4EP7A

Functional implications from the cid1 poly(u) polymerase crystal structure
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
340
structure length
319
Chain Sequence
b'DMSHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Functional implications from the cid1 poly(u) polymerase crystal structure.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 110
structure length 319
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4ep7A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ep7A02
1RPLA 7ICQA 3NYBA 4AT8A 4PGYA 4I27A 4O5KA 1ZQCA 3H37A 1XSPA 1ZQKA 1ZQGA 4AT9B 5IIKA 5HHIA 5D4BA 8ICNA 1BPEA 5HRIA 5J0TA 4F5OA 1MIYA 4WCWA 4KLSA 5CR0A 4Z6EA 5CP2A 4GXKA 8ICBA 4P4MA 4IQUA 1UEUA 5IIOA 3WFPA 8ICUA 2B56A 4F5RA 2B51A 4X4QA 4PH5A 5BOLA 7ICRA 4KLTA 5HR9A 2M2WA 4XUSA 2BCUA 1ZQOA 3OVSA 5F2VO 4NM1A 1ZQQA 4WC2A 2HHPA 4ATBA 4MFCA 3OGUA 4UD5A 5CA7A 5HRHA 5J2HA 4WC7A 4WBYA 1V4AA 5CJ7A 4XRHA 1ZQAA 5HREA 2ID1A 7ICEA 4QZBA 4RPYA 5DBCA 3L9DA 7ICFA 7ICTA 8ICCA 4I2JA 5EOZA 4WC4A 2ISOA 9ICLA 9ICPA 5J2KA 3PMNA 4UB4A 4YD1A 3UXPA 8ICSA 3UXOA 4RQ3A 1ZQRA 1MQ3A 2DR8A 3AUOA 7ICHA 4MFFA 2ZH9A 1ZQDA 4Z6FA 4P2HA 5IILA 3HIYA 4NKUA 2NRKA 5J0SA 4QZFA 3OVAA 3ISDA 1ZQIA 1WOTA 4NLNA 4IQTA 2PXIA 5J2IA 4M9NA 3H3AA 4I28A 1ZQEA 4RQ2A 4X4OA 5J2GA 8ICJA 1VJ7A 4KLFA 4DOBA 2ZH4A 4NXZA 4UAYA 3RH4A 4NM2A 5HRLA 4O5CA 3JPRA 2ZH3A 5HRKA 5DBAA 4RT2A 4KLUA 3AQKA 7ICSA 4KLQA 4RWQA 1ZQXA 5HRFA 8ICWA 9ICHA 8ICGA 1BPDA 4KLIA 4NY8A 1R8CA 7ICJA 9ICGA 4KLEA 1ZQLA 4EP7A 3HWTA 1JN3A 2BCVA 4M5DA 4I2GA 4UB3A 5DBBA 1NO5A 5HRGA 4TUSA 4S3NA 7ICUA 4RPXA 4WC6A 4X4SA 2FMSA 2PFQA 9ICBA 4P4OA 1ZQVA 8ICZA 4RPZA 4M9HA 2P66A 2BPCA 1JMSA 3C2LA 2I9GA 1JQRA 1UEVA 4WC5A 3JPPA 2M2UA 5DEDA 2BCSA 4R63A 2FMQA 3RJGA 4XQ8A 4MF8A 3WFRE 2FMPA 4E7XA 3V7LA 2B4VA 5DB8A 4MF2A 8ICRA 1HUZA 1ZQPA 1ZQWA 4P4PA 2O1PA 2BCRA 9ICOA 3JPSA 4LT6A 9ICRA 3RH6A 4RQ7A 5J0RA 4UB5A 4PHAA 1KDHA 8ICTA 1F5AA 1VFGA 4F5QA 2ZH8A 4I2BA 4JWNA 2ZH7A 4QZAA 3AU2A 3RJEA 2GWSA 4KLJA 3MGHA 9ICNA 1ZQUA 4F5PA 1XSLA 3UXNA 1ZQSA 4FHYA 2DR7A 1FA0A 4UB2A 3JPNA 3C5FA 1ZJMA 1BPZA 3K75D 4R64A 4ATBB 2PFPA 4RT3A 5DB6A 4KLHA 1ZQMA 3PMLA 4WC1A 7ICVA 3UPSA 3MDAA 2RFFA 1TFYA 4DOCA 3GDXA 4FHVA 4X5VA 5DB9A 9ICUA 9ICQA 4RQ0A 4M2YA 4NLKA 1ZQYA 4PPXA 1YLQA 4I2HA 5J0UA 3AQLA 5IIJA 4Z6CA 4NLZA 5CWRA 4QZIA 3C5GA 4QZEA 4QZHA 4E80A 1MQ2A 1UETA 4QZGA 3WFSC 9ICSA 1NOMA 2M2VA 4I2DA 4AT7A 8ICHA 2M2TA 8ICVA 4KLGA 4R66A 2Q66A 4K4HA 4QZ9A 2PFOA 4NKTA 3HW8A 1ZQZA 4K4IA 8ICAA 7ICIA 1R89A 5J2AA 1TFWA 5DDMA 3OUYA 4X0AA 9ICTA 3V7JA 1ZQHA 1BPBA 3OV7A 4X4UA 4O5EA 4FHPA 9ICAA 2ZHBA 1OU5A 4YCXA 4I29A 4O9MA 5DECA 4RQ6A 4GXJA 3V7KA 2ZH5A 2DRBA 1XSNA 3RJFA 4X4VA 3MDCA 8ICYA 4MFAA 4RQ5A 9ICEA 4WBZA 4M9GA 3JPOA 3TFRA 4WC3A 1R8BA 4EBJA 3UQ2A 4TURA 1TV9A 4FH3A 5IIMA 5IINA 4YN4A 3RJKA 4IQWA 3V72A 8ICKA 4RWNA 3MBYA 4JWMA 4YMNA 5HHHA 3HJ4A 8ICFA 4UB1A 5BOMA 1ZQNA 7ICKA 3LK9A 8ICEA 9ICWA 4RQ1A 4AT8B 4LZGA 4KLMA 3H38A 1ZQTA 4WC0A 3OVBA 4TUQA 5DDYA 4RWOA 3HX0A 2O5AA 3JYYA 1RZTA 3B0XA 2ZH1A 4M9JA 4AT9A 4XQ7A 5J2EA 2W9MA 8ICMA 9ICXA 1PX5A 4UBCA 2DR9A 4FHXA 4F5NA 5J0WA 2PBEA 4TUPA 4I2CA 3UPQA 4UAZA 4KLOA 4RQ8A 4QZCA 4QZ8A 3ISBA 3RJHA 4I2AA 5D49A 9ICFA 8ICOA 1ZQFA 4GXIA 7ICLA 2BPGA 5J0XA 4I2IA 1TVAA 3JPQA 3ISCA 5DB7A 8ICXA 1KNYA 4RQ4A 4FO6A 9ICVA 2ZH6A 4M04A 4UD4A 7ICPA 1MIVA 2BE3A 4IQVA 5HRDA 5TZVA 4K4GA 7ICNA 2BCQA 4X4PA 4PHDA 5J0PA 7ICGA 5J0QA 3JPTA 5D46A 4KLDA 4DOAA 2ZHAA 4DO9A 4QZDA 4FHWA 1MIWA 3RJJA 4PHEA 5J0YA 4E8FA 3TFSA 4XA5A 8ICQA 4EBKA 3WFQE 8ICIA 4AT7B 3H39A 7ICMA 1R8AA 2IHMA 9ICIA 3MGIA 3UQ0A 4M0AA 9ICKA 4M47A 1Q79A 1ZQBA 2PFNA 4YMOA 1HUOA 2BPFA 3AQMA 1BPXA 4IG8A 3OUYB 9ICJA 2VANA 4PGXA 2DVIA 9ICCA 5J2CA 4M9LA 4X4NA 4KLLA 3C2KA 4LZDA 7ICOA 5IIIA 4YMMA 5DKWA 4YD2A 8ICLA 3WFOA 3JZ0A 3LQCB 1Q78A 3HJ1A 5CB1A 5J0OA 4R65A 9ICMA 4UBBA 5J2DA 5J2BA 2ZH2A 4UAWA 1BPYA 5J29A 4RWPA 4X0BA 1ZJNA 4PGQA 5HRBA 3RJIA 2ISPA 4X4RA 1JAJA 5HC9A 4I2EA 4PHPA 3AU6A 4X4TA 5J2JA 1ZQJA 8ICPA 4Z6DA 2DRAA 4I2FA 3C18A 3C2MA 3PNCA 5BPCA 1KEJA 5CHGA 4FH5A 3C66A 3RH5A 2DR5A 4LVSA 3B0YA 3AQNA 5J2FA
chains in the Genus database with same CATH superfamily
1RPLA 7ICQA 3NYBA 4JLZA 4AT8A 4PGYA 4I27A 4O5KA 1ZQCA 3H37A 5D62A 1XSPA 1ZQKA 1ZQGA 4AT9B 4XJEA 5IIKA 5HHIA 5D4BA 8ICNA 4LEZA 1BPEA 5HRIA 5J0TA 4F5OA 1MIYA 4WCWA 4KLSA 5CR0A 2GA9D 4Z6EA 5CP2A 4GXKA 8ICBA 4P4MA 4IQUA 1UEUA 4KM5A 5IIOA 3WFPA 8ICUA 2B56A 4F5RA 2B51A 4X4QA 4PH5A 5BOLA 7ICRA 4KLTA 5HR9A 4NXVA 2M2WA 4XUSA 2BCUA 1ZQOA 3OVSA 2HN1A 5F2VO 4NM1A 1ZQQA 4WC2A 2HHPA 4ATBA 3ER8C 4MFCA 3OGUA 4UD5A 5CA7A 4MKPA 4WH5A 4O6AA 5HRHA 5J2HA 4WC7A 4WBYA 1V4AA 5CJ7A 4XRHA 4LEWA 1ZQAA 3JCFA 5HREA 2ID1A 7ICEA 4QZBA 4RPYA 5DBCA 3L9DA 7ICFA 7ICTA 8ICCA 4I2JA 5EOZA 4WC4A 2ISOA 9ICLA 9ICPA 5J2KA 4UB4A 3PMNA 4YD1A 3UXPA 8ICSA 3UXOA 4RQ3A 1ZQRA 4HX0A 1MQ3A 2DR8A 3AUOA 7ICHA 4MFFA 2ZH9A 1ZQDA 4NXTA 4Z6FA 4P2HA 5IILA 3HIYA 4LEVA 5CFUA 4NKUA 2NRKA 3OVAA 5J0SA 4QZFA 3ISDA 1ZQIA 1WOTA 4NLNA 4IQTA 2PXIA 5J2IA 4M9NA 3H3AA 4I28A 4WQKA 1ZQEA 4RQ2A 4X4OA 5J2GA 8ICJA 1VJ7A 4KLFA 4DOBA 2ZH4A 4NXZA 4UAYA 3RH4A 4NM2A 5HRLA 4O5CA 3JPRA 4OAIZ 2ZH3A 5HRKA 5DBAA 4RT2A 4KLUA 3AQKA 7ICSA 4KLQA 4RWQA 1ZQXA 5HRFA 8ICWA 9ICHA 8ICGA 1BPDA 4KLIA 4NY8A 1R8CA 7ICJA 9ICGA 4KB6A 4KLEA 1ZQLA 4EP7A 3HWTA 1JN3A 2BCVA 4M5DA 4I2GA 4UB3A 5DBBA 1NO5A 5HRGA 4TUSA 4S3NA 7ICUA 4RPXA 4X4SA 4WC6A 2FMSA 5B3QA 2PFQA 9ICBA 4P4OA 1ZQVA 8ICZA 4RPZA 4M9HA 2P66A 2BPCA 1JMSA 3C2LA 2I9GA 1JQRA 1UEVA 3NWIA 4WC5A 3JPPA 2M2UA 5DEDA 2BCSA 4R63A 5B3PA 2FMQA 3RJGA 4XQ8A 4MF8A 3WFRE 2FMPA 4E7XA 3V7LA 2B4VA 5DB8A 4MF2A 1GPJA 8ICRA 1HUZA 4FO1A 1ZQPA 1ZQWA 4P4PA 2O1PA 2BCRA 9ICOA 3JPSA 4LT6A 9ICRA 3RH6A 4RQ7A 5J0RA 4UB5A 4WQLA 4PHAA 1KDHA 8ICTA 1F5AA 1VFGA 4F5QA 2ZH8A 4I2BA 4JWNA 2ZH7A 4QZAA 3AU2A 3RJEA 2GWSA 4KLJA 4O68A 3MGHA 9ICNA 1ZQUA 4F5PA 1XSLA 3PHZA 3UXNA 1ZQSA 4FHYA 2DR7A 1FA0A 4NXUA 4UB2A 3JPNA 3C5FA 1ZJMA 1BPZA 3K75D 4R64A 4ATBB 2PFPA 4RT3A 5DB6A 4KLHA 1ZQMA 3PMLA 4WC1A 7ICVA 3UPSA 3MDAA 2RFFA 1TFYA 4DOCA 3GDXA 4FHVA 4X5VA 5DB9A 9ICUA 9ICQA 4RQ0A 4M2YA 4NLKA 1ZQYA 4PPXA 1YLQA 4I2HA 5J0UA 2GAFD 3AQLA 5IIJA 4Z6CA 4NLZA 5CWRA 4QZIA 3C5GA 4QZEA 4QZHA 4E80A 1MQ2A 1UETA 4QZGA 3WFSC 9ICSA 1NOMA 2M2VA 5CHEA 4AT7A 4I2DA 8ICHA 2M2TA 8ICVA 4KLGA 3ERCC 4R66A 2Q66A 4O69A 4K4HA 2EWRA 4QZ9A 2PFOA 4NKTA 3HW8A 1ZQZA 4K4IA 4N7RA 8ICAA 4WOYA 1R89A 1TFWA 5J2AA 7ICIA 5DDMA 3OUYA 4X0AA 9ICTA 4K8VA 3V7JA 1ZQHA 1BPBA 3OV7A 3MCRA 4X4UA 4O5EA 4FHPA 9ICAA 2ZHBA 4K97A 1OU5A 4YCXA 4I29A 4O9MA 5DECA 4RQ6A 4GXJA 3V7KA 4K98A 3K7DA 2ZH5A 2DRBA 1XSNA 3RJFA 4X4VA 3MDCA 8ICYA 3OWGA 3NVOA 4MFAA 4RQ5A 9ICEA 4WBZA 4M9GA 3JPOA 3TFRA 4WC3A 1R8BA 4EBJA 3UQ2A 4TURA 1TV9A 4FH3A 5IIMA 5IINA 3EF2A 4YN4A 3RJKA 4IQWA 3V72A 8ICKA 4RWNA 3MBYA 4JWMA 4OAGA 4YMNA 4K9AA 5HHHA 3HJ4A 8ICFA 4UB1A 4K9BA 5BOMA 1ZQNA 7ICKA 3LK9A 8ICEA 9ICWA 4RQ1A 4AT8B 5D61A 3NKUA 4LZGA 4KLMA 3H38A 1ZQTA 4WC0A 2IUBA 3OVBA 4TUQA 5DDYA 4RWOA 3HX0A 2O5AA 3JYYA 1RZTA 2ZH1A 3B0XA 4M9JA 4AT9A 4XQ7A 5J2EA 2W9MA 8ICMA 9ICXA 1PX5A 4UBCA 2DR9A 4FHXA 4F5NA 5J0WA 2PBEA 4TUPA 4I2CA 3UPQA 4UAZA 4KLOA 4RQ8A 4QZCA 4QZ8A 3ISBA 3RJHA 4I2AA 5D49A 9ICFA 2IHOA 8ICOA 1ZQFA 4GXIA 7ICLA 2BPGA 5J0XA 4I2IA 1TVAA 3JPQA 4NXWA 2HN2A 3ISCA 5DB7A 4K99A 8ICXA 1KNYA 4RQ4A 4FO6A 9ICVA 2ZH6A 4JLXA 4UD4A 4M04A 7ICPA 1MIVA 2BE3A 4I0UA 4IQVA 5HRDA 4LEYA 5TZVA 4K4GA 7ICNA 2BCQA 4X4PA 4PHDA 5J0PA 7ICGA 5J0QA 4EV6A 4EGWA 3CK6A 3JPTA 5D46A 4KLDA 4DOAA 2ZHAA 4DO9A 4QZDA 5CFTA 4FHWA 4OAHA 1MIWA 3RJJA 4PHEA 5J0YA 4E8FA 3TFSA 4XA5A 4K96A 5JTGA 8ICQA 4EBKA 4O67A 4OAFA 5CFSA 3WFQE 8ICIA 4AT7B 3H39A 7ICMA 1R8AA 2IHMA 9ICIA 3MGIA 3UQ0A 4M0AA 9ICKA 2BBJA 1Q79A 4M47A 1ZQBA 2PFNA 4YMOA 1HUOA 2BPFA 3AQMA 1BPXA 4IG8A 3OUYB 9ICJA 2VANA 4PGXA 2DVIA 5D63A 9ICCA 5J2CA 4M9LA 4X4NA 4KLLA 3C2KA 4LZDA 7ICOA 5IIIA 4YMMA 5DKWA 4YD2A 8ICLA 3WFOA 3JZ0A 3LQCB 1Q78A 4EEDA 3HJ1A 5CB1A 4NXXA 5J0OA 4EEBA 4R65A 9ICMA 4UBBA 2ZH2A 5J2DA 5J2BA 4UAWA 1BPYA 4RWPA 5J29A 4X0BA 2FCLA 4PGQA 1ZJNA 5HRBA 3RJIA 2ISPA 4X4RA 2BBHA 1JAJA 5HC9A 4I2EA 4PHPA 3AU6A 4X4TA 5J2JA 1ZQJA 8ICPA 4Z6DA 2DRAA 4I2FA 3C18A 3C2MA 3PNCA 5BPCA 1KEJA 5CHGA 4FH5A 3C66A 3RH5A 2DR5A 4LVSA 3B0YA 3AQNA 3ER9B 5J2FA
chains in the Genus database with same CATH topology
1RPLA 7ICQA 3NYBA 4JLZA 4AT8A 4PGYA 4I27A 4O5KA 1ZQCA 3H37A 1XSPA 1ZQKA 1ZQGA 4AT9B 5IIKA 5HHIA 5D4BA 8ICNA 4LEZA 1BPEA 5HRIA 5J0TA 4F5OA 1MIYA 4WCWA 4KLSA 5CR0A 4Z6EA 5CP2A 4GXKA 8ICBA 4P4MA 4IQUA 1UEUA 4KM5A 5IIOA 3WFPA 8ICUA 2B56A 4F5RA 2B51A 4X4QA 4PH5A 5BOLA 7ICRA 4KLTA 5HR9A 4NXVA 2M2WA 4XUSA 2BCUA 1ZQOA 3OVSA 5F2VO 4NM1A 1ZQQA 4WC2A 2HHPA 4ATBA 4MFCA 3OGUA 4UD5A 5CA7A 4MKPA 4O6AA 5HRHA 5J2HA 4WC7A 4WBYA 1V4AA 5CJ7A 4XRHA 4LEWA 1ZQAA 5HREA 2ID1A 7ICEA 4QZBA 4RPYA 5DBCA 3L9DA 7ICFA 7ICTA 8ICCA 4I2JA 5EOZA 4WC4A 2ISOA 9ICLA 9ICPA 5J2KA 4UB4A 3PMNA 4YD1A 3UXPA 8ICSA 3UXOA 4RQ3A 1ZQRA 1MQ3A 2DR8A 3AUOA 7ICHA 4MFFA 2ZH9A 1ZQDA 4NXTA 4Z6FA 4P2HA 5IILA 3HIYA 4LEVA 4NKUA 2NRKA 3OVAA 5J0SA 4QZFA 3ISDA 1ZQIA 1WOTA 4NLNA 4IQTA 2PXIA 5J2IA 4M9NA 3H3AA 4I28A 1ZQEA 4RQ2A 4X4OA 5J2GA 8ICJA 1VJ7A 4KLFA 4DOBA 2ZH4A 4NXZA 4UAYA 3RH4A 4NM2A 5HRLA 4O5CA 3JPRA 4OAIZ 2ZH3A 5HRKA 5DBAA 4RT2A 4KLUA 3AQKA 7ICSA 4KLQA 4RWQA 1ZQXA 5HRFA 8ICWA 9ICHA 8ICGA 1BPDA 4KLIA 4NY8A 1R8CA 7ICJA 9ICGA 4KB6A 4KLEA 1ZQLA 4EP7A 3HWTA 1JN3A 2BCVA 4M5DA 4I2GA 4UB3A 5DBBA 1NO5A 5HRGA 4TUSA 4S3NA 7ICUA 4RPXA 4X4SA 4WC6A 2FMSA 2PFQA 9ICBA 4P4OA 1ZQVA 8ICZA 4RPZA 4M9HA 2P66A 2BPCA 1JMSA 3C2LA 2I9GA 1JQRA 1UEVA 4WC5A 3JPPA 2M2UA 5DEDA 2BCSA 4R63A 2FMQA 3RJGA 4XQ8A 4MF8A 3WFRE 2FMPA 4E7XA 3V7LA 2B4VA 5DB8A 4MF2A 8ICRA 1HUZA 1ZQPA 1ZQWA 4P4PA 2O1PA 2BCRA 9ICOA 3JPSA 4LT6A 9ICRA 3RH6A 4RQ7A 5J0RA 4UB5A 4PHAA 1KDHA 8ICTA 1F5AA 1VFGA 4F5QA 2ZH8A 4I2BA 4JWNA 2ZH7A 4QZAA 3AU2A 3RJEA 2GWSA 4KLJA 4O68A 3MGHA 9ICNA 1ZQUA 4F5PA 1XSLA 3UXNA 1ZQSA 4FHYA 2DR7A 1FA0A 4NXUA 4UB2A 3JPNA 3C5FA 1ZJMA 1BPZA 3K75D 4R64A 4ATBB 2PFPA 4RT3A 5DB6A 4KLHA 1ZQMA 3PMLA 4WC1A 7ICVA 3UPSA 3MDAA 2RFFA 1TFYA 4DOCA 3GDXA 4FHVA 4X5VA 5DB9A 9ICUA 9ICQA 4RQ0A 4M2YA 4NLKA 1ZQYA 4PPXA 1YLQA 4I2HA 5J0UA 3AQLA 5IIJA 4Z6CA 4NLZA 5CWRA 4QZIA 3C5GA 4QZEA 4QZHA 4E80A 1MQ2A 1UETA 4QZGA 3WFSC 9ICSA 1NOMA 2M2VA 4AT7A 4I2DA 8ICHA 2M2TA 8ICVA 4KLGA 4R66A 2Q66A 4O69A 4K4HA 4QZ9A 2PFOA 4NKTA 3HW8A 1ZQZA 4K4IA 8ICAA 4WOYA 1R89A 1TFWA 5J2AA 7ICIA 5DDMA 3OUYA 4X0AA 9ICTA 4K8VA 3V7JA 1ZQHA 1BPBA 3OV7A 4X4UA 4O5EA 4FHPA 9ICAA 2ZHBA 4K97A 1OU5A 4YCXA 4I29A 4O9MA 5DECA 4RQ6A 4GXJA 3V7KA 4K98A 2ZH5A 2DRBA 1XSNA 3RJFA 4X4VA 3MDCA 8ICYA 4MFAA 4RQ5A 9ICEA 4WBZA 4M9GA 3JPOA 3TFRA 4WC3A 1R8BA 4EBJA 3UQ2A 4TURA 1TV9A 4FH3A 5IIMA 5IINA 4YN4A 3RJKA 4IQWA 3V72A 8ICKA 4RWNA 3MBYA 4JWMA 4OAGA 4YMNA 4K9AA 5HHHA 3HJ4A 8ICFA 4UB1A 4K9BA 5BOMA 1ZQNA 7ICKA 3LK9A 8ICEA 9ICWA 4RQ1A 4AT8B 4LZGA 4KLMA 3H38A 1ZQTA 4WC0A 3OVBA 4TUQA 5DDYA 4RWOA 3HX0A 2O5AA 3JYYA 1RZTA 2ZH1A 3B0XA 4M9JA 4AT9A 4XQ7A 5J2EA 2W9MA 8ICMA 9ICXA 1PX5A 4UBCA 2DR9A 4FHXA 4F5NA 5J0WA 2PBEA 4TUPA 4I2CA 3UPQA 4UAZA 4KLOA 4RQ8A 4QZCA 4QZ8A 3ISBA 3RJHA 4I2AA 5D49A 9ICFA 8ICOA 1ZQFA 4GXIA 7ICLA 2BPGA 5J0XA 4I2IA 1TVAA 3JPQA 4NXWA 3ISCA 5DB7A 4K99A 8ICXA 1KNYA 4RQ4A 4FO6A 9ICVA 2ZH6A 4JLXA 4UD4A 4M04A 7ICPA 1MIVA 2BE3A 4IQVA 5HRDA 4LEYA 5TZVA 4K4GA 7ICNA 2BCQA 4X4PA 4PHDA 5J0PA 7ICGA 5J0QA 3JPTA 5D46A 4KLDA 4DOAA 2ZHAA 4DO9A 4QZDA 4FHWA 4OAHA 1MIWA 3RJJA 4PHEA 5J0YA 4E8FA 3TFSA 4XA5A 4K96A 8ICQA 4EBKA 4O67A 4OAFA 3WFQE 8ICIA 4AT7B 3H39A 7ICMA 1R8AA 2IHMA 9ICIA 3MGIA 3UQ0A 4M0AA 9ICKA 4M47A 1Q79A 1ZQBA 2PFNA 4YMOA 1HUOA 2BPFA 3AQMA 1BPXA 4IG8A 3OUYB 9ICJA 2VANA 4PGXA 2DVIA 9ICCA 5J2CA 4M9LA 4X4NA 4KLLA 3C2KA 4LZDA 7ICOA 5IIIA 4YMMA 5DKWA 4YD2A 8ICLA 3WFOA 3JZ0A 3LQCB 1Q78A 3HJ1A 5CB1A 4NXXA 5J0OA 4R65A 9ICMA 4UBBA 2ZH2A 5J2DA 5J2BA 4UAWA 1BPYA 5J29A 4RWPA 4X0BA 1ZJNA 4PGQA 5HRBA 3RJIA 2ISPA 4X4RA 1JAJA 5HC9A 4I2EA 4PHPA 3AU6A 4X4TA 5J2JA 1ZQJA 8ICPA 4Z6DA 2DRAA 4I2FA 3C18A 3C2MA 3PNCA 5BPCA 1KEJA 5CHGA 4FH5A 3C66A 3RH5A 2DR5A 4LVSA 3B0YA 3AQNA 5J2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RPL A;  7ICQ A;  3NYB A;  4AT8 A;  4PGY A;  4I27 A;  4O5K A;  1ZQC A;  3H37 A;  1XSP A;  1ZQK A;  1ZQG A;  4AT9 B;  5IIK A;  5HHI A;  5D4B A;  8ICN A;  1BPE A;  5HRI A;  5J0T A;  4F5O A;  1MIY A;  4WCW A;  4KLS A;  5CR0 A;  4Z6E A;  5CP2 A;  4GXK A;  8ICB A;  4P4M A;  4IQU A;  1UEU A;  5IIO A;  3WFP A;  8ICU A;  2B56 A;  4F5R A;  2B51 A;  4X4Q A;  4PH5 A;  5BOL A;  7ICR A;  4KLT A;  5HR9 A;  2M2W A;  4XUS A;  2BCU A;  1ZQO A;  3OVS A;  5F2V O;  4NM1 A;  1ZQQ A;  4WC2 A;  2HHP A;  4ATB A;  4MFC A;  3OGU A;  4UD5 A;  5CA7 A;  5HRH A;  5J2H A;  4WC7 A;  4WBY A;  1V4A A;  5CJ7 A;  4XRH A;  1ZQA A;  5HRE A;  2ID1 A;  7ICE A;  4QZB A;  4RPY A;  5DBC A;  3L9D A;  7ICF A;  7ICT A;  8ICC A;  4I2J A;  5EOZ A;  4WC4 A;  2ISO A;  9ICL A;  9ICP A;  5J2K A;  3PMN A;  4UB4 A;  4YD1 A;  3UXP A;  8ICS A;  3UXO A;  4RQ3 A;  1ZQR A;  1MQ3 A;  2DR8 A;  3AUO A;  7ICH A;  4MFF A;  2ZH9 A;  1ZQD A;  4Z6F A;  4P2H A;  5IIL A;  3HIY A;  4NKU A;  2NRK A;  5J0S A;  4QZF A;  3OVA A;  3ISD A;  1ZQI A;  1WOT A;  4NLN A;  4IQT A;  2PXI A;  5J2I A;  4M9N A;  3H3A A;  4I28 A;  1ZQE A;  4RQ2 A;  4X4O A;  5J2G A;  8ICJ A;  1VJ7 A;  4KLF A;  4DOB A;  2ZH4 A;  4NXZ A;  4UAY A;  3RH4 A;  4NM2 A;  5HRL A;  4O5C A;  3JPR A;  2ZH3 A;  5HRK A;  5DBA A;  4RT2 A;  4KLU A;  3AQK A;  7ICS A;  4KLQ A;  4RWQ A;  1ZQX A;  5HRF A;  8ICW A;  9ICH A;  8ICG A;  1BPD A;  4KLI A;  4NY8 A;  1R8C A;  7ICJ A;  9ICG A;  4KLE A;  1ZQL A;  4EP7 A;  3HWT A;  1JN3 A;  2BCV A;  4M5D A;  4I2G A;  4UB3 A;  5DBB A;  1NO5 A;  5HRG A;  4TUS A;  4S3N A;  7ICU A;  4RPX A;  4WC6 A;  4X4S A;  2FMS A;  2PFQ A;  9ICB A;  4P4O A;  1ZQV A;  8ICZ A;  4RPZ A;  4M9H A;  2P66 A;  2BPC A;  1JMS A;  3C2L A;  2I9G A;  1JQR A;  1UEV A;  4WC5 A;  3JPP A;  2M2U A;  5DED A;  2BCS A;  4R63 A;  2FMQ A;  3RJG A;  4XQ8 A;  4MF8 A;  3WFR E;  2FMP A;  4E7X A;  3V7L A;  2B4V A;  5DB8 A;  4MF2 A;  8ICR A;  1HUZ A;  1ZQP A;  1ZQW A;  4P4P A;  2O1P A;  2BCR A;  9ICO A;  3JPS A;  4LT6 A;  9ICR A;  3RH6 A;  4RQ7 A;  5J0R A;  4UB5 A;  4PHA A;  1KDH A;  8ICT A;  1F5A A;  1VFG A;  4F5Q A;  2ZH8 A;  4I2B A;  4JWN A;  2ZH7 A;  4QZA A;  3AU2 A;  3RJE A;  2GWS A;  4KLJ A;  3MGH A;  9ICN A;  1ZQU A;  4F5P A;  1XSL A;  3UXN A;  1ZQS A;  4FHY A;  2DR7 A;  1FA0 A;  4UB2 A;  3JPN A;  3C5F A;  1ZJM A;  1BPZ A;  3K75 D;  4R64 A;  4ATB B;  2PFP A;  4RT3 A;  5DB6 A;  4KLH A;  1ZQM A;  3PML A;  4WC1 A;  7ICV A;  3UPS A;  3MDA A;  2RFF A;  1TFY A;  4DOC A;  3GDX A;  4FHV A;  4X5V A;  5DB9 A;  9ICU A;  9ICQ A;  4RQ0 A;  4M2Y A;  4NLK A;  1ZQY A;  4PPX A;  1YLQ A;  4I2H A;  5J0U A;  3AQL A;  5IIJ A;  4Z6C A;  4NLZ A;  5CWR A;  4QZI A;  3C5G A;  4QZE A;  4QZH A;  4E80 A;  1MQ2 A;  1UET A;  4QZG A;  3WFS C;  9ICS A;  1NOM A;  2M2V A;  4I2D A;  4AT7 A;  8ICH A;  2M2T A;  8ICV A;  4KLG A;  4R66 A;  2Q66 A;  4K4H A;  4QZ9 A;  2PFO A;  4NKT A;  3HW8 A;  1ZQZ A;  4K4I A;  8ICA A;  7ICI A;  1R89 A;  5J2A A;  1TFW A;  5DDM A;  3OUY A;  4X0A A;  9ICT A;  3V7J A;  1ZQH A;  1BPB A;  3OV7 A;  4X4U A;  4O5E A;  4FHP A;  9ICA A;  2ZHB A;  1OU5 A;  4YCX A;  4I29 A;  4O9M A;  5DEC A;  4RQ6 A;  4GXJ A;  3V7K A;  2ZH5 A;  2DRB A;  1XSN A;  3RJF A;  4X4V A;  3MDC A;  8ICY A;  4MFA A;  4RQ5 A;  9ICE A;  4WBZ A;  4M9G A;  3JPO A;  3TFR A;  4WC3 A;  1R8B A;  4EBJ A;  3UQ2 A;  4TUR A;  1TV9 A;  4FH3 A;  5IIM A;  5IIN A;  4YN4 A;  3RJK A;  4IQW A;  3V72 A;  8ICK A;  4RWN A;  3MBY A;  4JWM A;  4YMN A;  5HHH A;  3HJ4 A;  8ICF A;  4UB1 A;  5BOM A;  1ZQN A;  7ICK A;  3LK9 A;  8ICE A;  9ICW A;  4RQ1 A;  4AT8 B;  4LZG A;  4KLM A;  3H38 A;  1ZQT A;  4WC0 A;  3OVB A;  4TUQ A;  5DDY A;  4RWO A;  3HX0 A;  2O5A A;  3JYY A;  1RZT A;  3B0X A;  2ZH1 A;  4M9J A;  4AT9 A;  4XQ7 A;  5J2E A;  2W9M A;  8ICM A;  9ICX A;  1PX5 A;  4UBC A;  2DR9 A;  4FHX A;  4F5N A;  5J0W A;  2PBE A;  4TUP A;  4I2C A;  3UPQ A;  4UAZ A;  4KLO A;  4RQ8 A;  4QZC A;  4QZ8 A;  3ISB A;  3RJH A;  4I2A A;  5D49 A;  9ICF A;  8ICO A;  1ZQF A;  4GXI A;  7ICL A;  2BPG A;  5J0X A;  4I2I A;  1TVA A;  3JPQ A;  3ISC A;  5DB7 A;  8ICX A;  1KNY A;  4RQ4 A;  4FO6 A;  9ICV A;  2ZH6 A;  4M04 A;  4UD4 A;  7ICP A;  1MIV A;  2BE3 A;  4IQV A;  5HRD A;  5TZV A;  4K4G A;  7ICN A;  2BCQ A;  4X4P A;  4PHD A;  5J0P A;  7ICG A;  5J0Q A;  3JPT A;  5D46 A;  4KLD A;  4DOA A;  2ZHA A;  4DO9 A;  4QZD A;  4FHW A;  1MIW A;  3RJJ A;  4PHE A;  5J0Y A;  4E8F A;  3TFS A;  4XA5 A;  8ICQ A;  4EBK A;  3WFQ E;  8ICI A;  4AT7 B;  3H39 A;  7ICM A;  1R8A A;  2IHM A;  9ICI A;  3MGI A;  3UQ0 A;  4M0A A;  9ICK A;  4M47 A;  1Q79 A;  1ZQB A;  2PFN A;  4YMO A;  1HUO A;  2BPF A;  3AQM A;  1BPX A;  4IG8 A;  3OUY B;  9ICJ A;  2VAN A;  4PGX A;  2DVI A;  9ICC A;  5J2C A;  4M9L A;  4X4N A;  4KLL A;  3C2K A;  4LZD A;  7ICO A;  5III A;  4YMM A;  5DKW A;  4YD2 A;  8ICL A;  3WFO A;  3JZ0 A;  3LQC B;  1Q78 A;  3HJ1 A;  5CB1 A;  5J0O A;  4R65 A;  9ICM A;  4UBB A;  5J2D A;  5J2B A;  2ZH2 A;  4UAW A;  1BPY A;  5J29 A;  4RWP A;  4X0B A;  1ZJN A;  4PGQ A;  5HRB A;  3RJI A;  2ISP A;  4X4R A;  1JAJ A;  5HC9 A;  4I2E A;  4PHP A;  3AU6 A;  4X4T A;  5J2J A;  1ZQJ A;  8ICP A;  4Z6D A;  2DRA A;  4I2F A;  3C18 A;  3C2M A;  3PNC A;  5BPC A;  1KEJ A;  5CHG A;  4FH5 A;  3C66 A;  3RH5 A;  2DR5 A;  4LVS A;  3B0Y A;  3AQN A;  5J2F A; 
#chains in the Genus database with same CATH topology
 1RPL A;  7ICQ A;  3NYB A;  4JLZ A;  4AT8 A;  4PGY A;  4I27 A;  4O5K A;  1ZQC A;  3H37 A;  5D62 A;  1XSP A;  1ZQK A;  1ZQG A;  4AT9 B;  4XJE A;  5IIK A;  5HHI A;  5D4B A;  8ICN A;  4LEZ A;  1BPE A;  5HRI A;  5J0T A;  4F5O A;  1MIY A;  4WCW A;  4KLS A;  5CR0 A;  2GA9 D;  4Z6E A;  5CP2 A;  4GXK A;  8ICB A;  4P4M A;  4IQU A;  1UEU A;  4KM5 A;  5IIO A;  3WFP A;  8ICU A;  2B56 A;  4F5R A;  2B51 A;  4X4Q A;  4PH5 A;  5BOL A;  7ICR A;  4KLT A;  5HR9 A;  4NXV A;  2M2W A;  4XUS A;  2BCU A;  1ZQO A;  3OVS A;  2HN1 A;  5F2V O;  4NM1 A;  1ZQQ A;  4WC2 A;  2HHP A;  4ATB A;  3ER8 C;  4MFC A;  3OGU A;  4UD5 A;  5CA7 A;  4MKP A;  4WH5 A;  4O6A A;  5HRH A;  5J2H A;  4WC7 A;  4WBY A;  1V4A A;  5CJ7 A;  4XRH A;  4LEW A;  1ZQA A;  3JCF A;  5HRE A;  2ID1 A;  7ICE A;  4QZB A;  4RPY A;  5DBC A;  3L9D A;  7ICF A;  7ICT A;  8ICC A;  4I2J A;  5EOZ A;  4WC4 A;  2ISO A;  9ICL A;  9ICP A;  5J2K A;  4UB4 A;  3PMN A;  4YD1 A;  3UXP A;  8ICS A;  3UXO A;  4RQ3 A;  1ZQR A;  4HX0 A;  1MQ3 A;  2DR8 A;  3AUO A;  7ICH A;  4MFF A;  2ZH9 A;  1ZQD A;  4NXT A;  4Z6F A;  4P2H A;  5IIL A;  3HIY A;  4LEV A;  5CFU A;  4NKU A;  2NRK A;  3OVA A;  5J0S A;  4QZF A;  3ISD A;  1ZQI A;  1WOT A;  4NLN A;  4IQT A;  2PXI A;  5J2I A;  4M9N A;  3H3A A;  4I28 A;  4WQK A;  1ZQE A;  4RQ2 A;  4X4O A;  5J2G A;  8ICJ A;  1VJ7 A;  4KLF A;  4DOB A;  2ZH4 A;  4NXZ A;  4UAY A;  3RH4 A;  4NM2 A;  5HRL A;  4O5C A;  3JPR A;  4OAI Z;  2ZH3 A;  5HRK A;  5DBA A;  4RT2 A;  4KLU A;  3AQK A;  7ICS A;  4KLQ A;  4RWQ A;  1ZQX A;  5HRF A;  8ICW A;  9ICH A;  8ICG A;  1BPD A;  4KLI A;  4NY8 A;  1R8C A;  7ICJ A;  9ICG A;  4KB6 A;  4KLE A;  1ZQL A;  4EP7 A;  3HWT A;  1JN3 A;  2BCV A;  4M5D A;  4I2G A;  4UB3 A;  5DBB A;  1NO5 A;  5HRG A;  4TUS A;  4S3N A;  7ICU A;  4RPX A;  4X4S A;  4WC6 A;  2FMS A;  5B3Q A;  2PFQ A;  9ICB A;  4P4O A;  1ZQV A;  8ICZ A;  4RPZ A;  4M9H A;  2P66 A;  2BPC A;  1JMS A;  3C2L A;  2I9G A;  1JQR A;  1UEV A;  3NWI A;  4WC5 A;  3JPP A;  2M2U A;  5DED A;  2BCS A;  4R63 A;  5B3P A;  2FMQ A;  3RJG A;  4XQ8 A;  4MF8 A;  3WFR E;  2FMP A;  4E7X A;  3V7L A;  2B4V A;  5DB8 A;  4MF2 A;  1GPJ A;  8ICR A;  1HUZ A;  4FO1 A;  1ZQP A;  1ZQW A;  4P4P A;  2O1P A;  2BCR A;  9ICO A;  3JPS A;  4LT6 A;  9ICR A;  3RH6 A;  4RQ7 A;  5J0R A;  4UB5 A;  4WQL A;  4PHA A;  1KDH A;  8ICT A;  1F5A A;  1VFG A;  4F5Q A;  2ZH8 A;  4I2B A;  4JWN A;  2ZH7 A;  4QZA A;  3AU2 A;  3RJE A;  2GWS A;  4KLJ A;  4O68 A;  3MGH A;  9ICN A;  1ZQU A;  4F5P A;  1XSL A;  3PHZ A;  3UXN A;  1ZQS A;  4FHY A;  2DR7 A;  1FA0 A;  4NXU A;  4UB2 A;  3JPN A;  3C5F A;  1ZJM A;  1BPZ A;  3K75 D;  4R64 A;  4ATB B;  2PFP A;  4RT3 A;  5DB6 A;  4KLH A;  1ZQM A;  3PML A;  4WC1 A;  7ICV A;  3UPS A;  3MDA A;  2RFF A;  1TFY A;  4DOC A;  3GDX A;  4FHV A;  4X5V A;  5DB9 A;  9ICU A;  9ICQ A;  4RQ0 A;  4M2Y A;  4NLK A;  1ZQY A;  4PPX A;  1YLQ A;  4I2H A;  5J0U A;  2GAF D;  3AQL A;  5IIJ A;  4Z6C A;  4NLZ A;  5CWR A;  4QZI A;  3C5G A;  4QZE A;  4QZH A;  4E80 A;  1MQ2 A;  1UET A;  4QZG A;  3WFS C;  9ICS A;  1NOM A;  2M2V A;  5CHE A;  4AT7 A;  4I2D A;  8ICH A;  2M2T A;  8ICV A;  4KLG A;  3ERC C;  4R66 A;  2Q66 A;  4O69 A;  4K4H A;  2EWR A;  4QZ9 A;  2PFO A;  4NKT A;  3HW8 A;  1ZQZ A;  4K4I A;  4N7R A;  8ICA A;  4WOY A;  1R89 A;  1TFW A;  5J2A A;  7ICI A;  5DDM A;  3OUY A;  4X0A A;  9ICT A;  4K8V A;  3V7J A;  1ZQH A;  1BPB A;  3OV7 A;  3MCR A;  4X4U A;  4O5E A;  4FHP A;  9ICA A;  2ZHB A;  4K97 A;  1OU5 A;  4YCX A;  4I29 A;  4O9M A;  5DEC A;  4RQ6 A;  4GXJ A;  3V7K A;  4K98 A;  3K7D A;  2ZH5 A;  2DRB A;  1XSN A;  3RJF A;  4X4V A;  3MDC A;  8ICY A;  3OWG A;  3NVO A;  4MFA A;  4RQ5 A;  9ICE A;  4WBZ A;  4M9G A;  3JPO A;  3TFR A;  4WC3 A;  1R8B A;  4EBJ A;  3UQ2 A;  4TUR A;  1TV9 A;  4FH3 A;  5IIM A;  5IIN A;  3EF2 A;  4YN4 A;  3RJK A;  4IQW A;  3V72 A;  8ICK A;  4RWN A;  3MBY A;  4JWM A;  4OAG A;  4YMN A;  4K9A A;  5HHH A;  3HJ4 A;  8ICF A;  4UB1 A;  4K9B A;  5BOM A;  1ZQN A;  7ICK A;  3LK9 A;  8ICE A;  9ICW A;  4RQ1 A;  4AT8 B;  5D61 A;  3NKU A;  4LZG A;  4KLM A;  3H38 A;  1ZQT A;  4WC0 A;  2IUB A;  3OVB A;  4TUQ A;  5DDY A;  4RWO A;  3HX0 A;  2O5A A;  3JYY A;  1RZT A;  2ZH1 A;  3B0X A;  4M9J A;  4AT9 A;  4XQ7 A;  5J2E A;  2W9M A;  8ICM A;  9ICX A;  1PX5 A;  4UBC A;  2DR9 A;  4FHX A;  4F5N A;  5J0W A;  2PBE A;  4TUP A;  4I2C A;  3UPQ A;  4UAZ A;  4KLO A;  4RQ8 A;  4QZC A;  4QZ8 A;  3ISB A;  3RJH A;  4I2A A;  5D49 A;  9ICF A;  2IHO A;  8ICO A;  1ZQF A;  4GXI A;  7ICL A;  2BPG A;  5J0X A;  4I2I A;  1TVA A;  3JPQ A;  4NXW A;  2HN2 A;  3ISC A;  5DB7 A;  4K99 A;  8ICX A;  1KNY A;  4RQ4 A;  4FO6 A;  9ICV A;  2ZH6 A;  4JLX A;  4UD4 A;  4M04 A;  7ICP A;  1MIV A;  2BE3 A;  4I0U A;  4IQV A;  5HRD A;  4LEY A;  5TZV A;  4K4G A;  7ICN A;  2BCQ A;  4X4P A;  4PHD A;  5J0P A;  7ICG A;  5J0Q A;  4EV6 A;  4EGW A;  3CK6 A;  3JPT A;  5D46 A;  4KLD A;  4DOA A;  2ZHA A;  4DO9 A;  4QZD A;  5CFT A;  4FHW A;  4OAH A;  1MIW A;  3RJJ A;  4PHE A;  5J0Y A;  4E8F A;  3TFS A;  4XA5 A;  4K96 A;  5JTG A;  8ICQ A;  4EBK A;  4O67 A;  4OAF A;  5CFS A;  3WFQ E;  8ICI A;  4AT7 B;  3H39 A;  7ICM A;  1R8A A;  2IHM A;  9ICI A;  3MGI A;  3UQ0 A;  4M0A A;  9ICK A;  2BBJ A;  1Q79 A;  4M47 A;  1ZQB A;  2PFN A;  4YMO A;  1HUO A;  2BPF A;  3AQM A;  1BPX A;  4IG8 A;  3OUY B;  9ICJ A;  2VAN A;  4PGX A;  2DVI A;  5D63 A;  9ICC A;  5J2C A;  4M9L A;  4X4N A;  4KLL A;  3C2K A;  4LZD A;  7ICO A;  5III A;  4YMM A;  5DKW A;  4YD2 A;  8ICL A;  3WFO A;  3JZ0 A;  3LQC B;  1Q78 A;  4EED A;  3HJ1 A;  5CB1 A;  4NXX A;  5J0O A;  4EEB A;  4R65 A;  9ICM A;  4UBB A;  2ZH2 A;  5J2D A;  5J2B A;  4UAW A;  1BPY A;  4RWP A;  5J29 A;  4X0B A;  2FCL A;  4PGQ A;  1ZJN A;  5HRB A;  3RJI A;  2ISP A;  4X4R A;  2BBH A;  1JAJ A;  5HC9 A;  4I2E A;  4PHP A;  3AU6 A;  4X4T A;  5J2J A;  1ZQJ A;  8ICP A;  4Z6D A;  2DRA A;  4I2F A;  3C18 A;  3C2M A;  3PNC A;  5BPC A;  1KEJ A;  5CHG A;  4FH5 A;  3C66 A;  3RH5 A;  2DR5 A;  4LVS A;  3B0Y A;  3AQN A;  3ER9 B;  5J2F A; 
#chains in the Genus database with same CATH homology
 1RPL A;  7ICQ A;  3NYB A;  4JLZ A;  4AT8 A;  4PGY A;  4I27 A;  4O5K A;  1ZQC A;  3H37 A;  1XSP A;  1ZQK A;  1ZQG A;  4AT9 B;  5IIK A;  5HHI A;  5D4B A;  8ICN A;  4LEZ A;  1BPE A;  5HRI A;  5J0T A;  4F5O A;  1MIY A;  4WCW A;  4KLS A;  5CR0 A;  4Z6E A;  5CP2 A;  4GXK A;  8ICB A;  4P4M A;  4IQU A;  1UEU A;  4KM5 A;  5IIO A;  3WFP A;  8ICU A;  2B56 A;  4F5R A;  2B51 A;  4X4Q A;  4PH5 A;  5BOL A;  7ICR A;  4KLT A;  5HR9 A;  4NXV A;  2M2W A;  4XUS A;  2BCU A;  1ZQO A;  3OVS A;  5F2V O;  4NM1 A;  1ZQQ A;  4WC2 A;  2HHP A;  4ATB A;  4MFC A;  3OGU A;  4UD5 A;  5CA7 A;  4MKP A;  4O6A A;  5HRH A;  5J2H A;  4WC7 A;  4WBY A;  1V4A A;  5CJ7 A;  4XRH A;  4LEW A;  1ZQA A;  5HRE A;  2ID1 A;  7ICE A;  4QZB A;  4RPY A;  5DBC A;  3L9D A;  7ICF A;  7ICT A;  8ICC A;  4I2J A;  5EOZ A;  4WC4 A;  2ISO A;  9ICL A;  9ICP A;  5J2K A;  4UB4 A;  3PMN A;  4YD1 A;  3UXP A;  8ICS A;  3UXO A;  4RQ3 A;  1ZQR A;  1MQ3 A;  2DR8 A;  3AUO A;  7ICH A;  4MFF A;  2ZH9 A;  1ZQD A;  4NXT A;  4Z6F A;  4P2H A;  5IIL A;  3HIY A;  4LEV A;  4NKU A;  2NRK A;  3OVA A;  5J0S A;  4QZF A;  3ISD A;  1ZQI A;  1WOT A;  4NLN A;  4IQT A;  2PXI A;  5J2I A;  4M9N A;  3H3A A;  4I28 A;  1ZQE A;  4RQ2 A;  4X4O A;  5J2G A;  8ICJ A;  1VJ7 A;  4KLF A;  4DOB A;  2ZH4 A;  4NXZ A;  4UAY A;  3RH4 A;  4NM2 A;  5HRL A;  4O5C A;  3JPR A;  4OAI Z;  2ZH3 A;  5HRK A;  5DBA A;  4RT2 A;  4KLU A;  3AQK A;  7ICS A;  4KLQ A;  4RWQ A;  1ZQX A;  5HRF A;  8ICW A;  9ICH A;  8ICG A;  1BPD A;  4KLI A;  4NY8 A;  1R8C A;  7ICJ A;  9ICG A;  4KB6 A;  4KLE A;  1ZQL A;  4EP7 A;  3HWT A;  1JN3 A;  2BCV A;  4M5D A;  4I2G A;  4UB3 A;  5DBB A;  1NO5 A;  5HRG A;  4TUS A;  4S3N A;  7ICU A;  4RPX A;  4X4S A;  4WC6 A;  2FMS A;  2PFQ A;  9ICB A;  4P4O A;  1ZQV A;  8ICZ A;  4RPZ A;  4M9H A;  2P66 A;  2BPC A;  1JMS A;  3C2L A;  2I9G A;  1JQR A;  1UEV A;  4WC5 A;  3JPP A;  2M2U A;  5DED A;  2BCS A;  4R63 A;  2FMQ A;  3RJG A;  4XQ8 A;  4MF8 A;  3WFR E;  2FMP A;  4E7X A;  3V7L A;  2B4V A;  5DB8 A;  4MF2 A;  8ICR A;  1HUZ A;  1ZQP A;  1ZQW A;  4P4P A;  2O1P A;  2BCR A;  9ICO A;  3JPS A;  4LT6 A;  9ICR A;  3RH6 A;  4RQ7 A;  5J0R A;  4UB5 A;  4PHA A;  1KDH A;  8ICT A;  1F5A A;  1VFG A;  4F5Q A;  2ZH8 A;  4I2B A;  4JWN A;  2ZH7 A;  4QZA A;  3AU2 A;  3RJE A;  2GWS A;  4KLJ A;  4O68 A;  3MGH A;  9ICN A;  1ZQU A;  4F5P A;  1XSL A;  3UXN A;  1ZQS A;  4FHY A;  2DR7 A;  1FA0 A;  4NXU A;  4UB2 A;  3JPN A;  3C5F A;  1ZJM A;  1BPZ A;  3K75 D;  4R64 A;  4ATB B;  2PFP A;  4RT3 A;  5DB6 A;  4KLH A;  1ZQM A;  3PML A;  4WC1 A;  7ICV A;  3UPS A;  3MDA A;  2RFF A;  1TFY A;  4DOC A;  3GDX A;  4FHV A;  4X5V A;  5DB9 A;  9ICU A;  9ICQ A;  4RQ0 A;  4M2Y A;  4NLK A;  1ZQY A;  4PPX A;  1YLQ A;  4I2H A;  5J0U A;  3AQL A;  5IIJ A;  4Z6C A;  4NLZ A;  5CWR A;  4QZI A;  3C5G A;  4QZE A;  4QZH A;  4E80 A;  1MQ2 A;  1UET A;  4QZG A;  3WFS C;  9ICS A;  1NOM A;  2M2V A;  4AT7 A;  4I2D A;  8ICH A;  2M2T A;  8ICV A;  4KLG A;  4R66 A;  2Q66 A;  4O69 A;  4K4H A;  4QZ9 A;  2PFO A;  4NKT A;  3HW8 A;  1ZQZ A;  4K4I A;  8ICA A;  4WOY A;  1R89 A;  1TFW A;  5J2A A;  7ICI A;  5DDM A;  3OUY A;  4X0A A;  9ICT A;  4K8V A;  3V7J A;  1ZQH A;  1BPB A;  3OV7 A;  4X4U A;  4O5E A;  4FHP A;  9ICA A;  2ZHB A;  4K97 A;  1OU5 A;  4YCX A;  4I29 A;  4O9M A;  5DEC A;  4RQ6 A;  4GXJ A;  3V7K A;  4K98 A;  2ZH5 A;  2DRB A;  1XSN A;  3RJF A;  4X4V A;  3MDC A;  8ICY A;  4MFA A;  4RQ5 A;  9ICE A;  4WBZ A;  4M9G A;  3JPO A;  3TFR A;  4WC3 A;  1R8B A;  4EBJ A;  3UQ2 A;  4TUR A;  1TV9 A;  4FH3 A;  5IIM A;  5IIN A;  4YN4 A;  3RJK A;  4IQW A;  3V72 A;  8ICK A;  4RWN A;  3MBY A;  4JWM A;  4OAG A;  4YMN A;  4K9A A;  5HHH A;  3HJ4 A;  8ICF A;  4UB1 A;  4K9B A;  5BOM A;  1ZQN A;  7ICK A;  3LK9 A;  8ICE A;  9ICW A;  4RQ1 A;  4AT8 B;  4LZG A;  4KLM A;  3H38 A;  1ZQT A;  4WC0 A;  3OVB A;  4TUQ A;  5DDY A;  4RWO A;  3HX0 A;  2O5A A;  3JYY A;  1RZT A;  2ZH1 A;  3B0X A;  4M9J A;  4AT9 A;  4XQ7 A;  5J2E A;  2W9M A;  8ICM A;  9ICX A;  1PX5 A;  4UBC A;  2DR9 A;  4FHX A;  4F5N A;  5J0W A;  2PBE A;  4TUP A;  4I2C A;  3UPQ A;  4UAZ A;  4KLO A;  4RQ8 A;  4QZC A;  4QZ8 A;  3ISB A;  3RJH A;  4I2A A;  5D49 A;  9ICF A;  8ICO A;  1ZQF A;  4GXI A;  7ICL A;  2BPG A;  5J0X A;  4I2I A;  1TVA A;  3JPQ A;  4NXW A;  3ISC A;  5DB7 A;  4K99 A;  8ICX A;  1KNY A;  4RQ4 A;  4FO6 A;  9ICV A;  2ZH6 A;  4JLX A;  4UD4 A;  4M04 A;  7ICP A;  1MIV A;  2BE3 A;  4IQV A;  5HRD A;  4LEY A;  5TZV A;  4K4G A;  7ICN A;  2BCQ A;  4X4P A;  4PHD A;  5J0P A;  7ICG A;  5J0Q A;  3JPT A;  5D46 A;  4KLD A;  4DOA A;  2ZHA A;  4DO9 A;  4QZD A;  4FHW A;  4OAH A;  1MIW A;  3RJJ A;  4PHE A;  5J0Y A;  4E8F A;  3TFS A;  4XA5 A;  4K96 A;  8ICQ A;  4EBK A;  4O67 A;  4OAF A;  3WFQ E;  8ICI A;  4AT7 B;  3H39 A;  7ICM A;  1R8A A;  2IHM A;  9ICI A;  3MGI A;  3UQ0 A;  4M0A A;  9ICK A;  4M47 A;  1Q79 A;  1ZQB A;  2PFN A;  4YMO A;  1HUO A;  2BPF A;  3AQM A;  1BPX A;  4IG8 A;  3OUY B;  9ICJ A;  2VAN A;  4PGX A;  2DVI A;  9ICC A;  5J2C A;  4M9L A;  4X4N A;  4KLL A;  3C2K A;  4LZD A;  7ICO A;  5III A;  4YMM A;  5DKW A;  4YD2 A;  8ICL A;  3WFO A;  3JZ0 A;  3LQC B;  1Q78 A;  3HJ1 A;  5CB1 A;  4NXX A;  5J0O A;  4R65 A;  9ICM A;  4UBB A;  2ZH2 A;  5J2D A;  5J2B A;  4UAW A;  1BPY A;  5J29 A;  4RWP A;  4X0B A;  1ZJN A;  4PGQ A;  5HRB A;  3RJI A;  2ISP A;  4X4R A;  1JAJ A;  5HC9 A;  4I2E A;  4PHP A;  3AU6 A;  4X4T A;  5J2J A;  1ZQJ A;  8ICP A;  4Z6D A;  2DRA A;  4I2F A;  3C18 A;  3C2M A;  3PNC A;  5BPC A;  1KEJ A;  5CHG A;  4FH5 A;  3C66 A;  3RH5 A;  2DR5 A;  4LVS A;  3B0Y A;  3AQN A;  5J2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...