  3NGI A;  4GW6 A;  2KZM A;  4KAZ A;  2AJQ A;  1JXE A;  1WN7 A;  2FBV A;  3DLR A;  3AA2 A;  4CJU A;  4DS4 A;  1NK7 A;  4Z4G A;  1G15 A;  1VK0 A;  4E7J A;  4OLB A;  1TAU A;  4B08 A;  2P5O A;  4KB0 A;  4FLU A;  4CHZ A;  3LAK A;  5KRT A;  5KRS A;  1LW2 A;  1WLJ A;  2YNH A;  4FLT A;  4W5O A;  3S3N A;  4FYD A;  2DY4 A;  1U48 A;  3TI0 A;  4C8M A;  4R5P A;  3TAM A;  1B9F A;  1RBU A;  3SPZ A;  4M45 A;  4MFB A;  1FK9 A;  5CZ1 A;  4KB1 A;  4EP5 A;  2HHX A;  1D5A A;  3DOL A;  3SQ0 A;  1ASU A;  1SV5 A;  1NK0 A;  4DLG A;  1MU2 A;  3NFA A;  3F9K A;  4E89 A;  4DTX A;  2BDP A;  3U3G A;  4DSE A;  4DFJ A;  3AO2 A;  1HJR A;  3G0Z A;  3MAQ A;  3V9U A;  3D45 A;  3OYB A;  4FJH A;  1LWE A;  1RT6 A;  3THV A;  4GVM A;  3HXM A;  1WSF A;  4CHP A;  3OYD A;  1S9E A;  4E0D A;  3V9Z A;  1SKR A;  1UA0 A;  1TKD A;  4FJG A;  3LP2 A;  5FDL A;  3K57 A;  1BIU A;  1TKT A;  1IG9 A;  4J2D A;  1KRP A;  2HHT A;  3ZSZ A;  1LWC A;  2D5R A;  1JLQ A;  4TSX A;  2HHQ A;  4Q5V A;  2QKK A;  2WON A;  1TL3 A;  3OYI A;  2HVH A;  2OZS A;  1TK5 A;  3AA3 A;  1L3V A;  1XHX A;  4BDP A;  3DLG A;  1A5W A;  3CFO A;  4PUO A;  3NF7 A;  1NOY A;  2X74 A;  1ITG A;  5HRN A;  4EZ9 A;  3O3H A;  4DTR A;  2VG7 A;  4OPK A;  4DTP A;  3CG7 A;  4IKF A;  4KFB A;  3P5J A;  5DMR A;  3OS1 A;  4B3O A;  3VQC A;  3KKR A;  3OJU A;  3VA0 A;  3MXM A;  1RT3 A;  1K6Y A;  3S3O A;  1GOB A;  4HUE A;  4M3Y A;  2QXF A;  3K5O A;  4LSL A;  2RPI A;  2YNG A;  3CM5 A;  5CY4 A;  3TAG A;  1JKH A;  3SZ2 A;  2YNI A;  2PYJ A;  3SUO A;  1HNV A;  2X6N A;  3ZSO A;  5J1E A;  4FJM A;  3NH2 A;  1XHZ A;  4KI6 A;  4IBN A;  1C0M A;  4AIL C;  1WAF A;  2JLE A;  2ZE2 A;  4DU3 A;  3HK2 A;  1WSI A;  4I9L A;  3KK1 A;  3OVN A;  1C1B A;  4BWM A;  3ZSW A;  4BE2 A;  5CZ2 A;  4FLY A;  1A5X A;  3TAE A;  1NKC A;  3SUN A;  2XY6 A;  2DFE A;  4DLE A;  1IKV A;  1S1V A;  3RMA A;  1KCF A;  1SKW A;  2PYL A;  1ZBL A;  1S5J A;  3KIO A;  3PX0 A;  2HMI A;  2OPP A;  4FLW A;  5CYM A;  3E01 A;  4DSK A;  1U47 A;  5KGX A;  3CQ8 A;  3SQ4 A;  4ID1 A;  4M3U A;  4ID5 A;  1TL1 A;  2G8H A;  1IO2 A;  3OYJ A;  1L3U A;  3VQ8 A;  4DFM A;  4BE0 A;  4FLZ A;  2X78 A;  1KVB A;  2BE2 A;  1FKP A;  3C6T A;  3QNN A;  3TAQ A;  5I42 A;  4FJN A;  3ISN C;  2P51 A;  4LY7 A;  3L2U A;  1X1P A;  1NK4 A;  4AHC A;  3G10 A;  4CIG A;  4CEC A;  4CJ3 A;  3T1A A;  4CJP A;  4QOZ B;  1WSG A;  1HYS A;  2HHU A;  2PZS A;  3HP6 A;  5JS1 A;  1WNS A;  3KLH A;  3SYZ A;  4DQQ A;  1VSJ A;  2F96 A;  2RF2 A;  2Z1J A;  4Y1D A;  3O3F A;  5HP1 A;  4K8Z A;  3AO5 A;  1ASV A;  3VQQ A;  3VQE A;  1BQN A;  2Y1I A;  1U49 A;  1L5U A;  2G8F A;  3ZCM A;  1RTI A;  2D0C A;  3LPT A;  4CK1 A;  3PUF A;  3OJS A;  3RR7 A;  3DOK A;  3SI6 A;  3KD5 E;  2FBY A;  4XIU A;  1TKX A;  3ZT1 A;  4IFV A;  1I39 A;  4CGI A;  3SQ1 A;  3VQ4 A;  4CHN A;  3K59 A;  4MQ3 A;  4CIF A;  4O5B A;  2DFF A;  3PO5 A;  4FZY A;  4DTS A;  2FBT A;  4BWJ A;  3WNF A;  3HPO A;  3MEE A;  2GUI A;  3WNH A;  3NBP A;  4CGJ A;  3OYC A;  3VA3 A;  4QCL A;  3L2R A;  2G8K A;  3EYZ A;  4FLX A;  1QTM A;  4LH4 A;  4FJI A;  2OPQ A;  5E41 A;  4C8K A;  3AVF A;  5J2M A;  2YHB A;  1RDD A;  4B9S A;  2HND A;  2PY5 A;  3KJV A;  2D0B A;  4OKJ A;  1B9D A;  1HQU A;  3AVB A;  1X9W A;  3V9S A;  2WOM A;  3QES A;  4CFD A;  1JLF A;  3RRH A;  3HYF A;  1RNH A;  3QEV A;  3QLH A;  2E6M A;  4DTO A;  4O0J A;  3L2W A;  1RDB A;  2HHV A;  3IRX A;  2E4L A;  3JSM A;  2B4J A;  4JLH A;  3ZSQ A;  3V4I A;  2GBZ A;  3DMJ A;  4M3W A;  2DFH A;  4E7I A;  1EP4 A;  4ZTF A;  3TWH A;  2F8T A;  4J2B A;  4HCB A;  4KI4 A;  1IKY A;  4DFP A;  1UA1 A;  1X9S A;  4CED A;  1D9F A;  4KPY A;  1U04 A;  1Q8I A;  3LP0 A;  3KTQ A;  3QO9 A;  4B8C A;  4W5R A;  1NK5 A;  3HPH A;  2HVI A;  4DTJ A;  4GMJ B;  2HHW A;  1SL0 A;  5HRO A;  1VSD A;  2D0A A;  2KZZ A;  3NF6 A;  3VQB A;  1Q9Y A;  2ETJ A;  1KTQ A;  3ALY A;  4AHU A;  1JLB A;  3ZT0 A;  2RN2 A;  4N47 A;  3AVK A;  1X9M A;  2VG6 A;  4F3O A;  3QEW A;  2XY7 A;  4H4O A;  4E1N A;  4M42 A;  2P5G A;  1HQE A;  3AA4 A;  4BDY A;  2XY5 A;  5HRS A;  4DG1 A;  3BDP A;  1BIS A;  1RT4 A;  4OKK A;  4E7K A;  4FVM A;  4OKE A;  1I3A A;  4DTM A;  2KW4 A;  3KKS A;  1B92 A;  3V6D A;  1QHT A;  3AO3 A;  3OS0 A;  4ZTJ A;  3DYA A;  5SWM A;  2KFZ A;  1N6Q A;  2RKI A;  4N56 A;  3M8S A;  5JS2 A;  4AH9 A;  2A1R A;  3AVA A;  2YHA A;  1N5Y A;  4KHW A;  1HMV A;  1RTH A;  1XC9 A;  3L2Q A;  3OYF A;  4CF0 A;  3LDS A;  4KO0 A;  5KI6 A;  3FFI A;  4FCY A;  3NF8 A;  2Z1I A;  3AVH A;  3PX6 A;  4YFU A;  1WSH A;  4FJ5 A;  3ULD A;  2FBX A;  4IG0 A;  4CGF A;  3RMD A;  2DTU A;  3OY9 A;  1TGO A;  3VQA A;  3RR8 A;  3K5L A;  1VSM A;  3OYN A;  1NK8 A;  3VQP A;  4FZX C;  2F8S A;  1BCM A;  3ZSY A;  5D3G A;  3NGY A;  5FRM A;  1Z25 A;  3OYE A;  3NHG A;  3TAF A;  3MEG A;  4FK2 A;  4NCA A;  4FJ9 A;  3LP3 A;  3AVN A;  3SV3 A;  1C0T A;  3SUQ A;  3CM6 A;  3DLE A;  4HUF A;  4KTQ A;  2O4G A;  3TAN A;  2ATQ A;  4CJK A;  3OYA A;  1T8E A;  1QE1 A;  3LPU A;  1KSP A;  2P1J A;  4CK2 A;  1QSS A;  4FJJ A;  3QIP A;  4RW8 A;  2IAJ A;  1HPZ A;  3PY8 A;  2OYQ A;  3A2F A;  1ZBI A;  4Z4E A;  1IH7 A;  3K5M A;  3D0P A;  4NYN A;  3HVT A;  1KVA A;  1REV A;  2JGU A;  3U3Y A;  3ZSX A;  3LZI A;  3LWL A;  4CGD A;  3HT3 A;  3QEP A;  1UOC A;  3WNE A;  1EKE A;  1HNI A;  3V9W A;  3HPG A;  1JL1 A;  2B5J A;  1SL1 A;  4ELT A;  4F2S A;  2BGG A;  2HHS A;  1ZBU A;  4DU1 A;  4C8L A;  4FJL A;  1RT7 A;  4CE9 A;  3TAR A;  3O4N A;  3P1G A;  4Y1C A;  5I3U A;  4B9T A;  3QER A;  4KHN A;  4FK4 A;  1JL2 A;  3VN5 A;  4HVJ A;  1TKZ A;  4UQG A;  4KHQ A;  4FJ8 A;  1DTQ A;  1VSL A;  3V1R A;  3OYG A;  3M8P A;  1L3S A;  3HO1 A;  2HW3 A;  3PV8 A;  1L3T A;  4W5N A;  3HL8 A;  4LH5 A;  2IGI A;  3VQ9 A;  3NH1 A;  3DRR A;  3NE6 A;  4CEF A;  2IDO A;  3LAN A;  1RDA A;  4AHT A;  4CIE A;  4DU4 A;  1BI4 B;  4B9M A;  4Q0B A;  1C1C A;  4Z4H A;  3KLF A;  3KK2 A;  3SV4 A;  3OYK A;  4RW6 A;  3NH0 A;  3M8R A;  4CEA A;  4CJW A;  4DF4 A;  1Y97 A;  1QSL A;  3NCI A;  4DSJ A;  4K8X A;  4Z4F A;  1TV6 A;  3SQ2 A;  3SUP A;  4PQU A;  4M41 A;  3MED A;  2Z1G A;  3H08 A;  3NGZ A;  3DI6 A;  4NCG A;  4CER A;  1C1A A;  1LV5 A;  3PX4 A;  3JYT A;  3DRP A;  3MXJ A;  3VQD A;  4ZHR A;  4I7F A;  4LD0 A;  3OS2 A;  3V1O A;  1NK6 A;  2QK9 A;  1CXQ A;  1J9A A;  2ZQB A;  1TK0 A;  3VQ6 A;  4E7H A;  3L3V A;  3AO4 A;  3DLK A;  4RW4 A;  1KLN A;  4JRP A;  1ZYQ A;  1RBR A;  2OPR A;  4CEZ A;  1RIL A;  4JS4 A;  3RTV A;  4CF1 A;  2OZM A;  2Q3S A;  1XWL A;  1WSE A;  3ITH A;  3KLG A;  3WNG A;  1QQC A;  4ICL A;  5CYQ A;  3UIQ A;  3VQ5 A;  3OYM A;  1T05 A;  4HCC A;  4O4G A;  4J2A A;  4IG3 A;  2G8I A;  2BAN A;  1VRU A;  4CCH A;  4W5T A;  1W9H A;  1VSF A;  3I0R A;  1RTJ A;  2A1S A;  2ZD1 A;  4CEB A;  3V9X A;  4DQR A;  4CF2 A;  4OGC A;  3NAE A;  3S3M A;  5DK5 A;  2HB5 A;  4Z4C A;  3RRG A;  5C24 A;  1J53 A;  1O1W A;  3M8Q A;  3MEC A;  3LWM A;  5FRO A;  1JLE A;  1GOA A;  1LWF A;  5T7B A;  3K58 A;  1SKS A;  1NKE A;  3DLB A;  4M3Z A;  4OVL A;  4CHO A;  1IKW A;  4DSI A;  1S1W A;  4J2E A;  4O44 A;  3I8D A;  2VG5 A;  4O55 A;  4HHT A;  3SPY A;  3HST B;  4FZZ A;  4I2Q A;  4F4K A;  4CEO A;  3B6O A;  3LAL A;  4DS5 A;  5HRP A;  1C0U A;  1EXQ A;  1S6P A;  3AVG A;  1RCH A;  1QSY A;  2YKM A;  1RT1 A;  4CJ4 A;  3ZT2 A;  3DM2 A;  2W42 A; 
#chains in the Genus database with same CATH topology
 4LF6 K;  2G8V A;  5HRR A;  4C8N A;  4FW1 A;  4CEQ A;  3I0S A;  3CFR A;  2XRI A;  1HYV A;  1TK8 A;  4BRH A;  4CJQ A;  3EZ5 A;  2E6L A;  2V52 B;  3M6G A;  1BL3 A;  4JKB A;  2O8D A;  3RMB A;  1TUU A;  3CCE N;  1LW0 A;  2PBD A;  3LZJ A;  4DTN A;  2YNF A;  3N4Q A;  3RWU A;  4HUG A;  4EZ6 A;  2GV9 A;  4B3M K;  4XEI A;  3QEI A;  3IAY A;  5HBM A;  4C8O A;  4ISE A;  3W3D A;  3S9H A;  3ENH A;  4CHQ A;  3PO4 A;  1SAZ A;  3PIO L;  4IXC A;  2HNZ A;  3THX B;  5C42 A;  4JK7 A;  3CFP A;  4JI6 K;  4WQ5 A;  4DTU A;  4LF4 K;  4OPJ A;  3ZYY X;  4H8K A;  4PHT X;  5FRN A;  1VQ8 N;  4FSV A;  2I7N A;  3MWP A;  3O5B A;  4LFA K;  4G9Z A;  4CBU A;  2YCH A;  4H5W A;  3SAH A;  3KVG A;  1HNZ K;  3RMC A;  3MCP A;  1ATS A;  3HBT A;  1QQN A;  1TUY A;  4BRI A;  1YVN A;  1A5V A;  4E7L A;  4IZ9 A;  4JI5 K;  2ZGZ A;  3AVJ A;  1QZ6 A;  1J5O A;  1IKX A;  4Z4I A;  3CIP A;  1CLQ A;  1BGX T;  1C6V A;  4DFK A;  1VSE A;  4FLV A;  3HM9 A;  1DLO A;  3OA9 A;  3I56 N;  4I6M A;  2FF3 B;  4X66 K;  2XO7 A;  2EHG A;  4O8K A;  1RT5 A;  2Y1J A;  1BA0 A;  2E8A A;  2WBN A;  2F9T A;  3O80 A;  4Y0W A;  3AVL A;  1FW6 A;  4BGB A;  3ZT4 A;  4Z0U A;  1TAQ A;  3MX5 A;  3T7Z A;  1S6Q A;  1CXU A;  1ATN A;  4EP4 A;  3SCX A;  3SJJ A;  3ZX2 A;  4CZI A;  5A2Q O;  2ASM A;  1TVR A;  1RTD A;  2QWP A;  1SZ2 A;  1VSI A;  4AHS A;  3K9J A;  5KPR A;  1YVU A;  4JS5 A;  3VEY A;  3ZSV A;  3QNO A;  1NJX A;  2EX3 A;  2KQ2 A;  3CQY A;  3CJB A;  4WE1 A;  5BR8 K;  4NO7 A;  4GW6 A;  2HBL A;  4JKF A;  3M5R A;  1WN7 A;  3A5N C;  3DLR A;  4CJU A;  1C0F A;  3AA2 A;  1VK0 A;  4OLB A;  4KB0 A;  4LF5 K;  4CHZ A;  5KRT A;  5KRS A;  1WLJ A;  4WFN L;  4FYD A;  3S3N A;  2CGJ A;  3TI0 A;  3TAM A;  1B9F A;  1OVQ A;  1RBU A;  3SPZ A;  4HTL A;  5I9E B;  4KB1 A;  4MDA A;  4EP5 A;  1NK0 A;  4DLG A;  1MU2 A;  4E89 A;  5B8H A;  1RDU A;  1VQL N;  4DSE A;  3H3O B;  3AO2 A;  2OAN A;  1DGK N;  4FJH A;  1NGF A;  4CHP A;  1X3M A;  4GV6 A;  1S9E A;  4E0D A;  1SKR A;  3THY A;  5FDL A;  5AZI A;  3C7N A;  3CQX A;  5M1N A;  2HHT A;  2YHW A;  3ZSZ A;  1VQM N;  1LWC A;  1JLQ A;  3F5T A;  4DR2 K;  3D2F A;  1K9M O;  3OYI A;  4JNE A;  4V19 S;  3AA3 A;  1L3V A;  2V7Z A;  5BPN A;  4PUO A;  4H0P A;  2X74 A;  1ITG A;  5HRN A;  4EZ9 A;  3O3H A;  2P9P A;  4KFB A;  1I94 K;  3KKR A;  4FWO A;  1RT3 A;  1RDW X;  4HUE A;  5C10 A;  3K5O A;  2RPI A;  3CM5 A;  1K8K A;  3O9S A;  2YNI A;  1HNV A;  3ATV A;  4IJN A;  3O08 A;  4JI4 K;  3P31 A;  4AIL C;  1VQO N;  1WSI A;  4OLA A;  4BWM A;  5LJV A;  4BE2 A;  3TAE A;  4O8U A;  4HWI A;  1IV0 A;  1A5X A;  5AZJ A;  1IKV A;  1SKW A;  1KCF A;  5IWA K;  2PFU A;  3OYJ A;  3JS6 A;  4DUY K;  1FKP A;  3EL2 A;  1V4S A;  5I42 A;  2VCP A;  1NMD A;  3U4L A;  1BG3 A;  4CZE A;  4AHC A;  3WXL A;  4CEC A;  4CJP A;  1HYS A;  1WSG A;  4JN4 A;  3PSI A;  2PZS A;  3SYZ A;  3KLH A;  4GV3 A;  4H03 B;  3ENB A;  1N33 K;  4DHY A;  4BC2 A;  4CK1 A;  3DOK A;  1JCG A;  2BTF A;  3KD5 E;  2ASP A;  5JMV A;  2NRT A;  3K59 A;  4FZY A;  2HHS A;  2FBT A;  3WNF A;  4DR3 K;  3HPO A;  3VA3 A;  2GUI A;  4CZL A;  4IO8 A;  4LH4 A;  3C65 A;  4JI1 K;  5E41 A;  1RDD A;  2PY5 A;  3ZLJ A;  5AQM A;  4OKJ A;  4CZJ A;  3QES A;  2WOM A;  4CFD A;  3MN7 A;  1T3V A;  4DTO A;  5AQI A;  2O8C A;  3IRX A;  2NNW A;  3JSM A;  1ESV A;  2DFH A;  3TSP A;  1BU6 O;  1EP4 A;  2A41 A;  3R8E A;  4JYA K;  4CZM A;  4B1X B;  1UA1 A;  1D9F A;  3CC2 N;  3F2K A;  4A2B A;  3KTQ A;  3QO9 A;  4B8C A;  4W5R A;  5EXW A;  4DTJ A;  4GMJ B;  1VSD A;  5TKY A;  3VQB A;  1Q9Y A;  4BQZ A;  1Z6R A;  4YDU C;  3AVK A;  1X9M A;  1MWM A;  2VG6 A;  4F3O A;  2P9I A;  3E66 A;  3UKU B;  2P5G A;  3OTO K;  4MLH A;  3BDP A;  4PKH A;  4CZH A;  4YOW A;  1QHT A;  2RKI A;  2GEL A;  4BRO A;  4N56 A;  1H1V A;  3J7Z O;  3E9P A;  1KC8 O;  1HMV A;  3SAF A;  3HRG A;  1XC9 A;  3OYF A;  4CF0 A;  3G4S N;  4KO0 A;  5KI6 A;  4FCY A;  2Z1I A;  4GKK K;  4FJ5 A;  5AQY A;  3WEE A;  2FBX A;  1S72 N;  5BN9 A;  3OY9 A;  2ZJR L;  1TGO A;  1MA9 B;  1VSM A;  1FJG K;  3R3L A;  5DM7 L;  2F8S A;  2OTJ N;  3SLC A;  3MEG A;  2W6L A;  4NLC A;  4FJ9 A;  1HJO A;  3LP3 A;  3WXI A;  1E4G T;  3EE8 A;  1W2B M;  1ZC6 A;  1VQK N;  3DXM A;  3TPQ A;  3CJA A;  1QSS A;  3QIP A;  2P9K A;  2HF3 A;  3A2F A;  3D0P A;  2JGU A;  3CER A;  3LZI A;  5AQH A;  1EKE A;  3V9W A;  3HPG A;  2B5J A;  1SL1 A;  4F2S A;  2BGG A;  4DU1 A;  4C8L A;  4FJL A;  5KQD A;  1RT7 A;  3D6R A;  3H1V X;  3TAR A;  3P1G A;  4Y1C A;  2O8D B;  3VER A;  5I3U A;  3QER A;  4B9T A;  1OKJ A;  4A5A A;  4HVJ A;  1TKZ A;  4FJ8 A;  1DTQ A;  1VSL A;  1CZA N;  3M8P A;  4K0K K;  1YF5 L;  1NMN A;  3AAQ A;  4LH5 A;  2IGI A;  2D0O A;  4MO4 A;  3RSE A;  4FO0 A;  4CEF A;  4KH4 A;  1RDA A;  4BRM A;  4CIE A;  2NRW A;  4RW6 A;  3D2E A;  4NXM K;  4CJW A;  4DF4 A;  1ILY A;  1TV6 A;  2Z1G A;  3NGZ A;  1LV5 A;  1C1A A;  3O4W A;  3PX4 A;  4BG9 A;  3FLC O;  4I7F A;  3TU5 A;  1NK6 A;  1MDU B;  1CXQ A;  1J9A A;  3LDO A;  4E7H A;  3L3V A;  3NVK A;  3C6A A;  4JRP A;  2UXD K;  3FZF A;  4QS9 A;  3EKS A;  2Q3S A;  4JK8 A;  1R59 O;  1NNE A;  1YI2 N;  3UIQ A;  3OYM A;  4HCC A;  3BZK A;  4O4G A;  4CD1 A;  2G8I A;  2BAN A;  1VRU A;  3M3Z A;  4CCH A;  1RTJ A;  4GV9 A;  4DQR A;  3IDH A;  5FPM A;  1J53 A;  1O1W A;  3M8Q A;  3MEC A;  3LWM A;  1YHQ N;  5T7B A;  4DSI A;  2HBM A;  3I8D A;  4YOU A;  2VG5 A;  2WTU A;  4FL9 A;  3HST B;  4B3T K;  4M7Y A;  4CEO A;  4I6M B;  2NRX A;  3LAL A;  5HRP A;  4JKC A;  1RCH A;  3H3N O;  4CJ4 A;  3ZT2 A;  3WXK A;  4CJV A;  1WSJ A;  3T1H K;  3V81 A;  3AVC A;  4J8F A;  4OGE A;  4DMN A;  4M3U A;  3LDL A;  1JLC A;  3ZEU A;  1DTT A;  2E2P A;  3L8B A;  4H0O A;  3VEX A;  1S3X A;  1KQS M;  4XH5 A;  2P9L A;  4AM6 A;  3ID8 A;  3CD6 N;  2XY8 A;  5AQX A;  4GKJ K;  3L6Q A;  4B8A B;  3QML A;  4CZF A;  3KLI A;  3VEW A;  4CFA A;  3HP9 A;  3A0I X;  5C12 A;  4JI3 K;  3VTH A;  1IBM K;  5BPL A;  2OPS A;  2YV0 X;  3TR8 A;  3C94 A;  1FKO A;  3K2P A;  4JKH A;  4ELU A;  2B6A A;  4CES A;  5AQP A;  1EET A;  5J2P A;  4FXD A;  4IDK A;  3JAM O;  4DQS A;  2HBK A;  3SBG A;  1BHL A;  4NYF A;  2WFB A;  5F2R A;  4O0I A;  1RT2 A;  4F8R A;  1RBT A;  1OH5 A;  2YHX A;  4B9V A;  2QWQ A;  4CGH A;  4LSN A;  3LAM A;  1VRT A;  3THY B;  2NLX A;  5AZI B;  5SZT A;  3C7N B;  1S1U A;  3D2F B;  3T3F A;  3WQT A;  1EX4 A;  5C15 A;  5KTQ A;  3O9Q A;  3H46 O;  4NXN K;  4F3T A;  2ITG A;  2P9P B;  2UYT A;  1GLB G;  1K8K B;  1BOT O;  3A5L C;  4BVO A;  3QET A;  1QVF M;  1RGI A;  2QW9 A;  4PWD A;  3C6U A;  4I2P A;  4B9N A;  1Y64 A;  3IKM A;  4KRF A;  4CHY A;  2F7T A;  4CF8 A;  1T7P A;  5AZJ B;  3KD1 E;  3L2V A;  2YJF A;  1KAX A;  4EHU A;  3SNN A;  4EIA A;  1KFD A;  4ISF A;  4DCH A;  1UAX A;  4G1Q A;  5GAH P;  3HVR A;  1Q9X A;  1NBW A;  2YKN A;  4YY3 K;  3BEX A;  3CYM A;  4CK3 A;  5HLF A;  1Q86 O;  4FM1 A;  4CW7 B;  5GIN A;  1D9D A;  2OA8 A;  1CZ9 A;  2NRR A;  3VF2 A;  2OTL N;  2KTQ A;  4BAC A;  1S1T A;  3LP1 A;  1W0H A;  2BUP A;  3FZK A;  4CF9 A;  3EN9 A;  4WQ4 A;  4IFY A;  5AQW A;  4JKG A;  1JXE A;  2FBV A;  4DS4 A;  2UXC K;  2D1K A;  1LCU A;  1G15 A;  1TAU A;  4OX9 K;  3LAK A;  4W5O A;  1IBK K;  4AM7 A;  1U48 A;  4C8M A;  2GWK A;  3EEQ A;  5CZ1 A;  1N34 K;  4BRF A;  3DOL A;  3SQ0 A;  1ASU A;  1HKG A;  3QFP A;  5AQJ A;  3MN5 A;  2BDP A;  2HMP A;  4DFJ A;  3G0Z A;  4C1N K;  2KLA A;  5C0Y A;  5C2F A;  2CH5 A;  1WSF A;  1HNW K;  2ZF5 O;  4H5N A;  4BRN A;  1UA0 A;  1BIU A;  1TKT A;  2O8C B;  1KRP A;  1RFQ A;  2HHQ A;  4Q5V A;  1T44 A;  1JJ2 M;  2QA4 N;  2OZS A;  3I55 N;  3CCJ N;  3DLG A;  5AQL A;  2OCE A;  3E1Y A;  5CR4 A;  4OPK A;  4DTP A;  3NMU A;  3CG7 A;  3MMV A;  5DMR A;  3P5J A;  3ZX0 A;  3VGK A;  3OJU A;  3VA0 A;  1HKC A;  3MXM A;  3JXU A;  3HOT A;  3TAG A;  1JKH A;  3VMF B;  5BPM A;  4FJM A;  3P39 A;  3NH2 A;  1XHZ A;  4KI6 A;  2P9I B;  2ZE2 A;  2JLE A;  1XNR K;  1SQK A;  5HOO A;  3KK1 A;  3OVN A;  1C1B A;  5DM6 L;  5CZ2 A;  3KZB A;  4FLY A;  2XY6 A;  4ILJ A;  1S1V A;  1S5J A;  3KIO A;  3PX0 A;  2OPP A;  4FLW A;  3F9M A;  3SMS A;  4YOY A;  3CQ8 A;  4ID1 A;  4ID5 A;  3CME N;  4DR6 K;  5AQG A;  4DFM A;  4BE0 A;  4FLZ A;  2X78 A;  1YIT N;  1KVB A;  3VES A;  3C6T A;  4FOI A;  3QNN A;  3TAQ A;  3WEE B;  3L2U A;  2GUP A;  1GLL O;  3PIP L;  2KHO A;  4YOV A;  4BR5 A;  1VQ7 N;  3DXK B;  4MO5 A;  5CE3 A;  5JS1 A;  1WNS A;  5HP1 A;  3MK6 A;  1ASV A;  3VQQ A;  3VQE A;  4BRG A;  1U49 A;  3OJS A;  3HSC A;  3SI6 A;  3DXM B;  2HOE A;  5LL6 Z;  2CGK A;  2A3Z A;  4CGI A;  3VQ4 A;  2P9K B;  4CIF A;  4CGJ A;  2G8K A;  3EYZ A;  4FLX A;  2Q31 A;  4C8K A;  3CJ9 A;  5J2M A;  4FPA A;  3KJV A;  3VGL A;  1W7A A;  2VGM A;  1B9D A;  4LF8 K;  3AVB A;  1X9W A;  3V9S A;  3HYF A;  3QLH A;  4L3Q A;  4O0J A;  3CCM N;  1RDB A;  2F9W A;  2E4L A;  2V51 B;  4JLH A;  1NGJ A;  3V4I A;  2GBZ A;  2I7P A;  5JIC A;  3DMJ A;  3RSE B;  4E7I A;  1BUP A;  3TWH A;  4M63 C;  4KI4 A;  1IKY A;  4DFP A;  4BR7 A;  1BA1 A;  4CED A;  3SAG A;  5H1S Q;  3D2E B;  4JKA A;  3LP0 A;  3HPH A;  2HHW A;  5HRO A;  2D0A A;  2KZZ A;  4H0X B;  2YJE A;  2FF6 A;  1XNQ K;  1JLB A;  2WC9 A;  4H4O A;  3CCS N;  2XY5 A;  5HRS A;  3ATU A;  4DV4 K;  4BRC A;  1BIS A;  1HNX K;  4PKG A;  1D4X A;  3KKS A;  1B92 A;  3V6D A;  3WXJ A;  4ZTJ A;  5SWM A;  5AQF A;  4KHW A;  2YHA A;  4IOA L;  4BG8 A;  3LDS A;  3NF8 A;  3PX6 A;  4YFU A;  4GY2 B;  4U7B A;  3ULD A;  4IG0 A;  4MDB A;  4CGF A;  3RMD A;  4BC4 A;  3K5L A;  3OYN A;  5D3G A;  3NGY A;  5FRM A;  3TAF A;  3CJ1 A;  2AP1 A;  4NCA A;  3AVN A;  3Q7B A;  3DLE A;  2O4G A;  3TAN A;  3CPE A;  3AGR A;  4CJK A;  4RW8 A;  1VQ6 N;  2IAJ A;  1ZBI A;  4Z4E A;  1NGB A;  3KWG A;  2D4W A;  4BRP A;  3K5M A;  4LF9 K;  3ZEU B;  3HT3 A;  3O6W A;  3C0B A;  4B3R K;  4CE9 A;  2P9L B;  2Q36 A;  3BF3 A;  3VN5 A;  4A62 A;  2UUB K;  5AFU H;  2HW3 A;  3PV8 A;  3HL8 A;  3NH1 A;  2CH6 A;  2IDO A;  3LAN A;  2VWB A;  4Z4H A;  3SV4 A;  1HKB A;  3LM9 A;  3OYK A;  4ISG A;  4A5B A;  3M8R A;  3VF6 A;  1T6D A;  2E2O A;  1Y97 A;  4Z4F A;  4K25 A;  1VQN N;  3MED A;  1YJ9 N;  1M90 O;  3DRP A;  3IFR A;  4A57 A;  3V1O A;  1GLJ O;  4CJ7 A;  3CC4 N;  3HI0 A;  3VQ6 A;  4OPA A;  3QBX A;  1KLN A;  5JVH L;  4CEZ A;  2OZM A;  3ITH A;  1QQC A;  5CYQ A;  1JCF A;  4IDH A;  2EWS A;  4B1W B;  3ENO A;  3VGM A;  1VSF A;  1T6C A;  2A1S A;  4CEB A;  3CCV N;  3V9X A;  4DR7 K;  4CF2 A;  3S3M A;  1Q82 O;  2NRV A;  5JVG L;  3SZ2 A;  5FRO A;  1JLE A;  1GOA A;  1NKE A;  3DLB A;  4M3Z A;  3O9T A;  1IKW A;  1S1W A;  4O44 A;  5KQ8 A;  4JI8 K;  4O55 A;  3ULE A;  4I2Q A;  4EHT A;  3B6O A;  5JLH A;  4WF9 L;  2VQE K;  1KD1 O;  5GAE P;  1EXQ A;  3DLL L;  2FSN A;  2YKM A;  1RT1 A;  3DM2 A;  4WYB A;  2W42 A;  2QWN A;  4FK0 A;  4KTZ A;  1BIZ A;  1NJZ A;  1GOC A;  4ILG B;  4F2R A;  3G25 A;  4DF8 A;  1CZB A;  1VHX A;  1R0A A;  4PY5 A;  1JCE A;  3CET A;  4RG8 A;  4CJ5 A;  2E5L K;  2A5X A;  4H4M A;  5C25 A;  1S22 A;  1T03 A;  3TTF A;  4CFB A;  1J54 A;  3UKR B;  4FM2 A;  5J2N A;  1JXB A;  2KFN A;  4N76 A;  4H5T A;  3TTD A;  3DXK A;  3IS9 A;  3VTI A;  4JKG B;  4BC5 A;  2VWK A;  3QIC A;  1S9G A;  3P83 D;  1KXP A;  3WUH A;  3OBW A;  3NF9 A;  4CJR A;  3OBY A;  4W5Q A;  5J2Q A;  4JRQ A;  5FLX O;  4KV8 A;  3T19 A;  4BDZ A;  3LM2 A;  2HHH K;  2NUB A;  5M1P A;  4JAX A;  1U45 A;  2E20 A;  4X65 K;  1W97 L;  4N41 A;  2IOC A;  2QI2 A;  4M3T A;  4ELV A;  4DSL A;  3J8A A;  3HOS A;  3IMX A;  4QS8 A;  1GLA G;  4RW9 A;  3OYH A;  4KHY A;  4WCE L;  4E3S A;  3WT0 A;  4DV0 K;  3Q7C A;  3EY1 A;  3K5N A;  3IG1 A;  4KRE A;  4FPB A;  4AHR A;  4UY8 O;  3AV9 A;  1Z26 A;  5AQR A;  2O8F A;  4HTU A;  4E1M A;  1EWR A;  4H0Y B;  3KK3 A;  1VQP N;  4XH4 A;  1ZBH A;  3K0S A;  1SUQ A;  3GOI A;  1JLG A;  3A5M C;  3T1Y K;  4KKO A;  5M1O A;  2I5J A;  1U4B A;  4WFA L;  4BR9 A;  4FJ7 A;  1XI1 A;  1S1X A;  4FVU A;  3VPZ A;  3B6P A;  1O13 A;  1N32 K;  1KLM A;  3O4Q A;  3DLH A;  2FLO A;  3QEX A;  3HJF A;  3QIN A;  3J7A P;  3M1F A;  4FW2 A;  3AVM A;  5ADX A;  2XHB A;  3VQ7 A;  3UE5 A;  5EY4 A;  1RDC A;  3HTV A;  4RW7 A;  3AO1 A;  3TSU A;  4CJL A;  3V1Q A;  1QS4 A;  1NGD A;  4FWR A;  3KLE A;  1IJJ A;  5M1F A;  1NG9 A;  2LSN A;  1HRH A;  1D8Y A;  2FC0 A;  3NGI A;  3NDK A;  2IS3 A;  2KZM A;  4IOC L;  4KAZ A;  1BWF O;  1ATR A;  4YDU A;  4WFB L;  4B08 A;  4C23 A;  2P5O A;  3O1B A;  4FLT A;  1HR0 K;  4E1J A;  5IT9 O;  4R5P A;  1FK9 A;  2HHX A;  1D5A A;  2D0P A;  4JEP A;  3NFA A;  3F9K A;  3EZW A;  3HM8 A;  3U3G A;  3V9U A;  4BRQ A;  3WXM B;  5EX5 A;  3NVM A;  1LWE A;  1RT6 A;  2DPN A;  4GVM A;  3MCA B;  3HXM A;  5ELZ A;  4A59 A;  4CZK A;  1DKG D;  3V9Z A;  1EO1 A;  4FJG A;  3LP2 A;  1IG9 A;  4KH6 A;  2E88 A;  3U9D A;  4TSX A;  2QKK A;  3WQU A;  1TYQ A;  4BRK A;  2P9S A;  4IEE A;  2FXU A;  1XHX A;  5AR0 A;  4BDP A;  1A5W A;  1NOY A;  4DTR A;  2VG7 A;  3K9K A;  4PKI A;  1GLF O;  2VQF K;  4IKF A;  3OS1 A;  4B3O A;  5AQZ A;  4C1N I;  3S3O A;  4M3Y A;  2QXF A;  4LSL A;  5CY4 A;  3T69 A;  1G99 A;  2PYJ A;  3MN6 A;  3ZSO A;  3THW A;  3QB0 A;  5BN8 A;  1C0M A;  1WAF A;  4WQ5 C;  4FWL A;  4YOX A;  4I9L A;  3ZSW A;  1P8Z A;  4GNI A;  3LDN A;  3L4Q A;  4BR4 A;  3E01 A;  3E9O A;  3SQ4 A;  1EQY A;  2A6A A;  5HL7 L;  2IVP A;  2G8H A;  5M1K A;  1IO2 A;  1HUX A;  3VEZ A;  1L3U A;  2QWR A;  3VQ8 A;  3J7Y P;  3CJC A;  4OO1 J;  5LY3 A;  2Q0U A;  1GLE G;  5JLF A;  4M7X A;  4JKD A;  2ZJQ L;  1X1P A;  3G10 A;  4CIG A;  5ADX H;  4BRE A;  5GIO A;  4CJ3 A;  4QOZ B;  1VQ4 N;  1OH8 A;  3LDP A;  4DQQ A;  2F96 A;  5KPZ A;  2NZT A;  4IJA A;  2Y1I A;  1BQN A;  1L5U A;  2G8F A;  3LPT A;  2D0C A;  3RR7 A;  3PUF A;  4IFV A;  1I39 A;  3SQ1 A;  5BRH A;  4CHN A;  4MQ3 A;  4BC3 A;  4DTS A;  4BWJ A;  3WNH A;  2OPQ A;  2Q97 A;  1YJW N;  1NJI O;  3AVF A;  2YHB A;  5EOY A;  2HND A;  2UU9 K;  4R79 A;  2D0B A;  2A42 A;  5AQO A;  1JLF A;  4A2A A;  3UKR A;  2E6M A;  1KAZ A;  3L2W A;  2HHV A;  2B4J A;  3ZSQ A;  3R1X A;  1Q18 A;  3UB5 A;  4ZTF A;  4FWQ A;  4J2B A;  4HCB A;  1X9S A;  1NGG A;  4JD2 A;  4KPY A;  1Q8I A;  4DR1 K;  2HVI A;  1SL0 A;  3FE1 A;  5F1X A;  1EWQ A;  2P9U B;  1OH6 A;  1KTQ A;  5LMN K;  3ALY A;  5GAG P;  2ZWH A;  4AHU A;  1QQO A;  4BR2 A;  1HPM A;  3G6E N;  3QEW A;  3AA4 A;  3LDQ A;  5AQT A;  4BDY A;  4DV2 K;  2O8B A;  4DG1 A;  4OKK A;  3VEN A;  4KHP K;  3AAP A;  4OKE A;  1I3A A;  3VOV A;  2KW4 A;  3OS0 A;  3AO3 A;  1N6Q A;  3M8S A;  3CMA N;  3GDQ A;  4AH9 A;  2A1R A;  1N5Y A;  5E26 A;  1RTH A;  3IUC A;  3MDQ A;  3L2Q A;  2NRH A;  1QHA A;  1VQ5 N;  4OPH A;  1C0G A;  4RCH A;  1VAZ A;  2DTU A;  2E1Y A;  3VQA A;  4CVN E;  1ZBS A;  1U2V A;  2P9N A;  3ULE B;  3VQP A;  1BCM A;  5AQV A;  3ZSY A;  2QWM A;  4JI7 K;  3CC7 N;  1Z25 A;  5BRD A;  4MLE A;  3OYE A;  3NHG A;  3H1Q A;  4IOX A;  4U67 L;  4FK2 A;  4K41 A;  3ZET A;  5AJ3 K;  1Q7Y O;  3OYA A;  5CHI A;  2P1J A;  3PY8 A;  1V4T A;  4NYN A;  1REV A;  4YHH K;  4RWT A;  3WNE A;  1HNI A;  3CPW M;  1JL1 A;  4ELT A;  1ZBU A;  3O4N A;  4KHN A;  4FK4 A;  5AQS A;  3EKU A;  2A40 A;  4UQG A;  4A61 A;  1LOT B;  3OYG A;  1NLV A;  3HO1 A;  5FPN A;  1L3T A;  4FWM A;  4W5N A;  4RTF D;  3L4I A;  4LC9 B;  1U6Z A;  2V7Y A;  4DU4 A;  4Q0B A;  4AHT A;  3KLF A;  3NH0 A;  4CEA A;  4BR0 A;  5BR9 A;  4XH1 A;  1QSL A;  2QWL A;  3A5O C;  3SQ2 A;  3SUP A;  5AFU A;  4M41 A;  3I33 A;  3H08 A;  3DI6 A;  2QTD A;  4NCG A;  4B9Q A;  1M1K O;  3MXJ A;  3VQD A;  2F4V K;  4LD0 A;  3OS2 A;  1YJN N;  2VGN A;  4DV6 K;  2ZQB A;  1TK0 A;  1NGI A;  3DLK A;  4RW4 A;  1NWK A;  1ZYQ A;  2OPR A;  3SJH A;  3RTV A;  1XUP O;  4CF1 A;  1XWL A;  3WNG A;  3O1W A;  5M1Q A;  3VQ5 A;  1T05 A;  2FSK A;  4IG3 A;  4DQ8 A;  3DWL A;  5FPE A;  3RVC A;  3VF4 A;  2O8E A;  2HB5 A;  4Z4C A;  2O8F B;  3CJ7 A;  4LF7 K;  3DAW A;  3O9R A;  1GLD G;  4FZZ A;  4JK9 A;  4H0T B;  2QEX N;  4DS5 A;  1YXQ A;  3L0Q A;  4B1Y B;  1SS6 A;  3AVG A;  1OH7 A;  4FOE A;  3R6M A;  4CJT A;  5K14 A;  2Z1H A;  3AVI A;  4FJX A;  2HST A;  2FSJ A;  4B9L A;  3CCU N;  1FXX A;  4DR5 K;  1XQS C;  4N5S A;  3AY9 A;  4CJF A;  3CCR N;  3C95 A;  1ASW A;  3I8B A;  3CF5 L;  1P90 A;  4BQL A;  2X6S A;  3OYL A;  2HNY A;  4KHU A;  1NK9 A;  1KVC A;  3GE1 A;  4BRA A;  1F21 A;  1RBS A;  1VSH A;  3DRS A;  1NJW A;  4H0V B;  4E19 A;  5KGW A;  4B1Z A;  4CFC A;  4CZG A;  3DJC A;  4KTW A;  4DSF A;  2JWL A;  4DQP A;  1NOZ A;  4CEE A;  1VQ9 N;  1BDG A;  3CCQ N;  2QKB A;  1YTA A;  4FWN A;  1JLA A;  1NGH A;  3ASM A;  1BI4 A;  1NKB A;  5EU7 A;  4PA1 A;  4DWI A;  1HYZ A;  1QVG M;  3PSF A;  2G8W A;  1LAW A;  2QXL A;  3P4I A;  3MXI A;  1ZBF A;  5LJW A;  2IC3 A;  1WAJ A;  3E9L A;  5AQN A;  4PL8 A;  4KH5 A;  4QAG A;  4CJE A;  2O4I A;  1E3M A;  4JHD A;  4FM0 A;  4FJK A;  3CXC M;  4CJS A;  3U6F A;  4LFB K;  4M3R A;  3N4P A;  1SL2 A;  2VWJ A;  1BCO A;  1LAV A;  1YTU A;  2YX6 A;  3TAP A;  1TYQ B;  4YNQ A;  2P9S B;  3BZC A;  1K8A O;  2Q0R A;  4CGG A;  3QIO A;  1VSK A;  4M3X A;  4B9U A;  1NJY A;  3F73 A;  1YAG A;  2H3G X;  2W40 A;  4AHV A;  3BY5 A;  2G8U A;  2GX9 A;  2P9U A;  2UXB K;  2NRZ A;  3O9U A;  1RBV A;  1KFS A;  3SMP A;  3O3G A;  3THW B;  3ZSR A;  5C2D A;  3FZL A;  4I9Q A;  4KHS A;  3TTC A;  1YT3 A;  3L3U A;  4OJR A;  4DUZ K;  4BE1 A;  1BQM A;  3ZT3 A;  4DR4 K;  2W6K A;  3BGR A;  3LL3 A;  4NCB A;  4ILH A;  1UWB A;  4L8R B;  1X9J A;  3EO3 A;  3TAB A;  1WOQ A;  2R7Y A;  5TKW A;  3AA5 X;  1GLC G;  4DQI A;  3A8Y A;  2RHK A;  2AJQ A;  5FPD A;  4B1U B;  4X64 K;  4Z4G A;  2QWO A;  1NK7 A;  4E7J A;  4FWS A;  4Z94 A;  4FLU A;  3THX A;  1LW2 A;  2YNH A;  3MX2 A;  3R9P A;  2DY4 A;  4M45 A;  4MFB A;  4F9O A;  4AF1 A;  1SV5 A;  3SK3 A;  1J6Z A;  4NLB A;  4DTX A;  4IFE A;  4BVP A;  2ZM6 K;  1QQM A;  1HJR A;  3ZX3 A;  3MAQ A;  3D45 A;  3BUZ B;  3OYB A;  3GG4 A;  3THV A;  4JKE A;  3OYD A;  1TKD A;  2IVN A;  3K57 A;  4J2D A;  2D5R A;  3VET A;  2WON A;  5LMU K;  1TL3 A;  4EFH A;  2HVH A;  4LFC K;  1TK5 A;  1BO5 O;  3CFO A;  3NF7 A;  3QBW A;  3B8A X;  4JD2 B;  1HX1 A;  5GAD P;  4X62 K;  3BP8 A;  3VQC A;  1K6Y A;  1GOB A;  4JI0 K;  3EE9 A;  2YNG A;  3SUO A;  2X6N A;  5J1E A;  3AGK A;  4IBN A;  4DV3 K;  2YHY A;  4DU3 A;  3HK2 A;  4EAH D;  2O8B B;  1NKC A;  3FGU A;  3SUN A;  2DFE A;  3FZM A;  4DLE A;  1XC3 A;  3RMA A;  2PYL A;  1ZBL A;  4KBO A;  2HMI A;  1OVY A;  2ASO A;  5CYM A;  4DSK A;  1U47 A;  5EVZ A;  5KGX A;  4JV5 K;  1TL1 A;  3TSQ A;  4B1V A;  2GEM A;  2BE2 A;  4FJN A;  4H5V A;  3ISN C;  2E2Q A;  2P51 A;  4LY7 A;  3J80 O;  1NK4 A;  1U2V B;  4BRD A;  2P9N B;  5AQU A;  3T1A A;  2Q1N A;  3S41 A;  4FWP A;  4DB3 A;  2HHU A;  2W41 A;  3HP6 A;  1WBB A;  1VSJ A;  2RF2 A;  4Y1D A;  2Z1J A;  4K8Z A;  3O3F A;  3AO5 A;  4YOT A;  1YIJ N;  3ZCM A;  1RTI A;  3ZET B;  1DT9 A;  3KWI A;  2FBY A;  4XIU A;  1TKX A;  3ZT1 A;  4IEI A;  4O5B A;  2DFF A;  3PO5 A;  3P38 A;  4O5F A;  1N8R O;  3MEE A;  3OYC A;  4QCL A;  3NBP A;  4FWK A;  3L2R A;  1QTM A;  2UUC K;  4FJI A;  2IVO A;  2ITM A;  4QS7 A;  4DKW A;  4B9S A;  2E2N A;  3FR0 A;  4H5R A;  3H45 C;  1HQU A;  1XMO K;  3RRH A;  1RNH A;  3QEV A;  5E84 A;  4M3W A;  2PAV A;  4YOR A;  2F8T A;  2IIR A;  2RE2 A;  1E4F T;  4DV7 K;  1U04 A;  3J81 O;  1NK5 A;  2WUS A;  4WQ4 C;  1N36 K;  3MWT A;  3NF6 A;  2ETJ A;  2CGL A;  4AQY K;  3ZT0 A;  2RN2 A;  4N47 A;  1NU0 A;  2XY7 A;  4E1N A;  4M42 A;  1HQE A;  2JWK A;  1RT4 A;  4E7K A;  2KKZ A;  4FVM A;  1DEJ A;  3ID6 A;  3QDK A;  3U9Z A;  1NGC A;  2BH1 A;  4DTM A;  3DYA A;  2KFZ A;  1X3N A;  5JS2 A;  3AVA A;  2UUA K;  4BRL A;  3CI5 A;  1YUW A;  3FFI A;  2O8E B;  1HLU A;  4K43 A;  2GTD A;  3AVH A;  4CBW A;  1WSH A;  4PL7 A;  3PLA A;  2ZGY A;  3CHW A;  4BY9 C;  1QZ5 A;  3O8M A;  3RR8 A;  1NK8 A;  4FZX C;  4CI6 A;  1IG8 A;  1Q81 O;  3SV3 A;  1C0T A;  5MLC Q;  3CM6 A;  4K42 A;  3VEV A;  4HUF A;  3SUQ A;  4KTQ A;  3QFU A;  2ATQ A;  1T8E A;  1KSP A;  1QE1 A;  3LPU A;  2ZJP L;  4CK2 A;  4FJJ A;  1HPZ A;  2OYQ A;  1IH7 A;  3HVT A;  1KVA A;  3U3Y A;  3ZSX A;  3LWL A;  4CGD A;  3MN9 A;  3QEP A;  1UOC A;  4B3S K;  1WUA A;  3H6E A;  3KHY A;  3BF1 A;  5F0X A;  1ZXO A;  1JL2 A;  2AA4 A;  1NM1 A;  1NGA A;  3CCL N;  4KHQ A;  1KAY A;  3V1R A;  4CBX A;  1L3S A;  2HF4 A;  3KK7 A;  1J5E K;  3VQ9 A;  3DRR A;  1XMQ K;  3NE6 A;  3SBT A;  4BGA A;  4DV5 K;  1BI4 B;  4B9M A;  2QM1 A;  1C1C A;  1Z05 A;  3KK2 A;  5BRF A;  3G71 N;  4IWV A;  3FZH A;  4GVE A;  5GIP A;  3NCI A;  1WB9 A;  3HZ6 A;  4DSJ A;  4K8X A;  4PQU A;  2J4R A;  2HBJ A;  3OW2 M;  4CER A;  2YI1 A;  3JYT A;  1IBL K;  1K73 O;  4ZHR A;  2QK9 A;  1MWK A;  5BRE A;  2VYP A;  3AAR A;  4JHD B;  3UKU A;  3AO4 A;  1RBR A;  2GWJ A;  1RIL A;  4JS4 A;  1WSE A;  3KLG A;  4ICL A;  5AQQ A;  3FFK B;  3C6H A;  4J2A A;  3U8X A;  4CD3 A;  4W5T A;  1W9H A;  4NB4 A;  3I0R A;  2ZD1 A;  4OGC A;  4JI2 K;  3NAE A;  3VEO A;  5DK5 A;  3RRG A;  5C24 A;  1LWF A;  3K58 A;  1SKS A;  3D7E O;  2Q2R A;  4OVL A;  4CHO A;  5AQK A;  4IO9 L;  4J2E A;  3GBT A;  4HHT A;  3SPY A;  1WBD A;  4F4K A;  2E1Z A;  5KPT A;  3W0L A;  1NGE A;  3OHR A;  4DV1 K;  1C0U A;  1S6P A;  3GL1 A;  1QSY A; 
#chains in the Genus database with same CATH homology
 4FK0 A;  2G8V A;  4CJV A;  4KTZ A;  1WSJ A;  5HRR A;  4C8N A;  4CJT A;  1BIZ A;  3AVC A;  5K14 A;  3V81 A;  2Z1H A;  3AVI A;  4OGE A;  4DMN A;  4FW1 A;  4CEQ A;  3I0S A;  1NJZ A;  3CFR A;  2XRI A;  1HYV A;  4FJX A;  1TK8 A;  1JLC A;  4B9L A;  1GOC A;  4F2R A;  1DTT A;  4DF8 A;  1CZB A;  1FXX A;  1R0A A;  3L8B A;  4PY5 A;  4N5S A;  4CJF A;  4CJQ A;  3EZ5 A;  3C95 A;  1ASW A;  4RG8 A;  4CJ5 A;  2E6L A;  1BL3 A;  4H4M A;  2X6S A;  3OYL A;  2HNY A;  4KHU A;  5C25 A;  3RMB A;  1KVC A;  1NK9 A;  1F21 A;  1RBS A;  1LW0 A;  1VSH A;  1J54 A;  2XY8 A;  3DRS A;  4CFB A;  1T03 A;  4FM2 A;  3LZJ A;  4B8A B;  4DTN A;  4E19 A;  1NJW A;  2YNF A;  5J2N A;  3RWU A;  5KGW A;  1JXB A;  4HUG A;  4EZ6 A;  4CFC A;  3KLI A;  4N76 A;  4KTW A;  2KFN A;  4DSF A;  2GV9 A;  4CFA A;  3HP9 A;  1NOZ A;  3IS9 A;  4CEE A;  4DQP A;  3QEI A;  3IAY A;  1YTA A;  2QKB A;  1JLA A;  3ASM A;  5HBM A;  4C8O A;  3S9H A;  1BI4 A;  2OPS A;  4CHQ A;  2VWK A;  1NKB A;  5EU7 A;  3PO4 A;  2YV0 X;  3TR8 A;  1S9G A;  4PA1 A;  2HNZ A;  3P83 D;  4DWI A;  5C42 A;  3CFP A;  1HYZ A;  3NF9 A;  4CJR A;  3C94 A;  4W5Q A;  1FKO A;  3K2P A;  5J2Q A;  2G8W A;  4DTU A;  4ELU A;  2B6A A;  1LAW A;  4CES A;  4JRQ A;  4OPJ A;  4KV8 A;  3T19 A;  4BDZ A;  1ZBF A;  3MXI A;  1EET A;  4H8K A;  5J2P A;  4FXD A;  4IDK A;  5FRN A;  2IC3 A;  2NUB A;  1WAJ A;  4DQS A;  1BHL A;  4NYF A;  4QAG A;  4CJE A;  2O4I A;  1U45 A;  4N41 A;  2IOC A;  4O0I A;  1RT2 A;  4FM0 A;  4F8R A;  1RBT A;  4FJK A;  4M3T A;  4B9V A;  4ELV A;  4DSL A;  4CGH A;  4CJS A;  4LSN A;  3LAM A;  3U6F A;  1VRT A;  3RMC A;  5SZT A;  4RW9 A;  3OYH A;  4KHY A;  1S1U A;  4E3S A;  4M3R A;  3EY1 A;  2VWJ A;  3K5N A;  1BCO A;  3IG1 A;  3T3F A;  1SL2 A;  1A5V A;  1EX4 A;  1LAV A;  4E7L A;  3TAP A;  4YNQ A;  5KTQ A;  1YTU A;  4KRE A;  4OLA A;  4AHR A;  4CGG A;  3AV9 A;  3AVJ A;  3QIO A;  1IKX A;  1VSK A;  1Z26 A;  1J5O A;  4M3X A;  4Z4I A;  4F3T A;  2ITG A;  4HTU A;  1CLQ A;  4E1M A;  1BGX T;  4B9U A;  1C6V A;  3KK3 A;  1NJY A;  3F73 A;  4DFK A;  1ZBH A;  1SUQ A;  1VSE A;  4FLV A;  1JLG A;  3HM9 A;  4AHV A;  2G8U A;  1DLO A;  4KKO A;  2I5J A;  1U4B A;  1RBV A;  1KFS A;  2XO7 A;  2EHG A;  4FJ7 A;  1RT5 A;  3O3G A;  2Y1J A;  3QET A;  3ZSR A;  1S1X A;  1XI1 A;  3B6P A;  4I9Q A;  4PWD A;  3C6U A;  1KLM A;  4I2P A;  4B9N A;  3O4Q A;  3AVL A;  3DLH A;  4KRF A;  4CHY A;  3QEX A;  4CF8 A;  1T7P A;  3KD1 E;  3QIN A;  3HJF A;  4KHS A;  3ZT4 A;  4Z0U A;  3L2V A;  4FW2 A;  1YT3 A;  3AVM A;  1TAQ A;  3L3U A;  4OJR A;  2XHB A;  3VQ7 A;  4BE1 A;  1S6Q A;  1BQM A;  1KFD A;  1CXU A;  3SNN A;  3ZT3 A;  1RDC A;  4EP4 A;  3SCX A;  3SJJ A;  1UAX A;  4G1Q A;  4RW7 A;  3HVR A;  1Q9X A;  3AO1 A;  4CJL A;  3V1Q A;  2YKN A;  3BGR A;  4NCB A;  3CYM A;  1QS4 A;  4CK3 A;  5HLF A;  1TVR A;  4FM1 A;  1UWB A;  3KLE A;  1RTD A;  4L8R B;  1D9D A;  2OA8 A;  1CZ9 A;  1VSI A;  4AHS A;  1YVU A;  2KTQ A;  4JS5 A;  4BAC A;  1S1T A;  3ZSV A;  3QNO A;  3TAB A;  2LSN A;  3LP1 A;  2R7Y A;  1NJX A;  1HRH A;  3AA5 X;  1D8Y A;  1W0H A;  2FC0 A;  2EX3 A;  2KQ2 A;  4DQI A;  4WE1 A;  4CF9 A;  3NDK A;  2IS3 A;  4IFY A;  3NGI A;  4GW6 A;  2KZM A;  4KAZ A;  2AJQ A;  1JXE A;  1WN7 A;  2FBV A;  3DLR A;  3AA2 A;  4CJU A;  4DS4 A;  1NK7 A;  4Z4G A;  1G15 A;  1VK0 A;  4E7J A;  4OLB A;  1TAU A;  4B08 A;  2P5O A;  4KB0 A;  4FLU A;  4CHZ A;  3LAK A;  5KRT A;  5KRS A;  1LW2 A;  1WLJ A;  2YNH A;  4FLT A;  4W5O A;  3S3N A;  4FYD A;  2DY4 A;  1U48 A;  3TI0 A;  4C8M A;  4R5P A;  3TAM A;  1B9F A;  1RBU A;  3SPZ A;  4M45 A;  4MFB A;  1FK9 A;  5CZ1 A;  4KB1 A;  4EP5 A;  2HHX A;  1D5A A;  3DOL A;  3SQ0 A;  1ASU A;  1SV5 A;  1NK0 A;  4DLG A;  1MU2 A;  3NFA A;  3F9K A;  4E89 A;  4DTX A;  2BDP A;  3U3G A;  4DSE A;  4DFJ A;  3AO2 A;  1HJR A;  3G0Z A;  3MAQ A;  3V9U A;  3D45 A;  3OYB A;  4FJH A;  1LWE A;  1RT6 A;  3THV A;  4GVM A;  3HXM A;  1WSF A;  4CHP A;  3OYD A;  1S9E A;  4E0D A;  3V9Z A;  1SKR A;  1UA0 A;  1TKD A;  4FJG A;  3LP2 A;  5FDL A;  3K57 A;  1BIU A;  1TKT A;  1IG9 A;  4J2D A;  1KRP A;  2HHT A;  3ZSZ A;  1LWC A;  2D5R A;  1JLQ A;  4TSX A;  2HHQ A;  4Q5V A;  2QKK A;  2WON A;  1TL3 A;  3OYI A;  2HVH A;  2OZS A;  1TK5 A;  3AA3 A;  1L3V A;  1XHX A;  4BDP A;  3DLG A;  1A5W A;  3CFO A;  4PUO A;  3NF7 A;  1NOY A;  2X74 A;  1ITG A;  5HRN A;  4EZ9 A;  3O3H A;  4DTR A;  2VG7 A;  4OPK A;  4DTP A;  3CG7 A;  4IKF A;  4KFB A;  3P5J A;  5DMR A;  3OS1 A;  4B3O A;  3VQC A;  3KKR A;  3OJU A;  3VA0 A;  3MXM A;  1RT3 A;  1K6Y A;  3S3O A;  1GOB A;  4HUE A;  4M3Y A;  2QXF A;  3K5O A;  4LSL A;  2RPI A;  2YNG A;  3CM5 A;  5CY4 A;  3TAG A;  1JKH A;  3SZ2 A;  2YNI A;  2PYJ A;  3SUO A;  1HNV A;  2X6N A;  3ZSO A;  5J1E A;  4FJM A;  3NH2 A;  1XHZ A;  4KI6 A;  4IBN A;  1C0M A;  4AIL C;  1WAF A;  2JLE A;  2ZE2 A;  4DU3 A;  3HK2 A;  1WSI A;  4I9L A;  3KK1 A;  3OVN A;  1C1B A;  4BWM A;  3ZSW A;  4BE2 A;  5CZ2 A;  4FLY A;  1A5X A;  3TAE A;  1NKC A;  3SUN A;  2XY6 A;  2DFE A;  4DLE A;  1IKV A;  1S1V A;  3RMA A;  1KCF A;  1SKW A;  2PYL A;  1ZBL A;  1S5J A;  3KIO A;  3PX0 A;  2HMI A;  2OPP A;  4FLW A;  5CYM A;  3E01 A;  4DSK A;  1U47 A;  5KGX A;  3CQ8 A;  3SQ4 A;  4ID1 A;  4M3U A;  4ID5 A;  1TL1 A;  2G8H A;  1IO2 A;  3OYJ A;  1L3U A;  3VQ8 A;  4DFM A;  4BE0 A;  4FLZ A;  2X78 A;  1KVB A;  2BE2 A;  1FKP A;  3C6T A;  3QNN A;  3TAQ A;  5I42 A;  4FJN A;  3ISN C;  2P51 A;  4LY7 A;  3L2U A;  1X1P A;  1NK4 A;  4AHC A;  3G10 A;  4CIG A;  4CEC A;  4CJ3 A;  3T1A A;  4CJP A;  4QOZ B;  1WSG A;  1HYS A;  2HHU A;  2PZS A;  3HP6 A;  5JS1 A;  1WNS A;  3KLH A;  3SYZ A;  4DQQ A;  1VSJ A;  2F96 A;  2RF2 A;  2Z1J A;  4Y1D A;  3O3F A;  5HP1 A;  4K8Z A;  3AO5 A;  1ASV A;  3VQQ A;  3VQE A;  1BQN A;  2Y1I A;  1U49 A;  1L5U A;  2G8F A;  3ZCM A;  1RTI A;  2D0C A;  3LPT A;  4CK1 A;  3PUF A;  3OJS A;  3RR7 A;  3DOK A;  3SI6 A;  3KD5 E;  2FBY A;  4XIU A;  1TKX A;  3ZT1 A;  4IFV A;  1I39 A;  4CGI A;  3SQ1 A;  3VQ4 A;  4CHN A;  3K59 A;  4MQ3 A;  4CIF A;  4O5B A;  2DFF A;  3PO5 A;  4FZY A;  4DTS A;  2FBT A;  4BWJ A;  3WNF A;  3HPO A;  3MEE A;  2GUI A;  3WNH A;  3NBP A;  4CGJ A;  3OYC A;  3VA3 A;  4QCL A;  3L2R A;  2G8K A;  3EYZ A;  4FLX A;  1QTM A;  4LH4 A;  4FJI A;  2OPQ A;  5E41 A;  4C8K A;  3AVF A;  5J2M A;  2YHB A;  1RDD A;  4B9S A;  2HND A;  2PY5 A;  3KJV A;  2D0B A;  4OKJ A;  1B9D A;  1HQU A;  3AVB A;  1X9W A;  3V9S A;  2WOM A;  3QES A;  4CFD A;  1JLF A;  3RRH A;  3HYF A;  1RNH A;  3QEV A;  3QLH A;  2E6M A;  4DTO A;  4O0J A;  3L2W A;  1RDB A;  2HHV A;  3IRX A;  2E4L A;  3JSM A;  2B4J A;  4JLH A;  3ZSQ A;  3V4I A;  2GBZ A;  3DMJ A;  4M3W A;  2DFH A;  4E7I A;  1EP4 A;  4ZTF A;  3TWH A;  2F8T A;  4J2B A;  4HCB A;  4KI4 A;  1IKY A;  4DFP A;  1UA1 A;  1X9S A;  4CED A;  1D9F A;  4KPY A;  1U04 A;  1Q8I A;  3LP0 A;  3KTQ A;  3QO9 A;  4B8C A;  4W5R A;  1NK5 A;  3HPH A;  2HVI A;  4DTJ A;  4GMJ B;  2HHW A;  1SL0 A;  5HRO A;  1VSD A;  2D0A A;  2KZZ A;  3NF6 A;  3VQB A;  1Q9Y A;  2ETJ A;  1KTQ A;  3ALY A;  4AHU A;  1JLB A;  3ZT0 A;  2RN2 A;  4N47 A;  3AVK A;  1X9M A;  2VG6 A;  4F3O A;  3QEW A;  2XY7 A;  4H4O A;  4E1N A;  4M42 A;  2P5G A;  1HQE A;  3AA4 A;  4BDY A;  2XY5 A;  5HRS A;  4DG1 A;  3BDP A;  1BIS A;  1RT4 A;  4OKK A;  4E7K A;  4FVM A;  4OKE A;  1I3A A;  4DTM A;  2KW4 A;  3KKS A;  1B92 A;  3V6D A;  1QHT A;  3AO3 A;  3OS0 A;  4ZTJ A;  3DYA A;  5SWM A;  2KFZ A;  1N6Q A;  2RKI A;  4N56 A;  3M8S A;  5JS2 A;  4AH9 A;  2A1R A;  3AVA A;  2YHA A;  1N5Y A;  4KHW A;  1HMV A;  1RTH A;  1XC9 A;  3L2Q A;  3OYF A;  4CF0 A;  3LDS A;  4KO0 A;  5KI6 A;  3FFI A;  4FCY A;  3NF8 A;  2Z1I A;  3AVH A;  3PX6 A;  4YFU A;  1WSH A;  4FJ5 A;  3ULD A;  2FBX A;  4IG0 A;  4CGF A;  3RMD A;  2DTU A;  3OY9 A;  1TGO A;  3VQA A;  3RR8 A;  3K5L A;  1VSM A;  3OYN A;  1NK8 A;  3VQP A;  4FZX C;  2F8S A;  1BCM A;  3ZSY A;  5D3G A;  3NGY A;  5FRM A;  1Z25 A;  3OYE A;  3NHG A;  3TAF A;  3MEG A;  4FK2 A;  4NCA A;  4FJ9 A;  3LP3 A;  3AVN A;  3SV3 A;  1C0T A;  3SUQ A;  3CM6 A;  3DLE A;  4HUF A;  4KTQ A;  2O4G A;  3TAN A;  2ATQ A;  4CJK A;  3OYA A;  1T8E A;  1QE1 A;  3LPU A;  1KSP A;  2P1J A;  4CK2 A;  1QSS A;  4FJJ A;  3QIP A;  4RW8 A;  2IAJ A;  1HPZ A;  3PY8 A;  2OYQ A;  3A2F A;  1ZBI A;  4Z4E A;  1IH7 A;  3K5M A;  3D0P A;  4NYN A;  3HVT A;  1KVA A;  1REV A;  2JGU A;  3U3Y A;  3ZSX A;  3LZI A;  3LWL A;  4CGD A;  3HT3 A;  3QEP A;  1UOC A;  3WNE A;  1EKE A;  1HNI A;  3V9W A;  3HPG A;  1JL1 A;  2B5J A;  1SL1 A;  4ELT A;  4F2S A;  2BGG A;  2HHS A;  1ZBU A;  4DU1 A;  4C8L A;  4FJL A;  1RT7 A;  4CE9 A;  3TAR A;  3O4N A;  3P1G A;  4Y1C A;  5I3U A;  4B9T A;  3QER A;  4KHN A;  4FK4 A;  1JL2 A;  3VN5 A;  4HVJ A;  1TKZ A;  4UQG A;  4KHQ A;  4FJ8 A;  1DTQ A;  1VSL A;  3V1R A;  3OYG A;  3M8P A;  1L3S A;  3HO1 A;  2HW3 A;  3PV8 A;  1L3T A;  4W5N A;  3HL8 A;  4LH5 A;  2IGI A;  3VQ9 A;  3NH1 A;  3DRR A;  3NE6 A;  4CEF A;  2IDO A;  3LAN A;  1RDA A;  4AHT A;  4CIE A;  4DU4 A;  1BI4 B;  4B9M A;  4Q0B A;  1C1C A;  4Z4H A;  3KLF A;  3KK2 A;  3SV4 A;  3OYK A;  4RW6 A;  3NH0 A;  3M8R A;  4CEA A;  4CJW A;  4DF4 A;  1Y97 A;  1QSL A;  3NCI A;  4DSJ A;  4K8X A;  4Z4F A;  1TV6 A;  3SQ2 A;  3SUP A;  4PQU A;  4M41 A;  3MED A;  2Z1G A;  3H08 A;  3NGZ A;  3DI6 A;  4NCG A;  4CER A;  1C1A A;  1LV5 A;  3PX4 A;  3JYT A;  3DRP A;  3MXJ A;  3VQD A;  4ZHR A;  4I7F A;  4LD0 A;  3OS2 A;  3V1O A;  1NK6 A;  2QK9 A;  1CXQ A;  1J9A A;  2ZQB A;  1TK0 A;  3VQ6 A;  4E7H A;  3L3V A;  3AO4 A;  3DLK A;  4RW4 A;  1KLN A;  4JRP A;  1ZYQ A;  1RBR A;  2OPR A;  4CEZ A;  1RIL A;  4JS4 A;  3RTV A;  4CF1 A;  2OZM A;  2Q3S A;  1XWL A;  1WSE A;  3ITH A;  3KLG A;  3WNG A;  1QQC A;  4ICL A;  5CYQ A;  3UIQ A;  3VQ5 A;  3OYM A;  1T05 A;  4HCC A;  4O4G A;  4J2A A;  4IG3 A;  2G8I A;  2BAN A;  1VRU A;  4CCH A;  4W5T A;  1W9H A;  1VSF A;  3I0R A;  1RTJ A;  2A1S A;  2ZD1 A;  4CEB A;  3V9X A;  4DQR A;  4CF2 A;  4OGC A;  3NAE A;  3S3M A;  5DK5 A;  2HB5 A;  4Z4C A;  3RRG A;  5C24 A;  1J53 A;  1O1W A;  3M8Q A;  3MEC A;  3LWM A;  5FRO A;  1JLE A;  1GOA A;  1LWF A;  5T7B A;  3K58 A;  1SKS A;  1NKE A;  3DLB A;  4M3Z A;  4OVL A;  4CHO A;  1IKW A;  4DSI A;  1S1W A;  4J2E A;  4O44 A;  3I8D A;  2VG5 A;  4O55 A;  4HHT A;  3SPY A;  3HST B;  4FZZ A;  4I2Q A;  4F4K A;  4CEO A;  3B6O A;  3LAL A;  4DS5 A;  5HRP A;  1C0U A;  1EXQ A;  1S6P A;  3AVG A;  1RCH A;  1QSY A;  2YKM A;  1RT1 A;  4CJ4 A;  3ZT2 A;  3DM2 A;  2W42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...