4EP7A

Functional implications from the cid1 poly(u) polymerase crystal structure
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
340
structure length
319
Chain Sequence
DMSHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional implications from the cid1 poly(u) polymerase crystal structure.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
molecule keywords Poly(A) RNA polymerase protein cid1
total genus 110
structure length 319
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4ep7A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ep7A02
3C2LA 2DRAA 4DO9A 4RQ7A 7ICIA 3OUYA 5IIMA 8ICMA 4WC3A 5CB1A 5IINA 4UAYA 4F5NA 2PFPA 4AT9A 4IQUA 4QZBA 1ZQIA 5CP2A 4X4NA 3TFRA 5DBCA 2ZHBA 4RQ0A 4UAWA 4Z6CA 2M2WA 4QZHA 3WFRE 3H37A 4KLLA 9ICAA 2FMSA 2ZH2A 4S3NA 4R63A 2BCVA 3C5FA 4UB3A 4O9MA 4UBCA 4PHAA 5HREA 4KLUA 1TFWA 2P66A 4X5VA 3RJKA 3RH4A 4Z6EA 9ICFA 5J0WA 5J2CA 2ID1A 2M2VA 4UD4A 2VANA 2B4VA 4WBZA 4RQ2A 4UD5A 4WCWA 1JAJA 8ICGA 9ICJA 3AQMA 5F2VO 1UEUA 1XSNA 5DBAA 4FHYA 4M47A 4TUPA 7ICTA 4QZEA 5HR9A 5J0UA 2DVIA 8ICSA 4X4OA 3ISBA 1ZQGA 3UXNA 5J2FA 3WFSC 4I2JA 3AQKA 3ISCA 1HUZA 4I2HA 4X4QA 4YN4A 4I27A 4AT7A 4MF8A 3GDXA 4QZCA 1KNYA 3MBYA 3RH5A 2Q66A 2ZH1A 5J2BA 2ZH4A 4FH5A 4WC5A 3RH6A 4IQTA 3UQ0A 1BPYA 1ZQLA 1ZQSA 3RJJA 5IIIA 8ICHA 1ZQJA 4K4GA 1ZQTA 3HJ1A 3OVBA 2BPGA 5TZVA 5J0PA 5DB7A 4MFCA 1ZJMA 1MIWA 3RJEA 5J2EA 3RJGA 3LQCB 4RWOA 1ZQDA 1NOMA 4RQ6A 4KLIA 2BCRA 1ZQWA 3V7JA 1ZQRA 4YD2A 7ICUA 7ICFA 4YMOA 5BOLA 2DR8A 4O5EA 9ICSA 4PH5A 5J2DA 4DOBA 4I28A 8ICEA 5HRGA 4FHWA 1ZQPA 2PFNA 3UXPA 5HRFA 1ZQKA 3MDCA 4QZ9A 1ZQQA 1Q79A 4NM2A 7ICEA 3B0YA 9ICIA 1PX5A 4MFFA 3PMNA 4MFAA 8ICJA 4M9NA 8ICIA 4M9LA 3RJFA 4UB1A 1ZQOA 9ICPA 4YD1A 1KDHA 4I29A 5J0OA 5IIKA 4I2AA 4Z6FA 5J0QA 3AU2A 9ICLA 7ICLA 4WC0A 2DRBA 7ICOA 4X4PA 3H38A 4RPXA 4LZDA 7ICQA 5CA7A 5IIOA 4NM1A 5D4BA 4K4IA 4QZDA 4I2BA 1R8CA 3AQNA 4F5PA 1ZQXA 4P4PA 2ZH8A 5BPCA 1R89A 4NXZA 8ICKA 3JYYA 1ZQEA 3WFQE 5HC9A 9ICBA 4XQ8A 3JPPA 5CJ7A 1ZQHA 1BPBA 8ICYA 4M9GA 4R65A 2B51A 2ZHAA 2I9GA 8ICPA 3WFOA 5DECA 2PFQA 4JWMA 7ICMA 4KLEA 1KEJA 2ZH5A 9ICVA 3B0XA 5HRHA 4NLNA 3JPRA 3JPNA 4UBBA 2GWSA 9ICTA 8ICVA 1MQ3A 3V72A 4KLDA 5D46A 4PPXA 1MIYA 4RWNA 1ZQAA 4I2CA 4UAZA 8ICLA 8ICZA 4NLZA 3K75D 4RWPA 4TURA 4P2HA 9ICKA 1TFYA 3OGUA 3JPSA 5DKWA 5DDMA 4EBJA 1R8AA 4X4UA 9ICNA 9ICWA 4QZ8A 3OVSA 4RPZA 4QZFA 3LK9A 2M2UA 7ICSA 3C2MA 4P4OA 7ICVA 4NLKA 4RQ8A 3MGHA 1Q78A 1F5AA 4RQ1A 4KLGA 5HRIA 4WC7A 3RJIA 2O1PA 1BPDA 3HW8A 5J29A 4M5DA 4QZAA 4ATBB 3AQLA 2M2TA 2HHPA 1OU5A 1VJ7A 4IQVA 4RWQA 5DBBA 2ZH7A 4LZGA 4NY8A 1WOTA 2ZH3A 5J0YA 1ZQFA 1NO5A 5J0TA 2O5AA 2PBEA 5J2IA 4FHVA 4LVSA 8ICXA 4EP7A 4YMMA 3JPTA 1BPXA 4KLQA 3C2KA 1RZTA 4XRHA 4TUSA 4WC1A 4X4SA 3ISDA 8ICFA 4E80A 2IHMA 3JPQA 5D49A 3C5GA 4IQWA 8ICCA 8ICTA 4F5RA 4NKTA 4KLFA 3AU6A 4RPYA 4UB4A 2FMPA 2DR7A 5HHHA 4X4RA 4AT9B 4PGQA 3C18A 4M9JA 7ICKA 4GXIA 4MF2A 4UB5A 5BOMA 4PHPA 1MQ2A 4YMNA 4QZIA 4JWNA 5HRKA 4KLSA 4EBKA 4IG8A 4RQ5A 3V7KA 4KLJA 4WBYA 5DB8A 8ICWA 9ICOA 8ICOA 3JZ0A 4I2EA 4UB2A 3WFPA 4GXKA 1XSLA 1ZQCA 2B56A 4M2YA 3PNCA 4I2GA 1R8BA 3JPOA 5HRBA 5J2JA 4KLTA 7ICRA 4RQ4A 3H3AA 3OUYB 4X0AA 1ZJNA 4M0AA 4O5CA 8ICNA 4E8FA 9ICUA 4YCXA 2BE3A 4E7XA 5J2HA 8ICBA 9ICMA 4GXJA 9ICCA 3TFSA 1MIVA 2BCQA 4X0BA 4FHPA 3RJHA 1ZQYA 4NKUA 3HX0A 3PMLA 1UEVA 4PGYA 4FHXA 1JN3A 5CR0A 8ICAA 1TVAA 2RFFA 5EOZA 2ISPA 8ICRA 2BCSA 3OV7A 3UQ2A 4I2DA 7ICHA 4WC4A 2DR9A 2PXIA 4TUQA 5DB9A 1ZQZA 4PHEA 5DDYA 7ICNA 4KLMA 4RQ3A 9ICGA 8ICUA 1ZQBA 2FMQA 4WC6A 1V4AA 9ICQA 1HUOA 5DEDA 4Z6DA 4O5KA 4AT7B 5J0XA 9ICEA 4ATBA 7ICJA 2PFOA 3V7LA 5IIJA 4KLHA 2BPCA 7ICGA 1VFGA 1RPLA 1TV9A 4PHDA 2W9MA 5HRDA 5CHGA 3L9DA 4KLOA 4FH3A 3HIYA 3UPSA 1ZQVA 2DR5A 2BCUA 1JQRA 1JMSA 3UXOA 4LT6A 4XA5A 4XQ7A 4PGXA 4I2FA 5HHIA 3AUOA 3H39A 4M9HA 4AT8A 4RT3A 4F5QA 2ZH9A 4X4VA 5HRLA 1FA0A 5J0RA 1BPZA 1ZQUA 2BPFA 3NYBA 3MDAA 7ICPA 4RT2A 4R64A 5DB6A 4M04A 4DOCA 3MGIA 9ICRA 2NRKA 4AT8B 4XUSA 3C66A 1XSPA 5CWRA 1BPEA 3UPQA 2ISOA 9ICHA 3HJ4A 1UETA 4F5OA 3OVAA 4I2IA 5J0SA 3HWTA 2ZH6A 1YLQA 4QZGA 1ZQNA 8ICQA 4X4TA 5J2GA 4P4MA 1ZQMA 5J2AA 4WC2A 4R66A 5IILA 5J2KA 4FO6A 9ICXA 4DOAA 4K4HA
chains in the Genus database with same CATH superfamily
2DRAA 3C2LA 4DO9A 4RQ7A 4K99A 7ICIA 3OUYA 5IIMA 8ICMA 4WC3A 4OAGA 5CB1A 5IINA 4UAYA 4F5NA 4X4NA 4AT9A 4K98A 4IQUA 4QZBA 5CP2A 1ZQIA 2PFPA 3TFRA 4EEDA 5DBCA 2BBHA 2ZHBA 4HX0A 4RQ0A 2FCLA 4UAWA 4Z6CA 2M2WA 4QZHA 3PHZA 3WFRE 3H37A 4KLLA 9ICAA 2FMSA 2ZH2A 4S3NA 4R63A 3NWIA 2BCVA 3C5FA 1TFWA 4UB3A 4UBCA 4PHAA 5HREA 4O9MA 4KLUA 4WH5A 2P66A 4X5VA 4OAFA 3RJKA 3RH4A 4Z6EA 9ICFA 5J0WA 5J2CA 2ID1A 2M2VA 4UD4A 2IUBA 2VANA 2B4VA 4WBZA 4RQ2A 4UD5A 4WCWA 1JAJA 8ICGA 9ICJA 3AQMA 5F2VO 1UEUA 1XSNA 5DBAA 4FHYA 5B3PA 4M47A 4FO1A 4TUPA 4QZEA 5HR9A 7ICTA 4NXVA 5J0UA 2DVIA 8ICSA 4X4OA 3ISBA 1ZQGA 3UXNA 5J2FA 3WFSC 4I2JA 3NVOA 3AQKA 3ISCA 1HUZA 4I2HA 4X4QA 4YN4A 4I27A 4AT7A 3K7DA 4MF8A 4O6AA 3GDXA 4QZCA 1KNYA 3MBYA 3RH5A 2ZH1A 2Q66A 4OAIZ 5J2BA 2ZH4A 4KM5A 4FH5A 4WC5A 3RH6A 4IQTA 3UQ0A 1BPYA 1ZQLA 1ZQSA 3RJJA 5IIIA 8ICHA 1ZQJA 4K4GA 1ZQTA 3MCRA 3HJ1A 3OVBA 2BPGA 5TZVA 5J0PA 5DB7A 4MFCA 4WOYA 1ZJMA 1MIWA 3RJEA 4LEWA 5J2EA 3RJGA 3LQCB 4RWOA 1ZQDA 1NOMA 4RQ6A 4KLIA 2BCRA 1ZQWA 3V7JA 1ZQRA 4YD2A 7ICUA 7ICFA 4YMOA 5BOLA 2DR8A 4O5EA 9ICSA 4PH5A 5J2DA 4DOBA 4I28A 8ICEA 5HRGA 4FHWA 1ZQPA 2PFNA 3UXPA 5HRFA 1ZQKA 2IHOA 3MDCA 4QZ9A 1ZQQA 1Q79A 4NM2A 7ICEA 3B0YA 9ICIA 1PX5A 4MFFA 3PMNA 4MFAA 8ICJA 4M9NA 8ICIA 4M9LA 3RJFA 4UB1A 1ZQOA 9ICPA 4YD1A 1KDHA 4I29A 4LEYA 5J0OA 5IIKA 4I2AA 4Z6FA 4OAHA 5J0QA 3AU2A 9ICLA 7ICLA 2DRBA 4WC0A 7ICOA 4X4PA 4NXUA 3H38A 4RPXA 4LZDA 7ICQA 5CA7A 4EEBA 5IIOA 4NM1A 4K96A 4WQLA 5D4BA 4K4IA 4QZDA 4WQKA 4I2BA 1R8CA 3AQNA 5CFTA 1ZQXA 4F5PA 4P4PA 2ZH8A 5BPCA 1R89A 4JLXA 4NXZA 8ICKA 3JYYA 1ZQEA 3WFQE 5HC9A 9ICBA 4XQ8A 3JPPA 5CJ7A 1ZQHA 1BPBA 8ICYA 4M9GA 4R65A 2B51A 2ZHAA 2I9GA 8ICPA 3WFOA 5DECA 2PFQA 4JWMA 7ICMA 4KLEA 1KEJA 3ER8C 2ZH5A 9ICVA 5CHEA 3B0XA 5HRHA 4NLNA 3JPRA 3JPNA 4UBBA 2GWSA 9ICTA 8ICVA 1MQ3A 3V72A 4KLDA 4K4HA 3NKUA 5D46A 4PPXA 5B3QA 1MIYA 4RWNA 5CFUA 1ZQAA 4I2CA 2HN2A 4UAZA 8ICLA 8ICZA 4NLZA 3K75D 4RWPA 5D63A 4TURA 4LEZA 4P2HA 9ICKA 1TFYA 3OGUA 3JPSA 5DKWA 5DDMA 4EBJA 1R8AA 4X4UA 9ICNA 9ICWA 3OVSA 4QZ8A 4RPZA 4QZFA 3LK9A 2M2UA 7ICSA 4NXTA 3C2MA 4P4OA 7ICVA 4XJEA 4NLKA 4RQ8A 3MGHA 1Q78A 1F5AA 4RQ1A 4O68A 4KLGA 5HRIA 4WC7A 1GPJA 3RJIA 2O1PA 1BPDA 3HW8A 5J29A 4M5DA 4QZAA 4ATBB 3AQLA 2M2TA 2HHPA 5JTGA 4MKPA 5D61A 1OU5A 1VJ7A 4IQVA 4LEVA 4RWQA 5DBBA 2ZH7A 4LZGA 4NY8A 2ZH3A 1WOTA 5J0YA 1ZQFA 1NO5A 5J0TA 4NXXA 2O5AA 2PBEA 5J2IA 4I0UA 4FHVA 4LVSA 8ICXA 4K9BA 4EP7A 4YMMA 3JPTA 1BPXA 4KLQA 3C2KA 3EF2A 1RZTA 4NXWA 4XRHA 4TUSA 4K8VA 4WC1A 4X4SA 3ISDA 8ICFA 4E80A 2IHMA 3JPQA 5D49A 3C5GA 4IQWA 8ICCA 8ICTA 4F5RA 4NKTA 2EWRA 4JLZA 4KLFA 3AU6A 4RPYA 4UB4A 4EV6A 2FMPA 2DR7A 5HHHA 4X4RA 4AT9B 4PGQA 3C18A 4M9JA 7ICKA 4GXIA 4MF2A 4UB5A 5BOMA 4PHPA 1MQ2A 4YMNA 4QZIA 4JWNA 5HRKA 3ER9B 4KLSA 4EBKA 4IG8A 4RQ5A 3V7KA 4KLJA 5CFSA 4WBYA 5DB8A 8ICWA 9ICOA 8ICOA 3JZ0A 4I2EA 4UB2A 3WFPA 4GXKA 1XSLA 1ZQCA 2B56A 4M2YA 3PNCA 4I2GA 1R8BA 3JPOA 5HRBA 5J2JA 4KLTA 7ICRA 4RQ4A 3OUYB 3H3AA 4X0AA 1ZJNA 4M0AA 4O5CA 8ICNA 4E8FA 4O67A 9ICUA 4YCXA 2BE3A 4E7XA 5J2HA 8ICBA 9ICMA 4GXJA 9ICCA 3TFSA 1MIVA 2BCQA 4X0BA 4FHPA 3RJHA 1ZQYA 4NKUA 3HX0A 3PMLA 1UEVA 4PGYA 4FHXA 3CK6A 1JN3A 5CR0A 8ICAA 1TVAA 2RFFA 2GA9D 5EOZA 2ISPA 8ICRA 2BCSA 3OV7A 4K9AA 4N7RA 3UQ2A 4I2DA 7ICHA 4WC4A 2DR9A 2PXIA 4KB6A 4TUQA 5DB9A 1ZQZA 4PHEA 2HN1A 5DDYA 7ICNA 4KLMA 4RQ3A 9ICGA 8ICUA 1ZQBA 2FMQA 4WC6A 1V4AA 9ICQA 1HUOA 5DEDA 4Z6DA 4O5KA 4AT7B 5J0XA 9ICEA 4ATBA 7ICJA 2PFOA 3V7LA 5IIJA 4KLHA 2BPCA 7ICGA 1VFGA 1RPLA 1TV9A 4PHDA 2W9MA 5HRDA 5CHGA 3L9DA 4KLOA 3ERCC 4FH3A 3HIYA 3UPSA 2DR5A 1ZQVA 2BCUA 1JQRA 1JMSA 3UXOA 4LT6A 4XA5A 4XQ7A 4PGXA 4I2FA 5HHIA 3AUOA 3H39A 4M9HA 4AT8A 4RT3A 4F5QA 2ZH9A 4X4VA 5HRLA 2GAFD 1FA0A 5J0RA 4K97A 1BPZA 1ZQUA 2BPFA 3NYBA 3MDAA 7ICPA 4RT2A 4R64A 2BBJA 5DB6A 4M04A 4DOCA 3MGIA 3OWGA 9ICRA 4AT8B 2NRKA 4XUSA 3C66A 1XSPA 4EGWA 5CWRA 1BPEA 3UPQA 2ISOA 9ICHA 1UETA 3HJ4A 4F5OA 3OVAA 4O69A 4I2IA 5J0SA 2ZH6A 3HWTA 1YLQA 4QZGA 1ZQNA 8ICQA 4X4TA 5J2GA 4P4MA 1ZQMA 5J2AA 4WC2A 4R66A 5D62A 5IILA 5J2KA 4FO6A 9ICXA 4DOAA 3JCFA
chains in the Genus database with same CATH topology
2DRAA 3C2LA 4DO9A 4RQ7A 4K99A 7ICIA 3OUYA 5IIMA 8ICMA 4WC3A 4OAGA 5CB1A 5IINA 4UAYA 4F5NA 4X4NA 4AT9A 4K98A 4IQUA 4QZBA 5CP2A 1ZQIA 2PFPA 3TFRA 5DBCA 2ZHBA 4RQ0A 4UAWA 4Z6CA 2M2WA 4QZHA 3WFRE 3H37A 4KLLA 9ICAA 2FMSA 2ZH2A 4S3NA 4R63A 2BCVA 3C5FA 1TFWA 4UB3A 4UBCA 4PHAA 5HREA 4O9MA 4KLUA 2P66A 4X5VA 4OAFA 3RJKA 3RH4A 4Z6EA 9ICFA 5J0WA 5J2CA 2ID1A 2M2VA 4UD4A 2VANA 2B4VA 4WBZA 4RQ2A 4UD5A 4WCWA 1JAJA 8ICGA 9ICJA 3AQMA 5F2VO 1UEUA 1XSNA 5DBAA 4FHYA 4M47A 4TUPA 7ICTA 4QZEA 5HR9A 4NXVA 5J0UA 2DVIA 8ICSA 4X4OA 3ISBA 1ZQGA 3UXNA 5J2FA 3WFSC 4I2JA 3AQKA 3ISCA 1HUZA 4I2HA 4X4QA 4YN4A 4I27A 4AT7A 4MF8A 4O6AA 3GDXA 4QZCA 1KNYA 3MBYA 3RH5A 2ZH1A 2Q66A 4OAIZ 5J2BA 2ZH4A 4KM5A 4FH5A 4WC5A 3RH6A 4IQTA 3UQ0A 1BPYA 1ZQLA 1ZQSA 3RJJA 5IIIA 8ICHA 1ZQJA 4K4GA 1ZQTA 3HJ1A 3OVBA 2BPGA 5TZVA 5J0PA 5DB7A 4MFCA 4WOYA 1ZJMA 1MIWA 3RJEA 4LEWA 5J2EA 3RJGA 3LQCB 4RWOA 1ZQDA 1NOMA 4RQ6A 4KLIA 2BCRA 1ZQWA 3V7JA 1ZQRA 4YD2A 7ICUA 7ICFA 4YMOA 5BOLA 2DR8A 4O5EA 9ICSA 4PH5A 5J2DA 4DOBA 4I28A 8ICEA 5HRGA 4FHWA 1ZQPA 2PFNA 3UXPA 5HRFA 1ZQKA 3MDCA 4QZ9A 1ZQQA 1Q79A 4NM2A 7ICEA 3B0YA 9ICIA 1PX5A 4MFFA 3PMNA 4MFAA 8ICJA 4M9NA 8ICIA 4M9LA 3RJFA 4UB1A 1ZQOA 9ICPA 4YD1A 1KDHA 4I29A 4LEYA 5J0OA 5IIKA 4I2AA 4Z6FA 4OAHA 5J0QA 3AU2A 9ICLA 7ICLA 2DRBA 4WC0A 7ICOA 4X4PA 4NXUA 3H38A 4RPXA 4LZDA 7ICQA 5CA7A 5IIOA 4NM1A 4K96A 5D4BA 4K4IA 4QZDA 4I2BA 1R8CA 3AQNA 4F5PA 1ZQXA 4P4PA 2ZH8A 5BPCA 1R89A 4JLXA 4NXZA 8ICKA 3JYYA 1ZQEA 3WFQE 5HC9A 9ICBA 4XQ8A 3JPPA 5CJ7A 1ZQHA 1BPBA 8ICYA 4M9GA 4R65A 2B51A 2ZHAA 2I9GA 8ICPA 3WFOA 5DECA 2PFQA 4JWMA 7ICMA 4KLEA 1KEJA 2ZH5A 9ICVA 3B0XA 5HRHA 4NLNA 3JPRA 3JPNA 4UBBA 2GWSA 9ICTA 8ICVA 1MQ3A 3V72A 4KLDA 5D46A 4PPXA 1MIYA 4RWNA 1ZQAA 4I2CA 4UAZA 8ICLA 8ICZA 4NLZA 3K75D 4RWPA 4TURA 4LEZA 4P2HA 9ICKA 1TFYA 3OGUA 3JPSA 5DKWA 5DDMA 4EBJA 1R8AA 4X4UA 9ICNA 9ICWA 3OVSA 4QZ8A 4RPZA 4QZFA 3LK9A 2M2UA 7ICSA 4NXTA 3C2MA 4P4OA 7ICVA 4NLKA 4RQ8A 3MGHA 1Q78A 1F5AA 4RQ1A 4O68A 4KLGA 5HRIA 4WC7A 3RJIA 2O1PA 1BPDA 3HW8A 5J29A 4M5DA 4QZAA 4ATBB 3AQLA 2M2TA 2HHPA 4MKPA 1OU5A 1VJ7A 4IQVA 4LEVA 4RWQA 5DBBA 2ZH7A 4LZGA 4NY8A 2ZH3A 1WOTA 5J0YA 1ZQFA 1NO5A 5J0TA 4NXXA 2O5AA 2PBEA 5J2IA 4FHVA 4LVSA 8ICXA 4K9BA 4EP7A 4YMMA 3JPTA 1BPXA 4KLQA 3C2KA 1RZTA 4NXWA 4XRHA 4TUSA 4K8VA 4WC1A 4X4SA 3ISDA 8ICFA 4E80A 2IHMA 3JPQA 5D49A 3C5GA 4IQWA 8ICCA 8ICTA 4F5RA 4NKTA 4JLZA 4KLFA 3AU6A 4RPYA 4UB4A 2FMPA 2DR7A 5HHHA 4X4RA 4AT9B 4PGQA 3C18A 4M9JA 7ICKA 4GXIA 4MF2A 4UB5A 5BOMA 4PHPA 1MQ2A 4YMNA 4QZIA 4JWNA 5HRKA 4KLSA 4EBKA 4IG8A 4RQ5A 3V7KA 4KLJA 4WBYA 5DB8A 8ICWA 9ICOA 8ICOA 3JZ0A 4I2EA 4UB2A 3WFPA 4GXKA 1XSLA 1ZQCA 2B56A 4M2YA 3PNCA 4I2GA 1R8BA 3JPOA 5HRBA 5J2JA 4KLTA 7ICRA 4RQ4A 3OUYB 3H3AA 4X0AA 1ZJNA 4M0AA 4O5CA 8ICNA 4E8FA 4O67A 9ICUA 4YCXA 2BE3A 4E7XA 5J2HA 8ICBA 9ICMA 4GXJA 9ICCA 3TFSA 1MIVA 2BCQA 4X0BA 4FHPA 3RJHA 1ZQYA 4NKUA 3HX0A 3PMLA 1UEVA 4PGYA 4FHXA 1JN3A 5CR0A 8ICAA 1TVAA 2RFFA 5EOZA 2ISPA 8ICRA 2BCSA 3OV7A 4K9AA 3UQ2A 4I2DA 7ICHA 4WC4A 2DR9A 2PXIA 4KB6A 4TUQA 5DB9A 1ZQZA 4PHEA 5DDYA 7ICNA 4KLMA 4RQ3A 9ICGA 8ICUA 1ZQBA 2FMQA 4WC6A 1V4AA 9ICQA 1HUOA 5DEDA 4Z6DA 4O5KA 4AT7B 5J0XA 9ICEA 4ATBA 7ICJA 2PFOA 3V7LA 5IIJA 4KLHA 2BPCA 7ICGA 1VFGA 1RPLA 1TV9A 4PHDA 2W9MA 5HRDA 5CHGA 3L9DA 4KLOA 4FH3A 3HIYA 3UPSA 2DR5A 1ZQVA 2BCUA 1JQRA 1JMSA 3UXOA 4LT6A 4XA5A 4XQ7A 4PGXA 4I2FA 5HHIA 3AUOA 3H39A 4M9HA 4AT8A 4RT3A 4F5QA 2ZH9A 4X4VA 5HRLA 1FA0A 5J0RA 4K97A 1BPZA 1ZQUA 2BPFA 3NYBA 3MDAA 7ICPA 4RT2A 4R64A 5DB6A 4M04A 4DOCA 3MGIA 9ICRA 4AT8B 2NRKA 4XUSA 3C66A 1XSPA 5CWRA 1BPEA 3UPQA 2ISOA 9ICHA 1UETA 3HJ4A 4F5OA 3OVAA 4O69A 4I2IA 5J0SA 2ZH6A 3HWTA 1YLQA 4QZGA 1ZQNA 8ICQA 4X4TA 5J2GA 4P4MA 1ZQMA 5J2AA 4WC2A 4R66A 5IILA 5J2KA 4FO6A 9ICXA 4DOAA 4K4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C2L A;  2DRA A;  4DO9 A;  4RQ7 A;  7ICI A;  3OUY A;  5IIM A;  8ICM A;  4WC3 A;  5CB1 A;  5IIN A;  4UAY A;  4F5N A;  2PFP A;  4AT9 A;  4IQU A;  4QZB A;  1ZQI A;  5CP2 A;  4X4N A;  3TFR A;  5DBC A;  2ZHB A;  4RQ0 A;  4UAW A;  4Z6C A;  2M2W A;  4QZH A;  3WFR E;  3H37 A;  4KLL A;  9ICA A;  2FMS A;  2ZH2 A;  4S3N A;  4R63 A;  2BCV A;  3C5F A;  4UB3 A;  4O9M A;  4UBC A;  4PHA A;  5HRE A;  4KLU A;  1TFW A;  2P66 A;  4X5V A;  3RJK A;  3RH4 A;  4Z6E A;  9ICF A;  5J0W A;  5J2C A;  2ID1 A;  2M2V A;  4UD4 A;  2VAN A;  2B4V A;  4WBZ A;  4RQ2 A;  4UD5 A;  4WCW A;  1JAJ A;  8ICG A;  9ICJ A;  3AQM A;  5F2V O;  1UEU A;  1XSN A;  5DBA A;  4FHY A;  4M47 A;  4TUP A;  7ICT A;  4QZE A;  5HR9 A;  5J0U A;  2DVI A;  8ICS A;  4X4O A;  3ISB A;  1ZQG A;  3UXN A;  5J2F A;  3WFS C;  4I2J A;  3AQK A;  3ISC A;  1HUZ A;  4I2H A;  4X4Q A;  4YN4 A;  4I27 A;  4AT7 A;  4MF8 A;  3GDX A;  4QZC A;  1KNY A;  3MBY A;  3RH5 A;  2Q66 A;  2ZH1 A;  5J2B A;  2ZH4 A;  4FH5 A;  4WC5 A;  3RH6 A;  4IQT A;  3UQ0 A;  1BPY A;  1ZQL A;  1ZQS A;  3RJJ A;  5III A;  8ICH A;  1ZQJ A;  4K4G A;  1ZQT A;  3HJ1 A;  3OVB A;  2BPG A;  5TZV A;  5J0P A;  5DB7 A;  4MFC A;  1ZJM A;  1MIW A;  3RJE A;  5J2E A;  3RJG A;  3LQC B;  4RWO A;  1ZQD A;  1NOM A;  4RQ6 A;  4KLI A;  2BCR A;  1ZQW A;  3V7J A;  1ZQR A;  4YD2 A;  7ICU A;  7ICF A;  4YMO A;  5BOL A;  2DR8 A;  4O5E A;  9ICS A;  4PH5 A;  5J2D A;  4DOB A;  4I28 A;  8ICE A;  5HRG A;  4FHW A;  1ZQP A;  2PFN A;  3UXP A;  5HRF A;  1ZQK A;  3MDC A;  4QZ9 A;  1ZQQ A;  1Q79 A;  4NM2 A;  7ICE A;  3B0Y A;  9ICI A;  1PX5 A;  4MFF A;  3PMN A;  4MFA A;  8ICJ A;  4M9N A;  8ICI A;  4M9L A;  3RJF A;  4UB1 A;  1ZQO A;  9ICP A;  4YD1 A;  1KDH A;  4I29 A;  5J0O A;  5IIK A;  4I2A A;  4Z6F A;  5J0Q A;  3AU2 A;  9ICL A;  7ICL A;  4WC0 A;  2DRB A;  7ICO A;  4X4P A;  3H38 A;  4RPX A;  4LZD A;  7ICQ A;  5CA7 A;  5IIO A;  4NM1 A;  5D4B A;  4K4I A;  4QZD A;  4I2B A;  1R8C A;  3AQN A;  4F5P A;  1ZQX A;  4P4P A;  2ZH8 A;  5BPC A;  1R89 A;  4NXZ A;  8ICK A;  3JYY A;  1ZQE A;  3WFQ E;  5HC9 A;  9ICB A;  4XQ8 A;  3JPP A;  5CJ7 A;  1ZQH A;  1BPB A;  8ICY A;  4M9G A;  4R65 A;  2B51 A;  2ZHA A;  2I9G A;  8ICP A;  3WFO A;  5DEC A;  2PFQ A;  4JWM A;  7ICM A;  4KLE A;  1KEJ A;  2ZH5 A;  9ICV A;  3B0X A;  5HRH A;  4NLN A;  3JPR A;  3JPN A;  4UBB A;  2GWS A;  9ICT A;  8ICV A;  1MQ3 A;  3V72 A;  4KLD A;  5D46 A;  4PPX A;  1MIY A;  4RWN A;  1ZQA A;  4I2C A;  4UAZ A;  8ICL A;  8ICZ A;  4NLZ A;  3K75 D;  4RWP A;  4TUR A;  4P2H A;  9ICK A;  1TFY A;  3OGU A;  3JPS A;  5DKW A;  5DDM A;  4EBJ A;  1R8A A;  4X4U A;  9ICN A;  9ICW A;  4QZ8 A;  3OVS A;  4RPZ A;  4QZF A;  3LK9 A;  2M2U A;  7ICS A;  3C2M A;  4P4O A;  7ICV A;  4NLK A;  4RQ8 A;  3MGH A;  1Q78 A;  1F5A A;  4RQ1 A;  4KLG A;  5HRI A;  4WC7 A;  3RJI A;  2O1P A;  1BPD A;  3HW8 A;  5J29 A;  4M5D A;  4QZA A;  4ATB B;  3AQL A;  2M2T A;  2HHP A;  1OU5 A;  1VJ7 A;  4IQV A;  4RWQ A;  5DBB A;  2ZH7 A;  4LZG A;  4NY8 A;  1WOT A;  2ZH3 A;  5J0Y A;  1ZQF A;  1NO5 A;  5J0T A;  2O5A A;  2PBE A;  5J2I A;  4FHV A;  4LVS A;  8ICX A;  4EP7 A;  4YMM A;  3JPT A;  1BPX A;  4KLQ A;  3C2K A;  1RZT A;  4XRH A;  4TUS A;  4WC1 A;  4X4S A;  3ISD A;  8ICF A;  4E80 A;  2IHM A;  3JPQ A;  5D49 A;  3C5G A;  4IQW A;  8ICC A;  8ICT A;  4F5R A;  4NKT A;  4KLF A;  3AU6 A;  4RPY A;  4UB4 A;  2FMP A;  2DR7 A;  5HHH A;  4X4R A;  4AT9 B;  4PGQ A;  3C18 A;  4M9J A;  7ICK A;  4GXI A;  4MF2 A;  4UB5 A;  5BOM A;  4PHP A;  1MQ2 A;  4YMN A;  4QZI A;  4JWN A;  5HRK A;  4KLS A;  4EBK A;  4IG8 A;  4RQ5 A;  3V7K A;  4KLJ A;  4WBY A;  5DB8 A;  8ICW A;  9ICO A;  8ICO A;  3JZ0 A;  4I2E A;  4UB2 A;  3WFP A;  4GXK A;  1XSL A;  1ZQC A;  2B56 A;  4M2Y A;  3PNC A;  4I2G A;  1R8B A;  3JPO A;  5HRB A;  5J2J A;  4KLT A;  7ICR A;  4RQ4 A;  3H3A A;  3OUY B;  4X0A A;  1ZJN A;  4M0A A;  4O5C A;  8ICN A;  4E8F A;  9ICU A;  4YCX A;  2BE3 A;  4E7X A;  5J2H A;  8ICB A;  9ICM A;  4GXJ A;  9ICC A;  3TFS A;  1MIV A;  2BCQ A;  4X0B A;  4FHP A;  3RJH A;  1ZQY A;  4NKU A;  3HX0 A;  3PML A;  1UEV A;  4PGY A;  4FHX A;  1JN3 A;  5CR0 A;  8ICA A;  1TVA A;  2RFF A;  5EOZ A;  2ISP A;  8ICR A;  2BCS A;  3OV7 A;  3UQ2 A;  4I2D A;  7ICH A;  4WC4 A;  2DR9 A;  2PXI A;  4TUQ A;  5DB9 A;  1ZQZ A;  4PHE A;  5DDY A;  7ICN A;  4KLM A;  4RQ3 A;  9ICG A;  8ICU A;  1ZQB A;  2FMQ A;  4WC6 A;  1V4A A;  9ICQ A;  1HUO A;  5DED A;  4Z6D A;  4O5K A;  4AT7 B;  5J0X A;  9ICE A;  4ATB A;  7ICJ A;  2PFO A;  3V7L A;  5IIJ A;  4KLH A;  2BPC A;  7ICG A;  1VFG A;  1RPL A;  1TV9 A;  4PHD A;  2W9M A;  5HRD A;  5CHG A;  3L9D A;  4KLO A;  4FH3 A;  3HIY A;  3UPS A;  1ZQV A;  2DR5 A;  2BCU A;  1JQR A;  1JMS A;  3UXO A;  4LT6 A;  4XA5 A;  4XQ7 A;  4PGX A;  4I2F A;  5HHI A;  3AUO A;  3H39 A;  4M9H A;  4AT8 A;  4RT3 A;  4F5Q A;  2ZH9 A;  4X4V A;  5HRL A;  1FA0 A;  5J0R A;  1BPZ A;  1ZQU A;  2BPF A;  3NYB A;  3MDA A;  7ICP A;  4RT2 A;  4R64 A;  5DB6 A;  4M04 A;  4DOC A;  3MGI A;  9ICR A;  2NRK A;  4AT8 B;  4XUS A;  3C66 A;  1XSP A;  5CWR A;  1BPE A;  3UPQ A;  2ISO A;  9ICH A;  3HJ4 A;  1UET A;  4F5O A;  3OVA A;  4I2I A;  5J0S A;  3HWT A;  2ZH6 A;  1YLQ A;  4QZG A;  1ZQN A;  8ICQ A;  4X4T A;  5J2G A;  4P4M A;  1ZQM A;  5J2A A;  4WC2 A;  4R66 A;  5IIL A;  5J2K A;  4FO6 A;  9ICX A;  4DOA A;  4K4H A; 
#chains in the Genus database with same CATH topology
 2DRA A;  3C2L A;  4DO9 A;  4RQ7 A;  4K99 A;  7ICI A;  3OUY A;  5IIM A;  8ICM A;  4WC3 A;  4OAG A;  5CB1 A;  5IIN A;  4UAY A;  4F5N A;  4X4N A;  4AT9 A;  4K98 A;  4IQU A;  4QZB A;  5CP2 A;  1ZQI A;  2PFP A;  3TFR A;  4EED A;  5DBC A;  2BBH A;  2ZHB A;  4HX0 A;  4RQ0 A;  2FCL A;  4UAW A;  4Z6C A;  2M2W A;  4QZH A;  3PHZ A;  3WFR E;  3H37 A;  4KLL A;  9ICA A;  2FMS A;  2ZH2 A;  4S3N A;  4R63 A;  3NWI A;  2BCV A;  3C5F A;  1TFW A;  4UB3 A;  4UBC A;  4PHA A;  5HRE A;  4O9M A;  4KLU A;  4WH5 A;  2P66 A;  4X5V A;  4OAF A;  3RJK A;  3RH4 A;  4Z6E A;  9ICF A;  5J0W A;  5J2C A;  2ID1 A;  2M2V A;  4UD4 A;  2IUB A;  2VAN A;  2B4V A;  4WBZ A;  4RQ2 A;  4UD5 A;  4WCW A;  1JAJ A;  8ICG A;  9ICJ A;  3AQM A;  5F2V O;  1UEU A;  1XSN A;  5DBA A;  4FHY A;  5B3P A;  4M47 A;  4FO1 A;  4TUP A;  4QZE A;  5HR9 A;  7ICT A;  4NXV A;  5J0U A;  2DVI A;  8ICS A;  4X4O A;  3ISB A;  1ZQG A;  3UXN A;  5J2F A;  3WFS C;  4I2J A;  3NVO A;  3AQK A;  3ISC A;  1HUZ A;  4I2H A;  4X4Q A;  4YN4 A;  4I27 A;  4AT7 A;  3K7D A;  4MF8 A;  4O6A A;  3GDX A;  4QZC A;  1KNY A;  3MBY A;  3RH5 A;  2ZH1 A;  2Q66 A;  4OAI Z;  5J2B A;  2ZH4 A;  4KM5 A;  4FH5 A;  4WC5 A;  3RH6 A;  4IQT A;  3UQ0 A;  1BPY A;  1ZQL A;  1ZQS A;  3RJJ A;  5III A;  8ICH A;  1ZQJ A;  4K4G A;  1ZQT A;  3MCR A;  3HJ1 A;  3OVB A;  2BPG A;  5TZV A;  5J0P A;  5DB7 A;  4MFC A;  4WOY A;  1ZJM A;  1MIW A;  3RJE A;  4LEW A;  5J2E A;  3RJG A;  3LQC B;  4RWO A;  1ZQD A;  1NOM A;  4RQ6 A;  4KLI A;  2BCR A;  1ZQW A;  3V7J A;  1ZQR A;  4YD2 A;  7ICU A;  7ICF A;  4YMO A;  5BOL A;  2DR8 A;  4O5E A;  9ICS A;  4PH5 A;  5J2D A;  4DOB A;  4I28 A;  8ICE A;  5HRG A;  4FHW A;  1ZQP A;  2PFN A;  3UXP A;  5HRF A;  1ZQK A;  2IHO A;  3MDC A;  4QZ9 A;  1ZQQ A;  1Q79 A;  4NM2 A;  7ICE A;  3B0Y A;  9ICI A;  1PX5 A;  4MFF A;  3PMN A;  4MFA A;  8ICJ A;  4M9N A;  8ICI A;  4M9L A;  3RJF A;  4UB1 A;  1ZQO A;  9ICP A;  4YD1 A;  1KDH A;  4I29 A;  4LEY A;  5J0O A;  5IIK A;  4I2A A;  4Z6F A;  4OAH A;  5J0Q A;  3AU2 A;  9ICL A;  7ICL A;  2DRB A;  4WC0 A;  7ICO A;  4X4P A;  4NXU A;  3H38 A;  4RPX A;  4LZD A;  7ICQ A;  5CA7 A;  4EEB A;  5IIO A;  4NM1 A;  4K96 A;  4WQL A;  5D4B A;  4K4I A;  4QZD A;  4WQK A;  4I2B A;  1R8C A;  3AQN A;  5CFT A;  1ZQX A;  4F5P A;  4P4P A;  2ZH8 A;  5BPC A;  1R89 A;  4JLX A;  4NXZ A;  8ICK A;  3JYY A;  1ZQE A;  3WFQ E;  5HC9 A;  9ICB A;  4XQ8 A;  3JPP A;  5CJ7 A;  1ZQH A;  1BPB A;  8ICY A;  4M9G A;  4R65 A;  2B51 A;  2ZHA A;  2I9G A;  8ICP A;  3WFO A;  5DEC A;  2PFQ A;  4JWM A;  7ICM A;  4KLE A;  1KEJ A;  3ER8 C;  2ZH5 A;  9ICV A;  5CHE A;  3B0X A;  5HRH A;  4NLN A;  3JPR A;  3JPN A;  4UBB A;  2GWS A;  9ICT A;  8ICV A;  1MQ3 A;  3V72 A;  4KLD A;  4K4H A;  3NKU A;  5D46 A;  4PPX A;  5B3Q A;  1MIY A;  4RWN A;  5CFU A;  1ZQA A;  4I2C A;  2HN2 A;  4UAZ A;  8ICL A;  8ICZ A;  4NLZ A;  3K75 D;  4RWP A;  5D63 A;  4TUR A;  4LEZ A;  4P2H A;  9ICK A;  1TFY A;  3OGU A;  3JPS A;  5DKW A;  5DDM A;  4EBJ A;  1R8A A;  4X4U A;  9ICN A;  9ICW A;  3OVS A;  4QZ8 A;  4RPZ A;  4QZF A;  3LK9 A;  2M2U A;  7ICS A;  4NXT A;  3C2M A;  4P4O A;  7ICV A;  4XJE A;  4NLK A;  4RQ8 A;  3MGH A;  1Q78 A;  1F5A A;  4RQ1 A;  4O68 A;  4KLG A;  5HRI A;  4WC7 A;  1GPJ A;  3RJI A;  2O1P A;  1BPD A;  3HW8 A;  5J29 A;  4M5D A;  4QZA A;  4ATB B;  3AQL A;  2M2T A;  2HHP A;  5JTG A;  4MKP A;  5D61 A;  1OU5 A;  1VJ7 A;  4IQV A;  4LEV A;  4RWQ A;  5DBB A;  2ZH7 A;  4LZG A;  4NY8 A;  2ZH3 A;  1WOT A;  5J0Y A;  1ZQF A;  1NO5 A;  5J0T A;  4NXX A;  2O5A A;  2PBE A;  5J2I A;  4I0U A;  4FHV A;  4LVS A;  8ICX A;  4K9B A;  4EP7 A;  4YMM A;  3JPT A;  1BPX A;  4KLQ A;  3C2K A;  3EF2 A;  1RZT A;  4NXW A;  4XRH A;  4TUS A;  4K8V A;  4WC1 A;  4X4S A;  3ISD A;  8ICF A;  4E80 A;  2IHM A;  3JPQ A;  5D49 A;  3C5G A;  4IQW A;  8ICC A;  8ICT A;  4F5R A;  4NKT A;  2EWR A;  4JLZ A;  4KLF A;  3AU6 A;  4RPY A;  4UB4 A;  4EV6 A;  2FMP A;  2DR7 A;  5HHH A;  4X4R A;  4AT9 B;  4PGQ A;  3C18 A;  4M9J A;  7ICK A;  4GXI A;  4MF2 A;  4UB5 A;  5BOM A;  4PHP A;  1MQ2 A;  4YMN A;  4QZI A;  4JWN A;  5HRK A;  3ER9 B;  4KLS A;  4EBK A;  4IG8 A;  4RQ5 A;  3V7K A;  4KLJ A;  5CFS A;  4WBY A;  5DB8 A;  8ICW A;  9ICO A;  8ICO A;  3JZ0 A;  4I2E A;  4UB2 A;  3WFP A;  4GXK A;  1XSL A;  1ZQC A;  2B56 A;  4M2Y A;  3PNC A;  4I2G A;  1R8B A;  3JPO A;  5HRB A;  5J2J A;  4KLT A;  7ICR A;  4RQ4 A;  3OUY B;  3H3A A;  4X0A A;  1ZJN A;  4M0A A;  4O5C A;  8ICN A;  4E8F A;  4O67 A;  9ICU A;  4YCX A;  2BE3 A;  4E7X A;  5J2H A;  8ICB A;  9ICM A;  4GXJ A;  9ICC A;  3TFS A;  1MIV A;  2BCQ A;  4X0B A;  4FHP A;  3RJH A;  1ZQY A;  4NKU A;  3HX0 A;  3PML A;  1UEV A;  4PGY A;  4FHX A;  3CK6 A;  1JN3 A;  5CR0 A;  8ICA A;  1TVA A;  2RFF A;  2GA9 D;  5EOZ A;  2ISP A;  8ICR A;  2BCS A;  3OV7 A;  4K9A A;  4N7R A;  3UQ2 A;  4I2D A;  7ICH A;  4WC4 A;  2DR9 A;  2PXI A;  4KB6 A;  4TUQ A;  5DB9 A;  1ZQZ A;  4PHE A;  2HN1 A;  5DDY A;  7ICN A;  4KLM A;  4RQ3 A;  9ICG A;  8ICU A;  1ZQB A;  2FMQ A;  4WC6 A;  1V4A A;  9ICQ A;  1HUO A;  5DED A;  4Z6D A;  4O5K A;  4AT7 B;  5J0X A;  9ICE A;  4ATB A;  7ICJ A;  2PFO A;  3V7L A;  5IIJ A;  4KLH A;  2BPC A;  7ICG A;  1VFG A;  1RPL A;  1TV9 A;  4PHD A;  2W9M A;  5HRD A;  5CHG A;  3L9D A;  4KLO A;  3ERC C;  4FH3 A;  3HIY A;  3UPS A;  2DR5 A;  1ZQV A;  2BCU A;  1JQR A;  1JMS A;  3UXO A;  4LT6 A;  4XA5 A;  4XQ7 A;  4PGX A;  4I2F A;  5HHI A;  3AUO A;  3H39 A;  4M9H A;  4AT8 A;  4RT3 A;  4F5Q A;  2ZH9 A;  4X4V A;  5HRL A;  2GAF D;  1FA0 A;  5J0R A;  4K97 A;  1BPZ A;  1ZQU A;  2BPF A;  3NYB A;  3MDA A;  7ICP A;  4RT2 A;  4R64 A;  2BBJ A;  5DB6 A;  4M04 A;  4DOC A;  3MGI A;  3OWG A;  9ICR A;  4AT8 B;  2NRK A;  4XUS A;  3C66 A;  1XSP A;  4EGW A;  5CWR A;  1BPE A;  3UPQ A;  2ISO A;  9ICH A;  1UET A;  3HJ4 A;  4F5O A;  3OVA A;  4O69 A;  4I2I A;  5J0S A;  2ZH6 A;  3HWT A;  1YLQ A;  4QZG A;  1ZQN A;  8ICQ A;  4X4T A;  5J2G A;  4P4M A;  1ZQM A;  5J2A A;  4WC2 A;  4R66 A;  5D62 A;  5IIL A;  5J2K A;  4FO6 A;  9ICX A;  4DOA A;  3JCF A; 
#chains in the Genus database with same CATH homology
 2DRA A;  3C2L A;  4DO9 A;  4RQ7 A;  4K99 A;  7ICI A;  3OUY A;  5IIM A;  8ICM A;  4WC3 A;  4OAG A;  5CB1 A;  5IIN A;  4UAY A;  4F5N A;  4X4N A;  4AT9 A;  4K98 A;  4IQU A;  4QZB A;  5CP2 A;  1ZQI A;  2PFP A;  3TFR A;  5DBC A;  2ZHB A;  4RQ0 A;  4UAW A;  4Z6C A;  2M2W A;  4QZH A;  3WFR E;  3H37 A;  4KLL A;  9ICA A;  2FMS A;  2ZH2 A;  4S3N A;  4R63 A;  2BCV A;  3C5F A;  1TFW A;  4UB3 A;  4UBC A;  4PHA A;  5HRE A;  4O9M A;  4KLU A;  2P66 A;  4X5V A;  4OAF A;  3RJK A;  3RH4 A;  4Z6E A;  9ICF A;  5J0W A;  5J2C A;  2ID1 A;  2M2V A;  4UD4 A;  2VAN A;  2B4V A;  4WBZ A;  4RQ2 A;  4UD5 A;  4WCW A;  1JAJ A;  8ICG A;  9ICJ A;  3AQM A;  5F2V O;  1UEU A;  1XSN A;  5DBA A;  4FHY A;  4M47 A;  4TUP A;  7ICT A;  4QZE A;  5HR9 A;  4NXV A;  5J0U A;  2DVI A;  8ICS A;  4X4O A;  3ISB A;  1ZQG A;  3UXN A;  5J2F A;  3WFS C;  4I2J A;  3AQK A;  3ISC A;  1HUZ A;  4I2H A;  4X4Q A;  4YN4 A;  4I27 A;  4AT7 A;  4MF8 A;  4O6A A;  3GDX A;  4QZC A;  1KNY A;  3MBY A;  3RH5 A;  2ZH1 A;  2Q66 A;  4OAI Z;  5J2B A;  2ZH4 A;  4KM5 A;  4FH5 A;  4WC5 A;  3RH6 A;  4IQT A;  3UQ0 A;  1BPY A;  1ZQL A;  1ZQS A;  3RJJ A;  5III A;  8ICH A;  1ZQJ A;  4K4G A;  1ZQT A;  3HJ1 A;  3OVB A;  2BPG A;  5TZV A;  5J0P A;  5DB7 A;  4MFC A;  4WOY A;  1ZJM A;  1MIW A;  3RJE A;  4LEW A;  5J2E A;  3RJG A;  3LQC B;  4RWO A;  1ZQD A;  1NOM A;  4RQ6 A;  4KLI A;  2BCR A;  1ZQW A;  3V7J A;  1ZQR A;  4YD2 A;  7ICU A;  7ICF A;  4YMO A;  5BOL A;  2DR8 A;  4O5E A;  9ICS A;  4PH5 A;  5J2D A;  4DOB A;  4I28 A;  8ICE A;  5HRG A;  4FHW A;  1ZQP A;  2PFN A;  3UXP A;  5HRF A;  1ZQK A;  3MDC A;  4QZ9 A;  1ZQQ A;  1Q79 A;  4NM2 A;  7ICE A;  3B0Y A;  9ICI A;  1PX5 A;  4MFF A;  3PMN A;  4MFA A;  8ICJ A;  4M9N A;  8ICI A;  4M9L A;  3RJF A;  4UB1 A;  1ZQO A;  9ICP A;  4YD1 A;  1KDH A;  4I29 A;  4LEY A;  5J0O A;  5IIK A;  4I2A A;  4Z6F A;  4OAH A;  5J0Q A;  3AU2 A;  9ICL A;  7ICL A;  2DRB A;  4WC0 A;  7ICO A;  4X4P A;  4NXU A;  3H38 A;  4RPX A;  4LZD A;  7ICQ A;  5CA7 A;  5IIO A;  4NM1 A;  4K96 A;  5D4B A;  4K4I A;  4QZD A;  4I2B A;  1R8C A;  3AQN A;  4F5P A;  1ZQX A;  4P4P A;  2ZH8 A;  5BPC A;  1R89 A;  4JLX A;  4NXZ A;  8ICK A;  3JYY A;  1ZQE A;  3WFQ E;  5HC9 A;  9ICB A;  4XQ8 A;  3JPP A;  5CJ7 A;  1ZQH A;  1BPB A;  8ICY A;  4M9G A;  4R65 A;  2B51 A;  2ZHA A;  2I9G A;  8ICP A;  3WFO A;  5DEC A;  2PFQ A;  4JWM A;  7ICM A;  4KLE A;  1KEJ A;  2ZH5 A;  9ICV A;  3B0X A;  5HRH A;  4NLN A;  3JPR A;  3JPN A;  4UBB A;  2GWS A;  9ICT A;  8ICV A;  1MQ3 A;  3V72 A;  4KLD A;  5D46 A;  4PPX A;  1MIY A;  4RWN A;  1ZQA A;  4I2C A;  4UAZ A;  8ICL A;  8ICZ A;  4NLZ A;  3K75 D;  4RWP A;  4TUR A;  4LEZ A;  4P2H A;  9ICK A;  1TFY A;  3OGU A;  3JPS A;  5DKW A;  5DDM A;  4EBJ A;  1R8A A;  4X4U A;  9ICN A;  9ICW A;  3OVS A;  4QZ8 A;  4RPZ A;  4QZF A;  3LK9 A;  2M2U A;  7ICS A;  4NXT A;  3C2M A;  4P4O A;  7ICV A;  4NLK A;  4RQ8 A;  3MGH A;  1Q78 A;  1F5A A;  4RQ1 A;  4O68 A;  4KLG A;  5HRI A;  4WC7 A;  3RJI A;  2O1P A;  1BPD A;  3HW8 A;  5J29 A;  4M5D A;  4QZA A;  4ATB B;  3AQL A;  2M2T A;  2HHP A;  4MKP A;  1OU5 A;  1VJ7 A;  4IQV A;  4LEV A;  4RWQ A;  5DBB A;  2ZH7 A;  4LZG A;  4NY8 A;  2ZH3 A;  1WOT A;  5J0Y A;  1ZQF A;  1NO5 A;  5J0T A;  4NXX A;  2O5A A;  2PBE A;  5J2I A;  4FHV A;  4LVS A;  8ICX A;  4K9B A;  4EP7 A;  4YMM A;  3JPT A;  1BPX A;  4KLQ A;  3C2K A;  1RZT A;  4NXW A;  4XRH A;  4TUS A;  4K8V A;  4WC1 A;  4X4S A;  3ISD A;  8ICF A;  4E80 A;  2IHM A;  3JPQ A;  5D49 A;  3C5G A;  4IQW A;  8ICC A;  8ICT A;  4F5R A;  4NKT A;  4JLZ A;  4KLF A;  3AU6 A;  4RPY A;  4UB4 A;  2FMP A;  2DR7 A;  5HHH A;  4X4R A;  4AT9 B;  4PGQ A;  3C18 A;  4M9J A;  7ICK A;  4GXI A;  4MF2 A;  4UB5 A;  5BOM A;  4PHP A;  1MQ2 A;  4YMN A;  4QZI A;  4JWN A;  5HRK A;  4KLS A;  4EBK A;  4IG8 A;  4RQ5 A;  3V7K A;  4KLJ A;  4WBY A;  5DB8 A;  8ICW A;  9ICO A;  8ICO A;  3JZ0 A;  4I2E A;  4UB2 A;  3WFP A;  4GXK A;  1XSL A;  1ZQC A;  2B56 A;  4M2Y A;  3PNC A;  4I2G A;  1R8B A;  3JPO A;  5HRB A;  5J2J A;  4KLT A;  7ICR A;  4RQ4 A;  3OUY B;  3H3A A;  4X0A A;  1ZJN A;  4M0A A;  4O5C A;  8ICN A;  4E8F A;  4O67 A;  9ICU A;  4YCX A;  2BE3 A;  4E7X A;  5J2H A;  8ICB A;  9ICM A;  4GXJ A;  9ICC A;  3TFS A;  1MIV A;  2BCQ A;  4X0B A;  4FHP A;  3RJH A;  1ZQY A;  4NKU A;  3HX0 A;  3PML A;  1UEV A;  4PGY A;  4FHX A;  1JN3 A;  5CR0 A;  8ICA A;  1TVA A;  2RFF A;  5EOZ A;  2ISP A;  8ICR A;  2BCS A;  3OV7 A;  4K9A A;  3UQ2 A;  4I2D A;  7ICH A;  4WC4 A;  2DR9 A;  2PXI A;  4KB6 A;  4TUQ A;  5DB9 A;  1ZQZ A;  4PHE A;  5DDY A;  7ICN A;  4KLM A;  4RQ3 A;  9ICG A;  8ICU A;  1ZQB A;  2FMQ A;  4WC6 A;  1V4A A;  9ICQ A;  1HUO A;  5DED A;  4Z6D A;  4O5K A;  4AT7 B;  5J0X A;  9ICE A;  4ATB A;  7ICJ A;  2PFO A;  3V7L A;  5IIJ A;  4KLH A;  2BPC A;  7ICG A;  1VFG A;  1RPL A;  1TV9 A;  4PHD A;  2W9M A;  5HRD A;  5CHG A;  3L9D A;  4KLO A;  4FH3 A;  3HIY A;  3UPS A;  2DR5 A;  1ZQV A;  2BCU A;  1JQR A;  1JMS A;  3UXO A;  4LT6 A;  4XA5 A;  4XQ7 A;  4PGX A;  4I2F A;  5HHI A;  3AUO A;  3H39 A;  4M9H A;  4AT8 A;  4RT3 A;  4F5Q A;  2ZH9 A;  4X4V A;  5HRL A;  1FA0 A;  5J0R A;  4K97 A;  1BPZ A;  1ZQU A;  2BPF A;  3NYB A;  3MDA A;  7ICP A;  4RT2 A;  4R64 A;  5DB6 A;  4M04 A;  4DOC A;  3MGI A;  9ICR A;  4AT8 B;  2NRK A;  4XUS A;  3C66 A;  1XSP A;  5CWR A;  1BPE A;  3UPQ A;  2ISO A;  9ICH A;  1UET A;  3HJ4 A;  4F5O A;  3OVA A;  4O69 A;  4I2I A;  5J0S A;  2ZH6 A;  3HWT A;  1YLQ A;  4QZG A;  1ZQN A;  8ICQ A;  4X4T A;  5J2G A;  4P4M A;  1ZQM A;  5J2A A;  4WC2 A;  4R66 A;  5IIL A;  5J2K A;  4FO6 A;  9ICX A;  4DOA A;  4K4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...