4EP4A

Thermus thermophilus ruvc structure
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
166
Chain Sequence
MVVAGIDPGITHLGLGVVAVEGKGALKARLLHGEVVKTSPQEPAKERVGRIHARVLEVLHRFRPEAVAVEEQFFYRQNELAYKVGWALGAVLVAAFEAGVPVYAYGPMQVKQALAGHGHAAKEEVALMVRGILGLKEAPRPSHLADALAIALTHAFYARMGTAKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Crossover junction endodeoxyribonuclease RuvC
publication title Structural asymmetry in the Thermus thermophilus RuvC dimer suggests a basis for sequential strand cleavages during Holliday junction resolution.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 54
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature ec 3.1.22.4: Crossover junction endodeoxyribonuclease.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02075 RuvC Crossover junction endodeoxyribonuclease RuvC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ep4A00
1TK8A 1D8YA 3KK1A 1SKRA 4M3ZA 1UA1A 1RBUA 4E7KA 1BL3A 4R5PA 3V81A 1BCOA 3VQEA 1J5OA 1HYSA 1BCMA 4LH4A 3HPGA 3SPZA 3DRPA 4DF4A 2E4LA 4CJFA 1JLAA 3CG7A 4DTMA 3RR8A 1HYZA 1RILA 1GOCA 4KTWA 3NE6A 2YKMA 3PUFA 3O3GA 2DFHA 4BACA 1S1VA 2QXFA 4ICLA 3VQ9A 4DFJA 2DY4A 4UQGA 3NCIA 1C0TA 4CJTA 4XIUA 1NKCA 1J53A 1ZBFA 3V9XA 4OVLA 2ZD1A 4CEOA 4LD0A 1YT3A 4DU1A 2YNHA 3NH2A 3HP6A 3SNNA 4FK0A 1WSJA 3ZSWA 2E6LA 4FLVA 4FJLA 3V9ZA 1T05A 1NKEA 3CM5A 4NCAA 1LAVA 4CFCA 2OZMA 4CIGA 1IO2A 4CGDA 5I42A 1RDAA 2BDPA 4ZTFA 1RT7A 3L2WA 2EX3A 2QKKA 2Z1GA 1HYVA 2G8VA 2F96A 5DK5A 1DTTA 1ASUA 4CJ4A 2A1RA 4JRPA 1KFDA 1TAUA 3CFPA 1RT2A 4GMJB 4CJQA 4QOZB 4DTJA 4EP4A 1TL1A 1SL0A 1Q9YA 1J54A 2YNGA 4FJMA 4H8KA 3KLHA 4N76A 1JL1A 5I3UA 4HCCA 3I0RA 3OYJA 3ZSVA 4KTZA 4DTXA 4KREA 1RT4A 2KTQA 4OGCA 3QESA 1F21A 1FKPA 4CJLA 1KCFA 1SKSA 3ZCMA 1YVUA 4KV8A 3AVJA 3TABA 3AVGA 4E7LA 3EZ5A 3F73A 2VG7A 3LP0A 3ZSRA 4KKOA 3AA3A 1FKOA 2X74A 3MAQA 5J2QA 5HRPA 1UA0A 4Z4FA 4IG0A 1EKEA 1KFSA 3DRSA 1BGXT 4OPJA 2G8WA 3PY8A 2OZSA 3O4NA 4FJNA 4DLEA 1RBRA 3LDSA 4CCHA 4E89A 1CLQA 4RW9A 1LWCA 3TAPA 5KRSA 4KTQA 3HK2A 4KAZA 3OVNA 3TI0A 1DLOA 5HRSA 2HHSA 1YTAA 5HRNA 3OYDA 4CF1A 1QSYA 3DLHA 4Z4GA 4NYFA 1W9HA 4IDKA 4IFYA 4Z4CA 4JS4A 3AVFA 4CEAA 2GV9A 3DI6A 3DLRA 4DQPA 1KLNA 3M8PA 4DSFA 4CEFA 4NYNA 4CE9A 4FZXC 5SWMA 2Z1HA 1CXQA 3ULDA 3QINA 4N47A 4W5TA 1QSSA 1O1WA 1KLMA 4M3YA 4OKKA 3NF8A 3VQAA 3EY1A 4FYDA 4E1NA 4I9QA 1CZ9A 2P5OA 4Z4HA 4B9VA 4HCBA 3WNHA 1ZBLA 1BQMA 3C94A 4DG1A 1A5WA 3QLHA 1U49A 3L2RA 3HM9A 2KZZA 1C1AA 3CM6A 4Z0UA 4DSJA 4CF8A 4KO0A 1XC9A 1N6QA 4FZYA 3NGIA 4GVMA 4BDPA 1ZBHA 4PY5A 1L3SA 4F2RA 3HP9A 3V1RA 2HVHA 2RN2A 1TVRA 1JLGA 1EP4A 3T3FA 1QS4A 2E6MA 2HW3A 3RWUA 2JGUA 1JLQA 1WSFA 1SUQA 3TAEA 4GW6A 3NGZA 4B9SA 1NK5A 3AV9A 1L3VA 4CJSA 1ASWA 3VQDA 4ELUA 3KJVA 3RTVA 4CEDA 1RDBA 3OYEA 4OKJA 1Y97A 1ITGA 1KVCA 1HQUA 3AVBA 3ZT4A 3KKRA 1S1TA 4CFDA 4E7IA 1TKXA 4BDYA 3HJFA 1LW2A 4FJIA 4C8OA 4ELVA 3KD1E 4F2SA 1BI4B 3DLGA 4HVJA 1D9DA 2PY5A 4O5BA 3SUPA 3ZSXA 2F8SA 4W5QA 3D0PA 2QKBA 4ELTA 2OPQA 1NKBA 4AHVA 4CJ3A 4JRQA 4KPYA 3ZT3A 1C0MA 3ITHA 1VSKA 2FBTA 3CYMA 3LZIA 3VA3A 4I9LA 4DMNA 2P1JA 4B8AB 2GUIA 3LAKA 1S5JA 4AHUA 3NF6A 4B08A 3ZSQA 3IG1A 5CYQA 4B8CA 4ID5A 3ALYA 1UAXA 4CFBA 2YNIA 4FW1A 3JSMA 3V4IA 5EU7A 3NAEA 2G8IA 4FJHA 4O0JA 4FJXA 3WNGA 4DTNA 1SKWA 5FRNA 4IKFA 3OYNA 1JLFA 3S3NA 1S9EA 3THVA 1WSEA 3QEVA 3P83D 1X9WA 2W42A 4DQRA 4Z4IA 4CEQA 1NK7A 1RTHA 3G0ZA 4RW4A 4FLYA 3QNNA 4I2PA 1U04A 3NH0A 1JLBA 2HNZA 4DF8A 3U6FA 1A5XA 2YHBA 1R0AA 4B3OA 1XWLA 1QQCA 3WNEA 3LP3A 3PO5A 2HHWA 2B6AA 2G8HA 1IKYA 1QE1A 2HB5A 3T19A 1JLEA 3AVAA 4OPKA 4KHQA 1IKVA 3HPOA 5CYMA 1LWFA 4LY7A 2IS3A 1TKTA 4C8NA 5J2MA 3SUOA 3ZT1A 1C1BA 3OJSA 3SV4A 3HO1A 4OLAA 4M3XA 4KFBA 5J1EA 4FCYA 4CJ5A 4H4MA 3OYBA 2IGIA 4IG3A 1Z26A 4KI4A 1CZBA 3ASMA 1T7PA 1JKHA 1Q8IA 1VRUA 2ZE2A 4HUGA 3SPYA 3B6OA 1U48A 2IAJA 3AO1A 1RBTA 4DWIA 1FK9A 4E19A 3DM2A 4Y1CA 4EZ9A 3S9HA 4KHUA 4CECA 5SZTA 3OYGA 1S1UA 3MXJA 2NUBA 1WN7A 2BGGA 5FRMA 3CFRA 4O55A 2Y1JA 1TKDA 1RT6A 4FM1A 1ZYQA 3NBPA 3RMAA 4DS4A 4CJVA 2B4JA 3AA5X 1C1CA 1VRTA 4IBNA 1NK6A 4FLZA 3OYMA 4BWMA 4CESA 3TARA 1GOBA 3QO9A 4CGJA 4O44A 3U3GA 3OS0A 3ZSZA 2IC3A 3SJJA 3L3UA 2R7YA 3HVTA 4DS5A 4PWDA 1IH7A 1BI4A 3M8SA 5HROA 3WNFA 1LV5A 2WOMA 4LH5A 4CHZA 4Q0BA 3HSTB 1WSIA 4CJWA 3LP1A 2D0BA 3QERA 4PQUA 4LSNA 3I8DA 1RT5A 4EP5A 1HNIA 3PX6A 4CIFA 4DTUA 3LZJA 3RMBA 4O0IA 1KTQA 4CGFA 4E7HA 5HP1A 3ZSOA 3VQ8A 3DOLA 2B5JA 3HVRA 4B9LA 2YNFA 1XI1A 2ZQBA 3QNOA 1U4BA 4CGHA 2PYLA 1K6YA 3LALA 3TWHA 1QTMA 4OKEA 3RRHA 1NJZA 2BE2A 5E41A 3LPUA 1TK0A 1J9AA 3K5LA 3SUNA 4KHSA 2Z1IA 2KQ2A 3LP2A 4DU4A 2ATQA 1VSLA 4K8XA 1A5VA 4W5RA 3VN5A 1BHLA 2OA8A 3H08A 5T7BA 3PO4A 1RDDA 2IOCA 1VK0A 1FXXA 3VQBA 3ISNC 1JL2A 4CK3A 5KRTA 1WSGA 4O4GA 3AO4A 3V9WA 3NHGA 2KFZA 1RTIA 1VSEA 2PYJA 4E1MA 3AVNA 4EZ6A 3L2UA 4M3WA 1RTDA 1RBSA 4B9UA 2FBYA 3IS9A 3LANA 4F8RA 4B9TA 1X9SA 5C24A 4N56A 3A2FA 3HT3A 3KK2A 3KK3A 3AVLA 4E3SA 4BE1A 2HHXA 2Y1IA 1I3AA 2X78A 3CQ8A 1JXEA 2AJQA 4JLHA 2WONA 3SZ2A 1HRHA 3L3VA 4CEZA 3OS1A 1NK0A 4DTSA 3RMCA 2XY6A 4NCBA 1B9DA 3KLFA 3K5MA 4CHPA 3SCXA 3RMDA 1WAFA 2Q3SA 2HHVA 4DTRA 1KVAA 1RT3A 4CHNA 3V6DA 4MFBA 3KKSA 4PA1A 1UWBA 2G8KA 4L8RB 4CF0A 1JLCA 2X6NA 4RW8A 5FDLA 4CHQA 3K57A 3HL8A 4AHTA 3OYIA 4RW6A 3MEGA 4Y1DA 3HXMA 2YKNA 3O3HA 4AILC 2IDOA 4CIEA 2XHBA 4AHRA 5KGWA 1VSJA 3ZSYA 3ZT2A 3OYFA 3IAYA 3M8QA 4M3RA 3KD5E 2GBZA 1NK4A 1RNHA 1ZBUA 3P5JA 1IG9A 2VG5A 2QK9A 4FLWA 1S9GA 3DRRA 1NJYA 4KI6A 4CGGA 3OS2A 3OYHA 1SL1A 3AVKA 3AA4A 1IKWA 3VQ6A 3RR7A 2F8TA 1JXBA 3NF7A 4CEEA 2HVIA 2KZMA 3TAFA 2X6SA 3VQ5A 3VQPA 3VA0A 4OJRA 4W5OA 2ETJA 3OYKA 1RTJA 2HMIA 3QIPA 4CF9A 2OYQA 4F3TA 1I39A 1WLJA 3OYCA 4J2AA 4J2EA 3SV3A 4M3TA 1BIUA 4J2DA 4QCLA 4FJ7A 3HYFA 2DFEA 2P51A 3I0SA 1BIZA 1VSMA 3DMJA 3TAQA 2HHTA 5C25A 4CJKA 1QHTA 3D45A 3SQ0A 2XY7A 3DLKA 3KIOA 5C42A 3F9KA 4NCGA 1VSHA 3O4QA 2HHUA 2RKIA 2BANA 3SQ4A 2JLEA 3TANA 1TV6A 4HHTA 2PZSA 1GOAA 1HPZA 3K5OA 4ZHRA 4Q5VA 4QAGA 4E0DA 2O4IA 4E7JA 3QEXA 1RCHA 1LWEA 2I5JA 4J2BA 3QEPA 1HQEA 4FM2A 1RDCA 3KLIA 4DSEA 3SUQA 4DFPA 3T1AA 3CFOA 4AHCA 3UIQA 4YNQA 1VSDA 4DQIA 2ITGA 4IFVA 4TSXA 3NDKA 1NJWA 1T03A 2P5GA 4CK2A 4I2QA 1L5UA 4FJ5A 2G8FA 3C95A 4CJPA 5K14A 2VG6A 1ZBIA 2FC0A 4FLUA 3S3OA 1U45A 4AH9A 1S1XA 1NOYA 4CF2A 4K8ZA 4F4KA 2Z1JA 3LWLA 3NGYA 5KI6A 2OPPA 3LPTA 3KLEA 1WNSA 4HTUA 3TAGA 1QSLA 1N5YA 2G8UA 1BISA 1T8EA 3LAMA 2VWJA 4YFUA 4BWJA 4CGIA 4N5SA 3KLGA 2D0CA 1L3UA 1TGOA 5CZ2A 3OJUA 3HPHA 2FBXA 5HBMA 1LAWA 3S3MA 4F3OA 4KB0A 1RBVA 3L2QA 1EXQA 4CHOA 5KTQA 4FK2A 3EYZA 1VSIA 3OYLA 4C8MA 3JYTA 1EX4A 2YHAA 1WAJA 4B9MA 2KFNA 3AO3A 4BE2A 1B92A 3TR8A 3DLBA 2A1SA 3SYZA 3U3YA 2YV0X 4DQQA 3G10A 4JS5A 3V9UA 3VQ4A 4DSKA 4FJJA 4ID1A 3K5NA 1Z25A 4DTOA 4C8KA 3DOKA 3RRGA 4DQSA 2FBVA 1D9FA 4CEBA 4FM0A 4DFMA 4LSLA 3O3FA 4C8LA 4CK1A 1REVA 4FZZA 2D0AA 4B9NA 3SQ1A 4H4OA 2RF2A 3M8RA 1TK5A 3PX4A 1DTQA 5HLFA 4DLGA 3VQCA 5J2NA 1RT1A 2HNDA 3QEWA 3IRXA 4CERA 1Q9XA 5D3GA 5CZ1A 4HUFA 4AHSA 4ZTJA 4DFKA 1S1WA 1UOCA 1B9FA 3BGRA 2DFFA 1KSPA 3DYAA 1SL2A 5HRRA 4FVMA 4DU3A 2LSNA 1YTUA 3SQ2A 1CXUA 5KGXA 4I7FA 4FK4A 4FJ9A 4FXDA 3TAMA 3E01A 3MECA 2HNYA 4FLXA 3AO2A 3VQ7A 1WSHA 2EHGA 5JS2A 4BDZA 4FJ8A 2RPIA 2XRIA 4MQ3A 4CJUA 3NH1A 1G15A 4KHNA 2HHQA 3OYAA 1TAQA 2XY8A 5CY4A 3QIOA 1SV5A 1C0UA 3AA2A 3DLEA 1KRPA 3BDPA 2DTUA 3K2PA 4DTPA 4OLBA 4CFAA 3MEDA 1MU2A 4HUEA 3V9SA 2D5RA 4M3UA 1BQNA 1TL3A 1S6PA 1XHXA 1ASVA 1NK8A 5FROA 4KRFA 4FJGA 1LW0A 3AVMA 4G1QA 1D5AA 4M42A 4KB1A 3OY9A 1U47A 3LWMA 1HMVA 3AO5A 3V1OA 4OGEA 3PV8A 1NK9A 3C6UA 1XHZA 4KHWA 2OPRA 4Z4EA 4DSIA 4BE0A 2XO7A 3AVHA 3L2VA 3K58A 1EETA 1VSFA 4KHYA 4W5NA 1IKXA 4PUOA 3KTQA 1TKZA 1X1PA 1S6QA 3PX0A 2OPSA 4N41A 5DMRA 3SI6A 4M45A 5JS1A 4WE1A 1X9MA 4FJKA 3MEEA 1KVBA 3QETA 4RG8A 2KW4A 3ZT0A 3MXIA 3MXMA 3FFIA 4FLTA 1NJXA 3B6PA 4CJRA 2O4GA 4M41A 1C6VA 3C6TA 3V1QA 4CJEA 3NFAA 5J2PA 4DSLA 4FW2A 3VQQA 1L3TA 2XY5A 2VWKA 4CHYA 4RW7A 3L8BA 3QEIA 1HNVA 1W0HA 3K59A 3AVCA 1HJRA 3P1GA 3NF9A 1NOZA 3AVIA
chains in the Genus database with same CATH superfamily
4BGBA 1D8YA 4BRKA 4R5PA 3VQEA 4CZLA 1BCMA 4CJFA 4JV5K 1S3XA 3DXMB 4A5AA 4KTWA 1GOCA 3VEOA 2QXFA 1HUXA 3H45C 3NCIA 5JVGL 4OVLA 4FWSA 1EWQA 3A5NC 4CZFA 3MCAB 1TYQA 1WSJA 2QW9A 2P9LA 3O9QA 4CZKA 4FLVA 4FJLA 3V9ZA 1T05A 3MWPA 2UU9K 2OZMA 4CIGA 1KAZA 4CGDA 4CBWA 4DUYK 1RDWX 2D0PA 4ZTFA 1RT7A 2EX3A 3R3LA 2QKKA 2Z1GA 1JCEA 2NZTA 1ASUA 5DK5A 3IUCA 4CJ4A 4GMJB 4CJQA 4EP4A 1Q9YA 4G9ZA 1HX1A 3KLHA 3ZX2A 2GWKA 1JL1A 3EZWA 2I7PA 1F21A 1NGJA 3ZETB 1P90A 3AVGA 3F73A 2VG7A 2FLOA 3P39A 1UA0A 4IG0A 1EKEA 2G8WA 2OZSA 3O4NA 3I33A 1QZ6A 3C7NB 1QQOA 4CCHA 4E89A 1CLQA 5KRSA 3H6EA 3HK2A 3EKSA 1IV0A 5HRNA 3OYDA 4FO0A 4Z4CA 4CEAA 3UB5A 1HKCA 4CEFA 1GLEG 5SWMA 3ULDA 4N47A 4W5TA 1QSSA 4M3YA 1KLMA 4OKKA 3VQAA 1NGHA 4FSVA 4E1NA 4WQ4C 3WNHA 1NJIO 3BF3A 3DLLL 1U49A 2ZF5O 4DSJA 1XC9A 1N6QA 1ILYA 1XC3A 3OTOK 4PY5A 3IMXA 3O1WA 1TVRA 1EP4A 2E6MA 4JI2K 2HW3A 3RWUA 1OVYA 1RDBA 2YJFA 5KPRA 1ITGA 1HQUA 3AVBA 2O8FB 4JKHA 4ISGA 3HJFA 3EE8A 4C8OA 4AM6A 1BI4B 1D9DA 2PY5A 3SUPA 3ZSXA 2F8SA 4W5QA 3D0PA 3CCLN 1NKBA 4KPYA 2O8BA 2FBTA 3LZIA 4I9LA 3OBYA 4DV2K 4AF1A 1ZBSA 2GUIA 3LAKA 3IG1A 5CYQA 1NWKA 3ALYA 4WCEL 2YNIA 3D6RA 5JLHA 3V4IA 4IOXA 3WNGA 4DTNA 4MO5A 3SLCA 3SMSA 2QWNA 3THVA 4Z4IA 2UXDK 1NK7A 3G0ZA 4RW4A 3AAPA 3NH0A 3U6FA 1M90O 3ZYYX 1QQCA 1VQ5N 3ATUA 4H03B 4OPKA 3TPQA 4KHQA 1IKVA 5CYMA 1LWFA 2F4VK 3OJSA 4A5BA 3VESA 5J1EA 1Z26A 1CZBA 3ASMA 4GNIA 1Q8IA 2ZE2A 3O5BA 5F2RA 2IAJA 1FK9A 3DM2A 2W6KA 4Y1CA 5SZTA 4BROA 2NUBA 2W6LA 3EN9A 4MLHA 3M6GA 2ASPA 4O55A 5AZIA 4FM1A 3RMAA 1C1CA 1VRTA 3D2EA 5LJVA 3OYMA 4BWMA 1NGFA 4CESA 1GOBA 3QO9A 3TARA 4CGJA 2IC3A 3E66A 4DR2K 3HVTA 4WYBA 3M8SA 3WNFA 4BY9C 4CHZA 1I94K 3LP1A 4DV5K 2V7ZA 4LSNA 4O8KA 3DJCA 2A42A 1KQSM 4E7HA 3AY9A 1XI1A 1GLCG 3K9JA 4UY8O 1U4BA 1YJNN 3ZEUA 3RRHA 5E41A 3LPUA 1NG9A 1N33K 1IJJA 4KHSA 5GADP 1VSLA 1A5VA 4W5RA 3H08A 1U2VA 1VK0A 1V4TA 4QS8A 4NXMK 4O4GA 3V9WA 1RTIA 2PYJA 3AVNA 3L2UA 4M3WA 1RTDA 1RBSA 2EWSA 4BRLA 4F8RA 1YAGA 3A2FA 3AVLA 1I3AA 2X78A 1JXEA 2P9UB 4LF7K 4FL9A 2WONA 1HRHA 3L3VA 4CEZA 3OS1A 4DV7K 4DTSA 2XY6A 3RMDA 1WAFA 5FPEA 3V6DA 3LDNA 2X6NA 4RW8A 4F9OA 3OYIA 1NM1A 5GAGP 3QBWA 3HXMA 3WQUA 4NB4A 3FE1A 4AHRA 3ZSYA 3OYFA 3M8QA 3U8XA 2P9IB 4DR3K 4DV6K 4A57A 1S9GA 4KI6A 3OS2A 2QWLA 4C23A 1QQNA 3IKMA 2HVIA 2KZMA 2NRTA 3CCMN 3TAFA 3VQ5A 2HBMA 3VQPA 4W5OA 2ETJA 2OYQA 4CF9A 3DXKA 4B1ZA 5KPZA 3O9UA 3GG4A 1SAZA 4M3TA 4FJ7A 2FF3B 3HYFA 2P51A 2P9KB 1QHTA 2XY7A 3KIOA 3ENBA 5F1XA 5AQZA 3F9KA 2HHUA 1YF5L 1BDGA 3SQ4A 1N8RO 4HHTA 4KHPK 4IEEA 3QEXA 2O8CB 1LWEA 4WFAL 4FM2A 2ZJQL 2PAVA 3SUQA 4AHCA 4DV0K 1VSDA 5A2QO 4CK2A 3F9MA 4PKIA 3C95A 4CJPA 4CZMA 5LMNK 2FC0A 3S3OA 4BR9A 2E2QA 4F4KA 1Y64A 1P8ZA 5KI6A 3KLEA 3LPTA 1WNSA 4MO4A 2VWJA 4FWQA 2P9SA 3OJUA 5HBMA 5M1NA 3UE5A 4A2AA 5KTQA 3VOVA 5C10A 4JI3K 4JKCA 5ADXA 3JYTA 2KFNA 3ULEA 1B92A 3PSFA 3TR8A 1VHXA 4KH5A 1VQ9N 2A1SA 1ATNA 2YV0X 3G10A 3H3NO 4XEIA 4FJJA 1S22A 4JKDA 4DQSA 4JAXA 3HTVA 1HKBA 2P9PA 1K73O 2IVNA 2ZJRL 2RF2A 1TK5A 5HLFA 5J2NA 3VQCA 3AGRA 1Q9XA 1ZXOA 2Q31A 5CZ1A 4LF9K 3A8YA 4DFKA 1UOCA 4RTFD 5AR0A 4DV1K 1SL2A 4DU3A 1YTUA 3SQ2A 4FK4A 5C2FA 3TAMA 1WUAA 3MECA 2EHGA 3H1QA 4I6MA 3UKRB 3RSEB 4JK8A 2HHQA 3MX5A 5M1FA 1TAQA 3VEXA 5TKYA 4OLBA 3MEDA 3LDPA 4M3UA 1HNXK 1BQNA 1XMOK 5E26A 1XHXA 4FJGA 1LW0A 4M42A 4G1QA 1D5AA 3UKUA 4KB1A 2F9WA 3OY9A 4BG8A 3BF1A 3QDKA 3AO5A 4OGEA 1NK9A 1HLUA 2OPRA 4X64K 4BE0A 1YUWA 3L2VA 4H0OA 1IKXA 4FVUA 1S6QA 3PX0A 5DMRA 1KAXA 4M45A 4H5RA 5JS1A 5IT9O 1KVBA 3QETA 3MXIA 2NLXA 1MWKA 3B6PA 3VTHA 3R6MA 4CJRA 4BRCA 3V1QA 3VQQA 2BUPA 5TKWA 3QEIA 1HNVA 1HJRA 4DV4K 1TK8A 1RBUA 4E7KA 1BL3A 3H1VX 5AJ3K 1V4SA 2Q97A 4CD3A 3O4WA 3L4IA 3HPGA 5JICA 4DF4A 2E4LA 2OCEA 3CG7A 3FZLA 4DTMA 5C12A 4WF9L 4BACA 2YKMA 3PUFA 4DFJA 2DFHA 1CZAN 4ICLA 3VQ9A 3TSUA 2VQFK 1C0TA 3VGKA 2CGKA 3CJBA 2ZD1A 3BZKA 4YOTA 4NLBA 1NGEA 3VEZA 3CI5A 3VF4A 4B3TK 3HP6A 3SNNA 4FK0A 1VQ8N 1LAVA 5I42A 3QB0A 2GUPA 4B1YB 3HM8A 4YORA 4DQ8A 2V51B 2G8VA 1DTTA 2A1RA 1MA9B 4PL8A 1TAUA 1TUUA 2UYTA 1TL1A 1XUPO 3P31A 4FJMA 4H8KA 2ASMA 4HCCA 3ENOA 4OGCA 1GLAG 4CZHA 1YVUA 1FJGK 4E7LA 2FF6A 1J6ZA 4C1NK 4BRGA 4FJNA 4OPJA 3LDSA 1E3MA 1IBLK 3TAPA 4KTQA 1BU6O 1NGCA 3CCJN 3TI0A 4YDUA 3CERA 5AQMA 4BC3A 4JKAA 4LF5K 4CF1A 4NYFA 3G71N 1W9HA 3DXMA 4IDKA 4YY3K 4IFYA 2GV9A 3DI6A 3DLRA 2GEMA 2Q0UA 4CE9A 2Z1HA 1CXQA 2O8EB 3NF8A 3EY1A 4FYDA 1GLBG 3KVGA 4I9QA 2P5OA 2RE2A 3C94A 4DG1A 4FWNA 3FZHA 3L2RA 2KZZA 2HBLA 1C1AA 3CM6A 4Z0UA 3LDQA 4CF8A 4KO0A 1KXPA 3HOTA 4NO7A 4BDPA 2NRXA 4F2RA 2KKZA 3T3FA 1GLDG 4M7YA 4ILGB 1WSFA 4R79A 3CD6N 4IDHA 3TAEA 1BOTO 1NK5A 1L3VA 1YVNA 5GAHP 3KJVA 3OYEA 4O8UA 3ZT4A 3E9OA 3ENHA 4H5WA 3SAFA 3TTFA 4CFDA 1TKXA 4BDYA 1LW2A 4ELVA 5C0YA 3C65A 3CMAN 2P9NB 2OPQA 4IOAL 3ITHA 2WUSA 4BR4A 5EXWA 4LFBK 4DMNA 2P1JA 1S5JA 2D1KA 3C7NA 4JKGB 4B08A 3ZSQA 3VGLA 4CFBA 4FW1A 3CJCA 5FRNA 3OYNA 4BG9A 1WSEA 3P83D 3FZMA 4X66K 3MN9A 4RWTA 4I2PA 1U04A 2HNZA 4H0PA 2YHBA 1C0GA 3LM9A 3LP3A 2B6AA 2G8HA 1QE1A 4B1UB 1JLEA 3VETA 2IS3A 1TKTA 4C8NA 3SV4A 1Z05A 4FCYA 4CJ5A 3OYBA 4IG3A 1T6CA 1T7PA 1VRUA 2A5XA 1BWFO 3AO1A 1RBTA 4E19A 3J81O 4QS7A 4K25A 3D2FB 1RT6A 1ZYQA 3NBPA 4DS4A 3AA5X 4IBNA 2O8FA 3VERA 3OS0A 1OVQA 2R7YA 4DS5A 4BC2A 5M1QA 1BI4A 4LH5A 4Q0BA 3QERA 4PQUA 2HMPA 4EP5A 1HNIA 4CIFA 4GKJK 4M7XA 3LZJA 4XH4A 3QICA 3RMBA 3VQ8A 3DOLA 3HVRA 2YNFA 4Y0WA 3QNOA 3THYB 4JKEA 3TWHA 2WBNA 2PBDA 4WQ5A 2BE2A 1TK0A 1J9AA 3K5LA 2Z1IA 3VF6A 2QWOA 3NMUA 5T7BA 1NGIA 3THXB 4CK3A 1WSGA 1VSEA 4EZ6A 2Q1NA 2QWQA 4B9UA 2FBYA 3MCPA 5EOYA 4A62A 1HNZK 2AA4A 3CJAA 1HKGA 1QQMA 5AQGA 2AJQA 1NK0A 4NCBA 1B9DA 3SCXA 4DR6K 2HHVA 1KVAA 4CHNA 2G8KA 1UWBA 3P4IA 3ATVA 4EIAA 4CF0A 4CHQA 3HZ6A 1VQPN 4RW6A 3L6QA 3O3HA 3O6WA 2XHBA 1NGBA 4M3RA 4DB3A 3KD5E 2GBZA 1HR0K 3WT0A 3P5JA 3MDQA 2QK9A 3CETA 4BRNA 4FLWA 1NJYA 2FSNA 2F8TA 3AA4A 2Q36A 2BH1A 5JLFA 1JXBA 3JAMO 1NLVA 4CZIA 3OYKA 2HMIA 4BC4A 4J2AA 4J2EA 3O9SA 1H1VA 2E5LK 4CZJA 4BRDA 5BRFA 1ESVA 4NCGA 2E88A 1VSHA 2JLEA 2PZSA 1HPZA 2O4IA 4QAGA 4JKBA 1IG8A 4EAHD 5AFUA 4DSEA 5F0XA 3R8EA 3CFOA 5B8HA 1MDUB 5CHIA 2ZJPL 5BRDA 4FJ5A 2P5GA 1L5UA 2P9UA 1ATRA 3Q7CA 4FLUA 1U45A 1YJ9N 4M63C 4CF2A 3LWLA 5KPTA 3VTIA 4U67L 1Q18A 3LAMA 3WUHA 4CGIA 4N5SA 3M5RA 3KLGA 2D0CA 5ADXH 1W7AA 4H0XB 4BRPA 1YI2N 5FPNA 3MMVA 2P9IA 3DAWA 4FOEA 2YHAA 3WQTA 4JI8K 3DLBA 3T7ZA 3SYZA 5BREA 3W3DA 4JK9A 3HBTA 4ID1A 3DOKA 3RRGA 1D9FA 4XH1A 4CEBA 5E84A 4LSLA 4IFEA 2D0AA 4BC5A 3T1HK 4H4OA 1VAZA 3M8RA 3THWB 3PX4A 1DTQA 2P9KA 1RT1A 3IRXA 3DWLA 1B9FA 1OH8A 2DFFA 3N4PA 1KSPA 5AQLA 1FW6A 1CXUA 1VQON 2O8CA 2IVOA 1QHAA 4EHTA 4JI0K 5JS2A 4FJ8A 2RPIA 1QVGM 3NH1A 1G15A 1KRPA 3DLEA 3BDPA 2DTUA 2AP1A 4DTPA 4HUEA 3V9SA 1TL3A 2IIRA 1S6PA 2I7NA 5AQYA 1NK8A 3A0IX 4KRFA 4H5TA 3AVMA 5AQQA 4EHUA 4IJNA 3LWMA 3PV8A 2FSKA 4KHWA 5BPNA 2XO7A 1T3VA 1EETA 3JXUA 1EQYA 1E4FT 1KC8O 4PUOA 1TKZA 4PHTX 3SI6A 4CZEA 4FJKA 2KW4A 2QXLA 3ZT0A 3IFRA 3MXMA 3FFIA 1NJXA 1OH5A 4CJEA 3U4LA 3NFAA 3L8BA 4CHYA 4RW7A 4B1VA 3K59A 2A40A 2QM1A 3KK1A 4M3ZA 3V81A 2O8DB 1G99A 3A5MC 4B1XB 4IEIA 1J5OA 3NVKA 4LH4A 3SPZA 3C6AA 3DRPA 4FPAA 2ZGZA 2DPNA 2E1ZA 1YITN 1RILA 4BVOA 1XMQK 3O3GA 1HJOA 1S1VA 2DY4A 3SMPA 4UQGA 3CCSN 4JKFA 4XIUA 1J53A 3V9XA 2NRRA 4MDBA 3UKRA 1YT3A 3KZBA 4DU1A 2YNHA 3RSEA 3NH2A 5AQWA 4BRAA 5AQHA 2E6LA 3CM5A 1RDUA 2NRZA 3MK6A 2BDPA 4DR1K 3N4QA 1HYVA 2QTDA 2UUBK 5GINA 1KFDA 5BPLA 4IO9L 1RT2A 4QOZB 1SL0A 4JI1K 1WBDA 4YOUA 4PL7A 3WXLA 3OYJA 3ZSVA 4KTZA 5DM7L 4DTXA 3TTCA 2KTQA 1RT4A 3QESA 3AAQA 1FKPA 4CJLA 1KCFA 3ZCMA 3TABA 3EZ5A 3LP0A 4KKOA 2X74A 3MAQA 5J2QA 3DRSA 1BGXT 3PY8A 4CJ7A 4CW7B 2HF4A 4DLEA 3E9LA 1LWCA 3LDOA 4NLCA 3OVNA 2HHSA 1T6DA 1YJWN 4DQPA 1KLNA 4DSFA 3WEEB 3QINA 4BRQA 4YHHK 1Q86O 4Z4HA 4HCBA 2YX6A 1BQMA 4L3QA 1A5WA 1DT9A 3GE1A 3QLHA 4ILJA 1IBKK 2VGNA 5BRHA 3NGIA 4A2BA 3HP9A 3V1RA 2HVHA 2RN2A 3O9TA 2CGLA 2VGMA 2JGUA 1JLQA 3B8AX 4GW6A 3NGZA 3VEVA 3AV9A 5JVHL 3EE9A 3VQDA 4CVNE 5LJWA 3CC2N 4CEDA 4ELUA 4OKJA 3O8MA 2GWJA 3O08A 1EO1A 2OTLN 3KD1E 4F2SA 1BO5O 4HVJA 4O5BA 2E8AA 4ELTA 2V52B 4AHVA 4CJ3A 4JRQA 2F9TA 1VSKA 3FFKB 3GBTA 4AHUA 4YDUC 5AZJB 5LY3A 1BUPA 3PIPL 3JSMA 3KHYA 2NRWA 3NAEA 2D0OA 2G8IA 4GKKK 4LFAK 3QEVA 4CEQA 1GLJO 1GLFO 1RTHA 4OPHA 3QNNA 1JLBA 4DF8A 1R0AA 1VQ7N 5AQOA 4FPBA 2O8EA 4Z94A 2HB5A 3T19A 3AVAA 4LY7A 3F2KA 1N34K 3CC4N 3ZT1A 1C1BA 1JCFA 4KFBA 4JK7A 4H4MA 4KI4A 1JKHA 3R9PA 3A5LC 4ISEA 2FXUA 5BN9A 4KHUA 4BRFA 4EZ9A 4X62K 4CECA 1S1UA 3MXJA 3JS6A 1WN7A 2BGGA 3CFRA 1TKDA 4J8FA 2B4JA 4H0YB 5LMUK 5EX5A 4FLZA 2HHHK 4DR4K 3ZSZA 3SJJA 4DR5K 3L3UA 4BREA 2V7YA 3CJ9A 3HSTB 1WSIA 5HL7L 2P9NA 2D0BA 3I8DA 3CPEA 1NMNA 1J5EK 2GTDA 5HP1A 4CGFA 4JKGA 3ZSOA 3M3ZA 4C1NI 3MN6A 4CGHA 3J7ZO 1NBWA 3LALA 1QTMA 1NJZA 3AGKA 3SUNA 4ILHA 2Q0RA 2KQ2A 1NGGA 3LP2A 4DU4A 3VN5A 2NNWA 3PO4A 4H5NA 1FXXA 3ISNC 3QFUA 5AQFA 4JHDB 2KFZA 3HOSA 3NHGA 4LF4K 4E1MA 3CIPA 1X9JA 3IS9A 5FLXO 3CJ7A 2OTJN 3H46O 1X9SA 3KK3A 4E3SA 4GV3A 1GLLO 3CQ8A 5ELZA 4JLHA 3SZ2A 5C15A 4BRIA 3RMCA 1Z6RA 4CHPA 2Q3SA 3D2FA 4E1JA 1SQKA 4DTRA 2HSTA 1RT3A 4LC9B 2RHKA 4PA1A 4L8RB 4BGAA 4JNEA 1JLCA 4AHTA 4Y1DA 2YKNA 4AILC 3FR0A 5AQVA 5BN8A 4JI7K 3IAYA 1VQLN 1NK4A 1ZBUA 2A41A 3SJHA 2NRHA 1RFQA 2VG5A 3DRRA 3WXMB 3SK3A 4H0TB 3OYHA 3CC7N 1OH6A 3RR7A 3CCEN 3O80A 4CEEA 4A61A 1BA1A 4WQ5C 4RCHA 4OJRA 1RTJA 2YJEA 3QIPA 3THYA 3OYCA 2VQEK 4J2DA 4QCLA 3VEYA 4JD2B 2GX9A 2HHTA 1VSMA 3TAQA 2IVPA 4BR5A 5C25A 2VYPA 3LDLA 1QZ5A 4CJKA 1XNQK 3D45A 3SQ0A 5HOOA 2QWRA 3THXA 3O4QA 2J4RA 2BANA 2RKIA 1HNWK 1TV6A 5AFUH 3G6EN 1GOAA 3K5OA 3ZX3A 4E0DA 2HBJA 4E7JA 1RCHA 2I5JA 4J2BA 3GOIA 3QEPA 1HQEA 3Q7BA 3KLIA 1VQMN 4B3RK 4IFVA 4TSXA 3NDKA 1T03A 4I2QA 5DM6L 5K14A 2VG6A 1ZBIA 1YHQN 1S72N 1S1XA 2VWBA 1NOYA 2Z1JA 3L0QA 3TSQA 2OPPA 4ISFA 4HTUA 1QSLA 2E2OA 1BISA 1T8EA 4YFUA 4BWJA 2KLAA 5C2DA 3EKUA 4WFBL 5CZ2A 3S3MA 4F3OA 1RBVA 3L2QA 1EXQA 4FK2A 2ZGYA 3EYZA 1EWRA 1VSIA 4JEPA 3OYLA 4C8MA 1WAJA 3D7EO 4B9MA 5AQJA 1ATSA 4BE2A 3U3YA 4DQQA 4JS5A 3V9UA 2HBKA 4O5FA 4DSKA 3HI0A 3EO3A 3K5NA 1Z25A 4C8KA 3F5TA 2FBVA 1NGDA 4KH4A 4C8LA 4DFMA 3O3FA 1TUYA 4MLEA 4FZZA 5H1SQ 5GIOA 3SQ1A 4B9NA 1XNRK 3CHWA 2OANA 1SZ2A 1T44A 3CXCM 4DLGA 2QA4N 2HNDA 3CCQN 1HPMA 4CERA 4FWKA 5BPMA 5D3GA 4AHSA 1K8KA 3DYAA 5HRRA 4FVMA 2LSNA 3LL3A 5KGXA 4I7FA 5AQPA 4OX9K 4FJ9A 4U7BA 2UUCK 3A5OC 3P38A 3CQXA 1WSHA 3TTDA 3VENA 4BDZA 5AQKA 2XRIA 4MQ3A 4KHNA 1TYQB 2P9LB 3OYAA 3BP8A 1SV5A 1C0UA 3AA2A 3MWTA 1WBBA 3WXIA 4BRHA 4JYAK 1MU2A 5KQDA 3CCUN 2YI1A 3ZX0A 3C6UA 5FPMA 4DV3K 1XQSC 3AVHA 3K58A 4W5NA 1R59O 2WTUA 4KHYA 3IDHA 3MX2A 4N41A 4WFNL 4KBOA 3BUZB 4WE1A 1X9MA 4FLTA 2NRVA 4M41A 4BQZA 5J2PA 4DSLA 4FW2A 2XY5A 2VWKA 1W0HA 1SS6A 1NOZA 4BQLA 3T1YK 3THWA 1SKRA 1UA1A 2PFUA 1K8KB 1BCOA 1C0FA 1HYSA 5FPDA 5GAEP 1JLAA 3FZKA 4YOXA 3RR8A 1HYZA 3NE6A 4CJTA 1VQNN 4JI6K 5BR9A 1NKCA 1ZBFA 3QMLA 4CEOA 5AQSA 4LD0A 5AQUA 3ZSWA 3PSIA 1NKEA 4WQ4A 4NCAA 3WXJA 4CFCA 1IO2A 1RDAA 3L2WA 4DHYA 4AQYK 2F96A 1DKGD 3I56N 4JRPA 4FWPA 1NGAA 1WOQA 3CFPA 4GVEA 4DTJA 1J54A 2YNGA 3CQYA 2CH5A 4XH5A 3SBGA 1W97L 1X3NA 5I3UA 3I0RA 4CZGA 4KREA 4IWVA 1W2BM 3KWGA 1SKSA 4FWMA 4MDAA 4KV8A 3AVJA 2UUAK 3O1BA 3CF5L 4BR7A 3ZSRA 3AA3A 3RVCA 1FKOA 4FOIA 5HRPA 2O8BB 2H3GX 4Z4FA 3G25A 1KFSA 2W41A 5I9EB 1BA0A 1Q7YO 2E20A 4DKWA 1RBRA 1N32K 4RW9A 4KH6A 2O8DA 4KAZA 1DLOA 5HRSA 1RGIA 1YTAA 2ZWHA 4CBUA 1QSYA 4LF8K 3DLHA 5AQNA 4Z4GA 3VEWA 3FLCO 2YHXA 4JS4A 4IOCL 3AVFA 3TU5A 4CD1A 3M8PA 3OA9A 4NYNA 4FZXC 2E2PA 1O1WA 3E1YA 1WB9A 1KD1O 1CZ9A 4B9VA 1ZBLA 3AARA 3PIOL 2YCHA 4AM7A 2HF3A 3HM9A 1ZBHA 4FZYA 3ID6A 4GVMA 2GELA 2QWMA 3OW2M 1L3SA 1JLGA 1QS4A 5AQRA 1SUQA 4B9SA 5AZIB 4CJSA 1ASWA 3U9DA 3RTVA 3D2EB 1Y97A 1Q82O 1KVCA 3KKRA 4OO1J 1LOTB 1S1TA 4E7IA 4FJIA 3DLGA 5BR8K 5M1KA 2QKBA 3CPWM 3ZT3A 1C0MA 2ASOA 3CYMA 3VA3A 3ID8A 2YHWA 3U9ZA 4B8AB 3GDQA 2UXCK 3NF6A 3SBTA 4B8CA 4ID5A 4B1WB 1UAXA 3L4QA 5EU7A 4FJHA 3ZEUB 4O0JA 4FJXA 1SKWA 2QEXN 4IKFA 3E9PA 1JLFA 3S3NA 1S9EA 1X9WA 2W42A 4DQRA 1OKJA 4HWIA 4FLYA 1U2VB 1A5XA 4B3OA 1XWLA 3WNEA 3WEEA 2CGJA 3PO5A 2HHWA 1IKYA 4CI6A 3HPOA 5J2MA 1DGKN 3SUOA 4NXNK 3HO1A 4A59A 4OLAA 2UXBK 4M3XA 5IWAK 2IGIA 2ZM6K 4HUGA 3SPYA 1U48A 3B6OA 4DWIA 4JN4A 2D4WA 3S9HA 3OYGA 5FRMA 2Y1JA 4EFHA 4QS9A 4CJVA 1NK6A 2WFBA 4B9QA 1VQ6N 4O44A 3U3GA 4PWDA 1IH7A 5HROA 1DEJA 1LV5A 4FWRA 4YOVA 2WOMA 4CJWA 3ZLJA 1RT5A 5EVZA 5AQXA 3PX6A 3FZFA 4DTUA 4O0IA 1KTQA 1ZC6A 3VPZA 3QBXA 2B5JA 3OBWA 4B9LA 2CH6A 5AZJA 3BEXA 2ZQBA 2PYLA 3DXKB 3W0LA 1K6YA 3SAGA 4OKEA 4BR2A 4K41A 2QI2A 4PKGA 3T69A 2ATQA 4K8XA 1BHLA 1YXQA 2OA8A 3G4SN 2JWLA 1RDDA 2IOCA 3VQBA 3TSPA 5CE3A 1JL2A 5KRTA 3S41A 3AO4A 1QVFM 4GV6A 3EEQA 3K0SA 1NMDA 3NVMA 4JI4K 3LANA 1M1KO 3K9KA 4YOWA 4B9TA 5C24A 4N56A 3HT3A 3KK2A 3J7AP 4BE1A 2Y1IA 1X3MA 3K5MA 3KLFA 3H3OB 2HHXA 4MFBA 3KKSA 5FDLA 3K57A 3HL8A 4LF6K 3MEGA 2WC9A 2VCPA 2P9SB 4GV9A 2IDOA 1VQKN 4K42A 1KAYA 4CIEA 5KGWA 1VSJA 2A3ZA 3CJ1A 3ZT2A 5CR4A 1RNHA 1O13A 3KK7A 1K8AO 5M1PA 1IG9A 4B3SK 3ULEB 1Q81O 4CGGA 1SL1A 3AVKA 1IKWA 3OHRA 3VQ6A 3NF7A 5AQIA 2X6SA 4K43A 1IBMK 3VA0A 5GIPA 4F3TA 1I39A 1WLJA 2P9PB 4JI5K 2BTFA 3SV3A 1BIUA 3KWIA 2DFEA 1OH7A 3I0SA 1BIZA 3DMJA 4LFCK 1K9MO 3MN5A 3DLKA 4FWOA 5C42A 4PKHA 4V19S 3TANA 4FWLA 4CBXA 4JHDA 4Q5VA 4ZHRA 4H5VA 3M1FA 3R1XA 2JWKA 1RDCA 4DFPA 3T1AA 3UIQA 3GL1A 4YNQA 4I6MB 4DQIA 2ITGA 3J8AA 4IJAA 1NJWA 3VF2A 4YOYA 2G8FA 4AH9A 4DR7K 4K8ZA 3LM2A 4HTLA 3C0BA 3NGYA 3UKUB 3TAGA 1MWMA 1N5YA 2G8UA 1VQ4N 5KQ8A 3CMEN 1L3UA 1TGOA 3HPHA 5AQTA 2FBXA 1LAWA 1YIJN 4KB0A 4CHOA 2FSJA 4H0VB 1EX4A 1NU0A 3AO3A 4IO8A 5M1OA 3WXKA 3VQ4A 2E2NA 3VGMA 4DUZK 4DTOA 4X65K 1N36K 4FM0A 1U6ZA 4CK1A 1REVA 3SAHA 2E1YA 3HSCA 1D4XA 4JD2A 3CCVN 3QEWA 3BY5A 3FGUA 5JMVA 5MLCQ 3CCRN 4HUFA 4GY2B 2A6AA 4BR0A 4ZTJA 1S1WA 3BGRA 1NNEA 3QFPA 3EL2A 3J7YP 4IZ9A 4OPAA 4FXDA 3I55N 4IXCA 3E01A 2HNYA 3I8BA 4FLXA 3AO2A 3VQ7A 2W40A 2ITMA 4CJUA 2YHYA 2XY8A 5CY4A 3QIOA 1JCGA 4BVPA 3K2PA 4CFAA 2KHOA 3J80O 2D5RA 2HOEA 2QWPA 3O9RA 1ASVA 3PLAA 5FROA 1U47A 1HMVA 1E4GT 3V1OA 4B3MK 1XHZA 1LCUA 4Z4EA 4DSIA 4K0KK 4BRMA 1BG3A 1VSFA 3KTQA 1X1PA 2OPSA 1JJ2M 3MEEA 4DCHA 3HRGA 4RG8A 5LL6Z 3MN7A 2O4GA 3VMFB 5EY4A 1C6VA 3C6TA 3ZETA 2F7TA 1L3TA 3BZCA 2Q2RA 3AVCA 3C6HA 3P1GA 3NF9A 4N76A 3AVIA
chains in the Genus database with same CATH topology
1TK8A 1D8YA 3KK1A 1SKRA 4M3ZA 1UA1A 1RBUA 4E7KA 1BL3A 4R5PA 3V81A 1BCOA 3VQEA 1J5OA 1HYSA 1BCMA 4LH4A 3HPGA 3SPZA 3DRPA 4DF4A 2E4LA 4CJFA 1JLAA 3CG7A 4DTMA 3RR8A 1HYZA 1RILA 1GOCA 4KTWA 3NE6A 2YKMA 3PUFA 3O3GA 2DFHA 4BACA 1S1VA 2QXFA 4ICLA 3VQ9A 4DFJA 2DY4A 4UQGA 3NCIA 1C0TA 4CJTA 4XIUA 1NKCA 1J53A 1ZBFA 3V9XA 4OVLA 2ZD1A 4CEOA 4LD0A 1YT3A 4DU1A 2YNHA 3NH2A 3HP6A 3SNNA 4FK0A 1WSJA 3ZSWA 2E6LA 4FLVA 4FJLA 3V9ZA 1T05A 1NKEA 3CM5A 4NCAA 1LAVA 4CFCA 2OZMA 4CIGA 1IO2A 4CGDA 5I42A 1RDAA 2BDPA 4ZTFA 1RT7A 3L2WA 2EX3A 2QKKA 2Z1GA 1HYVA 2G8VA 2F96A 5DK5A 1DTTA 1ASUA 4CJ4A 2A1RA 4JRPA 1KFDA 1TAUA 3CFPA 1RT2A 4GMJB 4CJQA 4QOZB 4DTJA 4EP4A 1TL1A 1SL0A 1Q9YA 1J54A 2YNGA 4FJMA 4H8KA 3KLHA 4N76A 1JL1A 5I3UA 4HCCA 3I0RA 3OYJA 3ZSVA 4KTZA 4DTXA 4KREA 1RT4A 2KTQA 4OGCA 3QESA 1F21A 1FKPA 4CJLA 1KCFA 1SKSA 3ZCMA 1YVUA 4KV8A 3AVJA 3TABA 3AVGA 4E7LA 3EZ5A 3F73A 2VG7A 3LP0A 3ZSRA 4KKOA 3AA3A 1FKOA 2X74A 3MAQA 5J2QA 5HRPA 1UA0A 4Z4FA 4IG0A 1EKEA 1KFSA 3DRSA 1BGXT 4OPJA 2G8WA 3PY8A 2OZSA 3O4NA 4FJNA 4DLEA 1RBRA 3LDSA 4CCHA 4E89A 1CLQA 4RW9A 1LWCA 3TAPA 5KRSA 4KTQA 3HK2A 4KAZA 3OVNA 3TI0A 1DLOA 5HRSA 2HHSA 1YTAA 5HRNA 3OYDA 4CF1A 1QSYA 3DLHA 4Z4GA 4NYFA 1W9HA 4IDKA 4IFYA 4Z4CA 4JS4A 3AVFA 4CEAA 2GV9A 3DI6A 3DLRA 4DQPA 1KLNA 3M8PA 4DSFA 4CEFA 4NYNA 4CE9A 4FZXC 5SWMA 2Z1HA 1CXQA 3ULDA 3QINA 4N47A 4W5TA 1QSSA 1O1WA 1KLMA 4M3YA 4OKKA 3NF8A 3VQAA 3EY1A 4FYDA 4E1NA 4I9QA 1CZ9A 2P5OA 4Z4HA 4B9VA 4HCBA 3WNHA 1ZBLA 1BQMA 3C94A 4DG1A 1A5WA 3QLHA 1U49A 3L2RA 3HM9A 2KZZA 1C1AA 3CM6A 4Z0UA 4DSJA 4CF8A 4KO0A 1XC9A 1N6QA 4FZYA 3NGIA 4GVMA 4BDPA 1ZBHA 4PY5A 1L3SA 4F2RA 3HP9A 3V1RA 2HVHA 2RN2A 1TVRA 1JLGA 1EP4A 3T3FA 1QS4A 2E6MA 2HW3A 3RWUA 2JGUA 1JLQA 1WSFA 1SUQA 3TAEA 4GW6A 3NGZA 4B9SA 1NK5A 3AV9A 1L3VA 4CJSA 1ASWA 3VQDA 4ELUA 3KJVA 3RTVA 4CEDA 1RDBA 3OYEA 4OKJA 1Y97A 1ITGA 1KVCA 1HQUA 3AVBA 3ZT4A 3KKRA 1S1TA 4CFDA 4E7IA 1TKXA 4BDYA 3HJFA 1LW2A 4FJIA 4C8OA 4ELVA 3KD1E 4F2SA 1BI4B 3DLGA 4HVJA 1D9DA 2PY5A 4O5BA 3SUPA 3ZSXA 2F8SA 4W5QA 3D0PA 2QKBA 4ELTA 2OPQA 1NKBA 4AHVA 4CJ3A 4JRQA 4KPYA 3ZT3A 1C0MA 3ITHA 1VSKA 2FBTA 3CYMA 3LZIA 3VA3A 4I9LA 4DMNA 2P1JA 4B8AB 2GUIA 3LAKA 1S5JA 4AHUA 3NF6A 4B08A 3ZSQA 3IG1A 5CYQA 4B8CA 4ID5A 3ALYA 1UAXA 4CFBA 2YNIA 4FW1A 3JSMA 3V4IA 5EU7A 3NAEA 2G8IA 4FJHA 4O0JA 4FJXA 3WNGA 4DTNA 1SKWA 5FRNA 4IKFA 3OYNA 1JLFA 3S3NA 1S9EA 3THVA 1WSEA 3QEVA 3P83D 1X9WA 2W42A 4DQRA 4Z4IA 4CEQA 1NK7A 1RTHA 3G0ZA 4RW4A 4FLYA 3QNNA 4I2PA 1U04A 3NH0A 1JLBA 2HNZA 4DF8A 3U6FA 1A5XA 2YHBA 1R0AA 4B3OA 1XWLA 1QQCA 3WNEA 3LP3A 3PO5A 2HHWA 2B6AA 2G8HA 1IKYA 1QE1A 2HB5A 3T19A 1JLEA 3AVAA 4OPKA 4KHQA 1IKVA 3HPOA 5CYMA 1LWFA 4LY7A 2IS3A 1TKTA 4C8NA 5J2MA 3SUOA 3ZT1A 1C1BA 3OJSA 3SV4A 3HO1A 4OLAA 4M3XA 4KFBA 5J1EA 4FCYA 4CJ5A 4H4MA 3OYBA 2IGIA 4IG3A 1Z26A 4KI4A 1CZBA 3ASMA 1T7PA 1JKHA 1Q8IA 1VRUA 2ZE2A 4HUGA 3SPYA 3B6OA 1U48A 2IAJA 3AO1A 1RBTA 4DWIA 1FK9A 4E19A 3DM2A 4Y1CA 4EZ9A 3S9HA 4KHUA 4CECA 5SZTA 3OYGA 1S1UA 3MXJA 2NUBA 1WN7A 2BGGA 5FRMA 3CFRA 4O55A 2Y1JA 1TKDA 1RT6A 4FM1A 1ZYQA 3NBPA 3RMAA 4DS4A 4CJVA 2B4JA 3AA5X 1C1CA 1VRTA 4IBNA 1NK6A 4FLZA 3OYMA 4BWMA 4CESA 3TARA 1GOBA 3QO9A 4CGJA 4O44A 3U3GA 3OS0A 3ZSZA 2IC3A 3SJJA 3L3UA 2R7YA 3HVTA 4DS5A 4PWDA 1IH7A 1BI4A 3M8SA 5HROA 3WNFA 1LV5A 2WOMA 4LH5A 4CHZA 4Q0BA 3HSTB 1WSIA 4CJWA 3LP1A 2D0BA 3QERA 4PQUA 4LSNA 3I8DA 1RT5A 4EP5A 1HNIA 3PX6A 4CIFA 4DTUA 3LZJA 3RMBA 4O0IA 1KTQA 4CGFA 4E7HA 5HP1A 3ZSOA 3VQ8A 3DOLA 2B5JA 3HVRA 4B9LA 2YNFA 1XI1A 2ZQBA 3QNOA 1U4BA 4CGHA 2PYLA 1K6YA 3LALA 3TWHA 1QTMA 4OKEA 3RRHA 1NJZA 2BE2A 5E41A 3LPUA 1TK0A 1J9AA 3K5LA 3SUNA 4KHSA 2Z1IA 2KQ2A 3LP2A 4DU4A 2ATQA 1VSLA 4K8XA 1A5VA 4W5RA 3VN5A 1BHLA 2OA8A 3H08A 5T7BA 3PO4A 1RDDA 2IOCA 1VK0A 1FXXA 3VQBA 3ISNC 1JL2A 4CK3A 5KRTA 1WSGA 4O4GA 3AO4A 3V9WA 3NHGA 2KFZA 1RTIA 1VSEA 2PYJA 4E1MA 3AVNA 4EZ6A 3L2UA 4M3WA 1RTDA 1RBSA 4B9UA 2FBYA 3IS9A 3LANA 4F8RA 4B9TA 1X9SA 5C24A 4N56A 3A2FA 3HT3A 3KK2A 3KK3A 3AVLA 4E3SA 4BE1A 2HHXA 2Y1IA 1I3AA 2X78A 3CQ8A 1JXEA 2AJQA 4JLHA 2WONA 3SZ2A 1HRHA 3L3VA 4CEZA 3OS1A 1NK0A 4DTSA 3RMCA 2XY6A 4NCBA 1B9DA 3KLFA 3K5MA 4CHPA 3SCXA 3RMDA 1WAFA 2Q3SA 2HHVA 4DTRA 1KVAA 1RT3A 4CHNA 3V6DA 4MFBA 3KKSA 4PA1A 1UWBA 2G8KA 4L8RB 4CF0A 1JLCA 2X6NA 4RW8A 5FDLA 4CHQA 3K57A 3HL8A 4AHTA 3OYIA 4RW6A 3MEGA 4Y1DA 3HXMA 2YKNA 3O3HA 4AILC 2IDOA 4CIEA 2XHBA 4AHRA 5KGWA 1VSJA 3ZSYA 3ZT2A 3OYFA 3IAYA 3M8QA 4M3RA 3KD5E 2GBZA 1NK4A 1RNHA 1ZBUA 3P5JA 1IG9A 2VG5A 2QK9A 4FLWA 1S9GA 3DRRA 1NJYA 4KI6A 4CGGA 3OS2A 3OYHA 1SL1A 3AVKA 3AA4A 1IKWA 3VQ6A 3RR7A 2F8TA 1JXBA 3NF7A 4CEEA 2HVIA 2KZMA 3TAFA 2X6SA 3VQ5A 3VQPA 3VA0A 4OJRA 4W5OA 2ETJA 3OYKA 1RTJA 2HMIA 3QIPA 4CF9A 2OYQA 4F3TA 1I39A 1WLJA 3OYCA 4J2AA 4J2EA 3SV3A 4M3TA 1BIUA 4J2DA 4QCLA 4FJ7A 3HYFA 2DFEA 2P51A 3I0SA 1BIZA 1VSMA 3DMJA 3TAQA 2HHTA 5C25A 4CJKA 1QHTA 3D45A 3SQ0A 2XY7A 3DLKA 3KIOA 5C42A 3F9KA 4NCGA 1VSHA 3O4QA 2HHUA 2RKIA 2BANA 3SQ4A 2JLEA 3TANA 1TV6A 4HHTA 2PZSA 1GOAA 1HPZA 3K5OA 4ZHRA 4Q5VA 4QAGA 4E0DA 2O4IA 4E7JA 3QEXA 1RCHA 1LWEA 2I5JA 4J2BA 3QEPA 1HQEA 4FM2A 1RDCA 3KLIA 4DSEA 3SUQA 4DFPA 3T1AA 3CFOA 4AHCA 3UIQA 4YNQA 1VSDA 4DQIA 2ITGA 4IFVA 4TSXA 3NDKA 1NJWA 1T03A 2P5GA 4CK2A 4I2QA 1L5UA 4FJ5A 2G8FA 3C95A 4CJPA 5K14A 2VG6A 1ZBIA 2FC0A 4FLUA 3S3OA 1U45A 4AH9A 1S1XA 1NOYA 4CF2A 4K8ZA 4F4KA 2Z1JA 3LWLA 3NGYA 5KI6A 2OPPA 3LPTA 3KLEA 1WNSA 4HTUA 3TAGA 1QSLA 1N5YA 2G8UA 1BISA 1T8EA 3LAMA 2VWJA 4YFUA 4BWJA 4CGIA 4N5SA 3KLGA 2D0CA 1L3UA 1TGOA 5CZ2A 3OJUA 3HPHA 2FBXA 5HBMA 1LAWA 3S3MA 4F3OA 4KB0A 1RBVA 3L2QA 1EXQA 4CHOA 5KTQA 4FK2A 3EYZA 1VSIA 3OYLA 4C8MA 3JYTA 1EX4A 2YHAA 1WAJA 4B9MA 2KFNA 3AO3A 4BE2A 1B92A 3TR8A 3DLBA 2A1SA 3SYZA 3U3YA 2YV0X 4DQQA 3G10A 4JS5A 3V9UA 3VQ4A 4DSKA 4FJJA 4ID1A 3K5NA 1Z25A 4DTOA 4C8KA 3DOKA 3RRGA 4DQSA 2FBVA 1D9FA 4CEBA 4FM0A 4DFMA 4LSLA 3O3FA 4C8LA 4CK1A 1REVA 4FZZA 2D0AA 4B9NA 3SQ1A 4H4OA 2RF2A 3M8RA 1TK5A 3PX4A 1DTQA 5HLFA 4DLGA 3VQCA 5J2NA 1RT1A 2HNDA 3QEWA 3IRXA 4CERA 1Q9XA 5D3GA 5CZ1A 4HUFA 4AHSA 4ZTJA 4DFKA 1S1WA 1UOCA 1B9FA 3BGRA 2DFFA 1KSPA 3DYAA 1SL2A 5HRRA 4FVMA 4DU3A 2LSNA 1YTUA 3SQ2A 1CXUA 5KGXA 4I7FA 4FK4A 4FJ9A 4FXDA 3TAMA 3E01A 3MECA 2HNYA 4FLXA 3AO2A 3VQ7A 1WSHA 2EHGA 5JS2A 4BDZA 4FJ8A 2RPIA 2XRIA 4MQ3A 4CJUA 3NH1A 1G15A 4KHNA 2HHQA 3OYAA 1TAQA 2XY8A 5CY4A 3QIOA 1SV5A 1C0UA 3AA2A 3DLEA 1KRPA 3BDPA 2DTUA 3K2PA 4DTPA 4OLBA 4CFAA 3MEDA 1MU2A 4HUEA 3V9SA 2D5RA 4M3UA 1BQNA 1TL3A 1S6PA 1XHXA 1ASVA 1NK8A 5FROA 4KRFA 4FJGA 1LW0A 3AVMA 4G1QA 1D5AA 4M42A 4KB1A 3OY9A 1U47A 3LWMA 1HMVA 3AO5A 3V1OA 4OGEA 3PV8A 1NK9A 3C6UA 1XHZA 4KHWA 2OPRA 4Z4EA 4DSIA 4BE0A 2XO7A 3AVHA 3L2VA 3K58A 1EETA 1VSFA 4KHYA 4W5NA 1IKXA 4PUOA 3KTQA 1TKZA 1X1PA 1S6QA 3PX0A 2OPSA 4N41A 5DMRA 3SI6A 4M45A 5JS1A 4WE1A 1X9MA 4FJKA 3MEEA 1KVBA 3QETA 4RG8A 2KW4A 3ZT0A 3MXIA 3MXMA 3FFIA 4FLTA 1NJXA 3B6PA 4CJRA 2O4GA 4M41A 1C6VA 3C6TA 3V1QA 4CJEA 3NFAA 5J2PA 4DSLA 4FW2A 3VQQA 1L3TA 2XY5A 2VWKA 4CHYA 4RW7A 3L8BA 3QEIA 1HNVA 1W0HA 3K59A 3AVCA 1HJRA 3P1GA 3NF9A 1NOZA 3AVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TK8 A;  1D8Y A;  3KK1 A;  1SKR A;  4M3Z A;  1UA1 A;  1RBU A;  4E7K A;  1BL3 A;  4R5P A;  3V81 A;  1BCO A;  3VQE A;  1J5O A;  1HYS A;  1BCM A;  4LH4 A;  3HPG A;  3SPZ A;  3DRP A;  4DF4 A;  2E4L A;  4CJF A;  1JLA A;  3CG7 A;  4DTM A;  3RR8 A;  1HYZ A;  1RIL A;  1GOC A;  4KTW A;  3NE6 A;  2YKM A;  3PUF A;  3O3G A;  2DFH A;  4BAC A;  1S1V A;  2QXF A;  4ICL A;  3VQ9 A;  4DFJ A;  2DY4 A;  4UQG A;  3NCI A;  1C0T A;  4CJT A;  4XIU A;  1NKC A;  1J53 A;  1ZBF A;  3V9X A;  4OVL A;  2ZD1 A;  4CEO A;  4LD0 A;  1YT3 A;  4DU1 A;  2YNH A;  3NH2 A;  3HP6 A;  3SNN A;  4FK0 A;  1WSJ A;  3ZSW A;  2E6L A;  4FLV A;  4FJL A;  3V9Z A;  1T05 A;  1NKE A;  3CM5 A;  4NCA A;  1LAV A;  4CFC A;  2OZM A;  4CIG A;  1IO2 A;  4CGD A;  5I42 A;  1RDA A;  2BDP A;  4ZTF A;  1RT7 A;  3L2W A;  2EX3 A;  2QKK A;  2Z1G A;  1HYV A;  2G8V A;  2F96 A;  5DK5 A;  1DTT A;  1ASU A;  4CJ4 A;  2A1R A;  4JRP A;  1KFD A;  1TAU A;  3CFP A;  1RT2 A;  4GMJ B;  4CJQ A;  4QOZ B;  4DTJ A;  4EP4 A;  1TL1 A;  1SL0 A;  1Q9Y A;  1J54 A;  2YNG A;  4FJM A;  4H8K A;  3KLH A;  4N76 A;  1JL1 A;  5I3U A;  4HCC A;  3I0R A;  3OYJ A;  3ZSV A;  4KTZ A;  4DTX A;  4KRE A;  1RT4 A;  2KTQ A;  4OGC A;  3QES A;  1F21 A;  1FKP A;  4CJL A;  1KCF A;  1SKS A;  3ZCM A;  1YVU A;  4KV8 A;  3AVJ A;  3TAB A;  3AVG A;  4E7L A;  3EZ5 A;  3F73 A;  2VG7 A;  3LP0 A;  3ZSR A;  4KKO A;  3AA3 A;  1FKO A;  2X74 A;  3MAQ A;  5J2Q A;  5HRP A;  1UA0 A;  4Z4F A;  4IG0 A;  1EKE A;  1KFS A;  3DRS A;  1BGX T;  4OPJ A;  2G8W A;  3PY8 A;  2OZS A;  3O4N A;  4FJN A;  4DLE A;  1RBR A;  3LDS A;  4CCH A;  4E89 A;  1CLQ A;  4RW9 A;  1LWC A;  3TAP A;  5KRS A;  4KTQ A;  3HK2 A;  4KAZ A;  3OVN A;  3TI0 A;  1DLO A;  5HRS A;  2HHS A;  1YTA A;  5HRN A;  3OYD A;  4CF1 A;  1QSY A;  3DLH A;  4Z4G A;  4NYF A;  1W9H A;  4IDK A;  4IFY A;  4Z4C A;  4JS4 A;  3AVF A;  4CEA A;  2GV9 A;  3DI6 A;  3DLR A;  4DQP A;  1KLN A;  3M8P A;  4DSF A;  4CEF A;  4NYN A;  4CE9 A;  4FZX C;  5SWM A;  2Z1H A;  1CXQ A;  3ULD A;  3QIN A;  4N47 A;  4W5T A;  1QSS A;  1O1W A;  1KLM A;  4M3Y A;  4OKK A;  3NF8 A;  3VQA A;  3EY1 A;  4FYD A;  4E1N A;  4I9Q A;  1CZ9 A;  2P5O A;  4Z4H A;  4B9V A;  4HCB A;  3WNH A;  1ZBL A;  1BQM A;  3C94 A;  4DG1 A;  1A5W A;  3QLH A;  1U49 A;  3L2R A;  3HM9 A;  2KZZ A;  1C1A A;  3CM6 A;  4Z0U A;  4DSJ A;  4CF8 A;  4KO0 A;  1XC9 A;  1N6Q A;  4FZY A;  3NGI A;  4GVM A;  4BDP A;  1ZBH A;  4PY5 A;  1L3S A;  4F2R A;  3HP9 A;  3V1R A;  2HVH A;  2RN2 A;  1TVR A;  1JLG A;  1EP4 A;  3T3F A;  1QS4 A;  2E6M A;  2HW3 A;  3RWU A;  2JGU A;  1JLQ A;  1WSF A;  1SUQ A;  3TAE A;  4GW6 A;  3NGZ A;  4B9S A;  1NK5 A;  3AV9 A;  1L3V A;  4CJS A;  1ASW A;  3VQD A;  4ELU A;  3KJV A;  3RTV A;  4CED A;  1RDB A;  3OYE A;  4OKJ A;  1Y97 A;  1ITG A;  1KVC A;  1HQU A;  3AVB A;  3ZT4 A;  3KKR A;  1S1T A;  4CFD A;  4E7I A;  1TKX A;  4BDY A;  3HJF A;  1LW2 A;  4FJI A;  4C8O A;  4ELV A;  3KD1 E;  4F2S A;  1BI4 B;  3DLG A;  4HVJ A;  1D9D A;  2PY5 A;  4O5B A;  3SUP A;  3ZSX A;  2F8S A;  4W5Q A;  3D0P A;  2QKB A;  4ELT A;  2OPQ A;  1NKB A;  4AHV A;  4CJ3 A;  4JRQ A;  4KPY A;  3ZT3 A;  1C0M A;  3ITH A;  1VSK A;  2FBT A;  3CYM A;  3LZI A;  3VA3 A;  4I9L A;  4DMN A;  2P1J A;  4B8A B;  2GUI A;  3LAK A;  1S5J A;  4AHU A;  3NF6 A;  4B08 A;  3ZSQ A;  3IG1 A;  5CYQ A;  4B8C A;  4ID5 A;  3ALY A;  1UAX A;  4CFB A;  2YNI A;  4FW1 A;  3JSM A;  3V4I A;  5EU7 A;  3NAE A;  2G8I A;  4FJH A;  4O0J A;  4FJX A;  3WNG A;  4DTN A;  1SKW A;  5FRN A;  4IKF A;  3OYN A;  1JLF A;  3S3N A;  1S9E A;  3THV A;  1WSE A;  3QEV A;  3P83 D;  1X9W A;  2W42 A;  4DQR A;  4Z4I A;  4CEQ A;  1NK7 A;  1RTH A;  3G0Z A;  4RW4 A;  4FLY A;  3QNN A;  4I2P A;  1U04 A;  3NH0 A;  1JLB A;  2HNZ A;  4DF8 A;  3U6F A;  1A5X A;  2YHB A;  1R0A A;  4B3O A;  1XWL A;  1QQC A;  3WNE A;  3LP3 A;  3PO5 A;  2HHW A;  2B6A A;  2G8H A;  1IKY A;  1QE1 A;  2HB5 A;  3T19 A;  1JLE A;  3AVA A;  4OPK A;  4KHQ A;  1IKV A;  3HPO A;  5CYM A;  1LWF A;  4LY7 A;  2IS3 A;  1TKT A;  4C8N A;  5J2M A;  3SUO A;  3ZT1 A;  1C1B A;  3OJS A;  3SV4 A;  3HO1 A;  4OLA A;  4M3X A;  4KFB A;  5J1E A;  4FCY A;  4CJ5 A;  4H4M A;  3OYB A;  2IGI A;  4IG3 A;  1Z26 A;  4KI4 A;  1CZB A;  3ASM A;  1T7P A;  1JKH A;  1Q8I A;  1VRU A;  2ZE2 A;  4HUG A;  3SPY A;  3B6O A;  1U48 A;  2IAJ A;  3AO1 A;  1RBT A;  4DWI A;  1FK9 A;  4E19 A;  3DM2 A;  4Y1C A;  4EZ9 A;  3S9H A;  4KHU A;  4CEC A;  5SZT A;  3OYG A;  1S1U A;  3MXJ A;  2NUB A;  1WN7 A;  2BGG A;  5FRM A;  3CFR A;  4O55 A;  2Y1J A;  1TKD A;  1RT6 A;  4FM1 A;  1ZYQ A;  3NBP A;  3RMA A;  4DS4 A;  4CJV A;  2B4J A;  3AA5 X;  1C1C A;  1VRT A;  4IBN A;  1NK6 A;  4FLZ A;  3OYM A;  4BWM A;  4CES A;  3TAR A;  1GOB A;  3QO9 A;  4CGJ A;  4O44 A;  3U3G A;  3OS0 A;  3ZSZ A;  2IC3 A;  3SJJ A;  3L3U A;  2R7Y A;  3HVT A;  4DS5 A;  4PWD A;  1IH7 A;  1BI4 A;  3M8S A;  5HRO A;  3WNF A;  1LV5 A;  2WOM A;  4LH5 A;  4CHZ A;  4Q0B A;  3HST B;  1WSI A;  4CJW A;  3LP1 A;  2D0B A;  3QER A;  4PQU A;  4LSN A;  3I8D A;  1RT5 A;  4EP5 A;  1HNI A;  3PX6 A;  4CIF A;  4DTU A;  3LZJ A;  3RMB A;  4O0I A;  1KTQ A;  4CGF A;  4E7H A;  5HP1 A;  3ZSO A;  3VQ8 A;  3DOL A;  2B5J A;  3HVR A;  4B9L A;  2YNF A;  1XI1 A;  2ZQB A;  3QNO A;  1U4B A;  4CGH A;  2PYL A;  1K6Y A;  3LAL A;  3TWH A;  1QTM A;  4OKE A;  3RRH A;  1NJZ A;  2BE2 A;  5E41 A;  3LPU A;  1TK0 A;  1J9A A;  3K5L A;  3SUN A;  4KHS A;  2Z1I A;  2KQ2 A;  3LP2 A;  4DU4 A;  2ATQ A;  1VSL A;  4K8X A;  1A5V A;  4W5R A;  3VN5 A;  1BHL A;  2OA8 A;  3H08 A;  5T7B A;  3PO4 A;  1RDD A;  2IOC A;  1VK0 A;  1FXX A;  3VQB A;  3ISN C;  1JL2 A;  4CK3 A;  5KRT A;  1WSG A;  4O4G A;  3AO4 A;  3V9W A;  3NHG A;  2KFZ A;  1RTI A;  1VSE A;  2PYJ A;  4E1M A;  3AVN A;  4EZ6 A;  3L2U A;  4M3W A;  1RTD A;  1RBS A;  4B9U A;  2FBY A;  3IS9 A;  3LAN A;  4F8R A;  4B9T A;  1X9S A;  5C24 A;  4N56 A;  3A2F A;  3HT3 A;  3KK2 A;  3KK3 A;  3AVL A;  4E3S A;  4BE1 A;  2HHX A;  2Y1I A;  1I3A A;  2X78 A;  3CQ8 A;  1JXE A;  2AJQ A;  4JLH A;  2WON A;  3SZ2 A;  1HRH A;  3L3V A;  4CEZ A;  3OS1 A;  1NK0 A;  4DTS A;  3RMC A;  2XY6 A;  4NCB A;  1B9D A;  3KLF A;  3K5M A;  4CHP A;  3SCX A;  3RMD A;  1WAF A;  2Q3S A;  2HHV A;  4DTR A;  1KVA A;  1RT3 A;  4CHN A;  3V6D A;  4MFB A;  3KKS A;  4PA1 A;  1UWB A;  2G8K A;  4L8R B;  4CF0 A;  1JLC A;  2X6N A;  4RW8 A;  5FDL A;  4CHQ A;  3K57 A;  3HL8 A;  4AHT A;  3OYI A;  4RW6 A;  3MEG A;  4Y1D A;  3HXM A;  2YKN A;  3O3H A;  4AIL C;  2IDO A;  4CIE A;  2XHB A;  4AHR A;  5KGW A;  1VSJ A;  3ZSY A;  3ZT2 A;  3OYF A;  3IAY A;  3M8Q A;  4M3R A;  3KD5 E;  2GBZ A;  1NK4 A;  1RNH A;  1ZBU A;  3P5J A;  1IG9 A;  2VG5 A;  2QK9 A;  4FLW A;  1S9G A;  3DRR A;  1NJY A;  4KI6 A;  4CGG A;  3OS2 A;  3OYH A;  1SL1 A;  3AVK A;  3AA4 A;  1IKW A;  3VQ6 A;  3RR7 A;  2F8T A;  1JXB A;  3NF7 A;  4CEE A;  2HVI A;  2KZM A;  3TAF A;  2X6S A;  3VQ5 A;  3VQP A;  3VA0 A;  4OJR A;  4W5O A;  2ETJ A;  3OYK A;  1RTJ A;  2HMI A;  3QIP A;  4CF9 A;  2OYQ A;  4F3T A;  1I39 A;  1WLJ A;  3OYC A;  4J2A A;  4J2E A;  3SV3 A;  4M3T A;  1BIU A;  4J2D A;  4QCL A;  4FJ7 A;  3HYF A;  2DFE A;  2P51 A;  3I0S A;  1BIZ A;  1VSM A;  3DMJ A;  3TAQ A;  2HHT A;  5C25 A;  4CJK A;  1QHT A;  3D45 A;  3SQ0 A;  2XY7 A;  3DLK A;  3KIO A;  5C42 A;  3F9K A;  4NCG A;  1VSH A;  3O4Q A;  2HHU A;  2RKI A;  2BAN A;  3SQ4 A;  2JLE A;  3TAN A;  1TV6 A;  4HHT A;  2PZS A;  1GOA A;  1HPZ A;  3K5O A;  4ZHR A;  4Q5V A;  4QAG A;  4E0D A;  2O4I A;  4E7J A;  3QEX A;  1RCH A;  1LWE A;  2I5J A;  4J2B A;  3QEP A;  1HQE A;  4FM2 A;  1RDC A;  3KLI A;  4DSE A;  3SUQ A;  4DFP A;  3T1A A;  3CFO A;  4AHC A;  3UIQ A;  4YNQ A;  1VSD A;  4DQI A;  2ITG A;  4IFV A;  4TSX A;  3NDK A;  1NJW A;  1T03 A;  2P5G A;  4CK2 A;  4I2Q A;  1L5U A;  4FJ5 A;  2G8F A;  3C95 A;  4CJP A;  5K14 A;  2VG6 A;  1ZBI A;  2FC0 A;  4FLU A;  3S3O A;  1U45 A;  4AH9 A;  1S1X A;  1NOY A;  4CF2 A;  4K8Z A;  4F4K A;  2Z1J A;  3LWL A;  3NGY A;  5KI6 A;  2OPP A;  3LPT A;  3KLE A;  1WNS A;  4HTU A;  3TAG A;  1QSL A;  1N5Y A;  2G8U A;  1BIS A;  1T8E A;  3LAM A;  2VWJ A;  4YFU A;  4BWJ A;  4CGI A;  4N5S A;  3KLG A;  2D0C A;  1L3U A;  1TGO A;  5CZ2 A;  3OJU A;  3HPH A;  2FBX A;  5HBM A;  1LAW A;  3S3M A;  4F3O A;  4KB0 A;  1RBV A;  3L2Q A;  1EXQ A;  4CHO A;  5KTQ A;  4FK2 A;  3EYZ A;  1VSI A;  3OYL A;  4C8M A;  3JYT A;  1EX4 A;  2YHA A;  1WAJ A;  4B9M A;  2KFN A;  3AO3 A;  4BE2 A;  1B92 A;  3TR8 A;  3DLB A;  2A1S A;  3SYZ A;  3U3Y A;  2YV0 X;  4DQQ A;  3G10 A;  4JS5 A;  3V9U A;  3VQ4 A;  4DSK A;  4FJJ A;  4ID1 A;  3K5N A;  1Z25 A;  4DTO A;  4C8K A;  3DOK A;  3RRG A;  4DQS A;  2FBV A;  1D9F A;  4CEB A;  4FM0 A;  4DFM A;  4LSL A;  3O3F A;  4C8L A;  4CK1 A;  1REV A;  4FZZ A;  2D0A A;  4B9N A;  3SQ1 A;  4H4O A;  2RF2 A;  3M8R A;  1TK5 A;  3PX4 A;  1DTQ A;  5HLF A;  4DLG A;  3VQC A;  5J2N A;  1RT1 A;  2HND A;  3QEW A;  3IRX A;  4CER A;  1Q9X A;  5D3G A;  5CZ1 A;  4HUF A;  4AHS A;  4ZTJ A;  4DFK A;  1S1W A;  1UOC A;  1B9F A;  3BGR A;  2DFF A;  1KSP A;  3DYA A;  1SL2 A;  5HRR A;  4FVM A;  4DU3 A;  2LSN A;  1YTU A;  3SQ2 A;  1CXU A;  5KGX A;  4I7F A;  4FK4 A;  4FJ9 A;  4FXD A;  3TAM A;  3E01 A;  3MEC A;  2HNY A;  4FLX A;  3AO2 A;  3VQ7 A;  1WSH A;  2EHG A;  5JS2 A;  4BDZ A;  4FJ8 A;  2RPI A;  2XRI A;  4MQ3 A;  4CJU A;  3NH1 A;  1G15 A;  4KHN A;  2HHQ A;  3OYA A;  1TAQ A;  2XY8 A;  5CY4 A;  3QIO A;  1SV5 A;  1C0U A;  3AA2 A;  3DLE A;  1KRP A;  3BDP A;  2DTU A;  3K2P A;  4DTP A;  4OLB A;  4CFA A;  3MED A;  1MU2 A;  4HUE A;  3V9S A;  2D5R A;  4M3U A;  1BQN A;  1TL3 A;  1S6P A;  1XHX A;  1ASV A;  1NK8 A;  5FRO A;  4KRF A;  4FJG A;  1LW0 A;  3AVM A;  4G1Q A;  1D5A A;  4M42 A;  4KB1 A;  3OY9 A;  1U47 A;  3LWM A;  1HMV A;  3AO5 A;  3V1O A;  4OGE A;  3PV8 A;  1NK9 A;  3C6U A;  1XHZ A;  4KHW A;  2OPR A;  4Z4E A;  4DSI A;  4BE0 A;  2XO7 A;  3AVH A;  3L2V A;  3K58 A;  1EET A;  1VSF A;  4KHY A;  4W5N A;  1IKX A;  4PUO A;  3KTQ A;  1TKZ A;  1X1P A;  1S6Q A;  3PX0 A;  2OPS A;  4N41 A;  5DMR A;  3SI6 A;  4M45 A;  5JS1 A;  4WE1 A;  1X9M A;  4FJK A;  3MEE A;  1KVB A;  3QET A;  4RG8 A;  2KW4 A;  3ZT0 A;  3MXI A;  3MXM A;  3FFI A;  4FLT A;  1NJX A;  3B6P A;  4CJR A;  2O4G A;  4M41 A;  1C6V A;  3C6T A;  3V1Q A;  4CJE A;  3NFA A;  5J2P A;  4DSL A;  4FW2 A;  3VQQ A;  1L3T A;  2XY5 A;  2VWK A;  4CHY A;  4RW7 A;  3L8B A;  3QEI A;  1HNV A;  1W0H A;  3K59 A;  3AVC A;  1HJR A;  3P1G A;  3NF9 A;  1NOZ A;  3AVI A; 
#chains in the Genus database with same CATH topology
 4BGB A;  1D8Y A;  4BRK A;  4R5P A;  3VQE A;  4CZL A;  1BCM A;  4CJF A;  4JV5 K;  1S3X A;  3DXM B;  4A5A A;  4KTW A;  1GOC A;  3VEO A;  2QXF A;  1HUX A;  3H45 C;  3NCI A;  5JVG L;  4OVL A;  4FWS A;  1EWQ A;  3A5N C;  4CZF A;  3MCA B;  1TYQ A;  1WSJ A;  2QW9 A;  2P9L A;  3O9Q A;  4CZK A;  4FLV A;  4FJL A;  3V9Z A;  1T05 A;  3MWP A;  2UU9 K;  2OZM A;  4CIG A;  1KAZ A;  4CGD A;  4CBW A;  4DUY K;  1RDW X;  2D0P A;  4ZTF A;  1RT7 A;  2EX3 A;  3R3L A;  2QKK A;  2Z1G A;  1JCE A;  2NZT A;  1ASU A;  5DK5 A;  3IUC A;  4CJ4 A;  4GMJ B;  4CJQ A;  4EP4 A;  1Q9Y A;  4G9Z A;  1HX1 A;  3KLH A;  3ZX2 A;  2GWK A;  1JL1 A;  3EZW A;  2I7P A;  1F21 A;  1NGJ A;  3ZET B;  1P90 A;  3AVG A;  3F73 A;  2VG7 A;  2FLO A;  3P39 A;  1UA0 A;  4IG0 A;  1EKE A;  2G8W A;  2OZS A;  3O4N A;  3I33 A;  1QZ6 A;  3C7N B;  1QQO A;  4CCH A;  4E89 A;  1CLQ A;  5KRS A;  3H6E A;  3HK2 A;  3EKS A;  1IV0 A;  5HRN A;  3OYD A;  4FO0 A;  4Z4C A;  4CEA A;  3UB5 A;  1HKC A;  4CEF A;  1GLE G;  5SWM A;  3ULD A;  4N47 A;  4W5T A;  1QSS A;  4M3Y A;  1KLM A;  4OKK A;  3VQA A;  1NGH A;  4FSV A;  4E1N A;  4WQ4 C;  3WNH A;  1NJI O;  3BF3 A;  3DLL L;  1U49 A;  2ZF5 O;  4DSJ A;  1XC9 A;  1N6Q A;  1ILY A;  1XC3 A;  3OTO K;  4PY5 A;  3IMX A;  3O1W A;  1TVR A;  1EP4 A;  2E6M A;  4JI2 K;  2HW3 A;  3RWU A;  1OVY A;  1RDB A;  2YJF A;  5KPR A;  1ITG A;  1HQU A;  3AVB A;  2O8F B;  4JKH A;  4ISG A;  3HJF A;  3EE8 A;  4C8O A;  4AM6 A;  1BI4 B;  1D9D A;  2PY5 A;  3SUP A;  3ZSX A;  2F8S A;  4W5Q A;  3D0P A;  3CCL N;  1NKB A;  4KPY A;  2O8B A;  2FBT A;  3LZI A;  4I9L A;  3OBY A;  4DV2 K;  4AF1 A;  1ZBS A;  2GUI A;  3LAK A;  3IG1 A;  5CYQ A;  1NWK A;  3ALY A;  4WCE L;  2YNI A;  3D6R A;  5JLH A;  3V4I A;  4IOX A;  3WNG A;  4DTN A;  4MO5 A;  3SLC A;  3SMS A;  2QWN A;  3THV A;  4Z4I A;  2UXD K;  1NK7 A;  3G0Z A;  4RW4 A;  3AAP A;  3NH0 A;  3U6F A;  1M90 O;  3ZYY X;  1QQC A;  1VQ5 N;  3ATU A;  4H03 B;  4OPK A;  3TPQ A;  4KHQ A;  1IKV A;  5CYM A;  1LWF A;  2F4V K;  3OJS A;  4A5B A;  3VES A;  5J1E A;  1Z26 A;  1CZB A;  3ASM A;  4GNI A;  1Q8I A;  2ZE2 A;  3O5B A;  5F2R A;  2IAJ A;  1FK9 A;  3DM2 A;  2W6K A;  4Y1C A;  5SZT A;  4BRO A;  2NUB A;  2W6L A;  3EN9 A;  4MLH A;  3M6G A;  2ASP A;  4O55 A;  5AZI A;  4FM1 A;  3RMA A;  1C1C A;  1VRT A;  3D2E A;  5LJV A;  3OYM A;  4BWM A;  1NGF A;  4CES A;  1GOB A;  3QO9 A;  3TAR A;  4CGJ A;  2IC3 A;  3E66 A;  4DR2 K;  3HVT A;  4WYB A;  3M8S A;  3WNF A;  4BY9 C;  4CHZ A;  1I94 K;  3LP1 A;  4DV5 K;  2V7Z A;  4LSN A;  4O8K A;  3DJC A;  2A42 A;  1KQS M;  4E7H A;  3AY9 A;  1XI1 A;  1GLC G;  3K9J A;  4UY8 O;  1U4B A;  1YJN N;  3ZEU A;  3RRH A;  5E41 A;  3LPU A;  1NG9 A;  1N33 K;  1IJJ A;  4KHS A;  5GAD P;  1VSL A;  1A5V A;  4W5R A;  3H08 A;  1U2V A;  1VK0 A;  1V4T A;  4QS8 A;  4NXM K;  4O4G A;  3V9W A;  1RTI A;  2PYJ A;  3AVN A;  3L2U A;  4M3W A;  1RTD A;  1RBS A;  2EWS A;  4BRL A;  4F8R A;  1YAG A;  3A2F A;  3AVL A;  1I3A A;  2X78 A;  1JXE A;  2P9U B;  4LF7 K;  4FL9 A;  2WON A;  1HRH A;  3L3V A;  4CEZ A;  3OS1 A;  4DV7 K;  4DTS A;  2XY6 A;  3RMD A;  1WAF A;  5FPE A;  3V6D A;  3LDN A;  2X6N A;  4RW8 A;  4F9O A;  3OYI A;  1NM1 A;  5GAG P;  3QBW A;  3HXM A;  3WQU A;  4NB4 A;  3FE1 A;  4AHR A;  3ZSY A;  3OYF A;  3M8Q A;  3U8X A;  2P9I B;  4DR3 K;  4DV6 K;  4A57 A;  1S9G A;  4KI6 A;  3OS2 A;  2QWL A;  4C23 A;  1QQN A;  3IKM A;  2HVI A;  2KZM A;  2NRT A;  3CCM N;  3TAF A;  3VQ5 A;  2HBM A;  3VQP A;  4W5O A;  2ETJ A;  2OYQ A;  4CF9 A;  3DXK A;  4B1Z A;  5KPZ A;  3O9U A;  3GG4 A;  1SAZ A;  4M3T A;  4FJ7 A;  2FF3 B;  3HYF A;  2P51 A;  2P9K B;  1QHT A;  2XY7 A;  3KIO A;  3ENB A;  5F1X A;  5AQZ A;  3F9K A;  2HHU A;  1YF5 L;  1BDG A;  3SQ4 A;  1N8R O;  4HHT A;  4KHP K;  4IEE A;  3QEX A;  2O8C B;  1LWE A;  4WFA L;  4FM2 A;  2ZJQ L;  2PAV A;  3SUQ A;  4AHC A;  4DV0 K;  1VSD A;  5A2Q O;  4CK2 A;  3F9M A;  4PKI A;  3C95 A;  4CJP A;  4CZM A;  5LMN K;  2FC0 A;  3S3O A;  4BR9 A;  2E2Q A;  4F4K A;  1Y64 A;  1P8Z A;  5KI6 A;  3KLE A;  3LPT A;  1WNS A;  4MO4 A;  2VWJ A;  4FWQ A;  2P9S A;  3OJU A;  5HBM A;  5M1N A;  3UE5 A;  4A2A A;  5KTQ A;  3VOV A;  5C10 A;  4JI3 K;  4JKC A;  5ADX A;  3JYT A;  2KFN A;  3ULE A;  1B92 A;  3PSF A;  3TR8 A;  1VHX A;  4KH5 A;  1VQ9 N;  2A1S A;  1ATN A;  2YV0 X;  3G10 A;  3H3N O;  4XEI A;  4FJJ A;  1S22 A;  4JKD A;  4DQS A;  4JAX A;  3HTV A;  1HKB A;  2P9P A;  1K73 O;  2IVN A;  2ZJR L;  2RF2 A;  1TK5 A;  5HLF A;  5J2N A;  3VQC A;  3AGR A;  1Q9X A;  1ZXO A;  2Q31 A;  5CZ1 A;  4LF9 K;  3A8Y A;  4DFK A;  1UOC A;  4RTF D;  5AR0 A;  4DV1 K;  1SL2 A;  4DU3 A;  1YTU A;  3SQ2 A;  4FK4 A;  5C2F A;  3TAM A;  1WUA A;  3MEC A;  2EHG A;  3H1Q A;  4I6M A;  3UKR B;  3RSE B;  4JK8 A;  2HHQ A;  3MX5 A;  5M1F A;  1TAQ A;  3VEX A;  5TKY A;  4OLB A;  3MED A;  3LDP A;  4M3U A;  1HNX K;  1BQN A;  1XMO K;  5E26 A;  1XHX A;  4FJG A;  1LW0 A;  4M42 A;  4G1Q A;  1D5A A;  3UKU A;  4KB1 A;  2F9W A;  3OY9 A;  4BG8 A;  3BF1 A;  3QDK A;  3AO5 A;  4OGE A;  1NK9 A;  1HLU A;  2OPR A;  4X64 K;  4BE0 A;  1YUW A;  3L2V A;  4H0O A;  1IKX A;  4FVU A;  1S6Q A;  3PX0 A;  5DMR A;  1KAX A;  4M45 A;  4H5R A;  5JS1 A;  5IT9 O;  1KVB A;  3QET A;  3MXI A;  2NLX A;  1MWK A;  3B6P A;  3VTH A;  3R6M A;  4CJR A;  4BRC A;  3V1Q A;  3VQQ A;  2BUP A;  5TKW A;  3QEI A;  1HNV A;  1HJR A;  4DV4 K;  1TK8 A;  1RBU A;  4E7K A;  1BL3 A;  3H1V X;  5AJ3 K;  1V4S A;  2Q97 A;  4CD3 A;  3O4W A;  3L4I A;  3HPG A;  5JIC A;  4DF4 A;  2E4L A;  2OCE A;  3CG7 A;  3FZL A;  4DTM A;  5C12 A;  4WF9 L;  4BAC A;  2YKM A;  3PUF A;  4DFJ A;  2DFH A;  1CZA N;  4ICL A;  3VQ9 A;  3TSU A;  2VQF K;  1C0T A;  3VGK A;  2CGK A;  3CJB A;  2ZD1 A;  3BZK A;  4YOT A;  4NLB A;  1NGE A;  3VEZ A;  3CI5 A;  3VF4 A;  4B3T K;  3HP6 A;  3SNN A;  4FK0 A;  1VQ8 N;  1LAV A;  5I42 A;  3QB0 A;  2GUP A;  4B1Y B;  3HM8 A;  4YOR A;  4DQ8 A;  2V51 B;  2G8V A;  1DTT A;  2A1R A;  1MA9 B;  4PL8 A;  1TAU A;  1TUU A;  2UYT A;  1TL1 A;  1XUP O;  3P31 A;  4FJM A;  4H8K A;  2ASM A;  4HCC A;  3ENO A;  4OGC A;  1GLA G;  4CZH A;  1YVU A;  1FJG K;  4E7L A;  2FF6 A;  1J6Z A;  4C1N K;  4BRG A;  4FJN A;  4OPJ A;  3LDS A;  1E3M A;  1IBL K;  3TAP A;  4KTQ A;  1BU6 O;  1NGC A;  3CCJ N;  3TI0 A;  4YDU A;  3CER A;  5AQM A;  4BC3 A;  4JKA A;  4LF5 K;  4CF1 A;  4NYF A;  3G71 N;  1W9H A;  3DXM A;  4IDK A;  4YY3 K;  4IFY A;  2GV9 A;  3DI6 A;  3DLR A;  2GEM A;  2Q0U A;  4CE9 A;  2Z1H A;  1CXQ A;  2O8E B;  3NF8 A;  3EY1 A;  4FYD A;  1GLB G;  3KVG A;  4I9Q A;  2P5O A;  2RE2 A;  3C94 A;  4DG1 A;  4FWN A;  3FZH A;  3L2R A;  2KZZ A;  2HBL A;  1C1A A;  3CM6 A;  4Z0U A;  3LDQ A;  4CF8 A;  4KO0 A;  1KXP A;  3HOT A;  4NO7 A;  4BDP A;  2NRX A;  4F2R A;  2KKZ A;  3T3F A;  1GLD G;  4M7Y A;  4ILG B;  1WSF A;  4R79 A;  3CD6 N;  4IDH A;  3TAE A;  1BOT O;  1NK5 A;  1L3V A;  1YVN A;  5GAH P;  3KJV A;  3OYE A;  4O8U A;  3ZT4 A;  3E9O A;  3ENH A;  4H5W A;  3SAF A;  3TTF A;  4CFD A;  1TKX A;  4BDY A;  1LW2 A;  4ELV A;  5C0Y A;  3C65 A;  3CMA N;  2P9N B;  2OPQ A;  4IOA L;  3ITH A;  2WUS A;  4BR4 A;  5EXW A;  4LFB K;  4DMN A;  2P1J A;  1S5J A;  2D1K A;  3C7N A;  4JKG B;  4B08 A;  3ZSQ A;  3VGL A;  4CFB A;  4FW1 A;  3CJC A;  5FRN A;  3OYN A;  4BG9 A;  1WSE A;  3P83 D;  3FZM A;  4X66 K;  3MN9 A;  4RWT A;  4I2P A;  1U04 A;  2HNZ A;  4H0P A;  2YHB A;  1C0G A;  3LM9 A;  3LP3 A;  2B6A A;  2G8H A;  1QE1 A;  4B1U B;  1JLE A;  3VET A;  2IS3 A;  1TKT A;  4C8N A;  3SV4 A;  1Z05 A;  4FCY A;  4CJ5 A;  3OYB A;  4IG3 A;  1T6C A;  1T7P A;  1VRU A;  2A5X A;  1BWF O;  3AO1 A;  1RBT A;  4E19 A;  3J81 O;  4QS7 A;  4K25 A;  3D2F B;  1RT6 A;  1ZYQ A;  3NBP A;  4DS4 A;  3AA5 X;  4IBN A;  2O8F A;  3VER A;  3OS0 A;  1OVQ A;  2R7Y A;  4DS5 A;  4BC2 A;  5M1Q A;  1BI4 A;  4LH5 A;  4Q0B A;  3QER A;  4PQU A;  2HMP A;  4EP5 A;  1HNI A;  4CIF A;  4GKJ K;  4M7X A;  3LZJ A;  4XH4 A;  3QIC A;  3RMB A;  3VQ8 A;  3DOL A;  3HVR A;  2YNF A;  4Y0W A;  3QNO A;  3THY B;  4JKE A;  3TWH A;  2WBN A;  2PBD A;  4WQ5 A;  2BE2 A;  1TK0 A;  1J9A A;  3K5L A;  2Z1I A;  3VF6 A;  2QWO A;  3NMU A;  5T7B A;  1NGI A;  3THX B;  4CK3 A;  1WSG A;  1VSE A;  4EZ6 A;  2Q1N A;  2QWQ A;  4B9U A;  2FBY A;  3MCP A;  5EOY A;  4A62 A;  1HNZ K;  2AA4 A;  3CJA A;  1HKG A;  1QQM A;  5AQG A;  2AJQ A;  1NK0 A;  4NCB A;  1B9D A;  3SCX A;  4DR6 K;  2HHV A;  1KVA A;  4CHN A;  2G8K A;  1UWB A;  3P4I A;  3ATV A;  4EIA A;  4CF0 A;  4CHQ A;  3HZ6 A;  1VQP N;  4RW6 A;  3L6Q A;  3O3H A;  3O6W A;  2XHB A;  1NGB A;  4M3R A;  4DB3 A;  3KD5 E;  2GBZ A;  1HR0 K;  3WT0 A;  3P5J A;  3MDQ A;  2QK9 A;  3CET A;  4BRN A;  4FLW A;  1NJY A;  2FSN A;  2F8T A;  3AA4 A;  2Q36 A;  2BH1 A;  5JLF A;  1JXB A;  3JAM O;  1NLV A;  4CZI A;  3OYK A;  2HMI A;  4BC4 A;  4J2A A;  4J2E A;  3O9S A;  1H1V A;  2E5L K;  4CZJ A;  4BRD A;  5BRF A;  1ESV A;  4NCG A;  2E88 A;  1VSH A;  2JLE A;  2PZS A;  1HPZ A;  2O4I A;  4QAG A;  4JKB A;  1IG8 A;  4EAH D;  5AFU A;  4DSE A;  5F0X A;  3R8E A;  3CFO A;  5B8H A;  1MDU B;  5CHI A;  2ZJP L;  5BRD A;  4FJ5 A;  2P5G A;  1L5U A;  2P9U A;  1ATR A;  3Q7C A;  4FLU A;  1U45 A;  1YJ9 N;  4M63 C;  4CF2 A;  3LWL A;  5KPT A;  3VTI A;  4U67 L;  1Q18 A;  3LAM A;  3WUH A;  4CGI A;  4N5S A;  3M5R A;  3KLG A;  2D0C A;  5ADX H;  1W7A A;  4H0X B;  4BRP A;  1YI2 N;  5FPN A;  3MMV A;  2P9I A;  3DAW A;  4FOE A;  2YHA A;  3WQT A;  4JI8 K;  3DLB A;  3T7Z A;  3SYZ A;  5BRE A;  3W3D A;  4JK9 A;  3HBT A;  4ID1 A;  3DOK A;  3RRG A;  1D9F A;  4XH1 A;  4CEB A;  5E84 A;  4LSL A;  4IFE A;  2D0A A;  4BC5 A;  3T1H K;  4H4O A;  1VAZ A;  3M8R A;  3THW B;  3PX4 A;  1DTQ A;  2P9K A;  1RT1 A;  3IRX A;  3DWL A;  1B9F A;  1OH8 A;  2DFF A;  3N4P A;  1KSP A;  5AQL A;  1FW6 A;  1CXU A;  1VQO N;  2O8C A;  2IVO A;  1QHA A;  4EHT A;  4JI0 K;  5JS2 A;  4FJ8 A;  2RPI A;  1QVG M;  3NH1 A;  1G15 A;  1KRP A;  3DLE A;  3BDP A;  2DTU A;  2AP1 A;  4DTP A;  4HUE A;  3V9S A;  1TL3 A;  2IIR A;  1S6P A;  2I7N A;  5AQY A;  1NK8 A;  3A0I X;  4KRF A;  4H5T A;  3AVM A;  5AQQ A;  4EHU A;  4IJN A;  3LWM A;  3PV8 A;  2FSK A;  4KHW A;  5BPN A;  2XO7 A;  1T3V A;  1EET A;  3JXU A;  1EQY A;  1E4F T;  1KC8 O;  4PUO A;  1TKZ A;  4PHT X;  3SI6 A;  4CZE A;  4FJK A;  2KW4 A;  2QXL A;  3ZT0 A;  3IFR A;  3MXM A;  3FFI A;  1NJX A;  1OH5 A;  4CJE A;  3U4L A;  3NFA A;  3L8B A;  4CHY A;  4RW7 A;  4B1V A;  3K59 A;  2A40 A;  2QM1 A;  3KK1 A;  4M3Z A;  3V81 A;  2O8D B;  1G99 A;  3A5M C;  4B1X B;  4IEI A;  1J5O A;  3NVK A;  4LH4 A;  3SPZ A;  3C6A A;  3DRP A;  4FPA A;  2ZGZ A;  2DPN A;  2E1Z A;  1YIT N;  1RIL A;  4BVO A;  1XMQ K;  3O3G A;  1HJO A;  1S1V A;  2DY4 A;  3SMP A;  4UQG A;  3CCS N;  4JKF A;  4XIU A;  1J53 A;  3V9X A;  2NRR A;  4MDB A;  3UKR A;  1YT3 A;  3KZB A;  4DU1 A;  2YNH A;  3RSE A;  3NH2 A;  5AQW A;  4BRA A;  5AQH A;  2E6L A;  3CM5 A;  1RDU A;  2NRZ A;  3MK6 A;  2BDP A;  4DR1 K;  3N4Q A;  1HYV A;  2QTD A;  2UUB K;  5GIN A;  1KFD A;  5BPL A;  4IO9 L;  1RT2 A;  4QOZ B;  1SL0 A;  4JI1 K;  1WBD A;  4YOU A;  4PL7 A;  3WXL A;  3OYJ A;  3ZSV A;  4KTZ A;  5DM7 L;  4DTX A;  3TTC A;  2KTQ A;  1RT4 A;  3QES A;  3AAQ A;  1FKP A;  4CJL A;  1KCF A;  3ZCM A;  3TAB A;  3EZ5 A;  3LP0 A;  4KKO A;  2X74 A;  3MAQ A;  5J2Q A;  3DRS A;  1BGX T;  3PY8 A;  4CJ7 A;  4CW7 B;  2HF4 A;  4DLE A;  3E9L A;  1LWC A;  3LDO A;  4NLC A;  3OVN A;  2HHS A;  1T6D A;  1YJW N;  4DQP A;  1KLN A;  4DSF A;  3WEE B;  3QIN A;  4BRQ A;  4YHH K;  1Q86 O;  4Z4H A;  4HCB A;  2YX6 A;  1BQM A;  4L3Q A;  1A5W A;  1DT9 A;  3GE1 A;  3QLH A;  4ILJ A;  1IBK K;  2VGN A;  5BRH A;  3NGI A;  4A2B A;  3HP9 A;  3V1R A;  2HVH A;  2RN2 A;  3O9T A;  2CGL A;  2VGM A;  2JGU A;  1JLQ A;  3B8A X;  4GW6 A;  3NGZ A;  3VEV A;  3AV9 A;  5JVH L;  3EE9 A;  3VQD A;  4CVN E;  5LJW A;  3CC2 N;  4CED A;  4ELU A;  4OKJ A;  3O8M A;  2GWJ A;  3O08 A;  1EO1 A;  2OTL N;  3KD1 E;  4F2S A;  1BO5 O;  4HVJ A;  4O5B A;  2E8A A;  4ELT A;  2V52 B;  4AHV A;  4CJ3 A;  4JRQ A;  2F9T A;  1VSK A;  3FFK B;  3GBT A;  4AHU A;  4YDU C;  5AZJ B;  5LY3 A;  1BUP A;  3PIP L;  3JSM A;  3KHY A;  2NRW A;  3NAE A;  2D0O A;  2G8I A;  4GKK K;  4LFA K;  3QEV A;  4CEQ A;  1GLJ O;  1GLF O;  1RTH A;  4OPH A;  3QNN A;  1JLB A;  4DF8 A;  1R0A A;  1VQ7 N;  5AQO A;  4FPB A;  2O8E A;  4Z94 A;  2HB5 A;  3T19 A;  3AVA A;  4LY7 A;  3F2K A;  1N34 K;  3CC4 N;  3ZT1 A;  1C1B A;  1JCF A;  4KFB A;  4JK7 A;  4H4M A;  4KI4 A;  1JKH A;  3R9P A;  3A5L C;  4ISE A;  2FXU A;  5BN9 A;  4KHU A;  4BRF A;  4EZ9 A;  4X62 K;  4CEC A;  1S1U A;  3MXJ A;  3JS6 A;  1WN7 A;  2BGG A;  3CFR A;  1TKD A;  4J8F A;  2B4J A;  4H0Y B;  5LMU K;  5EX5 A;  4FLZ A;  2HHH K;  4DR4 K;  3ZSZ A;  3SJJ A;  4DR5 K;  3L3U A;  4BRE A;  2V7Y A;  3CJ9 A;  3HST B;  1WSI A;  5HL7 L;  2P9N A;  2D0B A;  3I8D A;  3CPE A;  1NMN A;  1J5E K;  2GTD A;  5HP1 A;  4CGF A;  4JKG A;  3ZSO A;  3M3Z A;  4C1N I;  3MN6 A;  4CGH A;  3J7Z O;  1NBW A;  3LAL A;  1QTM A;  1NJZ A;  3AGK A;  3SUN A;  4ILH A;  2Q0R A;  2KQ2 A;  1NGG A;  3LP2 A;  4DU4 A;  3VN5 A;  2NNW A;  3PO4 A;  4H5N A;  1FXX A;  3ISN C;  3QFU A;  5AQF A;  4JHD B;  2KFZ A;  3HOS A;  3NHG A;  4LF4 K;  4E1M A;  3CIP A;  1X9J A;  3IS9 A;  5FLX O;  3CJ7 A;  2OTJ N;  3H46 O;  1X9S A;  3KK3 A;  4E3S A;  4GV3 A;  1GLL O;  3CQ8 A;  5ELZ A;  4JLH A;  3SZ2 A;  5C15 A;  4BRI A;  3RMC A;  1Z6R A;  4CHP A;  2Q3S A;  3D2F A;  4E1J A;  1SQK A;  4DTR A;  2HST A;  1RT3 A;  4LC9 B;  2RHK A;  4PA1 A;  4L8R B;  4BGA A;  4JNE A;  1JLC A;  4AHT A;  4Y1D A;  2YKN A;  4AIL C;  3FR0 A;  5AQV A;  5BN8 A;  4JI7 K;  3IAY A;  1VQL N;  1NK4 A;  1ZBU A;  2A41 A;  3SJH A;  2NRH A;  1RFQ A;  2VG5 A;  3DRR A;  3WXM B;  3SK3 A;  4H0T B;  3OYH A;  3CC7 N;  1OH6 A;  3RR7 A;  3CCE N;  3O80 A;  4CEE A;  4A61 A;  1BA1 A;  4WQ5 C;  4RCH A;  4OJR A;  1RTJ A;  2YJE A;  3QIP A;  3THY A;  3OYC A;  2VQE K;  4J2D A;  4QCL A;  3VEY A;  4JD2 B;  2GX9 A;  2HHT A;  1VSM A;  3TAQ A;  2IVP A;  4BR5 A;  5C25 A;  2VYP A;  3LDL A;  1QZ5 A;  4CJK A;  1XNQ K;  3D45 A;  3SQ0 A;  5HOO A;  2QWR A;  3THX A;  3O4Q A;  2J4R A;  2BAN A;  2RKI A;  1HNW K;  1TV6 A;  5AFU H;  3G6E N;  1GOA A;  3K5O A;  3ZX3 A;  4E0D A;  2HBJ A;  4E7J A;  1RCH A;  2I5J A;  4J2B A;  3GOI A;  3QEP A;  1HQE A;  3Q7B A;  3KLI A;  1VQM N;  4B3R K;  4IFV A;  4TSX A;  3NDK A;  1T03 A;  4I2Q A;  5DM6 L;  5K14 A;  2VG6 A;  1ZBI A;  1YHQ N;  1S72 N;  1S1X A;  2VWB A;  1NOY A;  2Z1J A;  3L0Q A;  3TSQ A;  2OPP A;  4ISF A;  4HTU A;  1QSL A;  2E2O A;  1BIS A;  1T8E A;  4YFU A;  4BWJ A;  2KLA A;  5C2D A;  3EKU A;  4WFB L;  5CZ2 A;  3S3M A;  4F3O A;  1RBV A;  3L2Q A;  1EXQ A;  4FK2 A;  2ZGY A;  3EYZ A;  1EWR A;  1VSI A;  4JEP A;  3OYL A;  4C8M A;  1WAJ A;  3D7E O;  4B9M A;  5AQJ A;  1ATS A;  4BE2 A;  3U3Y A;  4DQQ A;  4JS5 A;  3V9U A;  2HBK A;  4O5F A;  4DSK A;  3HI0 A;  3EO3 A;  3K5N A;  1Z25 A;  4C8K A;  3F5T A;  2FBV A;  1NGD A;  4KH4 A;  4C8L A;  4DFM A;  3O3F A;  1TUY A;  4MLE A;  4FZZ A;  5H1S Q;  5GIO A;  3SQ1 A;  4B9N A;  1XNR K;  3CHW A;  2OAN A;  1SZ2 A;  1T44 A;  3CXC M;  4DLG A;  2QA4 N;  2HND A;  3CCQ N;  1HPM A;  4CER A;  4FWK A;  5BPM A;  5D3G A;  4AHS A;  1K8K A;  3DYA A;  5HRR A;  4FVM A;  2LSN A;  3LL3 A;  5KGX A;  4I7F A;  5AQP A;  4OX9 K;  4FJ9 A;  4U7B A;  2UUC K;  3A5O C;  3P38 A;  3CQX A;  1WSH A;  3TTD A;  3VEN A;  4BDZ A;  5AQK A;  2XRI A;  4MQ3 A;  4KHN A;  1TYQ B;  2P9L B;  3OYA A;  3BP8 A;  1SV5 A;  1C0U A;  3AA2 A;  3MWT A;  1WBB A;  3WXI A;  4BRH A;  4JYA K;  1MU2 A;  5KQD A;  3CCU N;  2YI1 A;  3ZX0 A;  3C6U A;  5FPM A;  4DV3 K;  1XQS C;  3AVH A;  3K58 A;  4W5N A;  1R59 O;  2WTU A;  4KHY A;  3IDH A;  3MX2 A;  4N41 A;  4WFN L;  4KBO A;  3BUZ B;  4WE1 A;  1X9M A;  4FLT A;  2NRV A;  4M41 A;  4BQZ A;  5J2P A;  4DSL A;  4FW2 A;  2XY5 A;  2VWK A;  1W0H A;  1SS6 A;  1NOZ A;  4BQL A;  3T1Y K;  3THW A;  1SKR A;  1UA1 A;  2PFU A;  1K8K B;  1BCO A;  1C0F A;  1HYS A;  5FPD A;  5GAE P;  1JLA A;  3FZK A;  4YOX A;  3RR8 A;  1HYZ A;  3NE6 A;  4CJT A;  1VQN N;  4JI6 K;  5BR9 A;  1NKC A;  1ZBF A;  3QML A;  4CEO A;  5AQS A;  4LD0 A;  5AQU A;  3ZSW A;  3PSI A;  1NKE A;  4WQ4 A;  4NCA A;  3WXJ A;  4CFC A;  1IO2 A;  1RDA A;  3L2W A;  4DHY A;  4AQY K;  2F96 A;  1DKG D;  3I56 N;  4JRP A;  4FWP A;  1NGA A;  1WOQ A;  3CFP A;  4GVE A;  4DTJ A;  1J54 A;  2YNG A;  3CQY A;  2CH5 A;  4XH5 A;  3SBG A;  1W97 L;  1X3N A;  5I3U A;  3I0R A;  4CZG A;  4KRE A;  4IWV A;  1W2B M;  3KWG A;  1SKS A;  4FWM A;  4MDA A;  4KV8 A;  3AVJ A;  2UUA K;  3O1B A;  3CF5 L;  4BR7 A;  3ZSR A;  3AA3 A;  3RVC A;  1FKO A;  4FOI A;  5HRP A;  2O8B B;  2H3G X;  4Z4F A;  3G25 A;  1KFS A;  2W41 A;  5I9E B;  1BA0 A;  1Q7Y O;  2E20 A;  4DKW A;  1RBR A;  1N32 K;  4RW9 A;  4KH6 A;  2O8D A;  4KAZ A;  1DLO A;  5HRS A;  1RGI A;  1YTA A;  2ZWH A;  4CBU A;  1QSY A;  4LF8 K;  3DLH A;  5AQN A;  4Z4G A;  3VEW A;  3FLC O;  2YHX A;  4JS4 A;  4IOC L;  3AVF A;  3TU5 A;  4CD1 A;  3M8P A;  3OA9 A;  4NYN A;  4FZX C;  2E2P A;  1O1W A;  3E1Y A;  1WB9 A;  1KD1 O;  1CZ9 A;  4B9V A;  1ZBL A;  3AAR A;  3PIO L;  2YCH A;  4AM7 A;  2HF3 A;  3HM9 A;  1ZBH A;  4FZY A;  3ID6 A;  4GVM A;  2GEL A;  2QWM A;  3OW2 M;  1L3S A;  1JLG A;  1QS4 A;  5AQR A;  1SUQ A;  4B9S A;  5AZI B;  4CJS A;  1ASW A;  3U9D A;  3RTV A;  3D2E B;  1Y97 A;  1Q82 O;  1KVC A;  3KKR A;  4OO1 J;  1LOT B;  1S1T A;  4E7I A;  4FJI A;  3DLG A;  5BR8 K;  5M1K A;  2QKB A;  3CPW M;  3ZT3 A;  1C0M A;  2ASO A;  3CYM A;  3VA3 A;  3ID8 A;  2YHW A;  3U9Z A;  4B8A B;  3GDQ A;  2UXC K;  3NF6 A;  3SBT A;  4B8C A;  4ID5 A;  4B1W B;  1UAX A;  3L4Q A;  5EU7 A;  4FJH A;  3ZEU B;  4O0J A;  4FJX A;  1SKW A;  2QEX N;  4IKF A;  3E9P A;  1JLF A;  3S3N A;  1S9E A;  1X9W A;  2W42 A;  4DQR A;  1OKJ A;  4HWI A;  4FLY A;  1U2V B;  1A5X A;  4B3O A;  1XWL A;  3WNE A;  3WEE A;  2CGJ A;  3PO5 A;  2HHW A;  1IKY A;  4CI6 A;  3HPO A;  5J2M A;  1DGK N;  3SUO A;  4NXN K;  3HO1 A;  4A59 A;  4OLA A;  2UXB K;  4M3X A;  5IWA K;  2IGI A;  2ZM6 K;  4HUG A;  3SPY A;  1U48 A;  3B6O A;  4DWI A;  4JN4 A;  2D4W A;  3S9H A;  3OYG A;  5FRM A;  2Y1J A;  4EFH A;  4QS9 A;  4CJV A;  1NK6 A;  2WFB A;  4B9Q A;  1VQ6 N;  4O44 A;  3U3G A;  4PWD A;  1IH7 A;  5HRO A;  1DEJ A;  1LV5 A;  4FWR A;  4YOV A;  2WOM A;  4CJW A;  3ZLJ A;  1RT5 A;  5EVZ A;  5AQX A;  3PX6 A;  3FZF A;  4DTU A;  4O0I A;  1KTQ A;  1ZC6 A;  3VPZ A;  3QBX A;  2B5J A;  3OBW A;  4B9L A;  2CH6 A;  5AZJ A;  3BEX A;  2ZQB A;  2PYL A;  3DXK B;  3W0L A;  1K6Y A;  3SAG A;  4OKE A;  4BR2 A;  4K41 A;  2QI2 A;  4PKG A;  3T69 A;  2ATQ A;  4K8X A;  1BHL A;  1YXQ A;  2OA8 A;  3G4S N;  2JWL A;  1RDD A;  2IOC A;  3VQB A;  3TSP A;  5CE3 A;  1JL2 A;  5KRT A;  3S41 A;  3AO4 A;  1QVF M;  4GV6 A;  3EEQ A;  3K0S A;  1NMD A;  3NVM A;  4JI4 K;  3LAN A;  1M1K O;  3K9K A;  4YOW A;  4B9T A;  5C24 A;  4N56 A;  3HT3 A;  3KK2 A;  3J7A P;  4BE1 A;  2Y1I A;  1X3M A;  3K5M A;  3KLF A;  3H3O B;  2HHX A;  4MFB A;  3KKS A;  5FDL A;  3K57 A;  3HL8 A;  4LF6 K;  3MEG A;  2WC9 A;  2VCP A;  2P9S B;  4GV9 A;  2IDO A;  1VQK N;  4K42 A;  1KAY A;  4CIE A;  5KGW A;  1VSJ A;  2A3Z A;  3CJ1 A;  3ZT2 A;  5CR4 A;  1RNH A;  1O13 A;  3KK7 A;  1K8A O;  5M1P A;  1IG9 A;  4B3S K;  3ULE B;  1Q81 O;  4CGG A;  1SL1 A;  3AVK A;  1IKW A;  3OHR A;  3VQ6 A;  3NF7 A;  5AQI A;  2X6S A;  4K43 A;  1IBM K;  3VA0 A;  5GIP A;  4F3T A;  1I39 A;  1WLJ A;  2P9P B;  4JI5 K;  2BTF A;  3SV3 A;  1BIU A;  3KWI A;  2DFE A;  1OH7 A;  3I0S A;  1BIZ A;  3DMJ A;  4LFC K;  1K9M O;  3MN5 A;  3DLK A;  4FWO A;  5C42 A;  4PKH A;  4V19 S;  3TAN A;  4FWL A;  4CBX A;  4JHD A;  4Q5V A;  4ZHR A;  4H5V A;  3M1F A;  3R1X A;  2JWK A;  1RDC A;  4DFP A;  3T1A A;  3UIQ A;  3GL1 A;  4YNQ A;  4I6M B;  4DQI A;  2ITG A;  3J8A A;  4IJA A;  1NJW A;  3VF2 A;  4YOY A;  2G8F A;  4AH9 A;  4DR7 K;  4K8Z A;  3LM2 A;  4HTL A;  3C0B A;  3NGY A;  3UKU B;  3TAG A;  1MWM A;  1N5Y A;  2G8U A;  1VQ4 N;  5KQ8 A;  3CME N;  1L3U A;  1TGO A;  3HPH A;  5AQT A;  2FBX A;  1LAW A;  1YIJ N;  4KB0 A;  4CHO A;  2FSJ A;  4H0V B;  1EX4 A;  1NU0 A;  3AO3 A;  4IO8 A;  5M1O A;  3WXK A;  3VQ4 A;  2E2N A;  3VGM A;  4DUZ K;  4DTO A;  4X65 K;  1N36 K;  4FM0 A;  1U6Z A;  4CK1 A;  1REV A;  3SAH A;  2E1Y A;  3HSC A;  1D4X A;  4JD2 A;  3CCV N;  3QEW A;  3BY5 A;  3FGU A;  5JMV A;  5MLC Q;  3CCR N;  4HUF A;  4GY2 B;  2A6A A;  4BR0 A;  4ZTJ A;  1S1W A;  3BGR A;  1NNE A;  3QFP A;  3EL2 A;  3J7Y P;  4IZ9 A;  4OPA A;  4FXD A;  3I55 N;  4IXC A;  3E01 A;  2HNY A;  3I8B A;  4FLX A;  3AO2 A;  3VQ7 A;  2W40 A;  2ITM A;  4CJU A;  2YHY A;  2XY8 A;  5CY4 A;  3QIO A;  1JCG A;  4BVP A;  3K2P A;  4CFA A;  2KHO A;  3J80 O;  2D5R A;  2HOE A;  2QWP A;  3O9R A;  1ASV A;  3PLA A;  5FRO A;  1U47 A;  1HMV A;  1E4G T;  3V1O A;  4B3M K;  1XHZ A;  1LCU A;  4Z4E A;  4DSI A;  4K0K K;  4BRM A;  1BG3 A;  1VSF A;  3KTQ A;  1X1P A;  2OPS A;  1JJ2 M;  3MEE A;  4DCH A;  3HRG A;  4RG8 A;  5LL6 Z;  3MN7 A;  2O4G A;  3VMF B;  5EY4 A;  1C6V A;  3C6T A;  3ZET A;  2F7T A;  1L3T A;  3BZC A;  2Q2R A;  3AVC A;  3C6H A;  3P1G A;  3NF9 A;  4N76 A;  3AVI A; 
#chains in the Genus database with same CATH homology
 1TK8 A;  1D8Y A;  3KK1 A;  1SKR A;  4M3Z A;  1UA1 A;  1RBU A;  4E7K A;  1BL3 A;  4R5P A;  3V81 A;  1BCO A;  3VQE A;  1J5O A;  1HYS A;  1BCM A;  4LH4 A;  3HPG A;  3SPZ A;  3DRP A;  4DF4 A;  2E4L A;  4CJF A;  1JLA A;  3CG7 A;  4DTM A;  3RR8 A;  1HYZ A;  1RIL A;  1GOC A;  4KTW A;  3NE6 A;  2YKM A;  3PUF A;  3O3G A;  2DFH A;  4BAC A;  1S1V A;  2QXF A;  4ICL A;  3VQ9 A;  4DFJ A;  2DY4 A;  4UQG A;  3NCI A;  1C0T A;  4CJT A;  4XIU A;  1NKC A;  1J53 A;  1ZBF A;  3V9X A;  4OVL A;  2ZD1 A;  4CEO A;  4LD0 A;  1YT3 A;  4DU1 A;  2YNH A;  3NH2 A;  3HP6 A;  3SNN A;  4FK0 A;  1WSJ A;  3ZSW A;  2E6L A;  4FLV A;  4FJL A;  3V9Z A;  1T05 A;  1NKE A;  3CM5 A;  4NCA A;  1LAV A;  4CFC A;  2OZM A;  4CIG A;  1IO2 A;  4CGD A;  5I42 A;  1RDA A;  2BDP A;  4ZTF A;  1RT7 A;  3L2W A;  2EX3 A;  2QKK A;  2Z1G A;  1HYV A;  2G8V A;  2F96 A;  5DK5 A;  1DTT A;  1ASU A;  4CJ4 A;  2A1R A;  4JRP A;  1KFD A;  1TAU A;  3CFP A;  1RT2 A;  4GMJ B;  4CJQ A;  4QOZ B;  4DTJ A;  4EP4 A;  1TL1 A;  1SL0 A;  1Q9Y A;  1J54 A;  2YNG A;  4FJM A;  4H8K A;  3KLH A;  4N76 A;  1JL1 A;  5I3U A;  4HCC A;  3I0R A;  3OYJ A;  3ZSV A;  4KTZ A;  4DTX A;  4KRE A;  1RT4 A;  2KTQ A;  4OGC A;  3QES A;  1F21 A;  1FKP A;  4CJL A;  1KCF A;  1SKS A;  3ZCM A;  1YVU A;  4KV8 A;  3AVJ A;  3TAB A;  3AVG A;  4E7L A;  3EZ5 A;  3F73 A;  2VG7 A;  3LP0 A;  3ZSR A;  4KKO A;  3AA3 A;  1FKO A;  2X74 A;  3MAQ A;  5J2Q A;  5HRP A;  1UA0 A;  4Z4F A;  4IG0 A;  1EKE A;  1KFS A;  3DRS A;  1BGX T;  4OPJ A;  2G8W A;  3PY8 A;  2OZS A;  3O4N A;  4FJN A;  4DLE A;  1RBR A;  3LDS A;  4CCH A;  4E89 A;  1CLQ A;  4RW9 A;  1LWC A;  3TAP A;  5KRS A;  4KTQ A;  3HK2 A;  4KAZ A;  3OVN A;  3TI0 A;  1DLO A;  5HRS A;  2HHS A;  1YTA A;  5HRN A;  3OYD A;  4CF1 A;  1QSY A;  3DLH A;  4Z4G A;  4NYF A;  1W9H A;  4IDK A;  4IFY A;  4Z4C A;  4JS4 A;  3AVF A;  4CEA A;  2GV9 A;  3DI6 A;  3DLR A;  4DQP A;  1KLN A;  3M8P A;  4DSF A;  4CEF A;  4NYN A;  4CE9 A;  4FZX C;  5SWM A;  2Z1H A;  1CXQ A;  3ULD A;  3QIN A;  4N47 A;  4W5T A;  1QSS A;  1O1W A;  1KLM A;  4M3Y A;  4OKK A;  3NF8 A;  3VQA A;  3EY1 A;  4FYD A;  4E1N A;  4I9Q A;  1CZ9 A;  2P5O A;  4Z4H A;  4B9V A;  4HCB A;  3WNH A;  1ZBL A;  1BQM A;  3C94 A;  4DG1 A;  1A5W A;  3QLH A;  1U49 A;  3L2R A;  3HM9 A;  2KZZ A;  1C1A A;  3CM6 A;  4Z0U A;  4DSJ A;  4CF8 A;  4KO0 A;  1XC9 A;  1N6Q A;  4FZY A;  3NGI A;  4GVM A;  4BDP A;  1ZBH A;  4PY5 A;  1L3S A;  4F2R A;  3HP9 A;  3V1R A;  2HVH A;  2RN2 A;  1TVR A;  1JLG A;  1EP4 A;  3T3F A;  1QS4 A;  2E6M A;  2HW3 A;  3RWU A;  2JGU A;  1JLQ A;  1WSF A;  1SUQ A;  3TAE A;  4GW6 A;  3NGZ A;  4B9S A;  1NK5 A;  3AV9 A;  1L3V A;  4CJS A;  1ASW A;  3VQD A;  4ELU A;  3KJV A;  3RTV A;  4CED A;  1RDB A;  3OYE A;  4OKJ A;  1Y97 A;  1ITG A;  1KVC A;  1HQU A;  3AVB A;  3ZT4 A;  3KKR A;  1S1T A;  4CFD A;  4E7I A;  1TKX A;  4BDY A;  3HJF A;  1LW2 A;  4FJI A;  4C8O A;  4ELV A;  3KD1 E;  4F2S A;  1BI4 B;  3DLG A;  4HVJ A;  1D9D A;  2PY5 A;  4O5B A;  3SUP A;  3ZSX A;  2F8S A;  4W5Q A;  3D0P A;  2QKB A;  4ELT A;  2OPQ A;  1NKB A;  4AHV A;  4CJ3 A;  4JRQ A;  4KPY A;  3ZT3 A;  1C0M A;  3ITH A;  1VSK A;  2FBT A;  3CYM A;  3LZI A;  3VA3 A;  4I9L A;  4DMN A;  2P1J A;  4B8A B;  2GUI A;  3LAK A;  1S5J A;  4AHU A;  3NF6 A;  4B08 A;  3ZSQ A;  3IG1 A;  5CYQ A;  4B8C A;  4ID5 A;  3ALY A;  1UAX A;  4CFB A;  2YNI A;  4FW1 A;  3JSM A;  3V4I A;  5EU7 A;  3NAE A;  2G8I A;  4FJH A;  4O0J A;  4FJX A;  3WNG A;  4DTN A;  1SKW A;  5FRN A;  4IKF A;  3OYN A;  1JLF A;  3S3N A;  1S9E A;  3THV A;  1WSE A;  3QEV A;  3P83 D;  1X9W A;  2W42 A;  4DQR A;  4Z4I A;  4CEQ A;  1NK7 A;  1RTH A;  3G0Z A;  4RW4 A;  4FLY A;  3QNN A;  4I2P A;  1U04 A;  3NH0 A;  1JLB A;  2HNZ A;  4DF8 A;  3U6F A;  1A5X A;  2YHB A;  1R0A A;  4B3O A;  1XWL A;  1QQC A;  3WNE A;  3LP3 A;  3PO5 A;  2HHW A;  2B6A A;  2G8H A;  1IKY A;  1QE1 A;  2HB5 A;  3T19 A;  1JLE A;  3AVA A;  4OPK A;  4KHQ A;  1IKV A;  3HPO A;  5CYM A;  1LWF A;  4LY7 A;  2IS3 A;  1TKT A;  4C8N A;  5J2M A;  3SUO A;  3ZT1 A;  1C1B A;  3OJS A;  3SV4 A;  3HO1 A;  4OLA A;  4M3X A;  4KFB A;  5J1E A;  4FCY A;  4CJ5 A;  4H4M A;  3OYB A;  2IGI A;  4IG3 A;  1Z26 A;  4KI4 A;  1CZB A;  3ASM A;  1T7P A;  1JKH A;  1Q8I A;  1VRU A;  2ZE2 A;  4HUG A;  3SPY A;  3B6O A;  1U48 A;  2IAJ A;  3AO1 A;  1RBT A;  4DWI A;  1FK9 A;  4E19 A;  3DM2 A;  4Y1C A;  4EZ9 A;  3S9H A;  4KHU A;  4CEC A;  5SZT A;  3OYG A;  1S1U A;  3MXJ A;  2NUB A;  1WN7 A;  2BGG A;  5FRM A;  3CFR A;  4O55 A;  2Y1J A;  1TKD A;  1RT6 A;  4FM1 A;  1ZYQ A;  3NBP A;  3RMA A;  4DS4 A;  4CJV A;  2B4J A;  3AA5 X;  1C1C A;  1VRT A;  4IBN A;  1NK6 A;  4FLZ A;  3OYM A;  4BWM A;  4CES A;  3TAR A;  1GOB A;  3QO9 A;  4CGJ A;  4O44 A;  3U3G A;  3OS0 A;  3ZSZ A;  2IC3 A;  3SJJ A;  3L3U A;  2R7Y A;  3HVT A;  4DS5 A;  4PWD A;  1IH7 A;  1BI4 A;  3M8S A;  5HRO A;  3WNF A;  1LV5 A;  2WOM A;  4LH5 A;  4CHZ A;  4Q0B A;  3HST B;  1WSI A;  4CJW A;  3LP1 A;  2D0B A;  3QER A;  4PQU A;  4LSN A;  3I8D A;  1RT5 A;  4EP5 A;  1HNI A;  3PX6 A;  4CIF A;  4DTU A;  3LZJ A;  3RMB A;  4O0I A;  1KTQ A;  4CGF A;  4E7H A;  5HP1 A;  3ZSO A;  3VQ8 A;  3DOL A;  2B5J A;  3HVR A;  4B9L A;  2YNF A;  1XI1 A;  2ZQB A;  3QNO A;  1U4B A;  4CGH A;  2PYL A;  1K6Y A;  3LAL A;  3TWH A;  1QTM A;  4OKE A;  3RRH A;  1NJZ A;  2BE2 A;  5E41 A;  3LPU A;  1TK0 A;  1J9A A;  3K5L A;  3SUN A;  4KHS A;  2Z1I A;  2KQ2 A;  3LP2 A;  4DU4 A;  2ATQ A;  1VSL A;  4K8X A;  1A5V A;  4W5R A;  3VN5 A;  1BHL A;  2OA8 A;  3H08 A;  5T7B A;  3PO4 A;  1RDD A;  2IOC A;  1VK0 A;  1FXX A;  3VQB A;  3ISN C;  1JL2 A;  4CK3 A;  5KRT A;  1WSG A;  4O4G A;  3AO4 A;  3V9W A;  3NHG A;  2KFZ A;  1RTI A;  1VSE A;  2PYJ A;  4E1M A;  3AVN A;  4EZ6 A;  3L2U A;  4M3W A;  1RTD A;  1RBS A;  4B9U A;  2FBY A;  3IS9 A;  3LAN A;  4F8R A;  4B9T A;  1X9S A;  5C24 A;  4N56 A;  3A2F A;  3HT3 A;  3KK2 A;  3KK3 A;  3AVL A;  4E3S A;  4BE1 A;  2HHX A;  2Y1I A;  1I3A A;  2X78 A;  3CQ8 A;  1JXE A;  2AJQ A;  4JLH A;  2WON A;  3SZ2 A;  1HRH A;  3L3V A;  4CEZ A;  3OS1 A;  1NK0 A;  4DTS A;  3RMC A;  2XY6 A;  4NCB A;  1B9D A;  3KLF A;  3K5M A;  4CHP A;  3SCX A;  3RMD A;  1WAF A;  2Q3S A;  2HHV A;  4DTR A;  1KVA A;  1RT3 A;  4CHN A;  3V6D A;  4MFB A;  3KKS A;  4PA1 A;  1UWB A;  2G8K A;  4L8R B;  4CF0 A;  1JLC A;  2X6N A;  4RW8 A;  5FDL A;  4CHQ A;  3K57 A;  3HL8 A;  4AHT A;  3OYI A;  4RW6 A;  3MEG A;  4Y1D A;  3HXM A;  2YKN A;  3O3H A;  4AIL C;  2IDO A;  4CIE A;  2XHB A;  4AHR A;  5KGW A;  1VSJ A;  3ZSY A;  3ZT2 A;  3OYF A;  3IAY A;  3M8Q A;  4M3R A;  3KD5 E;  2GBZ A;  1NK4 A;  1RNH A;  1ZBU A;  3P5J A;  1IG9 A;  2VG5 A;  2QK9 A;  4FLW A;  1S9G A;  3DRR A;  1NJY A;  4KI6 A;  4CGG A;  3OS2 A;  3OYH A;  1SL1 A;  3AVK A;  3AA4 A;  1IKW A;  3VQ6 A;  3RR7 A;  2F8T A;  1JXB A;  3NF7 A;  4CEE A;  2HVI A;  2KZM A;  3TAF A;  2X6S A;  3VQ5 A;  3VQP A;  3VA0 A;  4OJR A;  4W5O A;  2ETJ A;  3OYK A;  1RTJ A;  2HMI A;  3QIP A;  4CF9 A;  2OYQ A;  4F3T A;  1I39 A;  1WLJ A;  3OYC A;  4J2A A;  4J2E A;  3SV3 A;  4M3T A;  1BIU A;  4J2D A;  4QCL A;  4FJ7 A;  3HYF A;  2DFE A;  2P51 A;  3I0S A;  1BIZ A;  1VSM A;  3DMJ A;  3TAQ A;  2HHT A;  5C25 A;  4CJK A;  1QHT A;  3D45 A;  3SQ0 A;  2XY7 A;  3DLK A;  3KIO A;  5C42 A;  3F9K A;  4NCG A;  1VSH A;  3O4Q A;  2HHU A;  2RKI A;  2BAN A;  3SQ4 A;  2JLE A;  3TAN A;  1TV6 A;  4HHT A;  2PZS A;  1GOA A;  1HPZ A;  3K5O A;  4ZHR A;  4Q5V A;  4QAG A;  4E0D A;  2O4I A;  4E7J A;  3QEX A;  1RCH A;  1LWE A;  2I5J A;  4J2B A;  3QEP A;  1HQE A;  4FM2 A;  1RDC A;  3KLI A;  4DSE A;  3SUQ A;  4DFP A;  3T1A A;  3CFO A;  4AHC A;  3UIQ A;  4YNQ A;  1VSD A;  4DQI A;  2ITG A;  4IFV A;  4TSX A;  3NDK A;  1NJW A;  1T03 A;  2P5G A;  4CK2 A;  4I2Q A;  1L5U A;  4FJ5 A;  2G8F A;  3C95 A;  4CJP A;  5K14 A;  2VG6 A;  1ZBI A;  2FC0 A;  4FLU A;  3S3O A;  1U45 A;  4AH9 A;  1S1X A;  1NOY A;  4CF2 A;  4K8Z A;  4F4K A;  2Z1J A;  3LWL A;  3NGY A;  5KI6 A;  2OPP A;  3LPT A;  3KLE A;  1WNS A;  4HTU A;  3TAG A;  1QSL A;  1N5Y A;  2G8U A;  1BIS A;  1T8E A;  3LAM A;  2VWJ A;  4YFU A;  4BWJ A;  4CGI A;  4N5S A;  3KLG A;  2D0C A;  1L3U A;  1TGO A;  5CZ2 A;  3OJU A;  3HPH A;  2FBX A;  5HBM A;  1LAW A;  3S3M A;  4F3O A;  4KB0 A;  1RBV A;  3L2Q A;  1EXQ A;  4CHO A;  5KTQ A;  4FK2 A;  3EYZ A;  1VSI A;  3OYL A;  4C8M A;  3JYT A;  1EX4 A;  2YHA A;  1WAJ A;  4B9M A;  2KFN A;  3AO3 A;  4BE2 A;  1B92 A;  3TR8 A;  3DLB A;  2A1S A;  3SYZ A;  3U3Y A;  2YV0 X;  4DQQ A;  3G10 A;  4JS5 A;  3V9U A;  3VQ4 A;  4DSK A;  4FJJ A;  4ID1 A;  3K5N A;  1Z25 A;  4DTO A;  4C8K A;  3DOK A;  3RRG A;  4DQS A;  2FBV A;  1D9F A;  4CEB A;  4FM0 A;  4DFM A;  4LSL A;  3O3F A;  4C8L A;  4CK1 A;  1REV A;  4FZZ A;  2D0A A;  4B9N A;  3SQ1 A;  4H4O A;  2RF2 A;  3M8R A;  1TK5 A;  3PX4 A;  1DTQ A;  5HLF A;  4DLG A;  3VQC A;  5J2N A;  1RT1 A;  2HND A;  3QEW A;  3IRX A;  4CER A;  1Q9X A;  5D3G A;  5CZ1 A;  4HUF A;  4AHS A;  4ZTJ A;  4DFK A;  1S1W A;  1UOC A;  1B9F A;  3BGR A;  2DFF A;  1KSP A;  3DYA A;  1SL2 A;  5HRR A;  4FVM A;  4DU3 A;  2LSN A;  1YTU A;  3SQ2 A;  1CXU A;  5KGX A;  4I7F A;  4FK4 A;  4FJ9 A;  4FXD A;  3TAM A;  3E01 A;  3MEC A;  2HNY A;  4FLX A;  3AO2 A;  3VQ7 A;  1WSH A;  2EHG A;  5JS2 A;  4BDZ A;  4FJ8 A;  2RPI A;  2XRI A;  4MQ3 A;  4CJU A;  3NH1 A;  1G15 A;  4KHN A;  2HHQ A;  3OYA A;  1TAQ A;  2XY8 A;  5CY4 A;  3QIO A;  1SV5 A;  1C0U A;  3AA2 A;  3DLE A;  1KRP A;  3BDP A;  2DTU A;  3K2P A;  4DTP A;  4OLB A;  4CFA A;  3MED A;  1MU2 A;  4HUE A;  3V9S A;  2D5R A;  4M3U A;  1BQN A;  1TL3 A;  1S6P A;  1XHX A;  1ASV A;  1NK8 A;  5FRO A;  4KRF A;  4FJG A;  1LW0 A;  3AVM A;  4G1Q A;  1D5A A;  4M42 A;  4KB1 A;  3OY9 A;  1U47 A;  3LWM A;  1HMV A;  3AO5 A;  3V1O A;  4OGE A;  3PV8 A;  1NK9 A;  3C6U A;  1XHZ A;  4KHW A;  2OPR A;  4Z4E A;  4DSI A;  4BE0 A;  2XO7 A;  3AVH A;  3L2V A;  3K58 A;  1EET A;  1VSF A;  4KHY A;  4W5N A;  1IKX A;  4PUO A;  3KTQ A;  1TKZ A;  1X1P A;  1S6Q A;  3PX0 A;  2OPS A;  4N41 A;  5DMR A;  3SI6 A;  4M45 A;  5JS1 A;  4WE1 A;  1X9M A;  4FJK A;  3MEE A;  1KVB A;  3QET A;  4RG8 A;  2KW4 A;  3ZT0 A;  3MXI A;  3MXM A;  3FFI A;  4FLT A;  1NJX A;  3B6P A;  4CJR A;  2O4G A;  4M41 A;  1C6V A;  3C6T A;  3V1Q A;  4CJE A;  3NFA A;  5J2P A;  4DSL A;  4FW2 A;  3VQQ A;  1L3T A;  2XY5 A;  2VWK A;  4CHY A;  4RW7 A;  3L8B A;  3QEI A;  1HNV A;  1W0H A;  3K59 A;  3AVC A;  1HJR A;  3P1G A;  3NF9 A;  1NOZ A;  3AVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...