4EP4A

Thermus thermophilus ruvc structure
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
166
Chain Sequence
b'MVVAGIDPGITHLGLGVVAVEGKGALKARLLHGEVVKTSPQEPAKERVGRIHARVLEVLHRFRPEAVAVEEQFFYRQNELAYKVGWALGAVLVAAFEAGVPVYAYGPMQVKQALAGHGHAAKEEVALMVRGILGLKEAPRPSHLADALAIALTHAFYARMGTAKPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Crossover junction endodeoxyribonuclease RuvC
publication title Structural asymmetry in the Thermus thermophilus RuvC dimer suggests a basis for sequential strand cleavages during Holliday junction resolution.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 54
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature ec 3.1.22.4: Crossover junction endodeoxyribonuclease.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02075 RuvC Crossover junction endodeoxyribonuclease RuvC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ep4A00
3RTVA 4CFBA 1T05A 1HYSA 3AV9A 1W9HA 4IFYA 4O55A 3L2WA 4AILC 4DTOA 1LV5A 1KTQA 4CFDA 4UQGA 4NCGA 3VQAA 2G8UA 4DTPA 4CEEA 4KTQA 3P1GA 3KLHA 4CJKA 2Z1JA 4CERA 5CYMA 3EYZA 2KTQA 3V1OA 4W5NA 2Y1JA 2WOMA 3JSMA 2QK9A 3NGZA 2HVIA 4BE2A 3ZT0A 1L3SA 3ZT4A 1QQCA 3CG7A 4OPJA 4DSJA 1X1PA 2R7YA 1C1CA 1I3AA 3LAMA 2YNIA 3PUFA 1BCOA 3K5LA 3QERA 4CGGA 3OYDA 3QETA 3SUOA 4FJJA 2AJQA 5KI6A 4W5OA 4ELTA 1IKVA 4RW4A 5KTQA 3ZSXA 4DQSA 4DSIA 1CLQA 4CJ4A 1NK5A 4OKJA 2FBXA 3FFIA 1N5YA 5FRMA 5KRTA 1QS4A 3LAKA 3PO5A 3NE6A 3ZT1A 3OYGA 4FLWA 2F8SA 5CY4A 3LDSA 3AO3A 4Y1DA 1RT5A 4EP5A 3L8BA 2OZMA 1EETA 2YNFA 1U48A 3V6DA 3SQ4A 3CM6A 2G8KA 1IKYA 3C6UA 3NGIA 2E4LA 4OPKA 3WNFA 3TAEA 1YT3A 3KD1E 4K8XA 2Z1IA 4NYFA 3LWMA 1RDCA 4CEFA 1SV5A 3AO2A 4CEDA 4KHYA 4CJLA 4CJRA 4CECA 2E6MA 1D9FA 1IO2A 1L3TA 3C94A 3ALYA 4FM1A 3PX6A 4M3YA 4CJTA 3AVHA 1KVAA 1KFSA 3HT3A 5CZ1A 4FYDA 3DMJA 4CF8A 1BGXT 1IKWA 1VSEA 2P51A 3T19A 4CEAA 4CGFA 3OYLA 4DS5A 3P83D 3LP0A 4KI6A 3QIPA 2VG6A 4KAZA 3ZT3A 5J2MA 3KK1A 4KPYA 3S3MA 3G10A 3MEEA 3PV8A 3ZSQA 4BDPA 4FK0A 1JLEA 3SUNA 2KZMA 1YVUA 1WSJA 4N5SA 4PQUA 1KVBA 3OYCA 3KJVA 3QNNA 1S5JA 4HTUA 4DTSA 4E7LA 3OVNA 3AO4A 1S1XA 3OS0A 1LW2A 3OYNA 1HJRA 2OA8A 4Z4EA 1ZBIA 4AH9A 3NH2A 3SPZA 4CEOA 1TL3A 2Q3SA 1LW0A 4FK2A 4GMJB 2XO7A 3HPOA 4M3UA 4OGCA 3KLGA 3VQ5A 4CJSA 4N41A 2G8IA 4N76A 1CZBA 3ITHA 4QOZB 4N56A 1WAJA 2GBZA 4LH4A 2ZE2A 2X6NA 4CIGA 5FRNA 4PWDA 1VSJA 1WAFA 4KB0A 2HNDA 5C42A 4Z4FA 1EKEA 4DG1A 3DRPA 4AHUA 4B9TA 4C8NA 3RRGA 1HPZA 3V9SA 4AHTA 2WONA 3OS1A 1JXEA 2X6SA 3C6TA 4HUGA 3SQ2A 3SQ0A 2P5GA 2KFNA 3HK2A 2KFZA 4FXDA 1HQEA 4KTZA 2G8WA 4KFBA 3LZIA 1UAXA 1SKWA 4IG0A 3DOKA 3D0PA 2XRIA 2O4GA 4J2AA 3O4NA 3MEGA 4BE0A 2XY6A 4CF1A 3M8PA 2HHTA 1ZBUA 1KFDA 3O4QA 2D0AA 4CHPA 4OLAA 4OVLA 2QXFA 3ZSVA 4R5PA 1LWEA 3TARA 4H4MA 3AVMA 3LZJA 1Q9XA 1D9DA 4K8ZA 4CIFA 1QSSA 3TAMA 4DTRA 1ASVA 3RRHA 3ZSZA 2A1SA 1DTQA 2DFFA 4PA1A 4LH5A 4N47A 4CHZA 4YFUA 4MFBA 4IFVA 1A5XA 2IC3A 1BIZA 1RT4A 3NF8A 5E41A 4J2EA 2YHAA 5HRNA 4RW8A 1X9SA 1NJXA 1BCMA 3VQCA 3VQ8A 4OKEA 1NJZA 1SKSA 1R0AA 3M8RA 4FLUA 3L3VA 4JLHA 5KGXA 1UA1A 4B9MA 4I9QA 4FM2A 4BE1A 2X74A 1L3UA 3PO4A 3HSTB 1S6PA 4O0IA 1NK4A 3K2PA 3VQBA 1T8EA 4B9UA 5D3GA 1O1WA 3PX4A 1C1BA 4O44A 4DFJA 2KZZA 3U3GA 3I0RA 2ZQBA 5SWMA 1RTDA 3VQ9A 3VQEA 1U45A 5DK5A 3M8QA 3NBPA 1JLQA 3OYJA 4KTWA 1VK0A 4EP4A 2X78A 1FK9A 1SL0A 2B6AA 2E6LA 2OPSA 2XHBA 2RKIA 5I42A 4W5TA 4L8RB 3HO1A 4Z0UA 5HP1A 3EZ5A 2PY5A 3ZCMA 1JLFA 4TSXA 3HXMA 2B5JA 3DOLA 4GW6A 4DTNA 4F8RA 3RWUA 1HMVA 2HNYA 3ISNC 1CZ9A 4E7KA 1G15A 4FLZA 4Z4IA 4B8CA 2Y1IA 1ASWA 3DRRA 3OYMA 1KSPA 1HRHA 4CHQA 4M41A 1GOAA 5KGWA 3S3OA 3RMCA 2P5OA 3P5JA 1FKOA 2F96A 1S9EA 3RR7A 2IS3A 2JLEA 3CM5A 4ID1A 4CGHA 3QEIA 1EXQA 4DQPA 3I8DA 4FLVA 2OPPA 4KO0A 4FJXA 2HHQA 1ITGA 4DTXA 5HRSA 4W5QA 1XC9A 3IG1A 3QLHA 3K58A 2XY7A 1KLMA 2BE2A 1C1AA 4KV8A 1BQNA 4FZYA 3ZSOA 1QTMA 4C8MA 1WSEA 3AVAA 4GVMA 2HW3A 5J2QA 1ZBFA 2FBVA 3OJSA 2P1JA 5HLFA 3BDPA 4FJHA 1QE1A 3WNGA 4AHRA 1S1VA 2B4JA 3VQPA 4CHYA 1TKDA 1NOYA 3K5OA 3DLGA 5C25A 4BDYA 4HCCA 4ID5A 2BANA 4AHSA 1YTUA 1WSHA 3RMBA 3I0SA 1T03A 3NF9A 2HHUA 1J5OA 1IG9A 4B3OA 4M3XA 1REVA 2VG7A 2ATQA 4CJQA 3KIOA 1K6YA 3NHGA 4FK4A 5EU7A 2G8VA 2DY4A 1UWBA 3DLEA 2GV9A 2QKBA 1SL1A 1ZBHA 3M8SA 1NKBA 2F8TA 3LP3A 3HPHA 4CK3A 4DQQA 2O4IA 3NGYA 4CGDA 4J2DA 1VRTA 3AA4A 5J2NA 2VWJA 2KQ2A 4B08A 2Z1HA 1RDBA 1WLJA 3SV3A 5HRRA 1WSFA 3L2RA 1B9DA 3NH1A 1Q9YA 4M3WA 3AVLA 3QINA 1LAWA 4MQ3A 3KKRA 3T1AA 3VA0A 4KI4A 2HHVA 4DU1A 2VG5A 1L5UA 3H08A 1HYVA 3KKSA 3OYKA 4ELVA 1J54A 2IDOA 4RW7A 5I3UA 3AVGA 4F2RA 3AVJA 2YNGA 4CF0A 4DF8A 4CK2A 3TI0A 3V9ZA 1VSLA 3NCIA 4NCAA 4CJVA 3K57A 1SL2A 1RBVA 5HRPA 2HB5A 4DSKA 4B9LA 3DRSA 1RDDA 3HL8A 3PY8A 3NF6A 4FJNA 1KVCA 1TV6A 1TAQA 1Z25A 1BISA 1F21A 4IDKA 3VQDA 4FLTA 3V81A 4KRFA 4CJ3A 1BI4B 2XY5A 3HM9A 5J2PA 1W0HA 2ITGA 1VSHA 3DLRA 1VSDA 3JYTA 1QSYA 3NF7A 2OZSA 3CFRA 3LALA 3DYAA 4ELUA 1SKRA 1RCHA 3NH0A 3MXJA 2KW4A 3L3UA 3TANA 1D8YA 2ETJA 4CCHA 4B9NA 4E7HA 4M45A 4DU3A 5HROA 3HPGA 1NJWA 2NUBA 1BIUA 1QHTA 1RT6A 3E01A 3U3YA 1BHLA 1JLCA 4PUOA 1XHXA 4HUFA 3TAFA 3IAYA 3HJFA 3V1RA 4I7FA 1HNVA 2OPRA 1RT2A 3LANA 3LPUA 1NKEA 4F2SA 4DS4A 4Y1CA 4ICLA 2RN2A 4FJ7A 1WN7A 1C0UA 1RTIA 2Z1GA 3SJJA 3NFAA 4NYNA 3NAEA 4B9SA 4F3OA 1U04A 4RW6A 1C6VA 4FVMA 1A5WA 1MU2A 3DLHA 3S9HA 4I2PA 3WNHA 5C24A 1TKZA 3KTQA 1NOZA 2EX3A 3KD5E 3B6OA 3KK3A 1DLOA 1VSKA 1BQMA 1HQUA 1S1TA 2I5JA 3UIQA 4Q5VA 2BDPA 3BGRA 1NJYA 4C8LA 4DSLA 2YNHA 3MEDA 2PZSA 4ZHRA 4Z4HA 3PX0A 3RMAA 3T3FA 3QEXA 3L2VA 1RTHA 2JGUA 4FLYA 1TK8A 3DLKA 1B9FA 4CGIA 4DMNA 4E19A 2HHWA 2RF2A 1JL2A 3MECA 1TK0A 1KLNA 3O3FA 4CK1A 4O4GA 3CYMA 2HVHA 1IH7A 3LP2A 4JRQA 1JLAA 4FJGA 4DTJA 4M42A 3DI6A 2G8FA 1TVRA 3B6PA 1JLBA 4BWMA 4CF2A 1S1UA 4I2QA 4CEBA 4DQIA 3G0ZA 3OYFA 1S1WA 4B9VA 4H8KA 1GOBA 3NDKA 3AO1A 2IGIA 1TKTA 3V9UA 4JS5A 4HUEA 1BL3A 2VWKA 4RW9A 3VQ4A 2D5RA 4CESA 4FLXA 3SI6A 3AVCA 1C0TA 2OPQA 3HYFA 3SUPA 4M3ZA 3RR8A 1JLGA 2GUIA 4DU4A 3ZSWA 4LD0A 3OYIA 1VSIA 1RBTA 4FJIA 3AVNA 4M3RA 1DTTA 5JS2A 4FJ9A 4E1NA 1KRPA 3AVIA 3CFOA 4FJ8A 1NK7A 2YKMA 4I9LA 1ZYQA 4KB1A 1LAVA 4DTMA 4LSNA 1CXUA 4JRPA 4DLGA 1U49A 4DFKA 1NK0A 3DLBA 4J2BA 5FROA 1N6QA 3LWLA 1VRUA 1U47A 4AHVA 1CXQA 3K5MA 3C95A 1LWFA 4G1QA 4CHNA 3ULDA 3ZT2A 3THVA 4CJEA 3AVKA 2A1RA 1L3VA 3VA3A 4CEQA 4FCYA 5FDLA 3OYBA 3S3NA 1JKHA 1A5VA 1EP4A 4E1MA 1JL1A 3TAGA 3QEPA 1XHZA 1T7PA 1RNHA 1ZBLA 3DM2A 4HCBA 1WSGA 3AA2A 4KHNA 3HP6A 3HP9A 1XI1A 1D5AA 1J53A 4O5BA 4CJ5A 2FBYA 4CJPA 1QSLA 2OYQA 1GOCA 4CE9A 3MXIA 4OLBA 2HMIA 4M3TA 2IAJA 3F73A 3V9XA 3OS2A 1WSIA 3ZSRA 4BWJA 4CJUA 2HHXA 5CYQA 4LY7A 4HVJA 4E7JA 4DSEA 4CFCA 4BDZA 3VN5A 4F3TA 3AVBA 1NKCA 1B92A 4EZ9A 3IS9A 3L2UA 4KHWA 4RG8A 3CFPA 1BI4A 3QO9A 3AVFA 4CJFA 1HYZA 3AA3A 4W5RA 1S6QA 3SQ1A 4Z4GA 4QAGA 1S9GA 2ZD1A 3OJUA 4KHQA 2W42A 3TABA 1FXXA 3OYAA 2YHBA 1I39A 1RBSA 1Z26A 5CZ2A 4Z4CA 4CEZA 3O3GA 3TAQA 4C8KA 4DWIA 1RILA 3TAPA 4XIUA 4E89A 3A2FA 2YKNA 1Q8IA 4H4OA 5K14A 2QKKA 3ASMA 1UOCA 4FJLA 4Q0BA 1RT3A 4FJ5A 5T7BA 4QCLA 1KCFA 4BACA 4CGJA 3LP1A 2BGGA 4FW2A 3HVTA 4NCBA 1EX4A 1SUQA 4DLEA 5HBMA 2YV0X 3QEVA 2HNZA 3OY9A 3CQ8A 2G8HA 4C8OA 1U4BA 4FZXC 1YTAA 1NK9A 2FBTA 2LSNA 3SYZA 3F9KA 4WE1A 3SZ2A 2XY8A 3SV4A 1TKXA 4OJRA 1J9AA 4F4KA 1VSFA 4OKKA 1ASUA 4DTUA 2D0CA 4O0JA 4FJMA 1XWLA 3V1QA 1TL1A 3RMDA 4CIEA 3QNOA 1RBRA 4DFPA 1TAUA 4E0DA 3TWHA 2DFHA 1IKXA 3O3HA 3KLIA 3D45A 4OGEA 4KKOA 1UA0A 1RTJA 3WNEA 4CJWA 4IKFA 1RT7A 4KREA 3SPYA 4CF9A 3K5NA 1RBUA 4IG3A 1X9MA 3SUQA 5J1EA 3K59A 4KHSA 4JS4A 3LPTA 3EY1A 4AHCA 4CFAA 3V9WA 3VQ7A 3TR8A 3U6FA 2PYLA 1RT1A 4FW1A 4E7IA 3KLFA 3OYEA 3HVRA 1X9WA 4FM0A 3KK2A 3AO5A 1WNSA 3ZSYA 4HHTA 3VQ6A 2FC0A 3SNNA 2DFEA 2IOCA 5SZTA 2HHSA 5KRSA 4DF4A 1FKPA 1LWCA 1Y97A 1TGOA 2PYJA 4LSLA 4PY5A 4DSFA 4ZTJA 3V4IA 2D0BA 3MAQA 4E3SA 2DTUA 4CHOA 3MXMA 1RDAA 2RPIA 1HNIA 1JXBA 3IRXA 3VQQA 4ZTFA 1TK5A 3SCXA 1C0MA 4FJKA 3QEWA 3L2QA 3KLEA 4B8AB 4EZ6A 4YNQA 1VSMA 3QIOA 1NK6A 3AA5X 3OYHA 2EHGA 4DQRA 3QESA 4DFMA 4KHUA 4IBNA 4FZZA 5DMRA 5JS1A 1NK8A
chains in the Genus database with same CATH superfamily
1XNRK 1HYSA 3QMLA 3L2WA 3HBTA 3E9LA 1KTQA 4UQGA 1W2BM 3VQAA 4QS7A 3NVMA 4JI1K 4WCEL 4DR5K 4CERA 3EYZA 1TYQA 3JSMA 1JCEA 4A5AA 5F2RA 3VEYA 3CCSN 1C1CA 1I3AA 3MX5A 5AQWA 3LAMA 4K43A 3DXMA 5KI6A 3C6AA 5KPTA 2W41A 3DJCA 4OKJA 1M90O 2P9IB 3PO5A 2NRHA 4FLWA 5CY4A 3AY9A 4Y1DA 3L8BA 3ENOA 2YNFA 1VAZA 1IKYA 3C6UA 5LJVA 4RCHA 1YT3A 4CEFA 2UUBK 3AO2A 4CEDA 1RDUA 5DM7L 2NRTA 4FSVA 2O8DA 2JWLA 2KKZA 4LF9K 1L3TA 3ALYA 4OO1J 1KVAA 3HT3A 4FYDA 4CJ7A 1OH5A 1VSEA 2P51A 4CEAA 1NNEA 3P83D 2P9PB 2D0PA 2VG6A 3M1FA 3ZT3A 4B1UB 2UXBK 1E3MA 3MEEA 4FK0A 2KZMA 4WQ5A 1WSJA 3ENBA 4FWNA 4N5SA 5AZIB 3QNNA 1S5JA 4DTSA 3OVNA 4EHTA 5C10A 3OYNA 1QQNA 2IVNA 2OA8A 3VF2A 4Z4EA 4XH4A 1TL3A 2Q3SA 2XO7A 3HPOA 4M3UA 3SBTA 1WAJA 4CIGA 2X6NA 4DB3A 2E2PA 5C15A 1WAFA 3G25A 5TKYA 3OTOK 1EKEA 3DRPA 4C8NA 1NGDA 1T3VA 1JXEA 3SQ2A 2P5GA 2NRWA 2KFZA 3BZKA 4IG0A 3DOKA 2D1KA 3ZLJA 4J2AA 3O4NA 1K8AO 2XY6A 5DM6L 3M3ZA 3EO3A 4BR9A 1GLBG 4BRLA 2D0AA 4R5PA 1D9DA 2O8EB 4K8ZA 4BRPA 2A1SA 4CHZA 4MFBA 4IFVA 1A5XA 1QVFM 1BIZA 4FOEA 5AQFA 2E1ZA 3F9MA 1X9SA 1NJXA 1BCMA 3VQ8A 1R0AA 3VTIA 4PL7A 4FLUA 3SLCA 1UA1A 3JAMO 4DV6K 4FM2A 1GLCG 1L3UA 3HSTB 1V4SA 3VQBA 3PX4A 4JKBA 2ZQBA 1X3MA 4KH5A 5AQZA 4CZFA 2F9WA 1U45A 3MCPA 4EP4A 1FK9A 1H1VA 4L8RB 5HP1A 3EZ5A 3ZCMA 4DTNA 4TSXA 4F8RA 4BRFA 3QDKA 3WXMB 1CZ9A 4E7KA 1HUXA 5BPLA 5AQGA 3CC4N 3VESA 4CHQA 4M41A 3J80O 5KGWA 4GVEA 3U4LA 1FKOA 4XH1A 2F96A 1S9EA 3RR7A 3CM5A 4DQPA 3U9ZA 1S72N 3I8DA 2OPPA 4KO0A 4I6MB 4BRIA 4JK7A 1BQNA 4GNIA 4AQYK 3ZSOA 2HW3A 3BDPA 4X65K 4FJHA 1NGEA 1QE1A 4AHRA 3TU5A 2B4JA 4CHYA 1KD1O 2UUAK 2H3GX 3DLEA 3D2EA 4ILHA 4AF1A 3M8SA 1NKBA 3LP3A 4YORA 3HPHA 3VOVA 1KXPA 1S22A 4IEEA 4YOXA 4DQQA 4J2DA 2VWJA 2W6LA 2OTLN 1B9DA 4JKDA 5AQMA 3KKRA 3LM9A 2YJFA 3OYKA 1J54A 2FXUA 3K9JA 3AVJA 3UKUB 3C0BA 3NMUA 3H3OB 4CZEA 3TI0A 3V9ZA 2YHYA 3NCIA 4NCAA 3O9QA 4BRAA 1RBVA 5HRPA 1RDDA 3LDOA 4FJNA 1KVCA 3B8AX 3VQDA 3CF5L 2XY5A 1ATSA 2UXCK 3HM9A 5J2PA 3THWA 4WFNL 3DLRA 3JYTA 3BZCA 3SMSA 1YJWN 3MXJA 3L3UA 2HSTA 4FWMA 4DU3A 1RT6A 1BHLA 1JLCA 4H0VB 1SZ2A 3TAFA 3A5LC 3HJFA 4BR0A 1XNQK 1NLVA 1EWRA 2OPRA 3AGKA 5GAGP 4JI3K 1NKEA 4B3SK 2GUPA 1EO1A 4ICLA 4UY8O 3OBWA 4FJ7A 1C0UA 2Z1GA 2ITMA 4BC3A 3HZ6A 4RW6A 3DLHA 3CERA 2E5LK 4YOUA 3B6OA 4A2BA 1DLOA 1VSKA 3FFKB 2JWKA 4IJNA 4IJAA 2HBJA 3CC2N 2HF3A 4DSLA 1N34K 3HRGA 3RMAA 3E9PA 3QEXA 3THXB 3L2VA 1TK8A 1RDWX 4DMNA 2P9NB 2P9IA 1TK0A 4JI0K 4EAHD 5AR0A 4DR1K 4M42A 4FJGA 2G8FA 1TVRA 1C0GA 3B6PA 3CQXA 4BWMA 1S1UA 1MA9B 4I2QA 4CEBA 4DQIA 3G0ZA 1S1WA 4LF6K 3NDKA 3AGRA 3D7EO 3HM8A 3V9UA 4HUEA 5MLCQ 5LMNK 4FLXA 3H45C 5H1SQ 4M3ZA 1O13A 1JLGA 1ESVA 2GUIA 3ZSWA 4LD0A 1VSIA 3CCJN 3VEZA 1XQSC 1KRPA 4FJ8A 4JKHA 4ISFA 4JKCA 2J4RA 2QWNA 3DLBA 1NK0A 4J2BA 3C65A 5FROA 4B1VA 3DXMB 1CXQA 5AZIA 3ZT2A 4BROA 4CEQA 5ADXH 5JICA 2P5OA 1XHZA 3G6EN 4B1WB 2FBYA 4DV4K 2HMIA 3ULEB 1WSIA 4LY7A 3WUHA 4E7JA 4BDZA 3HTVA 1ILYA 3AVBA 5AQHA 4KHWA 3L2UA 1BI4A 2O8DB 3AVFA 1HYZA 3KZBA 1S6QA 4QAGA 5KQDA 3K9KA 3VPZA 2YHBA 3O3GA 4DSIA 2QEXN 4JK8A 4XIUA 4FWOA 2ZM6K 1VQON 2QKKA 3TSUA 1VQMN 4FJ5A 3LP1A 1EX4A 5HBMA 2QI2A 2HNZA 2O8EA 3CJAA 1ZBSA 1E4FT 4JNEA 4FWLA 3J81O 2XY8A 3FZHA 2HHHK 1GLDG 3CD6N 1VSFA 4FVUA 4OKKA 2ZF5O 4DTUA 4BRKA 4DUZK 3MCAB 1TAUA 4H5VA 4H5TA 3D45A 1D4XA 4M7YA 1UA0A 4CJWA 4IEIA 2WC9A 4CF9A 4KHSA 3DAWA 4JS4A 3EY1A 1YAGA 2O8BB 3U6FA 2PYLA 3BEXA 4CW7B 3PIPL 3OYEA 3HVRA 1X9WA 3KK2A 4HHTA 2FC0A 2IOCA 1WBDA 4ILGB 4DF4A 1FW6A 1FKPA 1Y97A 3EE9A 4DSFA 3BUZB 1NGHA 3V4IA 4ZTJA 4GV9A 1N33K 1YITN 1RDAA 4BC2A 3RSEB 4B8AB 4YNQA 4I6MA 5EOYA 2ASPA 4FWQA 4KHUA 3QESA 4CZMA 1ZC6A 5DMRA 5JS1A 2W6KA 5EY4A 1T05A 3AV9A 4IFYA 1YHQN 4IDHA 1LV5A 3LL3A 4FWPA 4NCGA 2G8UA 2V52B 4CEEA 3KLHA 3DWLA 5CYMA 2HF4A 2Y1JA 2HVIA 3ZT0A 2UXDK 5BN9A 1QQCA 4X64K 4DSJA 1X1PA 1Q86O 3PUFA 1BCOA 3K5LA 4FJJA 3OYDA 4W5OA 5CR4A 4ELTA 1CLQA 1NK5A 3P31A 5FRMA 2NRRA 2V7ZA 3NE6A 4DR6K 2P9SB 4WQ4C 5HL7L 3AO3A 1K8KA 4EP5A 2G8KA 4OPKA 3CJ7A 2DPNA 3KD1E 4K8XA 4NYFA 3LWMA 4KHYA 2Q36A 4CJLA 1YXQA 4CJRA 4PKIA 3C94A 4BG9A 1K9MO 1KFSA 3M6GA 5JLFA 3DMJA 4CF8A 1IKWA 4DS5A 1U2VB 2FSJA 4CZGA 5M1NA 5AQXA 4BRMA 3CPWM 3H1VX 3J7AP 4B3RK 3ZSQA 4BDPA 1IBKK 3SUNA 3CXCM 5BPMA 3FZMA 4PQUA 2CH5A 3OYCA 2CGLA 2VYPA 4HTUA 1VQLN 3WXKA 3N4PA 4JK9A 1HJRA 2CGKA 3NH2A 3O80A 4FK2A 3QICA 4GMJB 1DEJA 2PFUA 4N76A 3ITHA 5E84A 2GBZA 4LH4A 3ZETA 5FRNA 3R1XA 2HNDA 3N4QA 3FZLA 3TSQA 4HUGA 3C6TA 2RE2A 4M7XA 4CVNE 1VQNN 4MLHA 4PHTX 4KTZA 4KFBA 1UAXA 1HKGA 3D0PA 2O4GA 4IFEA 4BE0A 4CF1A 1ZBUA 4CHPA 2QXFA 1LWEA 3TARA 2P9NA 3TAMA 1ASVA 4DTRA 3P39A 3ZSZA 4PA1A 4BRGA 3O1WA 5E41A 4J2EA 3WXJA 3MX2A 3M8RA 4I9QA 4B9UA 4O0IA 1T8EA 5D3GA 2UUCK 4O44A 4DFJA 2KZZA 3I0RA 1RTDA 3VQEA 1BDGA 4CI6A 5DK5A 1ZXOA 4CZLA 1VQ5N 3NBPA 3OYJA 2QWQA 1OH6A 3DXKB 1SL0A 4U67L 2OPSA 3AAPA 4FWKA 1LOTB 1JLFA 4DKWA 2HBLA 2E2NA 3HOSA 4Z4IA 1ASWA 3DRRA 3QB0A 1HRHA 1BG3A 3S3OA 4JKFA 5JVGL 2YJEA 2JLEA 3W0LA 4YOTA 4FLVA 4FJXA 1HKCA 1E4GT 5FPNA 4W5QA 3QLHA 3VTHA 1KLMA 4KV8A 3ULEA 2XY7A 4FZYA 4BC5A 3SBGA 1WSEA 1ZBFA 2FBVA 2FF3B 2AP1A 3WNGA 1TKDA 2BANA 1YTUA 1J5OA 4M3XA 2VG7A 4CJQA 3KIOA 4FK4A 1SL1A 2F8TA 3M5RA 4CK3A 2ASOA 4CGDA 3IDHA 1RDBA 4O8UA 3D2FA 4B1ZA 1WSFA 1Q18A 3NH1A 1Q9YA 3AVLA 3VA0A 1VQKN 2HHVA 4KI4A 2VG5A 1NM1A 2P9UA 3TTDA 4DR4K 4JI4K 4C1NK 3CMEN 4L3QA 4F2RA 4BRHA 4QS9A 1JCFA 1VSLA 1SL2A 3EZWA 1MDUB 3TTCA 4B9LA 3DRSA 3HL8A 3PY8A 3SAHA 3WT0A 1TV6A 4IDKA 3V81A 2A6AA 5AQPA 1BI4B 2Q0RA 5LL6Z 3A5NC 2O8BA 2ITGA 4IOXA 2QM1A 1ATNA 1NGAA 4IWVA 3DYAA 1SKRA 1RCHA 2KW4A 3T1HK 1NGFA 3G71N 2ETJA 4E7HA 2Q97A 1NJWA 1BIUA 5FPMA 3E01A 3RSEA 4A62A 3IAYA 1X3NA 5EX5A 4BRNA 3ZYYX 3V1RA 1HNVA 1WBBA 1Q81O 3LPUA 4Y1CA 2RN2A 2FF6A 1G99A 1WN7A 3EL2A 4B9SA 4FVMA 1A5WA 3F2KA 3S9HA 4I2PA 3WNHA 3FZFA 1NOZA 2EX3A 2CGJA 5I9EB 1HQUA 2I5JA 4O8KA 4GV6A 2BDPA 1NGIA 1K73O 4BQZA 1NBWA 4LF4K 4IO8A 3MWTA 3L4IA 3DLKA 5EVZA 4CGIA 2RF2A 3MECA 2P9SA 4O4GA 3C7NA 4BRDA 2HVHA 5C12A 1IH7A 4JRQA 2KLAA 4DTJA 1Z6RA 3MN5A 4RWTA 4JKEA 1CZAN 4B9VA 3AO1A 3ID8A 3R6MA 1BOTO 2E2OA 1BL3A 3VQ4A 2D5RA 4CESA 1C0TA 2OPQA 3HYFA 1XC3A 4DU4A 1U2VA 2WBNA 3AVNA 4LFAK 4FJ9A 2YKMA 4I9LA 4IZ9A 5BREA 4DTMA 4DLGA 2NLXA 2Q2RA 2I7NA 1N6QA 4A57A 4AHVA 1LWFA 3MN6A 3ULDA 1J6ZA 2A1RA 3THYA 5FDLA 1T7PA 4EHUA 1VQ4N 1WSGA 1NMNA 1J53A 3CI5A 4O5BA 1K8KB 4CJ5A 1QSLA 2OYQA 4CE9A 4KH4A 3BF3A 3SAFA 3OS2A 3ZSRA 5ADXA 2ZWHA 5CYQA 4DSEA 4H0YB 3CCMN 1B92A 3RVCA 3CFPA 1BO5O 4CJFA 4W5RA 3AA3A 5M1QA 2BUPA 3OJUA 4KHQA 2W42A 2OANA 1FXXA 1I39A 1Z26A 5CZ2A 4Z4CA 4CEZA 5AQIA 2PBDA 3A2FA 5K14A 3ASMA 4FJLA 3WXIA 2BH1A 5T7BA 2P9KA 2I7PA 3QEVA 4FZXC 4WFBL 2G8HA 1U4BA 4YDUC 2LSNA 3SYZA 4JV5K 3F9KA 4H5RA 2E88A 3SV4A 2AA4A 4OJRA 1XUPO 1ASUA 4LF7K 4FJMA 3GL1A 1TL1A 3IUCA 4CIEA 4DFPA 3J8AA 3TWHA 1IKXA 4KREA 1RTJA 3WNEA 3ZETB 2RHKA 3K5NA 1RBUA 4IG3A 3SUQA 5J1EA 3K59A 2VCPA 3LPTA 3DXKA 2UYTA 4AHCA 4A61A 3V9WA 3TR8A 2FSKA 4DV3K 1HJOA 1OVYA 4E7IA 3QFUA 3SNNA 2DFEA 5SZTA 2HHSA 5KRSA 1TGOA 2GX9A 2D0BA 3E66A 3MAQA 2GTDA 2W40A 3FR0A 3IRXA 4ZTFA 1TK5A 1C0MA 3L2QA 3KLEA 1VSMA 2A41A 3QIOA 3AA5X 3H1QA 2EHGA 4DQRA 2P9LB 4DFMA 3EN9A 3QBWA 1JCGA 3SJHA 4CFBA 3RTVA 3CC7N 4AM7A 4CFDA 3OBYA 1HLUA 1WOQA 4FO0A 4CJKA 2KTQA 2QK9A 2WOMA 3NGZA 4BE2A 1L3SA 4HWIA 3CG7A 3VERA 4OPJA 5BR8K 1LCUA 4CGGA 3QETA 2AJQA 4XH5A 1RGIA 3VMFB 1JJ2M 3O8MA 4CJ4A 3SK3A 1N5YA 3LAKA 3ZT1A 2F8SA 3O9UA 2NNWA 1RT5A 4KBOA 1EETA 2OCEA 1NU0A 4JI2K 1U48A 3V6DA 1TUYA 1QQOA 1IG8A 2NRVA 3GG4A 3TAEA 1T6DA 4JAXA 1QVGM 1SV5A 3O9TA 3A5MC 4OPAA 4CECA 5BPNA 4DR7K 2E6MA 3L6QA 1D9FA 4FM1A 4YOVA 4CJTA 3AVHA 4CBXA 1NOYA 3OYLA 4CGFA 4KI6A 3CCRN 2QWRA 4KAZA 5J2MA 3KK1A 4XEIA 4KPYA 3D6RA 3T1YK 3G10A 3PV8A 4K41A 1YVUA 3MWPA 1HNXK 3WQUA 4NB4A 4M63C 2UU9K 3AO4A 1S1XA 3SAGA 3OS0A 2VWBA 3GOIA 4AM6A 4AH9A 3D2FB 5JLHA 3SPZA 1HR0K 4RTFD 4CEOA 1ZBIA 4GKKK 5M1PA 4OGCA 3KLGA 1T44A 3CPEA 4N41A 2G8IA 4QOZB 2P9UB 3HOTA 2ZE2A 5M1KA 1VSJA 4H0PA 4K42A 4KB0A 4Z4FA 5C42A 1P8ZA 4BVOA 4AHUA 5GINA 3VEWA 2QA4N 3RRGA 5LJWA 3O9RA 2WONA 4DR3K 4MDAA 1NGGA 4BGBA 2KFNA 3HK2A 4BQLA 2G8WA 3LZIA 4LFBK 4H03B 3ZEUA 3M8PA 2F7TA 4CBUA 4C1NI 5GADP 3O4QA 1KFDA 4OVLA 4DV0K 4H4MA 1Q9XA 4CIFA 3KK7A 1QSSA 3RRHA 1DTQA 4YFUA 5B8HA 4LH5A 4DV1K 2IC3A 4CD1A 2V51B 1R59O 3NF8A 1YVNA 4RW8A 1NJZA 3A5OC 2QWOA 4DCHA 4B9MA 1WB9A 4DQ8A 4X66K 1S6PA 3GE1A 1O1WA 1Q7YO 5SWMA 3VQ9A 2EWSA 3U9DA 1JLQA 1QZ6A 1VK0A 5JVHL 4J8FA 1KC8O 5TKWA 2B6AA 2E6LA 3ID6A 4EIAA 1U6ZA 2XHBA 5I42A 4W5TA 4KH6A 3KWGA 4Z0UA 2PY5A 3HXMA 2B5JA 4GW6A 4BG8A 3GBTA 3CCUN 3RWUA 3ISNC 1G15A 4B8CA 1KAYA 5BRDA 5AQTA 3OYMA 1GOAA 3S41A 3RMCA 1GLLO 2IS3A 4CGHA 4ID1A 3QEIA 1EXQA 1YJ9N 3C7NB 1ITGA 4DTXA 5HRSA 3CQYA 1XC9A 3IG1A 3K58A 1W97L 4CD3A 2A5XA 1QTMA 4C8MA 2FSNA 3OJSA 1GLFO 2O8FA 3K5OA 3DLGA 5C25A 4BDYA 4ID5A 5C2DA 1T03A 2HHUA 5BRHA 1IG9A 4B3OA 3NHGA 3C6HA 5EU7A 1UWBA 3VGLA 2QKBA 3UE5A 3WEEA 1ZBHA 1GLJO 3L4QA 4U7BA 3NGYA 1VRTA 5J2NA 1SAZA 2KQ2A 4B08A 2Z1HA 1WLJA 3SV3A 5BRFA 3L2RA 5F0XA 3T69A 1LAWA 4MQ3A 3THYB 4YHHK 3CCVN 3KKSA 4ELVA 2D0OA 4RW7A 1IBMK 4CF0A 4DF8A 4B3MK 4WQ4A 1RFQA 3K57A 4MO4A 3VGMA 2QWMA 1WUAA 4DSKA 1X9JA 3NF6A 1Z25A 1BISA 4KRFA 4CJ3A 1W0HA 3MN7A 3PIOL 2QTDA 1QSYA 3FE1A 2OZSA 3CFRA 3LALA 4ELUA 3NH0A 4NXMK 3TANA 4O5FA 2P9KB 5AJ3K 4NLBA 5HROA 3HPGA 3MN9A 2NUBA 4A2AA 3H46O 3CCQN 4PUOA 1XHXA 4HUFA 4H5WA 5AQYA 3SMPA 3VGKA 1NG9A 2P9LA 1RT2A 4B1XB 1RTIA 3SJJA 3NFAA 4NYNA 5AQUA 3KTQA 3KD5E 3KK3A 1BQMA 3A0IX 5IT9O 4PKGA 3NVKA 4Q5VA 4V19S 3BGRA 5ELZA 3MEDA 2PZSA 3O1BA 4Z4HA 3T3FA 2NRZA 3TPQA 1RTHA 2JGUA 2YHXA 1B9FA 4E19A 2HHWA 3ZX2A 5AFUH 5LY3A 3CYMA 4BREA 1EWQA 4H5NA 5KPRA 3DI6A 1JLBA 4CF2A 4BRQA 3OYFA 3A8YA 1GOBA 3IKMA 2E20A 1TKTA 4YOWA 4MDBA 4JHDB 4WQ5C 3H3NO 3SUPA 4B9QA 5CHIA 4FJIA 1OH8A 2VQFK 1BA1A 4M3RA 5JS2A 4E1NA 1NK7A 4DR2K 4OX9K 4KB1A 3MK6A 4EZ9A 1U49A 4LSNA 4JRPA 4OPHA 3JS6A 3LWLA 5AQJA 1TUUA 1NWKA 3K5MA 2QW9A 1C0FA 2PAVA 3THVA 4CJEA 3VA3A 4JKGB 4FCYA 3LDLA 3S3NA 1EP4A 4CCHA 4E1MA 1JL1A 1RNHA 3HI0A 2QWLA 4KHNA 3BY5A 4GV3A 1D5AA 5HOOA 1YJNN 2E8AA 4YY3K 4FL9A 4OLBA 4CJUA 2HOEA 2QXLA 4CFCA 3VN5A 4X62K 4F3TA 2Q31A 3IS9A 2ZGZA 2E2QA 2NRXA 1NGBA 3QO9A 3SQ1A 5M1OA 1S9GA 2ZD1A 3TABA 3ENHA 3OYAA 4DWIA 3TAQA 1Q8IA 1S3XA 1UOCA 1QZ5A 2IVPA 2GWJA 3OW2M 4QCLA 3ZX3A 4CGJA 4FW2A 3JXUA 4NCBA 1SUQA 4DLEA 4BR7A 4LC9B 2YV0X 4BVPA 1HPMA 1VHXA 4CBWA 1NK9A 2FBTA 4PKHA 1N8RO 4E1JA 3SZ2A 1TKXA 4DV7K 3EE8A 1XWLA 3MDQA 3MMVA 4HTLA 3T7ZA 1RBRA 4E0DA 3UB5A 2NZTA 3O3HA 3E1YA 4IKFA 1RT7A 4A5BA 2CH6A 4CZHA 1X9MA 3G4SN 1J5EK 4JI6K 3VQ7A 3Q7BA 4BC4A 4PL8A 5C2FA 3ZSYA 3VQ6A 1VQ7N 2PYJA 3PSIA 1OH7A 4LSLA 3ZEUB 3Q7CA 4E3SA 4NO7A 1BUPA 4DUYK 3MXMA 3CJCA 1HNIA 1JXBA 2YHWA 3VQQA 3SCXA 1BU6O 5BR9A 1NK6A 4FOIA 3VENA 3WQTA 1NMDA 5M1FA 1I94K 1VQ6N 4JD2B 1NK8A 3J7YP 1W9HA 4O55A 4AILC 4DTOA 1IV0A 3LM2A 3CCEN 4JI8K 4C23A 4DTPA 4KTQA 1IJJA 3P1GA 2Z1JA 4BGAA 3V1OA 4W5NA 4DV2K 3CJBA 3ZT4A 2R7YA 2F9TA 5F1XA 2YNIA 4ISGA 3QERA 3SUOA 5FLXO 1IKVA 4RW4A 5CE3A 5KTQA 3ZSXA 4DQSA 2FBXA 3FFIA 5KRTA 1QS4A 3W3DA 3OYGA 3LDSA 2O8CB 4K0KK 1VQPN 1SQKA 2OZMA 5AZJA 3SQ4A 3CM6A 3UKRB 3NGIA 2E4LA 3WNFA 2Z1IA 3F5TA 1RDCA 3O6WA 3OA9A 3HSCA 1VQ8N 4FPBA 3CIPA 1IO2A 4YOYA 2WTUA 3PX6A 4M3YA 1DGKN 5CZ1A 1BGXT 4GKJK 3T19A 1BWFO 3LP0A 3QIPA 2A42A 2O8FB 3LDNA 3S3MA 3EEQA 1JLEA 3O4WA 3QBXA 3U8XA 4JYAK 1KVBA 3WEEB 3KJVA 4E7LA 3I8BA 3K0SA 2E1YA 1ATRA 4EFHA 1LW2A 3P38A 4WFAL 5AQOA 2WUSA 1LW0A 5A2QO 3OHRA 3LDPA 3VQ5A 2ASMA 4CJSA 2Q1NA 3ZX0A 1XMQK 1CZBA 4N56A 4ILJA 5KPZA 2D4WA 4PWDA 2YCHA 3O9SA 3IMXA 3E9OA 4DG1A 4B9TA 5IWAK 1SS6A 1HPZA 3V9SA 1YUWA 4AHTA 3OS1A 1N32K 2X6SA 3SQ0A 3TSPA 4FXDA 1HQEA 3VF6A 1HX1A 3VF4A 1SKWA 2XRIA 3MEGA 1GLAG 2HHTA 4OLAA 3ZSVA 3AVMA 3VEVA 3LZJA 1HNZK 1KQSM 4N47A 3VEOA 2DFFA 2V7YA 1T6CA 2VGNA 1RT4A 2BTFA 1M1KO 2YHAA 5HRNA 4B3TK 1SKSA 3VQCA 4K25A 4OKEA 3H6EA 4H0XB 3L3VA 4JLHA 5KGXA 4BE1A 2X74A 3PO4A 1NGJA 1NK4A 3K2PA 4YDUA 3AARA 3IFRA 1C1BA 2HMPA 5E26A 3TTFA 3WXLA 3U3GA 4JHDA 3KVGA 3M8QA 5AQVA 4KTWA 2X78A 4MLEA 2RKIA 4B1YB 3HO1A 4LF5K 4H0TB 3DOLA 4JN4A 3R9PA 1HMVA 2HNYA 2IIRA 4FLZA 1KAXA 2Y1IA 2GEMA 1KSPA 4JKGA 3CCLN 4BR5A 3P5JA 4QS8A 4CZJA 2HHQA 2BE2A 1C1AA 1W7AA 5AQLA 4GVMA 3AVAA 3KWIA 3FZKA 5J2QA 3I55N 5HLFA 2P1JA 1S1VA 2P9PA 3VQPA 3GDQA 1TYQB 4HCCA 3EKSA 4AHSA 1WSHA 3RMBA 3I0SA 4FWRA 3NF9A 4BR2A 1OKJA 2KHOA 1REVA 2A40A 2ATQA 1K6YA 4BRCA 2Q0UA 2G8VA 2DY4A 2GV9A 5FPEA 3VETA 2O4IA 3AA4A 3FGUA 5GIOA 3R3LA 3BF1A 4MO5A 1QHAA 5HRRA 5GAHP 5KQ8A 1DKGD 4M3WA 3QINA 3T1AA 1BA0A 4DU1A 1L5UA 3H08A 1HYVA 2IDOA 5I3UA 3AVGA 1GLEG 2YNGA 4ISEA 4CK2A 3DLLL 4CJVA 4GY2B 1N36K 4G9ZA 2HB5A 3ATUA 5AQRA 1MWMA 1XMOK 1TAQA 5C0YA 5LMUK 1F21A 4LFCK 4FLTA 1VSHA 4IOAL 1VSDA 3NF7A 1D8YA 4CZIA 4JKAA 4B9NA 4M45A 1QHTA 3U3YA 4JI7K 4FWSA 5BN8A 4I7FA 3LANA 4F2SA 4JD2A 4DS4A 1Q82O 2WFBA 4WYBA 3NAEA 4F3OA 1U04A 1C6VA 1MU2A 3CMAN 5C24A 1TKZA 5FPDA 2ZJRL 5GAEP 4BR4A 1S1TA 3UIQA 3I56N 1DT9A 1QQMA 1NJYA 4C8LA 2YNHA 1YIJN 1HKBA 4ZHRA 3PX0A 2YI1A 5GIPA 1IBLK 3O08A 4FLYA 1YF5L 3AAQA 5AQSA 3BP8A 2HBKA 1JL2A 1Z05A 1KLNA 5AQNA 3O3FA 4CK1A 3QFPA 2O8CA 3LP2A 1P90A 1JLAA 3UKRA 3LDQA 4H8KA 3FLCO 2IGIA 5AFUA 3L0QA 4JS5A 2VWKA 4RW9A 3SI6A 3AVCA 3RR8A 4Y0WA 3OYIA 1RBTA 1DTTA 2ZGYA 3AVIA 2HBMA 3CJ9A 3CFOA 4IOCL 1MWKA 1ZYQA 4LF8K 2OTJN 1LAVA 1CXUA 4DFKA 1EQYA 1U47A 1VRUA 1V4TA 2QWPA 3C95A 4G1QA 4CHNA 1YI2N 3AVKA 1HNWK 1L3VA 3EKUA 3OYBA 2DTUA 1JKHA 1A5VA 3QEPA 3TAGA 4Z94A 1ZBLA 2ZJPL 3DM2A 4A59A 4HCBA 4NLCA 3AA2A 3P4IA 5JMVA 3UKUA 3HP6A 4FPAA 3HP9A 1XI1A 4CJPA 4NXNK 1GOCA 3MXIA 5AZJB 2IAJA 4M3TA 3F73A 3V9XA 5AQQA 4JI5K 2VQEK 2HHXA 4BWJA 1FJGK 4HVJA 3ATVA 1NKCA 5EXWA 4RG8A 1OVQA 4Z4GA 2GWKA 4BY9C 2FLOA 1RBSA 4C8KA 1RILA 3TAPA 4E89A 2YKNA 3D2EB 4H4OA 4Q0BA 1RT3A 1KCFA 4BACA 2YX6A 4IO9L 2BGGA 3HVTA 1NGCA 3I33A 3OY9A 4H0OA 3CQ8A 4C8OA 4IXCA 1YTAA 1VQ9N 4F9OA 4WE1A 2ZJQL 4CZKA 4WF9L 1J9AA 4F4KA 3O5BA 2D0CA 4O0JA 4JEPA 2IVOA 3V1QA 4R79A 4KHPK 3RMDA 3CETA 3QNOA 4DHYA 2DFHA 3KLIA 4OGEA 4KKOA 4DV5K 3SPYA 3VEXA 1NJIO 3PLAA 3R8EA 4CFAA 3J7ZO 3THWB 1RT1A 4FW1A 1KAZA 2A3ZA 3KLFA 3THXA 2VGMA 4FM0A 3AO5A 1WNSA 3CJ1A 3PSFA 1LWCA 4PY5A 1Y64A 5AQKA 3CHWA 4CHOA 2RPIA 4FJKA 2GELA 3QEWA 4EZ6A 2F4VK 3KHYA 3OYHA 4FZZA 4IBNA
chains in the Genus database with same CATH topology
3RTVA 4CFBA 1T05A 1HYSA 3AV9A 1W9HA 4IFYA 4O55A 3L2WA 4AILC 4DTOA 1LV5A 1KTQA 4CFDA 4UQGA 4NCGA 3VQAA 2G8UA 4DTPA 4CEEA 4KTQA 3P1GA 3KLHA 4CJKA 2Z1JA 4CERA 5CYMA 3EYZA 2KTQA 3V1OA 4W5NA 2Y1JA 2WOMA 3JSMA 2QK9A 3NGZA 2HVIA 4BE2A 3ZT0A 1L3SA 3ZT4A 1QQCA 3CG7A 4OPJA 4DSJA 1X1PA 2R7YA 1C1CA 1I3AA 3LAMA 2YNIA 3PUFA 1BCOA 3K5LA 3QERA 4CGGA 3OYDA 3QETA 3SUOA 4FJJA 2AJQA 5KI6A 4W5OA 4ELTA 1IKVA 4RW4A 5KTQA 3ZSXA 4DQSA 4DSIA 1CLQA 4CJ4A 1NK5A 4OKJA 2FBXA 3FFIA 1N5YA 5FRMA 5KRTA 1QS4A 3LAKA 3PO5A 3NE6A 3ZT1A 3OYGA 4FLWA 2F8SA 5CY4A 3LDSA 3AO3A 4Y1DA 1RT5A 4EP5A 3L8BA 2OZMA 1EETA 2YNFA 1U48A 3V6DA 3SQ4A 3CM6A 2G8KA 1IKYA 3C6UA 3NGIA 2E4LA 4OPKA 3WNFA 3TAEA 1YT3A 3KD1E 4K8XA 2Z1IA 4NYFA 3LWMA 1RDCA 4CEFA 1SV5A 3AO2A 4CEDA 4KHYA 4CJLA 4CJRA 4CECA 2E6MA 1D9FA 1IO2A 1L3TA 3C94A 3ALYA 4FM1A 3PX6A 4M3YA 4CJTA 3AVHA 1KVAA 1KFSA 3HT3A 5CZ1A 4FYDA 3DMJA 4CF8A 1BGXT 1IKWA 1VSEA 2P51A 3T19A 4CEAA 4CGFA 3OYLA 4DS5A 3P83D 3LP0A 4KI6A 3QIPA 2VG6A 4KAZA 3ZT3A 5J2MA 3KK1A 4KPYA 3S3MA 3G10A 3MEEA 3PV8A 3ZSQA 4BDPA 4FK0A 1JLEA 3SUNA 2KZMA 1YVUA 1WSJA 4N5SA 4PQUA 1KVBA 3OYCA 3KJVA 3QNNA 1S5JA 4HTUA 4DTSA 4E7LA 3OVNA 3AO4A 1S1XA 3OS0A 1LW2A 3OYNA 1HJRA 2OA8A 4Z4EA 1ZBIA 4AH9A 3NH2A 3SPZA 4CEOA 1TL3A 2Q3SA 1LW0A 4FK2A 4GMJB 2XO7A 3HPOA 4M3UA 4OGCA 3KLGA 3VQ5A 4CJSA 4N41A 2G8IA 4N76A 1CZBA 3ITHA 4QOZB 4N56A 1WAJA 2GBZA 4LH4A 2ZE2A 2X6NA 4CIGA 5FRNA 4PWDA 1VSJA 1WAFA 4KB0A 2HNDA 5C42A 4Z4FA 1EKEA 4DG1A 3DRPA 4AHUA 4B9TA 4C8NA 3RRGA 1HPZA 3V9SA 4AHTA 2WONA 3OS1A 1JXEA 2X6SA 3C6TA 4HUGA 3SQ2A 3SQ0A 2P5GA 2KFNA 3HK2A 2KFZA 4FXDA 1HQEA 4KTZA 2G8WA 4KFBA 3LZIA 1UAXA 1SKWA 4IG0A 3DOKA 3D0PA 2XRIA 2O4GA 4J2AA 3O4NA 3MEGA 4BE0A 2XY6A 4CF1A 3M8PA 2HHTA 1ZBUA 1KFDA 3O4QA 2D0AA 4CHPA 4OLAA 4OVLA 2QXFA 3ZSVA 4R5PA 1LWEA 3TARA 4H4MA 3AVMA 3LZJA 1Q9XA 1D9DA 4K8ZA 4CIFA 1QSSA 3TAMA 4DTRA 1ASVA 3RRHA 3ZSZA 2A1SA 1DTQA 2DFFA 4PA1A 4LH5A 4N47A 4CHZA 4YFUA 4MFBA 4IFVA 1A5XA 2IC3A 1BIZA 1RT4A 3NF8A 5E41A 4J2EA 2YHAA 5HRNA 4RW8A 1X9SA 1NJXA 1BCMA 3VQCA 3VQ8A 4OKEA 1NJZA 1SKSA 1R0AA 3M8RA 4FLUA 3L3VA 4JLHA 5KGXA 1UA1A 4B9MA 4I9QA 4FM2A 4BE1A 2X74A 1L3UA 3PO4A 3HSTB 1S6PA 4O0IA 1NK4A 3K2PA 3VQBA 1T8EA 4B9UA 5D3GA 1O1WA 3PX4A 1C1BA 4O44A 4DFJA 2KZZA 3U3GA 3I0RA 2ZQBA 5SWMA 1RTDA 3VQ9A 3VQEA 1U45A 5DK5A 3M8QA 3NBPA 1JLQA 3OYJA 4KTWA 1VK0A 4EP4A 2X78A 1FK9A 1SL0A 2B6AA 2E6LA 2OPSA 2XHBA 2RKIA 5I42A 4W5TA 4L8RB 3HO1A 4Z0UA 5HP1A 3EZ5A 2PY5A 3ZCMA 1JLFA 4TSXA 3HXMA 2B5JA 3DOLA 4GW6A 4DTNA 4F8RA 3RWUA 1HMVA 2HNYA 3ISNC 1CZ9A 4E7KA 1G15A 4FLZA 4Z4IA 4B8CA 2Y1IA 1ASWA 3DRRA 3OYMA 1KSPA 1HRHA 4CHQA 4M41A 1GOAA 5KGWA 3S3OA 3RMCA 2P5OA 3P5JA 1FKOA 2F96A 1S9EA 3RR7A 2IS3A 2JLEA 3CM5A 4ID1A 4CGHA 3QEIA 1EXQA 4DQPA 3I8DA 4FLVA 2OPPA 4KO0A 4FJXA 2HHQA 1ITGA 4DTXA 5HRSA 4W5QA 1XC9A 3IG1A 3QLHA 3K58A 2XY7A 1KLMA 2BE2A 1C1AA 4KV8A 1BQNA 4FZYA 3ZSOA 1QTMA 4C8MA 1WSEA 3AVAA 4GVMA 2HW3A 5J2QA 1ZBFA 2FBVA 3OJSA 2P1JA 5HLFA 3BDPA 4FJHA 1QE1A 3WNGA 4AHRA 1S1VA 2B4JA 3VQPA 4CHYA 1TKDA 1NOYA 3K5OA 3DLGA 5C25A 4BDYA 4HCCA 4ID5A 2BANA 4AHSA 1YTUA 1WSHA 3RMBA 3I0SA 1T03A 3NF9A 2HHUA 1J5OA 1IG9A 4B3OA 4M3XA 1REVA 2VG7A 2ATQA 4CJQA 3KIOA 1K6YA 3NHGA 4FK4A 5EU7A 2G8VA 2DY4A 1UWBA 3DLEA 2GV9A 2QKBA 1SL1A 1ZBHA 3M8SA 1NKBA 2F8TA 3LP3A 3HPHA 4CK3A 4DQQA 2O4IA 3NGYA 4CGDA 4J2DA 1VRTA 3AA4A 5J2NA 2VWJA 2KQ2A 4B08A 2Z1HA 1RDBA 1WLJA 3SV3A 5HRRA 1WSFA 3L2RA 1B9DA 3NH1A 1Q9YA 4M3WA 3AVLA 3QINA 1LAWA 4MQ3A 3KKRA 3T1AA 3VA0A 4KI4A 2HHVA 4DU1A 2VG5A 1L5UA 3H08A 1HYVA 3KKSA 3OYKA 4ELVA 1J54A 2IDOA 4RW7A 5I3UA 3AVGA 4F2RA 3AVJA 2YNGA 4CF0A 4DF8A 4CK2A 3TI0A 3V9ZA 1VSLA 3NCIA 4NCAA 4CJVA 3K57A 1SL2A 1RBVA 5HRPA 2HB5A 4DSKA 4B9LA 3DRSA 1RDDA 3HL8A 3PY8A 3NF6A 4FJNA 1KVCA 1TV6A 1TAQA 1Z25A 1BISA 1F21A 4IDKA 3VQDA 4FLTA 3V81A 4KRFA 4CJ3A 1BI4B 2XY5A 3HM9A 5J2PA 1W0HA 2ITGA 1VSHA 3DLRA 1VSDA 3JYTA 1QSYA 3NF7A 2OZSA 3CFRA 3LALA 3DYAA 4ELUA 1SKRA 1RCHA 3NH0A 3MXJA 2KW4A 3L3UA 3TANA 1D8YA 2ETJA 4CCHA 4B9NA 4E7HA 4M45A 4DU3A 5HROA 3HPGA 1NJWA 2NUBA 1BIUA 1QHTA 1RT6A 3E01A 3U3YA 1BHLA 1JLCA 4PUOA 1XHXA 4HUFA 3TAFA 3IAYA 3HJFA 3V1RA 4I7FA 1HNVA 2OPRA 1RT2A 3LANA 3LPUA 1NKEA 4F2SA 4DS4A 4Y1CA 4ICLA 2RN2A 4FJ7A 1WN7A 1C0UA 1RTIA 2Z1GA 3SJJA 3NFAA 4NYNA 3NAEA 4B9SA 4F3OA 1U04A 4RW6A 1C6VA 4FVMA 1A5WA 1MU2A 3DLHA 3S9HA 4I2PA 3WNHA 5C24A 1TKZA 3KTQA 1NOZA 2EX3A 3KD5E 3B6OA 3KK3A 1DLOA 1VSKA 1BQMA 1HQUA 1S1TA 2I5JA 3UIQA 4Q5VA 2BDPA 3BGRA 1NJYA 4C8LA 4DSLA 2YNHA 3MEDA 2PZSA 4ZHRA 4Z4HA 3PX0A 3RMAA 3T3FA 3QEXA 3L2VA 1RTHA 2JGUA 4FLYA 1TK8A 3DLKA 1B9FA 4CGIA 4DMNA 4E19A 2HHWA 2RF2A 1JL2A 3MECA 1TK0A 1KLNA 3O3FA 4CK1A 4O4GA 3CYMA 2HVHA 1IH7A 3LP2A 4JRQA 1JLAA 4FJGA 4DTJA 4M42A 3DI6A 2G8FA 1TVRA 3B6PA 1JLBA 4BWMA 4CF2A 1S1UA 4I2QA 4CEBA 4DQIA 3G0ZA 3OYFA 1S1WA 4B9VA 4H8KA 1GOBA 3NDKA 3AO1A 2IGIA 1TKTA 3V9UA 4JS5A 4HUEA 1BL3A 2VWKA 4RW9A 3VQ4A 2D5RA 4CESA 4FLXA 3SI6A 3AVCA 1C0TA 2OPQA 3HYFA 3SUPA 4M3ZA 3RR8A 1JLGA 2GUIA 4DU4A 3ZSWA 4LD0A 3OYIA 1VSIA 1RBTA 4FJIA 3AVNA 4M3RA 1DTTA 5JS2A 4FJ9A 4E1NA 1KRPA 3AVIA 3CFOA 4FJ8A 1NK7A 2YKMA 4I9LA 1ZYQA 4KB1A 1LAVA 4DTMA 4LSNA 1CXUA 4JRPA 4DLGA 1U49A 4DFKA 1NK0A 3DLBA 4J2BA 5FROA 1N6QA 3LWLA 1VRUA 1U47A 4AHVA 1CXQA 3K5MA 3C95A 1LWFA 4G1QA 4CHNA 3ULDA 3ZT2A 3THVA 4CJEA 3AVKA 2A1RA 1L3VA 3VA3A 4CEQA 4FCYA 5FDLA 3OYBA 3S3NA 1JKHA 1A5VA 1EP4A 4E1MA 1JL1A 3TAGA 3QEPA 1XHZA 1T7PA 1RNHA 1ZBLA 3DM2A 4HCBA 1WSGA 3AA2A 4KHNA 3HP6A 3HP9A 1XI1A 1D5AA 1J53A 4O5BA 4CJ5A 2FBYA 4CJPA 1QSLA 2OYQA 1GOCA 4CE9A 3MXIA 4OLBA 2HMIA 4M3TA 2IAJA 3F73A 3V9XA 3OS2A 1WSIA 3ZSRA 4BWJA 4CJUA 2HHXA 5CYQA 4LY7A 4HVJA 4E7JA 4DSEA 4CFCA 4BDZA 3VN5A 4F3TA 3AVBA 1NKCA 1B92A 4EZ9A 3IS9A 3L2UA 4KHWA 4RG8A 3CFPA 1BI4A 3QO9A 3AVFA 4CJFA 1HYZA 3AA3A 4W5RA 1S6QA 3SQ1A 4Z4GA 4QAGA 1S9GA 2ZD1A 3OJUA 4KHQA 2W42A 3TABA 1FXXA 3OYAA 2YHBA 1I39A 1RBSA 1Z26A 5CZ2A 4Z4CA 4CEZA 3O3GA 3TAQA 4C8KA 4DWIA 1RILA 3TAPA 4XIUA 4E89A 3A2FA 2YKNA 1Q8IA 4H4OA 5K14A 2QKKA 3ASMA 1UOCA 4FJLA 4Q0BA 1RT3A 4FJ5A 5T7BA 4QCLA 1KCFA 4BACA 4CGJA 3LP1A 2BGGA 4FW2A 3HVTA 4NCBA 1EX4A 1SUQA 4DLEA 5HBMA 2YV0X 3QEVA 2HNZA 3OY9A 3CQ8A 2G8HA 4C8OA 1U4BA 4FZXC 1YTAA 1NK9A 2FBTA 2LSNA 3SYZA 3F9KA 4WE1A 3SZ2A 2XY8A 3SV4A 1TKXA 4OJRA 1J9AA 4F4KA 1VSFA 4OKKA 1ASUA 4DTUA 2D0CA 4O0JA 4FJMA 1XWLA 3V1QA 1TL1A 3RMDA 4CIEA 3QNOA 1RBRA 4DFPA 1TAUA 4E0DA 3TWHA 2DFHA 1IKXA 3O3HA 3KLIA 3D45A 4OGEA 4KKOA 1UA0A 1RTJA 3WNEA 4CJWA 4IKFA 1RT7A 4KREA 3SPYA 4CF9A 3K5NA 1RBUA 4IG3A 1X9MA 3SUQA 5J1EA 3K59A 4KHSA 4JS4A 3LPTA 3EY1A 4AHCA 4CFAA 3V9WA 3VQ7A 3TR8A 3U6FA 2PYLA 1RT1A 4FW1A 4E7IA 3KLFA 3OYEA 3HVRA 1X9WA 4FM0A 3KK2A 3AO5A 1WNSA 3ZSYA 4HHTA 3VQ6A 2FC0A 3SNNA 2DFEA 2IOCA 5SZTA 2HHSA 5KRSA 4DF4A 1FKPA 1LWCA 1Y97A 1TGOA 2PYJA 4LSLA 4PY5A 4DSFA 4ZTJA 3V4IA 2D0BA 3MAQA 4E3SA 2DTUA 4CHOA 3MXMA 1RDAA 2RPIA 1HNIA 1JXBA 3IRXA 3VQQA 4ZTFA 1TK5A 3SCXA 1C0MA 4FJKA 3QEWA 3L2QA 3KLEA 4B8AB 4EZ6A 4YNQA 1VSMA 3QIOA 1NK6A 3AA5X 3OYHA 2EHGA 4DQRA 3QESA 4DFMA 4KHUA 4IBNA 4FZZA 5DMRA 5JS1A 1NK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RTV A;  4CFB A;  1T05 A;  1HYS A;  3AV9 A;  1W9H A;  4IFY A;  4O55 A;  3L2W A;  4AIL C;  4DTO A;  1LV5 A;  1KTQ A;  4CFD A;  4UQG A;  4NCG A;  3VQA A;  2G8U A;  4DTP A;  4CEE A;  4KTQ A;  3P1G A;  3KLH A;  4CJK A;  2Z1J A;  4CER A;  5CYM A;  3EYZ A;  2KTQ A;  3V1O A;  4W5N A;  2Y1J A;  2WOM A;  3JSM A;  2QK9 A;  3NGZ A;  2HVI A;  4BE2 A;  3ZT0 A;  1L3S A;  3ZT4 A;  1QQC A;  3CG7 A;  4OPJ A;  4DSJ A;  1X1P A;  2R7Y A;  1C1C A;  1I3A A;  3LAM A;  2YNI A;  3PUF A;  1BCO A;  3K5L A;  3QER A;  4CGG A;  3OYD A;  3QET A;  3SUO A;  4FJJ A;  2AJQ A;  5KI6 A;  4W5O A;  4ELT A;  1IKV A;  4RW4 A;  5KTQ A;  3ZSX A;  4DQS A;  4DSI A;  1CLQ A;  4CJ4 A;  1NK5 A;  4OKJ A;  2FBX A;  3FFI A;  1N5Y A;  5FRM A;  5KRT A;  1QS4 A;  3LAK A;  3PO5 A;  3NE6 A;  3ZT1 A;  3OYG A;  4FLW A;  2F8S A;  5CY4 A;  3LDS A;  3AO3 A;  4Y1D A;  1RT5 A;  4EP5 A;  3L8B A;  2OZM A;  1EET A;  2YNF A;  1U48 A;  3V6D A;  3SQ4 A;  3CM6 A;  2G8K A;  1IKY A;  3C6U A;  3NGI A;  2E4L A;  4OPK A;  3WNF A;  3TAE A;  1YT3 A;  3KD1 E;  4K8X A;  2Z1I A;  4NYF A;  3LWM A;  1RDC A;  4CEF A;  1SV5 A;  3AO2 A;  4CED A;  4KHY A;  4CJL A;  4CJR A;  4CEC A;  2E6M A;  1D9F A;  1IO2 A;  1L3T A;  3C94 A;  3ALY A;  4FM1 A;  3PX6 A;  4M3Y A;  4CJT A;  3AVH A;  1KVA A;  1KFS A;  3HT3 A;  5CZ1 A;  4FYD A;  3DMJ A;  4CF8 A;  1BGX T;  1IKW A;  1VSE A;  2P51 A;  3T19 A;  4CEA A;  4CGF A;  3OYL A;  4DS5 A;  3P83 D;  3LP0 A;  4KI6 A;  3QIP A;  2VG6 A;  4KAZ A;  3ZT3 A;  5J2M A;  3KK1 A;  4KPY A;  3S3M A;  3G10 A;  3MEE A;  3PV8 A;  3ZSQ A;  4BDP A;  4FK0 A;  1JLE A;  3SUN A;  2KZM A;  1YVU A;  1WSJ A;  4N5S A;  4PQU A;  1KVB A;  3OYC A;  3KJV A;  3QNN A;  1S5J A;  4HTU A;  4DTS A;  4E7L A;  3OVN A;  3AO4 A;  1S1X A;  3OS0 A;  1LW2 A;  3OYN A;  1HJR A;  2OA8 A;  4Z4E A;  1ZBI A;  4AH9 A;  3NH2 A;  3SPZ A;  4CEO A;  1TL3 A;  2Q3S A;  1LW0 A;  4FK2 A;  4GMJ B;  2XO7 A;  3HPO A;  4M3U A;  4OGC A;  3KLG A;  3VQ5 A;  4CJS A;  4N41 A;  2G8I A;  4N76 A;  1CZB A;  3ITH A;  4QOZ B;  4N56 A;  1WAJ A;  2GBZ A;  4LH4 A;  2ZE2 A;  2X6N A;  4CIG A;  5FRN A;  4PWD A;  1VSJ A;  1WAF A;  4KB0 A;  2HND A;  5C42 A;  4Z4F A;  1EKE A;  4DG1 A;  3DRP A;  4AHU A;  4B9T A;  4C8N A;  3RRG A;  1HPZ A;  3V9S A;  4AHT A;  2WON A;  3OS1 A;  1JXE A;  2X6S A;  3C6T A;  4HUG A;  3SQ2 A;  3SQ0 A;  2P5G A;  2KFN A;  3HK2 A;  2KFZ A;  4FXD A;  1HQE A;  4KTZ A;  2G8W A;  4KFB A;  3LZI A;  1UAX A;  1SKW A;  4IG0 A;  3DOK A;  3D0P A;  2XRI A;  2O4G A;  4J2A A;  3O4N A;  3MEG A;  4BE0 A;  2XY6 A;  4CF1 A;  3M8P A;  2HHT A;  1ZBU A;  1KFD A;  3O4Q A;  2D0A A;  4CHP A;  4OLA A;  4OVL A;  2QXF A;  3ZSV A;  4R5P A;  1LWE A;  3TAR A;  4H4M A;  3AVM A;  3LZJ A;  1Q9X A;  1D9D A;  4K8Z A;  4CIF A;  1QSS A;  3TAM A;  4DTR A;  1ASV A;  3RRH A;  3ZSZ A;  2A1S A;  1DTQ A;  2DFF A;  4PA1 A;  4LH5 A;  4N47 A;  4CHZ A;  4YFU A;  4MFB A;  4IFV A;  1A5X A;  2IC3 A;  1BIZ A;  1RT4 A;  3NF8 A;  5E41 A;  4J2E A;  2YHA A;  5HRN A;  4RW8 A;  1X9S A;  1NJX A;  1BCM A;  3VQC A;  3VQ8 A;  4OKE A;  1NJZ A;  1SKS A;  1R0A A;  3M8R A;  4FLU A;  3L3V A;  4JLH A;  5KGX A;  1UA1 A;  4B9M A;  4I9Q A;  4FM2 A;  4BE1 A;  2X74 A;  1L3U A;  3PO4 A;  3HST B;  1S6P A;  4O0I A;  1NK4 A;  3K2P A;  3VQB A;  1T8E A;  4B9U A;  5D3G A;  1O1W A;  3PX4 A;  1C1B A;  4O44 A;  4DFJ A;  2KZZ A;  3U3G A;  3I0R A;  2ZQB A;  5SWM A;  1RTD A;  3VQ9 A;  3VQE A;  1U45 A;  5DK5 A;  3M8Q A;  3NBP A;  1JLQ A;  3OYJ A;  4KTW A;  1VK0 A;  4EP4 A;  2X78 A;  1FK9 A;  1SL0 A;  2B6A A;  2E6L A;  2OPS A;  2XHB A;  2RKI A;  5I42 A;  4W5T A;  4L8R B;  3HO1 A;  4Z0U A;  5HP1 A;  3EZ5 A;  2PY5 A;  3ZCM A;  1JLF A;  4TSX A;  3HXM A;  2B5J A;  3DOL A;  4GW6 A;  4DTN A;  4F8R A;  3RWU A;  1HMV A;  2HNY A;  3ISN C;  1CZ9 A;  4E7K A;  1G15 A;  4FLZ A;  4Z4I A;  4B8C A;  2Y1I A;  1ASW A;  3DRR A;  3OYM A;  1KSP A;  1HRH A;  4CHQ A;  4M41 A;  1GOA A;  5KGW A;  3S3O A;  3RMC A;  2P5O A;  3P5J A;  1FKO A;  2F96 A;  1S9E A;  3RR7 A;  2IS3 A;  2JLE A;  3CM5 A;  4ID1 A;  4CGH A;  3QEI A;  1EXQ A;  4DQP A;  3I8D A;  4FLV A;  2OPP A;  4KO0 A;  4FJX A;  2HHQ A;  1ITG A;  4DTX A;  5HRS A;  4W5Q A;  1XC9 A;  3IG1 A;  3QLH A;  3K58 A;  2XY7 A;  1KLM A;  2BE2 A;  1C1A A;  4KV8 A;  1BQN A;  4FZY A;  3ZSO A;  1QTM A;  4C8M A;  1WSE A;  3AVA A;  4GVM A;  2HW3 A;  5J2Q A;  1ZBF A;  2FBV A;  3OJS A;  2P1J A;  5HLF A;  3BDP A;  4FJH A;  1QE1 A;  3WNG A;  4AHR A;  1S1V A;  2B4J A;  3VQP A;  4CHY A;  1TKD A;  1NOY A;  3K5O A;  3DLG A;  5C25 A;  4BDY A;  4HCC A;  4ID5 A;  2BAN A;  4AHS A;  1YTU A;  1WSH A;  3RMB A;  3I0S A;  1T03 A;  3NF9 A;  2HHU A;  1J5O A;  1IG9 A;  4B3O A;  4M3X A;  1REV A;  2VG7 A;  2ATQ A;  4CJQ A;  3KIO A;  1K6Y A;  3NHG A;  4FK4 A;  5EU7 A;  2G8V A;  2DY4 A;  1UWB A;  3DLE A;  2GV9 A;  2QKB A;  1SL1 A;  1ZBH A;  3M8S A;  1NKB A;  2F8T A;  3LP3 A;  3HPH A;  4CK3 A;  4DQQ A;  2O4I A;  3NGY A;  4CGD A;  4J2D A;  1VRT A;  3AA4 A;  5J2N A;  2VWJ A;  2KQ2 A;  4B08 A;  2Z1H A;  1RDB A;  1WLJ A;  3SV3 A;  5HRR A;  1WSF A;  3L2R A;  1B9D A;  3NH1 A;  1Q9Y A;  4M3W A;  3AVL A;  3QIN A;  1LAW A;  4MQ3 A;  3KKR A;  3T1A A;  3VA0 A;  4KI4 A;  2HHV A;  4DU1 A;  2VG5 A;  1L5U A;  3H08 A;  1HYV A;  3KKS A;  3OYK A;  4ELV A;  1J54 A;  2IDO A;  4RW7 A;  5I3U A;  3AVG A;  4F2R A;  3AVJ A;  2YNG A;  4CF0 A;  4DF8 A;  4CK2 A;  3TI0 A;  3V9Z A;  1VSL A;  3NCI A;  4NCA A;  4CJV A;  3K57 A;  1SL2 A;  1RBV A;  5HRP A;  2HB5 A;  4DSK A;  4B9L A;  3DRS A;  1RDD A;  3HL8 A;  3PY8 A;  3NF6 A;  4FJN A;  1KVC A;  1TV6 A;  1TAQ A;  1Z25 A;  1BIS A;  1F21 A;  4IDK A;  3VQD A;  4FLT A;  3V81 A;  4KRF A;  4CJ3 A;  1BI4 B;  2XY5 A;  3HM9 A;  5J2P A;  1W0H A;  2ITG A;  1VSH A;  3DLR A;  1VSD A;  3JYT A;  1QSY A;  3NF7 A;  2OZS A;  3CFR A;  3LAL A;  3DYA A;  4ELU A;  1SKR A;  1RCH A;  3NH0 A;  3MXJ A;  2KW4 A;  3L3U A;  3TAN A;  1D8Y A;  2ETJ A;  4CCH A;  4B9N A;  4E7H A;  4M45 A;  4DU3 A;  5HRO A;  3HPG A;  1NJW A;  2NUB A;  1BIU A;  1QHT A;  1RT6 A;  3E01 A;  3U3Y A;  1BHL A;  1JLC A;  4PUO A;  1XHX A;  4HUF A;  3TAF A;  3IAY A;  3HJF A;  3V1R A;  4I7F A;  1HNV A;  2OPR A;  1RT2 A;  3LAN A;  3LPU A;  1NKE A;  4F2S A;  4DS4 A;  4Y1C A;  4ICL A;  2RN2 A;  4FJ7 A;  1WN7 A;  1C0U A;  1RTI A;  2Z1G A;  3SJJ A;  3NFA A;  4NYN A;  3NAE A;  4B9S A;  4F3O A;  1U04 A;  4RW6 A;  1C6V A;  4FVM A;  1A5W A;  1MU2 A;  3DLH A;  3S9H A;  4I2P A;  3WNH A;  5C24 A;  1TKZ A;  3KTQ A;  1NOZ A;  2EX3 A;  3KD5 E;  3B6O A;  3KK3 A;  1DLO A;  1VSK A;  1BQM A;  1HQU A;  1S1T A;  2I5J A;  3UIQ A;  4Q5V A;  2BDP A;  3BGR A;  1NJY A;  4C8L A;  4DSL A;  2YNH A;  3MED A;  2PZS A;  4ZHR A;  4Z4H A;  3PX0 A;  3RMA A;  3T3F A;  3QEX A;  3L2V A;  1RTH A;  2JGU A;  4FLY A;  1TK8 A;  3DLK A;  1B9F A;  4CGI A;  4DMN A;  4E19 A;  2HHW A;  2RF2 A;  1JL2 A;  3MEC A;  1TK0 A;  1KLN A;  3O3F A;  4CK1 A;  4O4G A;  3CYM A;  2HVH A;  1IH7 A;  3LP2 A;  4JRQ A;  1JLA A;  4FJG A;  4DTJ A;  4M42 A;  3DI6 A;  2G8F A;  1TVR A;  3B6P A;  1JLB A;  4BWM A;  4CF2 A;  1S1U A;  4I2Q A;  4CEB A;  4DQI A;  3G0Z A;  3OYF A;  1S1W A;  4B9V A;  4H8K A;  1GOB A;  3NDK A;  3AO1 A;  2IGI A;  1TKT A;  3V9U A;  4JS5 A;  4HUE A;  1BL3 A;  2VWK A;  4RW9 A;  3VQ4 A;  2D5R A;  4CES A;  4FLX A;  3SI6 A;  3AVC A;  1C0T A;  2OPQ A;  3HYF A;  3SUP A;  4M3Z A;  3RR8 A;  1JLG A;  2GUI A;  4DU4 A;  3ZSW A;  4LD0 A;  3OYI A;  1VSI A;  1RBT A;  4FJI A;  3AVN A;  4M3R A;  1DTT A;  5JS2 A;  4FJ9 A;  4E1N A;  1KRP A;  3AVI A;  3CFO A;  4FJ8 A;  1NK7 A;  2YKM A;  4I9L A;  1ZYQ A;  4KB1 A;  1LAV A;  4DTM A;  4LSN A;  1CXU A;  4JRP A;  4DLG A;  1U49 A;  4DFK A;  1NK0 A;  3DLB A;  4J2B A;  5FRO A;  1N6Q A;  3LWL A;  1VRU A;  1U47 A;  4AHV A;  1CXQ A;  3K5M A;  3C95 A;  1LWF A;  4G1Q A;  4CHN A;  3ULD A;  3ZT2 A;  3THV A;  4CJE A;  3AVK A;  2A1R A;  1L3V A;  3VA3 A;  4CEQ A;  4FCY A;  5FDL A;  3OYB A;  3S3N A;  1JKH A;  1A5V A;  1EP4 A;  4E1M A;  1JL1 A;  3TAG A;  3QEP A;  1XHZ A;  1T7P A;  1RNH A;  1ZBL A;  3DM2 A;  4HCB A;  1WSG A;  3AA2 A;  4KHN A;  3HP6 A;  3HP9 A;  1XI1 A;  1D5A A;  1J53 A;  4O5B A;  4CJ5 A;  2FBY A;  4CJP A;  1QSL A;  2OYQ A;  1GOC A;  4CE9 A;  3MXI A;  4OLB A;  2HMI A;  4M3T A;  2IAJ A;  3F73 A;  3V9X A;  3OS2 A;  1WSI A;  3ZSR A;  4BWJ A;  4CJU A;  2HHX A;  5CYQ A;  4LY7 A;  4HVJ A;  4E7J A;  4DSE A;  4CFC A;  4BDZ A;  3VN5 A;  4F3T A;  3AVB A;  1NKC A;  1B92 A;  4EZ9 A;  3IS9 A;  3L2U A;  4KHW A;  4RG8 A;  3CFP A;  1BI4 A;  3QO9 A;  3AVF A;  4CJF A;  1HYZ A;  3AA3 A;  4W5R A;  1S6Q A;  3SQ1 A;  4Z4G A;  4QAG A;  1S9G A;  2ZD1 A;  3OJU A;  4KHQ A;  2W42 A;  3TAB A;  1FXX A;  3OYA A;  2YHB A;  1I39 A;  1RBS A;  1Z26 A;  5CZ2 A;  4Z4C A;  4CEZ A;  3O3G A;  3TAQ A;  4C8K A;  4DWI A;  1RIL A;  3TAP A;  4XIU A;  4E89 A;  3A2F A;  2YKN A;  1Q8I A;  4H4O A;  5K14 A;  2QKK A;  3ASM A;  1UOC A;  4FJL A;  4Q0B A;  1RT3 A;  4FJ5 A;  5T7B A;  4QCL A;  1KCF A;  4BAC A;  4CGJ A;  3LP1 A;  2BGG A;  4FW2 A;  3HVT A;  4NCB A;  1EX4 A;  1SUQ A;  4DLE A;  5HBM A;  2YV0 X;  3QEV A;  2HNZ A;  3OY9 A;  3CQ8 A;  2G8H A;  4C8O A;  1U4B A;  4FZX C;  1YTA A;  1NK9 A;  2FBT A;  2LSN A;  3SYZ A;  3F9K A;  4WE1 A;  3SZ2 A;  2XY8 A;  3SV4 A;  1TKX A;  4OJR A;  1J9A A;  4F4K A;  1VSF A;  4OKK A;  1ASU A;  4DTU A;  2D0C A;  4O0J A;  4FJM A;  1XWL A;  3V1Q A;  1TL1 A;  3RMD A;  4CIE A;  3QNO A;  1RBR A;  4DFP A;  1TAU A;  4E0D A;  3TWH A;  2DFH A;  1IKX A;  3O3H A;  3KLI A;  3D45 A;  4OGE A;  4KKO A;  1UA0 A;  1RTJ A;  3WNE A;  4CJW A;  4IKF A;  1RT7 A;  4KRE A;  3SPY A;  4CF9 A;  3K5N A;  1RBU A;  4IG3 A;  1X9M A;  3SUQ A;  5J1E A;  3K59 A;  4KHS A;  4JS4 A;  3LPT A;  3EY1 A;  4AHC A;  4CFA A;  3V9W A;  3VQ7 A;  3TR8 A;  3U6F A;  2PYL A;  1RT1 A;  4FW1 A;  4E7I A;  3KLF A;  3OYE A;  3HVR A;  1X9W A;  4FM0 A;  3KK2 A;  3AO5 A;  1WNS A;  3ZSY A;  4HHT A;  3VQ6 A;  2FC0 A;  3SNN A;  2DFE A;  2IOC A;  5SZT A;  2HHS A;  5KRS A;  4DF4 A;  1FKP A;  1LWC A;  1Y97 A;  1TGO A;  2PYJ A;  4LSL A;  4PY5 A;  4DSF A;  4ZTJ A;  3V4I A;  2D0B A;  3MAQ A;  4E3S A;  2DTU A;  4CHO A;  3MXM A;  1RDA A;  2RPI A;  1HNI A;  1JXB A;  3IRX A;  3VQQ A;  4ZTF A;  1TK5 A;  3SCX A;  1C0M A;  4FJK A;  3QEW A;  3L2Q A;  3KLE A;  4B8A B;  4EZ6 A;  4YNQ A;  1VSM A;  3QIO A;  1NK6 A;  3AA5 X;  3OYH A;  2EHG A;  4DQR A;  3QES A;  4DFM A;  4KHU A;  4IBN A;  4FZZ A;  5DMR A;  5JS1 A;  1NK8 A; 
#chains in the Genus database with same CATH topology
 1XNR K;  1HYS A;  3QML A;  3L2W A;  3HBT A;  3E9L A;  1KTQ A;  4UQG A;  1W2B M;  3VQA A;  4QS7 A;  3NVM A;  4JI1 K;  4WCE L;  4DR5 K;  4CER A;  3EYZ A;  1TYQ A;  3JSM A;  1JCE A;  4A5A A;  5F2R A;  3VEY A;  3CCS N;  1C1C A;  1I3A A;  3MX5 A;  5AQW A;  3LAM A;  4K43 A;  3DXM A;  5KI6 A;  3C6A A;  5KPT A;  2W41 A;  3DJC A;  4OKJ A;  1M90 O;  2P9I B;  3PO5 A;  2NRH A;  4FLW A;  5CY4 A;  3AY9 A;  4Y1D A;  3L8B A;  3ENO A;  2YNF A;  1VAZ A;  1IKY A;  3C6U A;  5LJV A;  4RCH A;  1YT3 A;  4CEF A;  2UUB K;  3AO2 A;  4CED A;  1RDU A;  5DM7 L;  2NRT A;  4FSV A;  2O8D A;  2JWL A;  2KKZ A;  4LF9 K;  1L3T A;  3ALY A;  4OO1 J;  1KVA A;  3HT3 A;  4FYD A;  4CJ7 A;  1OH5 A;  1VSE A;  2P51 A;  4CEA A;  1NNE A;  3P83 D;  2P9P B;  2D0P A;  2VG6 A;  3M1F A;  3ZT3 A;  4B1U B;  2UXB K;  1E3M A;  3MEE A;  4FK0 A;  2KZM A;  4WQ5 A;  1WSJ A;  3ENB A;  4FWN A;  4N5S A;  5AZI B;  3QNN A;  1S5J A;  4DTS A;  3OVN A;  4EHT A;  5C10 A;  3OYN A;  1QQN A;  2IVN A;  2OA8 A;  3VF2 A;  4Z4E A;  4XH4 A;  1TL3 A;  2Q3S A;  2XO7 A;  3HPO A;  4M3U A;  3SBT A;  1WAJ A;  4CIG A;  2X6N A;  4DB3 A;  2E2P A;  5C15 A;  1WAF A;  3G25 A;  5TKY A;  3OTO K;  1EKE A;  3DRP A;  4C8N A;  1NGD A;  1T3V A;  1JXE A;  3SQ2 A;  2P5G A;  2NRW A;  2KFZ A;  3BZK A;  4IG0 A;  3DOK A;  2D1K A;  3ZLJ A;  4J2A A;  3O4N A;  1K8A O;  2XY6 A;  5DM6 L;  3M3Z A;  3EO3 A;  4BR9 A;  1GLB G;  4BRL A;  2D0A A;  4R5P A;  1D9D A;  2O8E B;  4K8Z A;  4BRP A;  2A1S A;  4CHZ A;  4MFB A;  4IFV A;  1A5X A;  1QVF M;  1BIZ A;  4FOE A;  5AQF A;  2E1Z A;  3F9M A;  1X9S A;  1NJX A;  1BCM A;  3VQ8 A;  1R0A A;  3VTI A;  4PL7 A;  4FLU A;  3SLC A;  1UA1 A;  3JAM O;  4DV6 K;  4FM2 A;  1GLC G;  1L3U A;  3HST B;  1V4S A;  3VQB A;  3PX4 A;  4JKB A;  2ZQB A;  1X3M A;  4KH5 A;  5AQZ A;  4CZF A;  2F9W A;  1U45 A;  3MCP A;  4EP4 A;  1FK9 A;  1H1V A;  4L8R B;  5HP1 A;  3EZ5 A;  3ZCM A;  4DTN A;  4TSX A;  4F8R A;  4BRF A;  3QDK A;  3WXM B;  1CZ9 A;  4E7K A;  1HUX A;  5BPL A;  5AQG A;  3CC4 N;  3VES A;  4CHQ A;  4M41 A;  3J80 O;  5KGW A;  4GVE A;  3U4L A;  1FKO A;  4XH1 A;  2F96 A;  1S9E A;  3RR7 A;  3CM5 A;  4DQP A;  3U9Z A;  1S72 N;  3I8D A;  2OPP A;  4KO0 A;  4I6M B;  4BRI A;  4JK7 A;  1BQN A;  4GNI A;  4AQY K;  3ZSO A;  2HW3 A;  3BDP A;  4X65 K;  4FJH A;  1NGE A;  1QE1 A;  4AHR A;  3TU5 A;  2B4J A;  4CHY A;  1KD1 O;  2UUA K;  2H3G X;  3DLE A;  3D2E A;  4ILH A;  4AF1 A;  3M8S A;  1NKB A;  3LP3 A;  4YOR A;  3HPH A;  3VOV A;  1KXP A;  1S22 A;  4IEE A;  4YOX A;  4DQQ A;  4J2D A;  2VWJ A;  2W6L A;  2OTL N;  1B9D A;  4JKD A;  5AQM A;  3KKR A;  3LM9 A;  2YJF A;  3OYK A;  1J54 A;  2FXU A;  3K9J A;  3AVJ A;  3UKU B;  3C0B A;  3NMU A;  3H3O B;  4CZE A;  3TI0 A;  3V9Z A;  2YHY A;  3NCI A;  4NCA A;  3O9Q A;  4BRA A;  1RBV A;  5HRP A;  1RDD A;  3LDO A;  4FJN A;  1KVC A;  3B8A X;  3VQD A;  3CF5 L;  2XY5 A;  1ATS A;  2UXC K;  3HM9 A;  5J2P A;  3THW A;  4WFN L;  3DLR A;  3JYT A;  3BZC A;  3SMS A;  1YJW N;  3MXJ A;  3L3U A;  2HST A;  4FWM A;  4DU3 A;  1RT6 A;  1BHL A;  1JLC A;  4H0V B;  1SZ2 A;  3TAF A;  3A5L C;  3HJF A;  4BR0 A;  1XNQ K;  1NLV A;  1EWR A;  2OPR A;  3AGK A;  5GAG P;  4JI3 K;  1NKE A;  4B3S K;  2GUP A;  1EO1 A;  4ICL A;  4UY8 O;  3OBW A;  4FJ7 A;  1C0U A;  2Z1G A;  2ITM A;  4BC3 A;  3HZ6 A;  4RW6 A;  3DLH A;  3CER A;  2E5L K;  4YOU A;  3B6O A;  4A2B A;  1DLO A;  1VSK A;  3FFK B;  2JWK A;  4IJN A;  4IJA A;  2HBJ A;  3CC2 N;  2HF3 A;  4DSL A;  1N34 K;  3HRG A;  3RMA A;  3E9P A;  3QEX A;  3THX B;  3L2V A;  1TK8 A;  1RDW X;  4DMN A;  2P9N B;  2P9I A;  1TK0 A;  4JI0 K;  4EAH D;  5AR0 A;  4DR1 K;  4M42 A;  4FJG A;  2G8F A;  1TVR A;  1C0G A;  3B6P A;  3CQX A;  4BWM A;  1S1U A;  1MA9 B;  4I2Q A;  4CEB A;  4DQI A;  3G0Z A;  1S1W A;  4LF6 K;  3NDK A;  3AGR A;  3D7E O;  3HM8 A;  3V9U A;  4HUE A;  5MLC Q;  5LMN K;  4FLX A;  3H45 C;  5H1S Q;  4M3Z A;  1O13 A;  1JLG A;  1ESV A;  2GUI A;  3ZSW A;  4LD0 A;  1VSI A;  3CCJ N;  3VEZ A;  1XQS C;  1KRP A;  4FJ8 A;  4JKH A;  4ISF A;  4JKC A;  2J4R A;  2QWN A;  3DLB A;  1NK0 A;  4J2B A;  3C65 A;  5FRO A;  4B1V A;  3DXM B;  1CXQ A;  5AZI A;  3ZT2 A;  4BRO A;  4CEQ A;  5ADX H;  5JIC A;  2P5O A;  1XHZ A;  3G6E N;  4B1W B;  2FBY A;  4DV4 K;  2HMI A;  3ULE B;  1WSI A;  4LY7 A;  3WUH A;  4E7J A;  4BDZ A;  3HTV A;  1ILY A;  3AVB A;  5AQH A;  4KHW A;  3L2U A;  1BI4 A;  2O8D B;  3AVF A;  1HYZ A;  3KZB A;  1S6Q A;  4QAG A;  5KQD A;  3K9K A;  3VPZ A;  2YHB A;  3O3G A;  4DSI A;  2QEX N;  4JK8 A;  4XIU A;  4FWO A;  2ZM6 K;  1VQO N;  2QKK A;  3TSU A;  1VQM N;  4FJ5 A;  3LP1 A;  1EX4 A;  5HBM A;  2QI2 A;  2HNZ A;  2O8E A;  3CJA A;  1ZBS A;  1E4F T;  4JNE A;  4FWL A;  3J81 O;  2XY8 A;  3FZH A;  2HHH K;  1GLD G;  3CD6 N;  1VSF A;  4FVU A;  4OKK A;  2ZF5 O;  4DTU A;  4BRK A;  4DUZ K;  3MCA B;  1TAU A;  4H5V A;  4H5T A;  3D45 A;  1D4X A;  4M7Y A;  1UA0 A;  4CJW A;  4IEI A;  2WC9 A;  4CF9 A;  4KHS A;  3DAW A;  4JS4 A;  3EY1 A;  1YAG A;  2O8B B;  3U6F A;  2PYL A;  3BEX A;  4CW7 B;  3PIP L;  3OYE A;  3HVR A;  1X9W A;  3KK2 A;  4HHT A;  2FC0 A;  2IOC A;  1WBD A;  4ILG B;  4DF4 A;  1FW6 A;  1FKP A;  1Y97 A;  3EE9 A;  4DSF A;  3BUZ B;  1NGH A;  3V4I A;  4ZTJ A;  4GV9 A;  1N33 K;  1YIT N;  1RDA A;  4BC2 A;  3RSE B;  4B8A B;  4YNQ A;  4I6M A;  5EOY A;  2ASP A;  4FWQ A;  4KHU A;  3QES A;  4CZM A;  1ZC6 A;  5DMR A;  5JS1 A;  2W6K A;  5EY4 A;  1T05 A;  3AV9 A;  4IFY A;  1YHQ N;  4IDH A;  1LV5 A;  3LL3 A;  4FWP A;  4NCG A;  2G8U A;  2V52 B;  4CEE A;  3KLH A;  3DWL A;  5CYM A;  2HF4 A;  2Y1J A;  2HVI A;  3ZT0 A;  2UXD K;  5BN9 A;  1QQC A;  4X64 K;  4DSJ A;  1X1P A;  1Q86 O;  3PUF A;  1BCO A;  3K5L A;  4FJJ A;  3OYD A;  4W5O A;  5CR4 A;  4ELT A;  1CLQ A;  1NK5 A;  3P31 A;  5FRM A;  2NRR A;  2V7Z A;  3NE6 A;  4DR6 K;  2P9S B;  4WQ4 C;  5HL7 L;  3AO3 A;  1K8K A;  4EP5 A;  2G8K A;  4OPK A;  3CJ7 A;  2DPN A;  3KD1 E;  4K8X A;  4NYF A;  3LWM A;  4KHY A;  2Q36 A;  4CJL A;  1YXQ A;  4CJR A;  4PKI A;  3C94 A;  4BG9 A;  1K9M O;  1KFS A;  3M6G A;  5JLF A;  3DMJ A;  4CF8 A;  1IKW A;  4DS5 A;  1U2V B;  2FSJ A;  4CZG A;  5M1N A;  5AQX A;  4BRM A;  3CPW M;  3H1V X;  3J7A P;  4B3R K;  3ZSQ A;  4BDP A;  1IBK K;  3SUN A;  3CXC M;  5BPM A;  3FZM A;  4PQU A;  2CH5 A;  3OYC A;  2CGL A;  2VYP A;  4HTU A;  1VQL N;  3WXK A;  3N4P A;  4JK9 A;  1HJR A;  2CGK A;  3NH2 A;  3O80 A;  4FK2 A;  3QIC A;  4GMJ B;  1DEJ A;  2PFU A;  4N76 A;  3ITH A;  5E84 A;  2GBZ A;  4LH4 A;  3ZET A;  5FRN A;  3R1X A;  2HND A;  3N4Q A;  3FZL A;  3TSQ A;  4HUG A;  3C6T A;  2RE2 A;  4M7X A;  4CVN E;  1VQN N;  4MLH A;  4PHT X;  4KTZ A;  4KFB A;  1UAX A;  1HKG A;  3D0P A;  2O4G A;  4IFE A;  4BE0 A;  4CF1 A;  1ZBU A;  4CHP A;  2QXF A;  1LWE A;  3TAR A;  2P9N A;  3TAM A;  1ASV A;  4DTR A;  3P39 A;  3ZSZ A;  4PA1 A;  4BRG A;  3O1W A;  5E41 A;  4J2E A;  3WXJ A;  3MX2 A;  3M8R A;  4I9Q A;  4B9U A;  4O0I A;  1T8E A;  5D3G A;  2UUC K;  4O44 A;  4DFJ A;  2KZZ A;  3I0R A;  1RTD A;  3VQE A;  1BDG A;  4CI6 A;  5DK5 A;  1ZXO A;  4CZL A;  1VQ5 N;  3NBP A;  3OYJ A;  2QWQ A;  1OH6 A;  3DXK B;  1SL0 A;  4U67 L;  2OPS A;  3AAP A;  4FWK A;  1LOT B;  1JLF A;  4DKW A;  2HBL A;  2E2N A;  3HOS A;  4Z4I A;  1ASW A;  3DRR A;  3QB0 A;  1HRH A;  1BG3 A;  3S3O A;  4JKF A;  5JVG L;  2YJE A;  2JLE A;  3W0L A;  4YOT A;  4FLV A;  4FJX A;  1HKC A;  1E4G T;  5FPN A;  4W5Q A;  3QLH A;  3VTH A;  1KLM A;  4KV8 A;  3ULE A;  2XY7 A;  4FZY A;  4BC5 A;  3SBG A;  1WSE A;  1ZBF A;  2FBV A;  2FF3 B;  2AP1 A;  3WNG A;  1TKD A;  2BAN A;  1YTU A;  1J5O A;  4M3X A;  2VG7 A;  4CJQ A;  3KIO A;  4FK4 A;  1SL1 A;  2F8T A;  3M5R A;  4CK3 A;  2ASO A;  4CGD A;  3IDH A;  1RDB A;  4O8U A;  3D2F A;  4B1Z A;  1WSF A;  1Q18 A;  3NH1 A;  1Q9Y A;  3AVL A;  3VA0 A;  1VQK N;  2HHV A;  4KI4 A;  2VG5 A;  1NM1 A;  2P9U A;  3TTD A;  4DR4 K;  4JI4 K;  4C1N K;  3CME N;  4L3Q A;  4F2R A;  4BRH A;  4QS9 A;  1JCF A;  1VSL A;  1SL2 A;  3EZW A;  1MDU B;  3TTC A;  4B9L A;  3DRS A;  3HL8 A;  3PY8 A;  3SAH A;  3WT0 A;  1TV6 A;  4IDK A;  3V81 A;  2A6A A;  5AQP A;  1BI4 B;  2Q0R A;  5LL6 Z;  3A5N C;  2O8B A;  2ITG A;  4IOX A;  2QM1 A;  1ATN A;  1NGA A;  4IWV A;  3DYA A;  1SKR A;  1RCH A;  2KW4 A;  3T1H K;  1NGF A;  3G71 N;  2ETJ A;  4E7H A;  2Q97 A;  1NJW A;  1BIU A;  5FPM A;  3E01 A;  3RSE A;  4A62 A;  3IAY A;  1X3N A;  5EX5 A;  4BRN A;  3ZYY X;  3V1R A;  1HNV A;  1WBB A;  1Q81 O;  3LPU A;  4Y1C A;  2RN2 A;  2FF6 A;  1G99 A;  1WN7 A;  3EL2 A;  4B9S A;  4FVM A;  1A5W A;  3F2K A;  3S9H A;  4I2P A;  3WNH A;  3FZF A;  1NOZ A;  2EX3 A;  2CGJ A;  5I9E B;  1HQU A;  2I5J A;  4O8K A;  4GV6 A;  2BDP A;  1NGI A;  1K73 O;  4BQZ A;  1NBW A;  4LF4 K;  4IO8 A;  3MWT A;  3L4I A;  3DLK A;  5EVZ A;  4CGI A;  2RF2 A;  3MEC A;  2P9S A;  4O4G A;  3C7N A;  4BRD A;  2HVH A;  5C12 A;  1IH7 A;  4JRQ A;  2KLA A;  4DTJ A;  1Z6R A;  3MN5 A;  4RWT A;  4JKE A;  1CZA N;  4B9V A;  3AO1 A;  3ID8 A;  3R6M A;  1BOT O;  2E2O A;  1BL3 A;  3VQ4 A;  2D5R A;  4CES A;  1C0T A;  2OPQ A;  3HYF A;  1XC3 A;  4DU4 A;  1U2V A;  2WBN A;  3AVN A;  4LFA K;  4FJ9 A;  2YKM A;  4I9L A;  4IZ9 A;  5BRE A;  4DTM A;  4DLG A;  2NLX A;  2Q2R A;  2I7N A;  1N6Q A;  4A57 A;  4AHV A;  1LWF A;  3MN6 A;  3ULD A;  1J6Z A;  2A1R A;  3THY A;  5FDL A;  1T7P A;  4EHU A;  1VQ4 N;  1WSG A;  1NMN A;  1J53 A;  3CI5 A;  4O5B A;  1K8K B;  4CJ5 A;  1QSL A;  2OYQ A;  4CE9 A;  4KH4 A;  3BF3 A;  3SAF A;  3OS2 A;  3ZSR A;  5ADX A;  2ZWH A;  5CYQ A;  4DSE A;  4H0Y B;  3CCM N;  1B92 A;  3RVC A;  3CFP A;  1BO5 O;  4CJF A;  4W5R A;  3AA3 A;  5M1Q A;  2BUP A;  3OJU A;  4KHQ A;  2W42 A;  2OAN A;  1FXX A;  1I39 A;  1Z26 A;  5CZ2 A;  4Z4C A;  4CEZ A;  5AQI A;  2PBD A;  3A2F A;  5K14 A;  3ASM A;  4FJL A;  3WXI A;  2BH1 A;  5T7B A;  2P9K A;  2I7P A;  3QEV A;  4FZX C;  4WFB L;  2G8H A;  1U4B A;  4YDU C;  2LSN A;  3SYZ A;  4JV5 K;  3F9K A;  4H5R A;  2E88 A;  3SV4 A;  2AA4 A;  4OJR A;  1XUP O;  1ASU A;  4LF7 K;  4FJM A;  3GL1 A;  1TL1 A;  3IUC A;  4CIE A;  4DFP A;  3J8A A;  3TWH A;  1IKX A;  4KRE A;  1RTJ A;  3WNE A;  3ZET B;  2RHK A;  3K5N A;  1RBU A;  4IG3 A;  3SUQ A;  5J1E A;  3K59 A;  2VCP A;  3LPT A;  3DXK A;  2UYT A;  4AHC A;  4A61 A;  3V9W A;  3TR8 A;  2FSK A;  4DV3 K;  1HJO A;  1OVY A;  4E7I A;  3QFU A;  3SNN A;  2DFE A;  5SZT A;  2HHS A;  5KRS A;  1TGO A;  2GX9 A;  2D0B A;  3E66 A;  3MAQ A;  2GTD A;  2W40 A;  3FR0 A;  3IRX A;  4ZTF A;  1TK5 A;  1C0M A;  3L2Q A;  3KLE A;  1VSM A;  2A41 A;  3QIO A;  3AA5 X;  3H1Q A;  2EHG A;  4DQR A;  2P9L B;  4DFM A;  3EN9 A;  3QBW A;  1JCG A;  3SJH A;  4CFB A;  3RTV A;  3CC7 N;  4AM7 A;  4CFD A;  3OBY A;  1HLU A;  1WOQ A;  4FO0 A;  4CJK A;  2KTQ A;  2QK9 A;  2WOM A;  3NGZ A;  4BE2 A;  1L3S A;  4HWI A;  3CG7 A;  3VER A;  4OPJ A;  5BR8 K;  1LCU A;  4CGG A;  3QET A;  2AJQ A;  4XH5 A;  1RGI A;  3VMF B;  1JJ2 M;  3O8M A;  4CJ4 A;  3SK3 A;  1N5Y A;  3LAK A;  3ZT1 A;  2F8S A;  3O9U A;  2NNW A;  1RT5 A;  4KBO A;  1EET A;  2OCE A;  1NU0 A;  4JI2 K;  1U48 A;  3V6D A;  1TUY A;  1QQO A;  1IG8 A;  2NRV A;  3GG4 A;  3TAE A;  1T6D A;  4JAX A;  1QVG M;  1SV5 A;  3O9T A;  3A5M C;  4OPA A;  4CEC A;  5BPN A;  4DR7 K;  2E6M A;  3L6Q A;  1D9F A;  4FM1 A;  4YOV A;  4CJT A;  3AVH A;  4CBX A;  1NOY A;  3OYL A;  4CGF A;  4KI6 A;  3CCR N;  2QWR A;  4KAZ A;  5J2M A;  3KK1 A;  4XEI A;  4KPY A;  3D6R A;  3T1Y K;  3G10 A;  3PV8 A;  4K41 A;  1YVU A;  3MWP A;  1HNX K;  3WQU A;  4NB4 A;  4M63 C;  2UU9 K;  3AO4 A;  1S1X A;  3SAG A;  3OS0 A;  2VWB A;  3GOI A;  4AM6 A;  4AH9 A;  3D2F B;  5JLH A;  3SPZ A;  1HR0 K;  4RTF D;  4CEO A;  1ZBI A;  4GKK K;  5M1P A;  4OGC A;  3KLG A;  1T44 A;  3CPE A;  4N41 A;  2G8I A;  4QOZ B;  2P9U B;  3HOT A;  2ZE2 A;  5M1K A;  1VSJ A;  4H0P A;  4K42 A;  4KB0 A;  4Z4F A;  5C42 A;  1P8Z A;  4BVO A;  4AHU A;  5GIN A;  3VEW A;  2QA4 N;  3RRG A;  5LJW A;  3O9R A;  2WON A;  4DR3 K;  4MDA A;  1NGG A;  4BGB A;  2KFN A;  3HK2 A;  4BQL A;  2G8W A;  3LZI A;  4LFB K;  4H03 B;  3ZEU A;  3M8P A;  2F7T A;  4CBU A;  4C1N I;  5GAD P;  3O4Q A;  1KFD A;  4OVL A;  4DV0 K;  4H4M A;  1Q9X A;  4CIF A;  3KK7 A;  1QSS A;  3RRH A;  1DTQ A;  4YFU A;  5B8H A;  4LH5 A;  4DV1 K;  2IC3 A;  4CD1 A;  2V51 B;  1R59 O;  3NF8 A;  1YVN A;  4RW8 A;  1NJZ A;  3A5O C;  2QWO A;  4DCH A;  4B9M A;  1WB9 A;  4DQ8 A;  4X66 K;  1S6P A;  3GE1 A;  1O1W A;  1Q7Y O;  5SWM A;  3VQ9 A;  2EWS A;  3U9D A;  1JLQ A;  1QZ6 A;  1VK0 A;  5JVH L;  4J8F A;  1KC8 O;  5TKW A;  2B6A A;  2E6L A;  3ID6 A;  4EIA A;  1U6Z A;  2XHB A;  5I42 A;  4W5T A;  4KH6 A;  3KWG A;  4Z0U A;  2PY5 A;  3HXM A;  2B5J A;  4GW6 A;  4BG8 A;  3GBT A;  3CCU N;  3RWU A;  3ISN C;  1G15 A;  4B8C A;  1KAY A;  5BRD A;  5AQT A;  3OYM A;  1GOA A;  3S41 A;  3RMC A;  1GLL O;  2IS3 A;  4CGH A;  4ID1 A;  3QEI A;  1EXQ A;  1YJ9 N;  3C7N B;  1ITG A;  4DTX A;  5HRS A;  3CQY A;  1XC9 A;  3IG1 A;  3K58 A;  1W97 L;  4CD3 A;  2A5X A;  1QTM A;  4C8M A;  2FSN A;  3OJS A;  1GLF O;  2O8F A;  3K5O A;  3DLG A;  5C25 A;  4BDY A;  4ID5 A;  5C2D A;  1T03 A;  2HHU A;  5BRH A;  1IG9 A;  4B3O A;  3NHG A;  3C6H A;  5EU7 A;  1UWB A;  3VGL A;  2QKB A;  3UE5 A;  3WEE A;  1ZBH A;  1GLJ O;  3L4Q A;  4U7B A;  3NGY A;  1VRT A;  5J2N A;  1SAZ A;  2KQ2 A;  4B08 A;  2Z1H A;  1WLJ A;  3SV3 A;  5BRF A;  3L2R A;  5F0X A;  3T69 A;  1LAW A;  4MQ3 A;  3THY B;  4YHH K;  3CCV N;  3KKS A;  4ELV A;  2D0O A;  4RW7 A;  1IBM K;  4CF0 A;  4DF8 A;  4B3M K;  4WQ4 A;  1RFQ A;  3K57 A;  4MO4 A;  3VGM A;  2QWM A;  1WUA A;  4DSK A;  1X9J A;  3NF6 A;  1Z25 A;  1BIS A;  4KRF A;  4CJ3 A;  1W0H A;  3MN7 A;  3PIO L;  2QTD A;  1QSY A;  3FE1 A;  2OZS A;  3CFR A;  3LAL A;  4ELU A;  3NH0 A;  4NXM K;  3TAN A;  4O5F A;  2P9K B;  5AJ3 K;  4NLB A;  5HRO A;  3HPG A;  3MN9 A;  2NUB A;  4A2A A;  3H46 O;  3CCQ N;  4PUO A;  1XHX A;  4HUF A;  4H5W A;  5AQY A;  3SMP A;  3VGK A;  1NG9 A;  2P9L A;  1RT2 A;  4B1X B;  1RTI A;  3SJJ A;  3NFA A;  4NYN A;  5AQU A;  3KTQ A;  3KD5 E;  3KK3 A;  1BQM A;  3A0I X;  5IT9 O;  4PKG A;  3NVK A;  4Q5V A;  4V19 S;  3BGR A;  5ELZ A;  3MED A;  2PZS A;  3O1B A;  4Z4H A;  3T3F A;  2NRZ A;  3TPQ A;  1RTH A;  2JGU A;  2YHX A;  1B9F A;  4E19 A;  2HHW A;  3ZX2 A;  5AFU H;  5LY3 A;  3CYM A;  4BRE A;  1EWQ A;  4H5N A;  5KPR A;  3DI6 A;  1JLB A;  4CF2 A;  4BRQ A;  3OYF A;  3A8Y A;  1GOB A;  3IKM A;  2E20 A;  1TKT A;  4YOW A;  4MDB A;  4JHD B;  4WQ5 C;  3H3N O;  3SUP A;  4B9Q A;  5CHI A;  4FJI A;  1OH8 A;  2VQF K;  1BA1 A;  4M3R A;  5JS2 A;  4E1N A;  1NK7 A;  4DR2 K;  4OX9 K;  4KB1 A;  3MK6 A;  4EZ9 A;  1U49 A;  4LSN A;  4JRP A;  4OPH A;  3JS6 A;  3LWL A;  5AQJ A;  1TUU A;  1NWK A;  3K5M A;  2QW9 A;  1C0F A;  2PAV A;  3THV A;  4CJE A;  3VA3 A;  4JKG B;  4FCY A;  3LDL A;  3S3N A;  1EP4 A;  4CCH A;  4E1M A;  1JL1 A;  1RNH A;  3HI0 A;  2QWL A;  4KHN A;  3BY5 A;  4GV3 A;  1D5A A;  5HOO A;  1YJN N;  2E8A A;  4YY3 K;  4FL9 A;  4OLB A;  4CJU A;  2HOE A;  2QXL A;  4CFC A;  3VN5 A;  4X62 K;  4F3T A;  2Q31 A;  3IS9 A;  2ZGZ A;  2E2Q A;  2NRX A;  1NGB A;  3QO9 A;  3SQ1 A;  5M1O A;  1S9G A;  2ZD1 A;  3TAB A;  3ENH A;  3OYA A;  4DWI A;  3TAQ A;  1Q8I A;  1S3X A;  1UOC A;  1QZ5 A;  2IVP A;  2GWJ A;  3OW2 M;  4QCL A;  3ZX3 A;  4CGJ A;  4FW2 A;  3JXU A;  4NCB A;  1SUQ A;  4DLE A;  4BR7 A;  4LC9 B;  2YV0 X;  4BVP A;  1HPM A;  1VHX A;  4CBW A;  1NK9 A;  2FBT A;  4PKH A;  1N8R O;  4E1J A;  3SZ2 A;  1TKX A;  4DV7 K;  3EE8 A;  1XWL A;  3MDQ A;  3MMV A;  4HTL A;  3T7Z A;  1RBR A;  4E0D A;  3UB5 A;  2NZT A;  3O3H A;  3E1Y A;  4IKF A;  1RT7 A;  4A5B A;  2CH6 A;  4CZH A;  1X9M A;  3G4S N;  1J5E K;  4JI6 K;  3VQ7 A;  3Q7B A;  4BC4 A;  4PL8 A;  5C2F A;  3ZSY A;  3VQ6 A;  1VQ7 N;  2PYJ A;  3PSI A;  1OH7 A;  4LSL A;  3ZEU B;  3Q7C A;  4E3S A;  4NO7 A;  1BUP A;  4DUY K;  3MXM A;  3CJC A;  1HNI A;  1JXB A;  2YHW A;  3VQQ A;  3SCX A;  1BU6 O;  5BR9 A;  1NK6 A;  4FOI A;  3VEN A;  3WQT A;  1NMD A;  5M1F A;  1I94 K;  1VQ6 N;  4JD2 B;  1NK8 A;  3J7Y P;  1W9H A;  4O55 A;  4AIL C;  4DTO A;  1IV0 A;  3LM2 A;  3CCE N;  4JI8 K;  4C23 A;  4DTP A;  4KTQ A;  1IJJ A;  3P1G A;  2Z1J A;  4BGA A;  3V1O A;  4W5N A;  4DV2 K;  3CJB A;  3ZT4 A;  2R7Y A;  2F9T A;  5F1X A;  2YNI A;  4ISG A;  3QER A;  3SUO A;  5FLX O;  1IKV A;  4RW4 A;  5CE3 A;  5KTQ A;  3ZSX A;  4DQS A;  2FBX A;  3FFI A;  5KRT A;  1QS4 A;  3W3D A;  3OYG A;  3LDS A;  2O8C B;  4K0K K;  1VQP N;  1SQK A;  2OZM A;  5AZJ A;  3SQ4 A;  3CM6 A;  3UKR B;  3NGI A;  2E4L A;  3WNF A;  2Z1I A;  3F5T A;  1RDC A;  3O6W A;  3OA9 A;  3HSC A;  1VQ8 N;  4FPB A;  3CIP A;  1IO2 A;  4YOY A;  2WTU A;  3PX6 A;  4M3Y A;  1DGK N;  5CZ1 A;  1BGX T;  4GKJ K;  3T19 A;  1BWF O;  3LP0 A;  3QIP A;  2A42 A;  2O8F B;  3LDN A;  3S3M A;  3EEQ A;  1JLE A;  3O4W A;  3QBX A;  3U8X A;  4JYA K;  1KVB A;  3WEE B;  3KJV A;  4E7L A;  3I8B A;  3K0S A;  2E1Y A;  1ATR A;  4EFH A;  1LW2 A;  3P38 A;  4WFA L;  5AQO A;  2WUS A;  1LW0 A;  5A2Q O;  3OHR A;  3LDP A;  3VQ5 A;  2ASM A;  4CJS A;  2Q1N A;  3ZX0 A;  1XMQ K;  1CZB A;  4N56 A;  4ILJ A;  5KPZ A;  2D4W A;  4PWD A;  2YCH A;  3O9S A;  3IMX A;  3E9O A;  4DG1 A;  4B9T A;  5IWA K;  1SS6 A;  1HPZ A;  3V9S A;  1YUW A;  4AHT A;  3OS1 A;  1N32 K;  2X6S A;  3SQ0 A;  3TSP A;  4FXD A;  1HQE A;  3VF6 A;  1HX1 A;  3VF4 A;  1SKW A;  2XRI A;  3MEG A;  1GLA G;  2HHT A;  4OLA A;  3ZSV A;  3AVM A;  3VEV A;  3LZJ A;  1HNZ K;  1KQS M;  4N47 A;  3VEO A;  2DFF A;  2V7Y A;  1T6C A;  2VGN A;  1RT4 A;  2BTF A;  1M1K O;  2YHA A;  5HRN A;  4B3T K;  1SKS A;  3VQC A;  4K25 A;  4OKE A;  3H6E A;  4H0X B;  3L3V A;  4JLH A;  5KGX A;  4BE1 A;  2X74 A;  3PO4 A;  1NGJ A;  1NK4 A;  3K2P A;  4YDU A;  3AAR A;  3IFR A;  1C1B A;  2HMP A;  5E26 A;  3TTF A;  3WXL A;  3U3G A;  4JHD A;  3KVG A;  3M8Q A;  5AQV A;  4KTW A;  2X78 A;  4MLE A;  2RKI A;  4B1Y B;  3HO1 A;  4LF5 K;  4H0T B;  3DOL A;  4JN4 A;  3R9P A;  1HMV A;  2HNY A;  2IIR A;  4FLZ A;  1KAX A;  2Y1I A;  2GEM A;  1KSP A;  4JKG A;  3CCL N;  4BR5 A;  3P5J A;  4QS8 A;  4CZJ A;  2HHQ A;  2BE2 A;  1C1A A;  1W7A A;  5AQL A;  4GVM A;  3AVA A;  3KWI A;  3FZK A;  5J2Q A;  3I55 N;  5HLF A;  2P1J A;  1S1V A;  2P9P A;  3VQP A;  3GDQ A;  1TYQ B;  4HCC A;  3EKS A;  4AHS A;  1WSH A;  3RMB A;  3I0S A;  4FWR A;  3NF9 A;  4BR2 A;  1OKJ A;  2KHO A;  1REV A;  2A40 A;  2ATQ A;  1K6Y A;  4BRC A;  2Q0U A;  2G8V A;  2DY4 A;  2GV9 A;  5FPE A;  3VET A;  2O4I A;  3AA4 A;  3FGU A;  5GIO A;  3R3L A;  3BF1 A;  4MO5 A;  1QHA A;  5HRR A;  5GAH P;  5KQ8 A;  1DKG D;  4M3W A;  3QIN A;  3T1A A;  1BA0 A;  4DU1 A;  1L5U A;  3H08 A;  1HYV A;  2IDO A;  5I3U A;  3AVG A;  1GLE G;  2YNG A;  4ISE A;  4CK2 A;  3DLL L;  4CJV A;  4GY2 B;  1N36 K;  4G9Z A;  2HB5 A;  3ATU A;  5AQR A;  1MWM A;  1XMO K;  1TAQ A;  5C0Y A;  5LMU K;  1F21 A;  4LFC K;  4FLT A;  1VSH A;  4IOA L;  1VSD A;  3NF7 A;  1D8Y A;  4CZI A;  4JKA A;  4B9N A;  4M45 A;  1QHT A;  3U3Y A;  4JI7 K;  4FWS A;  5BN8 A;  4I7F A;  3LAN A;  4F2S A;  4JD2 A;  4DS4 A;  1Q82 O;  2WFB A;  4WYB A;  3NAE A;  4F3O A;  1U04 A;  1C6V A;  1MU2 A;  3CMA N;  5C24 A;  1TKZ A;  5FPD A;  2ZJR L;  5GAE P;  4BR4 A;  1S1T A;  3UIQ A;  3I56 N;  1DT9 A;  1QQM A;  1NJY A;  4C8L A;  2YNH A;  1YIJ N;  1HKB A;  4ZHR A;  3PX0 A;  2YI1 A;  5GIP A;  1IBL K;  3O08 A;  4FLY A;  1YF5 L;  3AAQ A;  5AQS A;  3BP8 A;  2HBK A;  1JL2 A;  1Z05 A;  1KLN A;  5AQN A;  3O3F A;  4CK1 A;  3QFP A;  2O8C A;  3LP2 A;  1P90 A;  1JLA A;  3UKR A;  3LDQ A;  4H8K A;  3FLC O;  2IGI A;  5AFU A;  3L0Q A;  4JS5 A;  2VWK A;  4RW9 A;  3SI6 A;  3AVC A;  3RR8 A;  4Y0W A;  3OYI A;  1RBT A;  1DTT A;  2ZGY A;  3AVI A;  2HBM A;  3CJ9 A;  3CFO A;  4IOC L;  1MWK A;  1ZYQ A;  4LF8 K;  2OTJ N;  1LAV A;  1CXU A;  4DFK A;  1EQY A;  1U47 A;  1VRU A;  1V4T A;  2QWP A;  3C95 A;  4G1Q A;  4CHN A;  1YI2 N;  3AVK A;  1HNW K;  1L3V A;  3EKU A;  3OYB A;  2DTU A;  1JKH A;  1A5V A;  3QEP A;  3TAG A;  4Z94 A;  1ZBL A;  2ZJP L;  3DM2 A;  4A59 A;  4HCB A;  4NLC A;  3AA2 A;  3P4I A;  5JMV A;  3UKU A;  3HP6 A;  4FPA A;  3HP9 A;  1XI1 A;  4CJP A;  4NXN K;  1GOC A;  3MXI A;  5AZJ B;  2IAJ A;  4M3T A;  3F73 A;  3V9X A;  5AQQ A;  4JI5 K;  2VQE K;  2HHX A;  4BWJ A;  1FJG K;  4HVJ A;  3ATV A;  1NKC A;  5EXW A;  4RG8 A;  1OVQ A;  4Z4G A;  2GWK A;  4BY9 C;  2FLO A;  1RBS A;  4C8K A;  1RIL A;  3TAP A;  4E89 A;  2YKN A;  3D2E B;  4H4O A;  4Q0B A;  1RT3 A;  1KCF A;  4BAC A;  2YX6 A;  4IO9 L;  2BGG A;  3HVT A;  1NGC A;  3I33 A;  3OY9 A;  4H0O A;  3CQ8 A;  4C8O A;  4IXC A;  1YTA A;  1VQ9 N;  4F9O A;  4WE1 A;  2ZJQ L;  4CZK A;  4WF9 L;  1J9A A;  4F4K A;  3O5B A;  2D0C A;  4O0J A;  4JEP A;  2IVO A;  3V1Q A;  4R79 A;  4KHP K;  3RMD A;  3CET A;  3QNO A;  4DHY A;  2DFH A;  3KLI A;  4OGE A;  4KKO A;  4DV5 K;  3SPY A;  3VEX A;  1NJI O;  3PLA A;  3R8E A;  4CFA A;  3J7Z O;  3THW B;  1RT1 A;  4FW1 A;  1KAZ A;  2A3Z A;  3KLF A;  3THX A;  2VGM A;  4FM0 A;  3AO5 A;  1WNS A;  3CJ1 A;  3PSF A;  1LWC A;  4PY5 A;  1Y64 A;  5AQK A;  3CHW A;  4CHO A;  2RPI A;  4FJK A;  2GEL A;  3QEW A;  4EZ6 A;  2F4V K;  3KHY A;  3OYH A;  4FZZ A;  4IBN A; 
#chains in the Genus database with same CATH homology
 3RTV A;  4CFB A;  1T05 A;  1HYS A;  3AV9 A;  1W9H A;  4IFY A;  4O55 A;  3L2W A;  4AIL C;  4DTO A;  1LV5 A;  1KTQ A;  4CFD A;  4UQG A;  4NCG A;  3VQA A;  2G8U A;  4DTP A;  4CEE A;  4KTQ A;  3P1G A;  3KLH A;  4CJK A;  2Z1J A;  4CER A;  5CYM A;  3EYZ A;  2KTQ A;  3V1O A;  4W5N A;  2Y1J A;  2WOM A;  3JSM A;  2QK9 A;  3NGZ A;  2HVI A;  4BE2 A;  3ZT0 A;  1L3S A;  3ZT4 A;  1QQC A;  3CG7 A;  4OPJ A;  4DSJ A;  1X1P A;  2R7Y A;  1C1C A;  1I3A A;  3LAM A;  2YNI A;  3PUF A;  1BCO A;  3K5L A;  3QER A;  4CGG A;  3OYD A;  3QET A;  3SUO A;  4FJJ A;  2AJQ A;  5KI6 A;  4W5O A;  4ELT A;  1IKV A;  4RW4 A;  5KTQ A;  3ZSX A;  4DQS A;  4DSI A;  1CLQ A;  4CJ4 A;  1NK5 A;  4OKJ A;  2FBX A;  3FFI A;  1N5Y A;  5FRM A;  5KRT A;  1QS4 A;  3LAK A;  3PO5 A;  3NE6 A;  3ZT1 A;  3OYG A;  4FLW A;  2F8S A;  5CY4 A;  3LDS A;  3AO3 A;  4Y1D A;  1RT5 A;  4EP5 A;  3L8B A;  2OZM A;  1EET A;  2YNF A;  1U48 A;  3V6D A;  3SQ4 A;  3CM6 A;  2G8K A;  1IKY A;  3C6U A;  3NGI A;  2E4L A;  4OPK A;  3WNF A;  3TAE A;  1YT3 A;  3KD1 E;  4K8X A;  2Z1I A;  4NYF A;  3LWM A;  1RDC A;  4CEF A;  1SV5 A;  3AO2 A;  4CED A;  4KHY A;  4CJL A;  4CJR A;  4CEC A;  2E6M A;  1D9F A;  1IO2 A;  1L3T A;  3C94 A;  3ALY A;  4FM1 A;  3PX6 A;  4M3Y A;  4CJT A;  3AVH A;  1KVA A;  1KFS A;  3HT3 A;  5CZ1 A;  4FYD A;  3DMJ A;  4CF8 A;  1BGX T;  1IKW A;  1VSE A;  2P51 A;  3T19 A;  4CEA A;  4CGF A;  3OYL A;  4DS5 A;  3P83 D;  3LP0 A;  4KI6 A;  3QIP A;  2VG6 A;  4KAZ A;  3ZT3 A;  5J2M A;  3KK1 A;  4KPY A;  3S3M A;  3G10 A;  3MEE A;  3PV8 A;  3ZSQ A;  4BDP A;  4FK0 A;  1JLE A;  3SUN A;  2KZM A;  1YVU A;  1WSJ A;  4N5S A;  4PQU A;  1KVB A;  3OYC A;  3KJV A;  3QNN A;  1S5J A;  4HTU A;  4DTS A;  4E7L A;  3OVN A;  3AO4 A;  1S1X A;  3OS0 A;  1LW2 A;  3OYN A;  1HJR A;  2OA8 A;  4Z4E A;  1ZBI A;  4AH9 A;  3NH2 A;  3SPZ A;  4CEO A;  1TL3 A;  2Q3S A;  1LW0 A;  4FK2 A;  4GMJ B;  2XO7 A;  3HPO A;  4M3U A;  4OGC A;  3KLG A;  3VQ5 A;  4CJS A;  4N41 A;  2G8I A;  4N76 A;  1CZB A;  3ITH A;  4QOZ B;  4N56 A;  1WAJ A;  2GBZ A;  4LH4 A;  2ZE2 A;  2X6N A;  4CIG A;  5FRN A;  4PWD A;  1VSJ A;  1WAF A;  4KB0 A;  2HND A;  5C42 A;  4Z4F A;  1EKE A;  4DG1 A;  3DRP A;  4AHU A;  4B9T A;  4C8N A;  3RRG A;  1HPZ A;  3V9S A;  4AHT A;  2WON A;  3OS1 A;  1JXE A;  2X6S A;  3C6T A;  4HUG A;  3SQ2 A;  3SQ0 A;  2P5G A;  2KFN A;  3HK2 A;  2KFZ A;  4FXD A;  1HQE A;  4KTZ A;  2G8W A;  4KFB A;  3LZI A;  1UAX A;  1SKW A;  4IG0 A;  3DOK A;  3D0P A;  2XRI A;  2O4G A;  4J2A A;  3O4N A;  3MEG A;  4BE0 A;  2XY6 A;  4CF1 A;  3M8P A;  2HHT A;  1ZBU A;  1KFD A;  3O4Q A;  2D0A A;  4CHP A;  4OLA A;  4OVL A;  2QXF A;  3ZSV A;  4R5P A;  1LWE A;  3TAR A;  4H4M A;  3AVM A;  3LZJ A;  1Q9X A;  1D9D A;  4K8Z A;  4CIF A;  1QSS A;  3TAM A;  4DTR A;  1ASV A;  3RRH A;  3ZSZ A;  2A1S A;  1DTQ A;  2DFF A;  4PA1 A;  4LH5 A;  4N47 A;  4CHZ A;  4YFU A;  4MFB A;  4IFV A;  1A5X A;  2IC3 A;  1BIZ A;  1RT4 A;  3NF8 A;  5E41 A;  4J2E A;  2YHA A;  5HRN A;  4RW8 A;  1X9S A;  1NJX A;  1BCM A;  3VQC A;  3VQ8 A;  4OKE A;  1NJZ A;  1SKS A;  1R0A A;  3M8R A;  4FLU A;  3L3V A;  4JLH A;  5KGX A;  1UA1 A;  4B9M A;  4I9Q A;  4FM2 A;  4BE1 A;  2X74 A;  1L3U A;  3PO4 A;  3HST B;  1S6P A;  4O0I A;  1NK4 A;  3K2P A;  3VQB A;  1T8E A;  4B9U A;  5D3G A;  1O1W A;  3PX4 A;  1C1B A;  4O44 A;  4DFJ A;  2KZZ A;  3U3G A;  3I0R A;  2ZQB A;  5SWM A;  1RTD A;  3VQ9 A;  3VQE A;  1U45 A;  5DK5 A;  3M8Q A;  3NBP A;  1JLQ A;  3OYJ A;  4KTW A;  1VK0 A;  4EP4 A;  2X78 A;  1FK9 A;  1SL0 A;  2B6A A;  2E6L A;  2OPS A;  2XHB A;  2RKI A;  5I42 A;  4W5T A;  4L8R B;  3HO1 A;  4Z0U A;  5HP1 A;  3EZ5 A;  2PY5 A;  3ZCM A;  1JLF A;  4TSX A;  3HXM A;  2B5J A;  3DOL A;  4GW6 A;  4DTN A;  4F8R A;  3RWU A;  1HMV A;  2HNY A;  3ISN C;  1CZ9 A;  4E7K A;  1G15 A;  4FLZ A;  4Z4I A;  4B8C A;  2Y1I A;  1ASW A;  3DRR A;  3OYM A;  1KSP A;  1HRH A;  4CHQ A;  4M41 A;  1GOA A;  5KGW A;  3S3O A;  3RMC A;  2P5O A;  3P5J A;  1FKO A;  2F96 A;  1S9E A;  3RR7 A;  2IS3 A;  2JLE A;  3CM5 A;  4ID1 A;  4CGH A;  3QEI A;  1EXQ A;  4DQP A;  3I8D A;  4FLV A;  2OPP A;  4KO0 A;  4FJX A;  2HHQ A;  1ITG A;  4DTX A;  5HRS A;  4W5Q A;  1XC9 A;  3IG1 A;  3QLH A;  3K58 A;  2XY7 A;  1KLM A;  2BE2 A;  1C1A A;  4KV8 A;  1BQN A;  4FZY A;  3ZSO A;  1QTM A;  4C8M A;  1WSE A;  3AVA A;  4GVM A;  2HW3 A;  5J2Q A;  1ZBF A;  2FBV A;  3OJS A;  2P1J A;  5HLF A;  3BDP A;  4FJH A;  1QE1 A;  3WNG A;  4AHR A;  1S1V A;  2B4J A;  3VQP A;  4CHY A;  1TKD A;  1NOY A;  3K5O A;  3DLG A;  5C25 A;  4BDY A;  4HCC A;  4ID5 A;  2BAN A;  4AHS A;  1YTU A;  1WSH A;  3RMB A;  3I0S A;  1T03 A;  3NF9 A;  2HHU A;  1J5O A;  1IG9 A;  4B3O A;  4M3X A;  1REV A;  2VG7 A;  2ATQ A;  4CJQ A;  3KIO A;  1K6Y A;  3NHG A;  4FK4 A;  5EU7 A;  2G8V A;  2DY4 A;  1UWB A;  3DLE A;  2GV9 A;  2QKB A;  1SL1 A;  1ZBH A;  3M8S A;  1NKB A;  2F8T A;  3LP3 A;  3HPH A;  4CK3 A;  4DQQ A;  2O4I A;  3NGY A;  4CGD A;  4J2D A;  1VRT A;  3AA4 A;  5J2N A;  2VWJ A;  2KQ2 A;  4B08 A;  2Z1H A;  1RDB A;  1WLJ A;  3SV3 A;  5HRR A;  1WSF A;  3L2R A;  1B9D A;  3NH1 A;  1Q9Y A;  4M3W A;  3AVL A;  3QIN A;  1LAW A;  4MQ3 A;  3KKR A;  3T1A A;  3VA0 A;  4KI4 A;  2HHV A;  4DU1 A;  2VG5 A;  1L5U A;  3H08 A;  1HYV A;  3KKS A;  3OYK A;  4ELV A;  1J54 A;  2IDO A;  4RW7 A;  5I3U A;  3AVG A;  4F2R A;  3AVJ A;  2YNG A;  4CF0 A;  4DF8 A;  4CK2 A;  3TI0 A;  3V9Z A;  1VSL A;  3NCI A;  4NCA A;  4CJV A;  3K57 A;  1SL2 A;  1RBV A;  5HRP A;  2HB5 A;  4DSK A;  4B9L A;  3DRS A;  1RDD A;  3HL8 A;  3PY8 A;  3NF6 A;  4FJN A;  1KVC A;  1TV6 A;  1TAQ A;  1Z25 A;  1BIS A;  1F21 A;  4IDK A;  3VQD A;  4FLT A;  3V81 A;  4KRF A;  4CJ3 A;  1BI4 B;  2XY5 A;  3HM9 A;  5J2P A;  1W0H A;  2ITG A;  1VSH A;  3DLR A;  1VSD A;  3JYT A;  1QSY A;  3NF7 A;  2OZS A;  3CFR A;  3LAL A;  3DYA A;  4ELU A;  1SKR A;  1RCH A;  3NH0 A;  3MXJ A;  2KW4 A;  3L3U A;  3TAN A;  1D8Y A;  2ETJ A;  4CCH A;  4B9N A;  4E7H A;  4M45 A;  4DU3 A;  5HRO A;  3HPG A;  1NJW A;  2NUB A;  1BIU A;  1QHT A;  1RT6 A;  3E01 A;  3U3Y A;  1BHL A;  1JLC A;  4PUO A;  1XHX A;  4HUF A;  3TAF A;  3IAY A;  3HJF A;  3V1R A;  4I7F A;  1HNV A;  2OPR A;  1RT2 A;  3LAN A;  3LPU A;  1NKE A;  4F2S A;  4DS4 A;  4Y1C A;  4ICL A;  2RN2 A;  4FJ7 A;  1WN7 A;  1C0U A;  1RTI A;  2Z1G A;  3SJJ A;  3NFA A;  4NYN A;  3NAE A;  4B9S A;  4F3O A;  1U04 A;  4RW6 A;  1C6V A;  4FVM A;  1A5W A;  1MU2 A;  3DLH A;  3S9H A;  4I2P A;  3WNH A;  5C24 A;  1TKZ A;  3KTQ A;  1NOZ A;  2EX3 A;  3KD5 E;  3B6O A;  3KK3 A;  1DLO A;  1VSK A;  1BQM A;  1HQU A;  1S1T A;  2I5J A;  3UIQ A;  4Q5V A;  2BDP A;  3BGR A;  1NJY A;  4C8L A;  4DSL A;  2YNH A;  3MED A;  2PZS A;  4ZHR A;  4Z4H A;  3PX0 A;  3RMA A;  3T3F A;  3QEX A;  3L2V A;  1RTH A;  2JGU A;  4FLY A;  1TK8 A;  3DLK A;  1B9F A;  4CGI A;  4DMN A;  4E19 A;  2HHW A;  2RF2 A;  1JL2 A;  3MEC A;  1TK0 A;  1KLN A;  3O3F A;  4CK1 A;  4O4G A;  3CYM A;  2HVH A;  1IH7 A;  3LP2 A;  4JRQ A;  1JLA A;  4FJG A;  4DTJ A;  4M42 A;  3DI6 A;  2G8F A;  1TVR A;  3B6P A;  1JLB A;  4BWM A;  4CF2 A;  1S1U A;  4I2Q A;  4CEB A;  4DQI A;  3G0Z A;  3OYF A;  1S1W A;  4B9V A;  4H8K A;  1GOB A;  3NDK A;  3AO1 A;  2IGI A;  1TKT A;  3V9U A;  4JS5 A;  4HUE A;  1BL3 A;  2VWK A;  4RW9 A;  3VQ4 A;  2D5R A;  4CES A;  4FLX A;  3SI6 A;  3AVC A;  1C0T A;  2OPQ A;  3HYF A;  3SUP A;  4M3Z A;  3RR8 A;  1JLG A;  2GUI A;  4DU4 A;  3ZSW A;  4LD0 A;  3OYI A;  1VSI A;  1RBT A;  4FJI A;  3AVN A;  4M3R A;  1DTT A;  5JS2 A;  4FJ9 A;  4E1N A;  1KRP A;  3AVI A;  3CFO A;  4FJ8 A;  1NK7 A;  2YKM A;  4I9L A;  1ZYQ A;  4KB1 A;  1LAV A;  4DTM A;  4LSN A;  1CXU A;  4JRP A;  4DLG A;  1U49 A;  4DFK A;  1NK0 A;  3DLB A;  4J2B A;  5FRO A;  1N6Q A;  3LWL A;  1VRU A;  1U47 A;  4AHV A;  1CXQ A;  3K5M A;  3C95 A;  1LWF A;  4G1Q A;  4CHN A;  3ULD A;  3ZT2 A;  3THV A;  4CJE A;  3AVK A;  2A1R A;  1L3V A;  3VA3 A;  4CEQ A;  4FCY A;  5FDL A;  3OYB A;  3S3N A;  1JKH A;  1A5V A;  1EP4 A;  4E1M A;  1JL1 A;  3TAG A;  3QEP A;  1XHZ A;  1T7P A;  1RNH A;  1ZBL A;  3DM2 A;  4HCB A;  1WSG A;  3AA2 A;  4KHN A;  3HP6 A;  3HP9 A;  1XI1 A;  1D5A A;  1J53 A;  4O5B A;  4CJ5 A;  2FBY A;  4CJP A;  1QSL A;  2OYQ A;  1GOC A;  4CE9 A;  3MXI A;  4OLB A;  2HMI A;  4M3T A;  2IAJ A;  3F73 A;  3V9X A;  3OS2 A;  1WSI A;  3ZSR A;  4BWJ A;  4CJU A;  2HHX A;  5CYQ A;  4LY7 A;  4HVJ A;  4E7J A;  4DSE A;  4CFC A;  4BDZ A;  3VN5 A;  4F3T A;  3AVB A;  1NKC A;  1B92 A;  4EZ9 A;  3IS9 A;  3L2U A;  4KHW A;  4RG8 A;  3CFP A;  1BI4 A;  3QO9 A;  3AVF A;  4CJF A;  1HYZ A;  3AA3 A;  4W5R A;  1S6Q A;  3SQ1 A;  4Z4G A;  4QAG A;  1S9G A;  2ZD1 A;  3OJU A;  4KHQ A;  2W42 A;  3TAB A;  1FXX A;  3OYA A;  2YHB A;  1I39 A;  1RBS A;  1Z26 A;  5CZ2 A;  4Z4C A;  4CEZ A;  3O3G A;  3TAQ A;  4C8K A;  4DWI A;  1RIL A;  3TAP A;  4XIU A;  4E89 A;  3A2F A;  2YKN A;  1Q8I A;  4H4O A;  5K14 A;  2QKK A;  3ASM A;  1UOC A;  4FJL A;  4Q0B A;  1RT3 A;  4FJ5 A;  5T7B A;  4QCL A;  1KCF A;  4BAC A;  4CGJ A;  3LP1 A;  2BGG A;  4FW2 A;  3HVT A;  4NCB A;  1EX4 A;  1SUQ A;  4DLE A;  5HBM A;  2YV0 X;  3QEV A;  2HNZ A;  3OY9 A;  3CQ8 A;  2G8H A;  4C8O A;  1U4B A;  4FZX C;  1YTA A;  1NK9 A;  2FBT A;  2LSN A;  3SYZ A;  3F9K A;  4WE1 A;  3SZ2 A;  2XY8 A;  3SV4 A;  1TKX A;  4OJR A;  1J9A A;  4F4K A;  1VSF A;  4OKK A;  1ASU A;  4DTU A;  2D0C A;  4O0J A;  4FJM A;  1XWL A;  3V1Q A;  1TL1 A;  3RMD A;  4CIE A;  3QNO A;  1RBR A;  4DFP A;  1TAU A;  4E0D A;  3TWH A;  2DFH A;  1IKX A;  3O3H A;  3KLI A;  3D45 A;  4OGE A;  4KKO A;  1UA0 A;  1RTJ A;  3WNE A;  4CJW A;  4IKF A;  1RT7 A;  4KRE A;  3SPY A;  4CF9 A;  3K5N A;  1RBU A;  4IG3 A;  1X9M A;  3SUQ A;  5J1E A;  3K59 A;  4KHS A;  4JS4 A;  3LPT A;  3EY1 A;  4AHC A;  4CFA A;  3V9W A;  3VQ7 A;  3TR8 A;  3U6F A;  2PYL A;  1RT1 A;  4FW1 A;  4E7I A;  3KLF A;  3OYE A;  3HVR A;  1X9W A;  4FM0 A;  3KK2 A;  3AO5 A;  1WNS A;  3ZSY A;  4HHT A;  3VQ6 A;  2FC0 A;  3SNN A;  2DFE A;  2IOC A;  5SZT A;  2HHS A;  5KRS A;  4DF4 A;  1FKP A;  1LWC A;  1Y97 A;  1TGO A;  2PYJ A;  4LSL A;  4PY5 A;  4DSF A;  4ZTJ A;  3V4I A;  2D0B A;  3MAQ A;  4E3S A;  2DTU A;  4CHO A;  3MXM A;  1RDA A;  2RPI A;  1HNI A;  1JXB A;  3IRX A;  3VQQ A;  4ZTF A;  1TK5 A;  3SCX A;  1C0M A;  4FJK A;  3QEW A;  3L2Q A;  3KLE A;  4B8A B;  4EZ6 A;  4YNQ A;  1VSM A;  3QIO A;  1NK6 A;  3AA5 X;  3OYH A;  2EHG A;  4DQR A;  3QES A;  4DFM A;  4KHU A;  4IBN A;  4FZZ A;  5DMR A;  5JS1 A;  1NK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...