4EP7A

Functional implications from the cid1 poly(u) polymerase crystal structure
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
340
structure length
319
Chain Sequence
DMSHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Functional implications from the cid1 poly(u) polymerase crystal structure.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 110
structure length 319
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4ep7A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ep7A02
3GDXA 1YLQA 4YMMA 4UB3A 5J0TA 1ZJMA 2PFPA 3B0XA 1R8CA 4X4OA 3RJIA 7ICLA 5J2HA 2RFFA 4XQ8A 5DBBA 8ICOA 1ZQYA 2PFNA 1JQRA 2ZH3A 9ICOA 4UBBA 4K4HA 1NOMA 4LVSA 1ZQQA 2BPCA 3C2KA 2BCSA 4M47A 5DBCA 4RQ6A 5BOLA 4UAZA 2ZH4A 4I2IA 5HRDA 5IINA 4WBZA 5J0XA 1WOTA 3UQ2A 4TUPA 4QZEA 1UETA 4F5NA 4UB5A 4F5PA 5HRBA 4X4UA 4E8FA 3OVBA 2ZH1A 2BCVA 2M2TA 4UD4A 4I2JA 3MDAA 3H39A 4DOBA 3OUYA 4WC3A 4R63A 4I2GA 4PGQA 9ICGA 8ICEA 4NM2A 1R89A 3C18A 9ICJA 8ICLA 4KLTA 5J2BA 1JAJA 4KLDA 7ICKA 2DR9A 1ZQHA 4DOAA 7ICIA 4O5EA 4I2HA 4FHPA 4WC0A 4RPXA 4AT7B 3HW8A 4EBKA 4M04A 5CJ7A 4I2DA 7ICNA 4ATBB 4KLIA 1ZQCA 9ICLA 1ZQGA 4XA5A 5HRIA 4DOCA 4IG8A 2Q66A 4X4NA 3V7KA 4PGXA 4AT9B 4FHYA 4PPXA 4QZHA 1R8AA 5DDMA 4NLNA 9ICPA 3C5FA 1VFGA 4WC6A 2W9MA 4AT7A 4X4RA 3OVAA 4NY8A 4RPZA 1TVAA 2HHPA 5HHHA 4ATBA 3RJJA 4WC7A 4YMOA 5J0SA 9ICSA 4QZFA 4I2CA 2O5AA 4RWNA 4UB1A 2BCQA 4AT9A 4M2YA 8ICFA 7ICFA 3UPQA 4JWMA 1KEJA 1KDHA 4FHXA 3UXOA 8ICXA 3PMNA 4NLZA 4KLEA 4YMNA 2BPGA 5CR0A 4UAWA 2IHMA 1FA0A 3MGIA 5D49A 3V72A 4S3NA 4F5OA 4P4MA 4I28A 1ZQPA 4M9HA 3ISBA 4F5QA 3JYYA 4MFAA 3HJ4A 3RH6A 4GXJA 4GXIA 1MQ3A 1MIWA 4MFCA 1BPYA 5J2JA 5IIMA 4Z6FA 4FO6A 9ICRA 2BCUA 3H37A 2ZH6A 1XSLA 4QZGA 5J29A 5J2IA 2DR8A 9ICKA 4P2HA 1ZQRA 4KLFA 4RPYA 2M2WA 4RQ5A 9ICQA 4PGYA 1ZQFA 1NO5A 5EOZA 4M9GA 2B4VA 7ICPA 1BPDA 5J2KA 4O5CA 4RQ4A 4QZCA 5HRHA 1ZQNA 1BPEA 3ISCA 2P66A 4WC1A 4R66A 8ICYA 4RT3A 3JPSA 4IQVA 1ZQIA 3TFRA 2PBEA 3C5GA 4TUQA 3MGHA 4KLSA 2ISPA 4KLLA 4O9MA 3OVSA 4JWNA 5DB6A 3AU2A 4E80A 4DO9A 5BOMA 4P4PA 5J0YA 3MBYA 2DRBA 4E7XA 3JPTA 1ZQDA 4NLKA 4LZDA 3PNCA 9ICHA 4RT2A 3NYBA 1BPBA 4QZ8A 1UEVA 1TFYA 2ID1A 3AQLA 4R65A 3JPOA 5HR9A 5DB7A 3UXNA 7ICQA 9ICTA 7ICHA 5CWRA 2VANA 8ICQA 4NKUA 4X0AA 2DR5A 3HJ1A 3OGUA 7ICMA 2FMQA 1Q78A 3RJKA 4QZDA 3AQMA 4WC2A 4IQWA 3AQNA 8ICVA 5DKWA 5BPCA 4AT8B 1JMSA 3C66A 4IQUA 7ICGA 4MF2A 5HRLA 2B56A 1RZTA 4X0BA 2ZHAA 4M9JA 4I29A 5IILA 3WFSC 1F5AA 2B51A 2ISOA 3JPPA 3LK9A 7ICTA 9ICIA 4TURA 2M2VA 4AT8A 1ZQMA 9ICEA 4YN4A 5IIJA 3JPNA 1MQ2A 4FHWA 4WC4A 3UXPA 4X4TA 2BE3A 4X4SA 8ICKA 5HRGA 2ZH5A 2NRKA 4X4QA 4PHPA 7ICRA 5CP2A 5HRKA 4UAYA 3AU6A 9ICMA 3HIYA 5HREA 1ZQOA 3RJHA 5DBAA 3AUOA 2ZH8A 1R8BA 3ISDA 5J0OA 4PHEA 4RQ1A 4I2AA 8ICCA 5J2FA 4I2EA 8ICZA 1BPZA 4XUSA 1OU5A 4UB2A 8ICHA 4TUSA 4XRHA 3L9DA 5J2AA 4R64A 4M0AA 5J0PA 2BPFA 1ZQKA 7ICEA 4MF8A 4K4IA 5IIOA 4NM1A 3MDCA 9ICCA 3H3AA 4RWPA 1PX5A 4M9NA 5J0UA 1ZQZA 3RH5A 2BCRA 3PMLA 3RH4A 4PHAA 3V7LA 5J2CA 4M9LA 5CA7A 5DECA 5CB1A 1ZQWA 3JPQA 4K4GA 4KLJA 8ICMA 4YCXA 2ZH9A 2FMSA 4RQ8A 3WFQE 4YD1A 4UB4A 7ICOA 1HUOA 4RQ2A 1MIYA 4IQTA 4QZAA 2DVIA 8ICWA 3C2LA 1TV9A 3WFOA 8ICSA 7ICUA 8ICNA 3WFPA 4FHVA 4LZGA 8ICBA 5J0WA 1ZQVA 4QZIA 5HHIA 1VJ7A 1XSPA 1BPXA 4RWOA 3TFSA 8ICAA 4P4OA 3JZ0A 4KLGA 4LT6A 1HUZA 3RJGA 3UQ0A 1KNYA 4WCWA 4I2BA 9ICAA 4X5VA 4NKTA 9ICWA 1ZQLA 1ZJNA 4KLMA 3JPRA 7ICVA 4X4VA 5F2VO 3OUYB 5IIIA 5DB9A 4EP7A 2M2UA 1TFWA 4KLQA 7ICJA 4M5DA 5J0QA 3UPSA 4FH3A 2ZH2A 4QZ9A 4QZBA 5J2DA 4I27A 1ZQXA 3C2MA 5HC9A 2FMPA 4KLOA 4PH5A 9ICBA 4GXKA 4WBYA 4NXZA 8ICTA 1XSNA 7ICSA 3RJFA 5J0RA 5J2EA 1ZQTA 1V4AA 4X4PA 9ICFA 8ICGA 4Z6DA 9ICXA 3H38A 5J2GA 1UEUA 4I2FA 4EBJA 5IIKA 3OV7A 4KLHA 1ZQJA 4UBCA 1JN3A 5DDYA 1ZQEA 2PFQA 9ICNA 1Q79A 4Z6CA 4FH5A 4MFFA 2DR7A 1RPLA 5DB8A 2O1PA 2PXIA 9ICVA 5D46A 8ICUA 4UD5A 5TZVA 5D4BA 8ICPA 4F5RA 4YD2A 4RQ7A 3V7JA 4PHDA 2I9GA 8ICJA 3B0YA 5CHGA 5DEDA 2PFOA 3RJEA 3HWTA 4XQ7A 5HRFA 2ZH7A 4KLUA 1ZQBA 3HX0A 4RQ3A 4RQ0A 2DRAA 4Z6EA 4O5KA 1ZQAA 3AQKA 3LQCB 3K75D 1ZQUA 2ZHBA 4WC5A 4RWQA 1ZQSA 2GWSA 9ICUA 1MIVA 3WFRE 8ICIA 8ICRA
chains in the Genus database with same CATH superfamily
3GDXA 1YLQA 4YMMA 4UB3A 4OAFA 5J0TA 1ZJMA 2PFPA 3B0XA 1R8CA 4X4OA 3RJIA 7ICLA 4EV6A 5J2HA 2RFFA 4XQ8A 5DBBA 8ICOA 1ZQYA 2PFNA 1JQRA 2ZH3A 9ICOA 4UBBA 4K4HA 1NOMA 4XJEA 4LVSA 3NWIA 1ZQQA 2BPCA 3C2KA 2BCSA 4M47A 5DBCA 4RQ6A 5BOLA 4UAZA 4FO1A 2ZH4A 4I2IA 5HRDA 5IINA 4JLXA 4WBZA 5J0XA 1WOTA 3UQ2A 4TUPA 4NXWA 1UETA 4WQLA 4QZEA 4F5NA 4X4UA 5D61A 5HRBA 4UB5A 4E8FA 4F5PA 3OVBA 2ZH1A 2BCVA 2M2TA 4UD4A 4I2JA 3MDAA 3H39A 4DOBA 3OUYA 1GPJA 4WC3A 4R63A 4I2GA 4PGQA 9ICGA 8ICEA 4NM2A 1R89A 3C18A 4K8VA 9ICJA 8ICLA 4KLTA 5J2BA 1JAJA 4KLDA 7ICKA 2DR9A 1ZQHA 4DOAA 7ICIA 4O5EA 4I2HA 4FHPA 4WC0A 4RPXA 4AT7B 3HW8A 4EBKA 4O68A 4M04A 4LEYA 5CJ7A 4I2DA 7ICNA 4NXTA 4ATBB 4WH5A 4KLIA 1ZQCA 9ICLA 1ZQGA 4XA5A 4IG8A 5HRIA 4DOCA 2Q66A 4X4NA 3V7KA 4PGXA 4AT9B 4FHYA 5D62A 4PPXA 4QZHA 1R8AA 5DDMA 4NLNA 9ICPA 3C5FA 4NXUA 1VFGA 4WC6A 2W9MA 4AT7A 4X4RA 3OVAA 4NY8A 4RPZA 4LEVA 1TVAA 2HHPA 5HHHA 4ATBA 3RJJA 4YMOA 5J0SA 4WC7A 9ICSA 4QZFA 4I2CA 2O5AA 4O67A 4RWNA 4UB1A 4K9AA 2BCQA 4AT9A 4M2YA 8ICFA 7ICFA 3UPQA 4JWMA 1KEJA 1KDHA 4FHXA 3UXOA 8ICXA 3PMNA 4NLZA 4KLEA 4YMNA 2BPGA 5CR0A 4UAWA 2IHMA 2IUBA 1FA0A 3MGIA 5D49A 3V72A 5JTGA 4O6AA 4S3NA 4F5OA 4P4MA 4I28A 3ER8C 1ZQPA 4M9HA 3ISBA 4F5QA 3JYYA 4MFAA 3HJ4A 3RH6A 4EGWA 4GXJA 4GXIA 1MQ3A 1MIWA 4MFCA 1BPYA 3NVOA 5J2JA 4K9BA 5IIMA 4Z6FA 4EEBA 2IHOA 4FO6A 9ICRA 2BCUA 3H37A 2ZH6A 1XSLA 4QZGA 5J29A 5J2IA 2DR8A 9ICKA 2BBHA 4P2HA 1ZQRA 4KLFA 4RPYA 2M2WA 4RQ5A 9ICQA 4PGYA 4NXXA 4N7RA 5CFSA 1ZQFA 4MKPA 1NO5A 5EOZA 4M9GA 2B4VA 7ICPA 1BPDA 5J2KA 4O5CA 4RQ4A 4QZCA 5HRHA 1ZQNA 1BPEA 3ISCA 2P66A 4WC1A 4R66A 8ICYA 4RT3A 3JPSA 4IQVA 3NKUA 1ZQIA 3K7DA 3TFRA 3PHZA 2PBEA 3C5GA 4TUQA 3MGHA 4KLSA 2ISPA 4KLLA 4O9MA 3OVSA 4JWNA 5DB6A 3AU2A 4E80A 4DO9A 5BOMA 4P4PA 5J0YA 3MBYA 2DRBA 4E7XA 3JPTA 1ZQDA 4NLKA 4LZDA 3PNCA 9ICHA 4EEDA 3NYBA 4RT2A 1BPBA 4OAHA 4QZ8A 1UEVA 1TFYA 2ID1A 3AQLA 4R65A 3JPOA 5HR9A 5DB7A 2HN2A 3UXNA 7ICQA 9ICTA 7ICHA 5CWRA 2VANA 8ICQA 4NKUA 4JLZA 4X0AA 2DR5A 3HJ1A 3OGUA 7ICMA 2FMQA 3EF2A 1Q78A 3RJKA 4QZDA 3AQMA 4WC2A 4IQWA 3AQNA 8ICVA 5DKWA 5BPCA 4AT8B 1JMSA 3C66A 4IQUA 7ICGA 4MF2A 5HRLA 2B56A 5D63A 1RZTA 2ZHAA 4X0BA 4M9JA 4I29A 5IILA 3WFSC 1F5AA 2B51A 2ISOA 3JPPA 3LK9A 7ICTA 9ICIA 4TURA 3ER9B 2M2VA 4AT8A 1ZQMA 9ICEA 4YN4A 5IIJA 3JPNA 1MQ2A 4FHWA 4LEZA 4WC4A 3UXPA 4X4TA 2BE3A 4X4SA 8ICKA 5HRGA 2GA9D 2ZH5A 2NRKA 4X4QA 4PHPA 7ICRA 5CP2A 5HRKA 4UAYA 3AU6A 9ICMA 3HIYA 5HREA 1ZQOA 3RJHA 5DBAA 3AUOA 2ZH8A 4OAGA 1R8BA 3ISDA 5J0OA 4PHEA 4RQ1A 4I2AA 8ICCA 5J2FA 4I2EA 8ICZA 1BPZA 4XUSA 1OU5A 4UB2A 8ICHA 4TUSA 4XRHA 3L9DA 5J2AA 5CFUA 2GAFD 4R64A 4M0AA 5J0PA 2BPFA 1ZQKA 7ICEA 4MF8A 4K4IA 5IIOA 4NM1A 3MDCA 9ICCA 4K96A 3H3AA 4RWPA 1PX5A 4M9NA 2BBJA 5J0UA 1ZQZA 3RH5A 2BCRA 3PMLA 3RH4A 4PHAA 3V7LA 5J2CA 4M9LA 5CA7A 5DECA 5CB1A 1ZQWA 3JPQA 4K4GA 4KLJA 8ICMA 4YCXA 2ZH9A 2FMSA 4RQ8A 3WFQE 4YD1A 4UB4A 7ICOA 1HUOA 3CK6A 4RQ2A 1MIYA 2DVIA 4IQTA 4QZAA 8ICWA 3C2LA 1TV9A 3WFOA 8ICSA 7ICUA 8ICNA 3WFPA 4FHVA 4LZGA 8ICBA 5J0WA 1ZQVA 4QZIA 5HHIA 1VJ7A 1XSPA 1BPXA 4RWOA 3TFSA 8ICAA 4P4OA 3JZ0A 2HN1A 4KLGA 4LT6A 3OWGA 1HUZA 3RJGA 3UQ0A 1KNYA 4WCWA 4I2BA 9ICAA 4X5VA 4WQKA 4NKTA 9ICWA 1ZQLA 1ZJNA 4OAIZ 4KLMA 3JPRA 7ICVA 4X4VA 5F2VO 3OUYB 5IIIA 5DB9A 4EP7A 1TFWA 2M2UA 4KLQA 4K97A 4K99A 7ICJA 4M5DA 5J0QA 3UPSA 4FH3A 2ZH2A 4QZ9A 4QZBA 5J2DA 4I27A 5CFTA 4WOYA 1ZQXA 4LEWA 4O69A 3C2MA 5HC9A 4HX0A 2FMPA 4KLOA 4PH5A 9ICBA 4GXKA 4WBYA 4NXZA 8ICTA 1XSNA 2FCLA 7ICSA 3RJFA 5J0RA 5J2EA 1ZQTA 4NXVA 1V4AA 4X4PA 3MCRA 8ICGA 9ICFA 4Z6DA 9ICXA 3H38A 5J2GA 1UEUA 4I2FA 4EBJA 3OV7A 5IIKA 4KLHA 1ZQJA 4UBCA 1JN3A 5DDYA 1ZQEA 2PFQA 9ICNA 1Q79A 4Z6CA 4I0UA 4FH5A 4MFFA 2DR7A 1RPLA 5DB8A 2O1PA 2PXIA 9ICVA 5D46A 8ICUA 4UD5A 5TZVA 4KM5A 5D4BA 8ICPA 5CHEA 4F5RA 4YD2A 4RQ7A 3V7JA 4PHDA 2I9GA 5B3PA 8ICJA 3B0YA 5B3QA 3JCFA 5CHGA 5DEDA 2EWRA 2PFOA 3RJEA 3HWTA 4XQ7A 2ZH7A 5HRFA 4KLUA 1ZQBA 3HX0A 4RQ3A 4RQ0A 2DRAA 4Z6EA 4KB6A 4O5KA 1ZQAA 3AQKA 3LQCB 3K75D 1ZQUA 2ZHBA 4WC5A 4RWQA 4K98A 1ZQSA 2GWSA 9ICUA 1MIVA 3WFRE 8ICIA 8ICRA 3ERCC
chains in the Genus database with same CATH topology
3GDXA 1YLQA 4YMMA 4UB3A 4OAFA 5J0TA 1ZJMA 2PFPA 3B0XA 1R8CA 4X4OA 3RJIA 7ICLA 5J2HA 2RFFA 4XQ8A 5DBBA 8ICOA 1ZQYA 2PFNA 1JQRA 2ZH3A 9ICOA 4UBBA 4K4HA 1NOMA 4LVSA 1ZQQA 2BPCA 3C2KA 2BCSA 4M47A 5DBCA 4RQ6A 5BOLA 4UAZA 2ZH4A 4I2IA 5HRDA 5IINA 4JLXA 4WBZA 5J0XA 1WOTA 3UQ2A 4TUPA 4NXWA 1UETA 4QZEA 4F5NA 4X4UA 4UB5A 5HRBA 4F5PA 4E8FA 3OVBA 2ZH1A 2BCVA 2M2TA 4UD4A 4I2JA 3MDAA 3H39A 4DOBA 3OUYA 4WC3A 4R63A 4I2GA 4PGQA 9ICGA 8ICEA 4NM2A 1R89A 3C18A 4K8VA 9ICJA 8ICLA 4KLTA 5J2BA 1JAJA 4KLDA 7ICKA 2DR9A 1ZQHA 4DOAA 7ICIA 4O5EA 4I2HA 4FHPA 4WC0A 4RPXA 4AT7B 3HW8A 4EBKA 4O68A 4M04A 4LEYA 5CJ7A 4I2DA 7ICNA 4NXTA 4ATBB 4KLIA 1ZQCA 9ICLA 1ZQGA 4XA5A 5HRIA 4DOCA 4IG8A 2Q66A 4X4NA 3V7KA 4PGXA 4AT9B 4FHYA 4PPXA 4QZHA 1R8AA 5DDMA 4NLNA 9ICPA 3C5FA 4NXUA 1VFGA 4WC6A 2W9MA 4AT7A 4X4RA 3OVAA 4NY8A 4RPZA 4LEVA 1TVAA 2HHPA 5HHHA 4ATBA 3RJJA 4WC7A 4YMOA 5J0SA 9ICSA 4QZFA 4I2CA 2O5AA 4O67A 4RWNA 4UB1A 4K9AA 2BCQA 4AT9A 4M2YA 8ICFA 7ICFA 3UPQA 4JWMA 1KEJA 1KDHA 4FHXA 3UXOA 8ICXA 3PMNA 4NLZA 4KLEA 4YMNA 2BPGA 5CR0A 4UAWA 2IHMA 1FA0A 3MGIA 5D49A 3V72A 4O6AA 4S3NA 4F5OA 4P4MA 4I28A 1ZQPA 4M9HA 3ISBA 4F5QA 3JYYA 4MFAA 3HJ4A 3RH6A 4GXJA 4GXIA 1MQ3A 1MIWA 4MFCA 1BPYA 5J2JA 4K9BA 5IIMA 4Z6FA 4FO6A 9ICRA 2BCUA 3H37A 2ZH6A 1XSLA 4QZGA 5J29A 5J2IA 2DR8A 9ICKA 4P2HA 1ZQRA 4KLFA 4RPYA 2M2WA 4RQ5A 9ICQA 4PGYA 4NXXA 1ZQFA 4MKPA 1NO5A 5EOZA 4M9GA 2B4VA 7ICPA 1BPDA 5J2KA 4O5CA 4RQ4A 4QZCA 5HRHA 1ZQNA 1BPEA 3ISCA 2P66A 4WC1A 4R66A 8ICYA 4RT3A 3JPSA 4IQVA 1ZQIA 3TFRA 2PBEA 3C5GA 4TUQA 3MGHA 4KLSA 2ISPA 4KLLA 4O9MA 3OVSA 4JWNA 5DB6A 3AU2A 4E80A 4DO9A 5BOMA 4P4PA 5J0YA 3MBYA 2DRBA 4E7XA 3JPTA 1ZQDA 4NLKA 4LZDA 3PNCA 9ICHA 4RT2A 3NYBA 1BPBA 4OAHA 4QZ8A 1UEVA 1TFYA 2ID1A 3AQLA 4R65A 3JPOA 5HR9A 5DB7A 3UXNA 7ICQA 9ICTA 7ICHA 5CWRA 2VANA 8ICQA 4NKUA 4JLZA 4X0AA 2DR5A 3HJ1A 3OGUA 7ICMA 2FMQA 1Q78A 3RJKA 4QZDA 3AQMA 4WC2A 4IQWA 3AQNA 8ICVA 5BPCA 5DKWA 4AT8B 1JMSA 3C66A 4IQUA 7ICGA 4MF2A 5HRLA 2B56A 1RZTA 2ZHAA 4X0BA 4M9JA 4I29A 5IILA 3WFSC 1F5AA 2B51A 2ISOA 3JPPA 3LK9A 7ICTA 9ICIA 4TURA 2M2VA 4AT8A 1ZQMA 9ICEA 4YN4A 5IIJA 3JPNA 1MQ2A 4FHWA 4LEZA 4WC4A 3UXPA 4X4TA 2BE3A 4X4SA 8ICKA 5HRGA 2ZH5A 2NRKA 4X4QA 4PHPA 7ICRA 5CP2A 5HRKA 4UAYA 3AU6A 9ICMA 3HIYA 5HREA 1ZQOA 3RJHA 5DBAA 3AUOA 2ZH8A 4OAGA 1R8BA 3ISDA 5J0OA 4PHEA 4RQ1A 4I2AA 8ICCA 5J2FA 4I2EA 8ICZA 1BPZA 4XUSA 1OU5A 4UB2A 8ICHA 4TUSA 4XRHA 3L9DA 5J2AA 4R64A 4M0AA 5J0PA 2BPFA 1ZQKA 7ICEA 4MF8A 4K4IA 5IIOA 4NM1A 3MDCA 9ICCA 4K96A 3H3AA 4RWPA 1PX5A 4M9NA 5J0UA 1ZQZA 3RH5A 2BCRA 3PMLA 3RH4A 4PHAA 3V7LA 5J2CA 4M9LA 5CA7A 5DECA 5CB1A 1ZQWA 3JPQA 4K4GA 4KLJA 8ICMA 4YCXA 2ZH9A 2FMSA 4RQ8A 3WFQE 4YD1A 4UB4A 7ICOA 1HUOA 4RQ2A 1MIYA 2DVIA 4IQTA 4QZAA 8ICWA 3C2LA 1TV9A 3WFOA 8ICSA 7ICUA 8ICNA 3WFPA 4FHVA 4LZGA 8ICBA 5J0WA 1ZQVA 4QZIA 5HHIA 1VJ7A 1XSPA 1BPXA 4RWOA 3TFSA 8ICAA 4P4OA 3JZ0A 4KLGA 4LT6A 1HUZA 3RJGA 3UQ0A 1KNYA 4WCWA 4I2BA 9ICAA 4X5VA 4NKTA 9ICWA 1ZQLA 1ZJNA 4OAIZ 4KLMA 3JPRA 7ICVA 4X4VA 5F2VO 3OUYB 5IIIA 5DB9A 4EP7A 1TFWA 2M2UA 4KLQA 4K97A 4K99A 7ICJA 4M5DA 5J0QA 3UPSA 4FH3A 2ZH2A 4QZ9A 4QZBA 5J2DA 4I27A 4WOYA 1ZQXA 4LEWA 4O69A 3C2MA 5HC9A 2FMPA 4KLOA 4PH5A 9ICBA 4GXKA 4WBYA 4NXZA 8ICTA 1XSNA 7ICSA 3RJFA 5J0RA 5J2EA 1ZQTA 4NXVA 1V4AA 4X4PA 9ICFA 8ICGA 4Z6DA 9ICXA 3H38A 5J2GA 1UEUA 4I2FA 4EBJA 3OV7A 5IIKA 4KLHA 1ZQJA 4UBCA 1JN3A 5DDYA 1ZQEA 2PFQA 9ICNA 1Q79A 4Z6CA 4FH5A 4MFFA 2DR7A 1RPLA 5DB8A 2O1PA 2PXIA 9ICVA 5D46A 8ICUA 4UD5A 5TZVA 4KM5A 5D4BA 8ICPA 4F5RA 4YD2A 4RQ7A 3V7JA 4PHDA 2I9GA 8ICJA 3B0YA 5CHGA 5DEDA 2PFOA 3RJEA 3HWTA 4XQ7A 2ZH7A 5HRFA 4KLUA 1ZQBA 3HX0A 4RQ3A 4RQ0A 2DRAA 4Z6EA 4KB6A 4O5KA 1ZQAA 3AQKA 3LQCB 3K75D 1ZQUA 2ZHBA 4WC5A 4RWQA 4K98A 1ZQSA 2GWSA 9ICUA 1MIVA 3WFRE 8ICIA 8ICRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GDX A;  1YLQ A;  4YMM A;  4UB3 A;  5J0T A;  1ZJM A;  2PFP A;  3B0X A;  1R8C A;  4X4O A;  3RJI A;  7ICL A;  5J2H A;  2RFF A;  4XQ8 A;  5DBB A;  8ICO A;  1ZQY A;  2PFN A;  1JQR A;  2ZH3 A;  9ICO A;  4UBB A;  4K4H A;  1NOM A;  4LVS A;  1ZQQ A;  2BPC A;  3C2K A;  2BCS A;  4M47 A;  5DBC A;  4RQ6 A;  5BOL A;  4UAZ A;  2ZH4 A;  4I2I A;  5HRD A;  5IIN A;  4WBZ A;  5J0X A;  1WOT A;  3UQ2 A;  4TUP A;  4QZE A;  1UET A;  4F5N A;  4UB5 A;  4F5P A;  5HRB A;  4X4U A;  4E8F A;  3OVB A;  2ZH1 A;  2BCV A;  2M2T A;  4UD4 A;  4I2J A;  3MDA A;  3H39 A;  4DOB A;  3OUY A;  4WC3 A;  4R63 A;  4I2G A;  4PGQ A;  9ICG A;  8ICE A;  4NM2 A;  1R89 A;  3C18 A;  9ICJ A;  8ICL A;  4KLT A;  5J2B A;  1JAJ A;  4KLD A;  7ICK A;  2DR9 A;  1ZQH A;  4DOA A;  7ICI A;  4O5E A;  4I2H A;  4FHP A;  4WC0 A;  4RPX A;  4AT7 B;  3HW8 A;  4EBK A;  4M04 A;  5CJ7 A;  4I2D A;  7ICN A;  4ATB B;  4KLI A;  1ZQC A;  9ICL A;  1ZQG A;  4XA5 A;  5HRI A;  4DOC A;  4IG8 A;  2Q66 A;  4X4N A;  3V7K A;  4PGX A;  4AT9 B;  4FHY A;  4PPX A;  4QZH A;  1R8A A;  5DDM A;  4NLN A;  9ICP A;  3C5F A;  1VFG A;  4WC6 A;  2W9M A;  4AT7 A;  4X4R A;  3OVA A;  4NY8 A;  4RPZ A;  1TVA A;  2HHP A;  5HHH A;  4ATB A;  3RJJ A;  4WC7 A;  4YMO A;  5J0S A;  9ICS A;  4QZF A;  4I2C A;  2O5A A;  4RWN A;  4UB1 A;  2BCQ A;  4AT9 A;  4M2Y A;  8ICF A;  7ICF A;  3UPQ A;  4JWM A;  1KEJ A;  1KDH A;  4FHX A;  3UXO A;  8ICX A;  3PMN A;  4NLZ A;  4KLE A;  4YMN A;  2BPG A;  5CR0 A;  4UAW A;  2IHM A;  1FA0 A;  3MGI A;  5D49 A;  3V72 A;  4S3N A;  4F5O A;  4P4M A;  4I28 A;  1ZQP A;  4M9H A;  3ISB A;  4F5Q A;  3JYY A;  4MFA A;  3HJ4 A;  3RH6 A;  4GXJ A;  4GXI A;  1MQ3 A;  1MIW A;  4MFC A;  1BPY A;  5J2J A;  5IIM A;  4Z6F A;  4FO6 A;  9ICR A;  2BCU A;  3H37 A;  2ZH6 A;  1XSL A;  4QZG A;  5J29 A;  5J2I A;  2DR8 A;  9ICK A;  4P2H A;  1ZQR A;  4KLF A;  4RPY A;  2M2W A;  4RQ5 A;  9ICQ A;  4PGY A;  1ZQF A;  1NO5 A;  5EOZ A;  4M9G A;  2B4V A;  7ICP A;  1BPD A;  5J2K A;  4O5C A;  4RQ4 A;  4QZC A;  5HRH A;  1ZQN A;  1BPE A;  3ISC A;  2P66 A;  4WC1 A;  4R66 A;  8ICY A;  4RT3 A;  3JPS A;  4IQV A;  1ZQI A;  3TFR A;  2PBE A;  3C5G A;  4TUQ A;  3MGH A;  4KLS A;  2ISP A;  4KLL A;  4O9M A;  3OVS A;  4JWN A;  5DB6 A;  3AU2 A;  4E80 A;  4DO9 A;  5BOM A;  4P4P A;  5J0Y A;  3MBY A;  2DRB A;  4E7X A;  3JPT A;  1ZQD A;  4NLK A;  4LZD A;  3PNC A;  9ICH A;  4RT2 A;  3NYB A;  1BPB A;  4QZ8 A;  1UEV A;  1TFY A;  2ID1 A;  3AQL A;  4R65 A;  3JPO A;  5HR9 A;  5DB7 A;  3UXN A;  7ICQ A;  9ICT A;  7ICH A;  5CWR A;  2VAN A;  8ICQ A;  4NKU A;  4X0A A;  2DR5 A;  3HJ1 A;  3OGU A;  7ICM A;  2FMQ A;  1Q78 A;  3RJK A;  4QZD A;  3AQM A;  4WC2 A;  4IQW A;  3AQN A;  8ICV A;  5DKW A;  5BPC A;  4AT8 B;  1JMS A;  3C66 A;  4IQU A;  7ICG A;  4MF2 A;  5HRL A;  2B56 A;  1RZT A;  4X0B A;  2ZHA A;  4M9J A;  4I29 A;  5IIL A;  3WFS C;  1F5A A;  2B51 A;  2ISO A;  3JPP A;  3LK9 A;  7ICT A;  9ICI A;  4TUR A;  2M2V A;  4AT8 A;  1ZQM A;  9ICE A;  4YN4 A;  5IIJ A;  3JPN A;  1MQ2 A;  4FHW A;  4WC4 A;  3UXP A;  4X4T A;  2BE3 A;  4X4S A;  8ICK A;  5HRG A;  2ZH5 A;  2NRK A;  4X4Q A;  4PHP A;  7ICR A;  5CP2 A;  5HRK A;  4UAY A;  3AU6 A;  9ICM A;  3HIY A;  5HRE A;  1ZQO A;  3RJH A;  5DBA A;  3AUO A;  2ZH8 A;  1R8B A;  3ISD A;  5J0O A;  4PHE A;  4RQ1 A;  4I2A A;  8ICC A;  5J2F A;  4I2E A;  8ICZ A;  1BPZ A;  4XUS A;  1OU5 A;  4UB2 A;  8ICH A;  4TUS A;  4XRH A;  3L9D A;  5J2A A;  4R64 A;  4M0A A;  5J0P A;  2BPF A;  1ZQK A;  7ICE A;  4MF8 A;  4K4I A;  5IIO A;  4NM1 A;  3MDC A;  9ICC A;  3H3A A;  4RWP A;  1PX5 A;  4M9N A;  5J0U A;  1ZQZ A;  3RH5 A;  2BCR A;  3PML A;  3RH4 A;  4PHA A;  3V7L A;  5J2C A;  4M9L A;  5CA7 A;  5DEC A;  5CB1 A;  1ZQW A;  3JPQ A;  4K4G A;  4KLJ A;  8ICM A;  4YCX A;  2ZH9 A;  2FMS A;  4RQ8 A;  3WFQ E;  4YD1 A;  4UB4 A;  7ICO A;  1HUO A;  4RQ2 A;  1MIY A;  4IQT A;  4QZA A;  2DVI A;  8ICW A;  3C2L A;  1TV9 A;  3WFO A;  8ICS A;  7ICU A;  8ICN A;  3WFP A;  4FHV A;  4LZG A;  8ICB A;  5J0W A;  1ZQV A;  4QZI A;  5HHI A;  1VJ7 A;  1XSP A;  1BPX A;  4RWO A;  3TFS A;  8ICA A;  4P4O A;  3JZ0 A;  4KLG A;  4LT6 A;  1HUZ A;  3RJG A;  3UQ0 A;  1KNY A;  4WCW A;  4I2B A;  9ICA A;  4X5V A;  4NKT A;  9ICW A;  1ZQL A;  1ZJN A;  4KLM A;  3JPR A;  7ICV A;  4X4V A;  5F2V O;  3OUY B;  5III A;  5DB9 A;  4EP7 A;  2M2U A;  1TFW A;  4KLQ A;  7ICJ A;  4M5D A;  5J0Q A;  3UPS A;  4FH3 A;  2ZH2 A;  4QZ9 A;  4QZB A;  5J2D A;  4I27 A;  1ZQX A;  3C2M A;  5HC9 A;  2FMP A;  4KLO A;  4PH5 A;  9ICB A;  4GXK A;  4WBY A;  4NXZ A;  8ICT A;  1XSN A;  7ICS A;  3RJF A;  5J0R A;  5J2E A;  1ZQT A;  1V4A A;  4X4P A;  9ICF A;  8ICG A;  4Z6D A;  9ICX A;  3H38 A;  5J2G A;  1UEU A;  4I2F A;  4EBJ A;  5IIK A;  3OV7 A;  4KLH A;  1ZQJ A;  4UBC A;  1JN3 A;  5DDY A;  1ZQE A;  2PFQ A;  9ICN A;  1Q79 A;  4Z6C A;  4FH5 A;  4MFF A;  2DR7 A;  1RPL A;  5DB8 A;  2O1P A;  2PXI A;  9ICV A;  5D46 A;  8ICU A;  4UD5 A;  5TZV A;  5D4B A;  8ICP A;  4F5R A;  4YD2 A;  4RQ7 A;  3V7J A;  4PHD A;  2I9G A;  8ICJ A;  3B0Y A;  5CHG A;  5DED A;  2PFO A;  3RJE A;  3HWT A;  4XQ7 A;  5HRF A;  2ZH7 A;  4KLU A;  1ZQB A;  3HX0 A;  4RQ3 A;  4RQ0 A;  2DRA A;  4Z6E A;  4O5K A;  1ZQA A;  3AQK A;  3LQC B;  3K75 D;  1ZQU A;  2ZHB A;  4WC5 A;  4RWQ A;  1ZQS A;  2GWS A;  9ICU A;  1MIV A;  3WFR E;  8ICI A;  8ICR A; 
#chains in the Genus database with same CATH topology
 3GDX A;  1YLQ A;  4YMM A;  4UB3 A;  4OAF A;  5J0T A;  1ZJM A;  2PFP A;  3B0X A;  1R8C A;  4X4O A;  3RJI A;  7ICL A;  4EV6 A;  5J2H A;  2RFF A;  4XQ8 A;  5DBB A;  8ICO A;  1ZQY A;  2PFN A;  1JQR A;  2ZH3 A;  9ICO A;  4UBB A;  4K4H A;  1NOM A;  4XJE A;  4LVS A;  3NWI A;  1ZQQ A;  2BPC A;  3C2K A;  2BCS A;  4M47 A;  5DBC A;  4RQ6 A;  5BOL A;  4UAZ A;  4FO1 A;  2ZH4 A;  4I2I A;  5HRD A;  5IIN A;  4JLX A;  4WBZ A;  5J0X A;  1WOT A;  3UQ2 A;  4TUP A;  4NXW A;  1UET A;  4WQL A;  4QZE A;  4F5N A;  4X4U A;  5D61 A;  5HRB A;  4UB5 A;  4E8F A;  4F5P A;  3OVB A;  2ZH1 A;  2BCV A;  2M2T A;  4UD4 A;  4I2J A;  3MDA A;  3H39 A;  4DOB A;  3OUY A;  1GPJ A;  4WC3 A;  4R63 A;  4I2G A;  4PGQ A;  9ICG A;  8ICE A;  4NM2 A;  1R89 A;  3C18 A;  4K8V A;  9ICJ A;  8ICL A;  4KLT A;  5J2B A;  1JAJ A;  4KLD A;  7ICK A;  2DR9 A;  1ZQH A;  4DOA A;  7ICI A;  4O5E A;  4I2H A;  4FHP A;  4WC0 A;  4RPX A;  4AT7 B;  3HW8 A;  4EBK A;  4O68 A;  4M04 A;  4LEY A;  5CJ7 A;  4I2D A;  7ICN A;  4NXT A;  4ATB B;  4WH5 A;  4KLI A;  1ZQC A;  9ICL A;  1ZQG A;  4XA5 A;  4IG8 A;  5HRI A;  4DOC A;  2Q66 A;  4X4N A;  3V7K A;  4PGX A;  4AT9 B;  4FHY A;  5D62 A;  4PPX A;  4QZH A;  1R8A A;  5DDM A;  4NLN A;  9ICP A;  3C5F A;  4NXU A;  1VFG A;  4WC6 A;  2W9M A;  4AT7 A;  4X4R A;  3OVA A;  4NY8 A;  4RPZ A;  4LEV A;  1TVA A;  2HHP A;  5HHH A;  4ATB A;  3RJJ A;  4YMO A;  5J0S A;  4WC7 A;  9ICS A;  4QZF A;  4I2C A;  2O5A A;  4O67 A;  4RWN A;  4UB1 A;  4K9A A;  2BCQ A;  4AT9 A;  4M2Y A;  8ICF A;  7ICF A;  3UPQ A;  4JWM A;  1KEJ A;  1KDH A;  4FHX A;  3UXO A;  8ICX A;  3PMN A;  4NLZ A;  4KLE A;  4YMN A;  2BPG A;  5CR0 A;  4UAW A;  2IHM A;  2IUB A;  1FA0 A;  3MGI A;  5D49 A;  3V72 A;  5JTG A;  4O6A A;  4S3N A;  4F5O A;  4P4M A;  4I28 A;  3ER8 C;  1ZQP A;  4M9H A;  3ISB A;  4F5Q A;  3JYY A;  4MFA A;  3HJ4 A;  3RH6 A;  4EGW A;  4GXJ A;  4GXI A;  1MQ3 A;  1MIW A;  4MFC A;  1BPY A;  3NVO A;  5J2J A;  4K9B A;  5IIM A;  4Z6F A;  4EEB A;  2IHO A;  4FO6 A;  9ICR A;  2BCU A;  3H37 A;  2ZH6 A;  1XSL A;  4QZG A;  5J29 A;  5J2I A;  2DR8 A;  9ICK A;  2BBH A;  4P2H A;  1ZQR A;  4KLF A;  4RPY A;  2M2W A;  4RQ5 A;  9ICQ A;  4PGY A;  4NXX A;  4N7R A;  5CFS A;  1ZQF A;  4MKP A;  1NO5 A;  5EOZ A;  4M9G A;  2B4V A;  7ICP A;  1BPD A;  5J2K A;  4O5C A;  4RQ4 A;  4QZC A;  5HRH A;  1ZQN A;  1BPE A;  3ISC A;  2P66 A;  4WC1 A;  4R66 A;  8ICY A;  4RT3 A;  3JPS A;  4IQV A;  3NKU A;  1ZQI A;  3K7D A;  3TFR A;  3PHZ A;  2PBE A;  3C5G A;  4TUQ A;  3MGH A;  4KLS A;  2ISP A;  4KLL A;  4O9M A;  3OVS A;  4JWN A;  5DB6 A;  3AU2 A;  4E80 A;  4DO9 A;  5BOM A;  4P4P A;  5J0Y A;  3MBY A;  2DRB A;  4E7X A;  3JPT A;  1ZQD A;  4NLK A;  4LZD A;  3PNC A;  9ICH A;  4EED A;  3NYB A;  4RT2 A;  1BPB A;  4OAH A;  4QZ8 A;  1UEV A;  1TFY A;  2ID1 A;  3AQL A;  4R65 A;  3JPO A;  5HR9 A;  5DB7 A;  2HN2 A;  3UXN A;  7ICQ A;  9ICT A;  7ICH A;  5CWR A;  2VAN A;  8ICQ A;  4NKU A;  4JLZ A;  4X0A A;  2DR5 A;  3HJ1 A;  3OGU A;  7ICM A;  2FMQ A;  3EF2 A;  1Q78 A;  3RJK A;  4QZD A;  3AQM A;  4WC2 A;  4IQW A;  3AQN A;  8ICV A;  5DKW A;  5BPC A;  4AT8 B;  1JMS A;  3C66 A;  4IQU A;  7ICG A;  4MF2 A;  5HRL A;  2B56 A;  5D63 A;  1RZT A;  2ZHA A;  4X0B A;  4M9J A;  4I29 A;  5IIL A;  3WFS C;  1F5A A;  2B51 A;  2ISO A;  3JPP A;  3LK9 A;  7ICT A;  9ICI A;  4TUR A;  3ER9 B;  2M2V A;  4AT8 A;  1ZQM A;  9ICE A;  4YN4 A;  5IIJ A;  3JPN A;  1MQ2 A;  4FHW A;  4LEZ A;  4WC4 A;  3UXP A;  4X4T A;  2BE3 A;  4X4S A;  8ICK A;  5HRG A;  2GA9 D;  2ZH5 A;  2NRK A;  4X4Q A;  4PHP A;  7ICR A;  5CP2 A;  5HRK A;  4UAY A;  3AU6 A;  9ICM A;  3HIY A;  5HRE A;  1ZQO A;  3RJH A;  5DBA A;  3AUO A;  2ZH8 A;  4OAG A;  1R8B A;  3ISD A;  5J0O A;  4PHE A;  4RQ1 A;  4I2A A;  8ICC A;  5J2F A;  4I2E A;  8ICZ A;  1BPZ A;  4XUS A;  1OU5 A;  4UB2 A;  8ICH A;  4TUS A;  4XRH A;  3L9D A;  5J2A A;  5CFU A;  2GAF D;  4R64 A;  4M0A A;  5J0P A;  2BPF A;  1ZQK A;  7ICE A;  4MF8 A;  4K4I A;  5IIO A;  4NM1 A;  3MDC A;  9ICC A;  4K96 A;  3H3A A;  4RWP A;  1PX5 A;  4M9N A;  2BBJ A;  5J0U A;  1ZQZ A;  3RH5 A;  2BCR A;  3PML A;  3RH4 A;  4PHA A;  3V7L A;  5J2C A;  4M9L A;  5CA7 A;  5DEC A;  5CB1 A;  1ZQW A;  3JPQ A;  4K4G A;  4KLJ A;  8ICM A;  4YCX A;  2ZH9 A;  2FMS A;  4RQ8 A;  3WFQ E;  4YD1 A;  4UB4 A;  7ICO A;  1HUO A;  3CK6 A;  4RQ2 A;  1MIY A;  2DVI A;  4IQT A;  4QZA A;  8ICW A;  3C2L A;  1TV9 A;  3WFO A;  8ICS A;  7ICU A;  8ICN A;  3WFP A;  4FHV A;  4LZG A;  8ICB A;  5J0W A;  1ZQV A;  4QZI A;  5HHI A;  1VJ7 A;  1XSP A;  1BPX A;  4RWO A;  3TFS A;  8ICA A;  4P4O A;  3JZ0 A;  2HN1 A;  4KLG A;  4LT6 A;  3OWG A;  1HUZ A;  3RJG A;  3UQ0 A;  1KNY A;  4WCW A;  4I2B A;  9ICA A;  4X5V A;  4WQK A;  4NKT A;  9ICW A;  1ZQL A;  1ZJN A;  4OAI Z;  4KLM A;  3JPR A;  7ICV A;  4X4V A;  5F2V O;  3OUY B;  5III A;  5DB9 A;  4EP7 A;  1TFW A;  2M2U A;  4KLQ A;  4K97 A;  4K99 A;  7ICJ A;  4M5D A;  5J0Q A;  3UPS A;  4FH3 A;  2ZH2 A;  4QZ9 A;  4QZB A;  5J2D A;  4I27 A;  5CFT A;  4WOY A;  1ZQX A;  4LEW A;  4O69 A;  3C2M A;  5HC9 A;  4HX0 A;  2FMP A;  4KLO A;  4PH5 A;  9ICB A;  4GXK A;  4WBY A;  4NXZ A;  8ICT A;  1XSN A;  2FCL A;  7ICS A;  3RJF A;  5J0R A;  5J2E A;  1ZQT A;  4NXV A;  1V4A A;  4X4P A;  3MCR A;  8ICG A;  9ICF A;  4Z6D A;  9ICX A;  3H38 A;  5J2G A;  1UEU A;  4I2F A;  4EBJ A;  3OV7 A;  5IIK A;  4KLH A;  1ZQJ A;  4UBC A;  1JN3 A;  5DDY A;  1ZQE A;  2PFQ A;  9ICN A;  1Q79 A;  4Z6C A;  4I0U A;  4FH5 A;  4MFF A;  2DR7 A;  1RPL A;  5DB8 A;  2O1P A;  2PXI A;  9ICV A;  5D46 A;  8ICU A;  4UD5 A;  5TZV A;  4KM5 A;  5D4B A;  8ICP A;  5CHE A;  4F5R A;  4YD2 A;  4RQ7 A;  3V7J A;  4PHD A;  2I9G A;  5B3P A;  8ICJ A;  3B0Y A;  5B3Q A;  3JCF A;  5CHG A;  5DED A;  2EWR A;  2PFO A;  3RJE A;  3HWT A;  4XQ7 A;  2ZH7 A;  5HRF A;  4KLU A;  1ZQB A;  3HX0 A;  4RQ3 A;  4RQ0 A;  2DRA A;  4Z6E A;  4KB6 A;  4O5K A;  1ZQA A;  3AQK A;  3LQC B;  3K75 D;  1ZQU A;  2ZHB A;  4WC5 A;  4RWQ A;  4K98 A;  1ZQS A;  2GWS A;  9ICU A;  1MIV A;  3WFR E;  8ICI A;  8ICR A;  3ERC C; 
#chains in the Genus database with same CATH homology
 3GDX A;  1YLQ A;  4YMM A;  4UB3 A;  4OAF A;  5J0T A;  1ZJM A;  2PFP A;  3B0X A;  1R8C A;  4X4O A;  3RJI A;  7ICL A;  5J2H A;  2RFF A;  4XQ8 A;  5DBB A;  8ICO A;  1ZQY A;  2PFN A;  1JQR A;  2ZH3 A;  9ICO A;  4UBB A;  4K4H A;  1NOM A;  4LVS A;  1ZQQ A;  2BPC A;  3C2K A;  2BCS A;  4M47 A;  5DBC A;  4RQ6 A;  5BOL A;  4UAZ A;  2ZH4 A;  4I2I A;  5HRD A;  5IIN A;  4JLX A;  4WBZ A;  5J0X A;  1WOT A;  3UQ2 A;  4TUP A;  4NXW A;  1UET A;  4QZE A;  4F5N A;  4X4U A;  4UB5 A;  5HRB A;  4F5P A;  4E8F A;  3OVB A;  2ZH1 A;  2BCV A;  2M2T A;  4UD4 A;  4I2J A;  3MDA A;  3H39 A;  4DOB A;  3OUY A;  4WC3 A;  4R63 A;  4I2G A;  4PGQ A;  9ICG A;  8ICE A;  4NM2 A;  1R89 A;  3C18 A;  4K8V A;  9ICJ A;  8ICL A;  4KLT A;  5J2B A;  1JAJ A;  4KLD A;  7ICK A;  2DR9 A;  1ZQH A;  4DOA A;  7ICI A;  4O5E A;  4I2H A;  4FHP A;  4WC0 A;  4RPX A;  4AT7 B;  3HW8 A;  4EBK A;  4O68 A;  4M04 A;  4LEY A;  5CJ7 A;  4I2D A;  7ICN A;  4NXT A;  4ATB B;  4KLI A;  1ZQC A;  9ICL A;  1ZQG A;  4XA5 A;  5HRI A;  4DOC A;  4IG8 A;  2Q66 A;  4X4N A;  3V7K A;  4PGX A;  4AT9 B;  4FHY A;  4PPX A;  4QZH A;  1R8A A;  5DDM A;  4NLN A;  9ICP A;  3C5F A;  4NXU A;  1VFG A;  4WC6 A;  2W9M A;  4AT7 A;  4X4R A;  3OVA A;  4NY8 A;  4RPZ A;  4LEV A;  1TVA A;  2HHP A;  5HHH A;  4ATB A;  3RJJ A;  4WC7 A;  4YMO A;  5J0S A;  9ICS A;  4QZF A;  4I2C A;  2O5A A;  4O67 A;  4RWN A;  4UB1 A;  4K9A A;  2BCQ A;  4AT9 A;  4M2Y A;  8ICF A;  7ICF A;  3UPQ A;  4JWM A;  1KEJ A;  1KDH A;  4FHX A;  3UXO A;  8ICX A;  3PMN A;  4NLZ A;  4KLE A;  4YMN A;  2BPG A;  5CR0 A;  4UAW A;  2IHM A;  1FA0 A;  3MGI A;  5D49 A;  3V72 A;  4O6A A;  4S3N A;  4F5O A;  4P4M A;  4I28 A;  1ZQP A;  4M9H A;  3ISB A;  4F5Q A;  3JYY A;  4MFA A;  3HJ4 A;  3RH6 A;  4GXJ A;  4GXI A;  1MQ3 A;  1MIW A;  4MFC A;  1BPY A;  5J2J A;  4K9B A;  5IIM A;  4Z6F A;  4FO6 A;  9ICR A;  2BCU A;  3H37 A;  2ZH6 A;  1XSL A;  4QZG A;  5J29 A;  5J2I A;  2DR8 A;  9ICK A;  4P2H A;  1ZQR A;  4KLF A;  4RPY A;  2M2W A;  4RQ5 A;  9ICQ A;  4PGY A;  4NXX A;  1ZQF A;  4MKP A;  1NO5 A;  5EOZ A;  4M9G A;  2B4V A;  7ICP A;  1BPD A;  5J2K A;  4O5C A;  4RQ4 A;  4QZC A;  5HRH A;  1ZQN A;  1BPE A;  3ISC A;  2P66 A;  4WC1 A;  4R66 A;  8ICY A;  4RT3 A;  3JPS A;  4IQV A;  1ZQI A;  3TFR A;  2PBE A;  3C5G A;  4TUQ A;  3MGH A;  4KLS A;  2ISP A;  4KLL A;  4O9M A;  3OVS A;  4JWN A;  5DB6 A;  3AU2 A;  4E80 A;  4DO9 A;  5BOM A;  4P4P A;  5J0Y A;  3MBY A;  2DRB A;  4E7X A;  3JPT A;  1ZQD A;  4NLK A;  4LZD A;  3PNC A;  9ICH A;  4RT2 A;  3NYB A;  1BPB A;  4OAH A;  4QZ8 A;  1UEV A;  1TFY A;  2ID1 A;  3AQL A;  4R65 A;  3JPO A;  5HR9 A;  5DB7 A;  3UXN A;  7ICQ A;  9ICT A;  7ICH A;  5CWR A;  2VAN A;  8ICQ A;  4NKU A;  4JLZ A;  4X0A A;  2DR5 A;  3HJ1 A;  3OGU A;  7ICM A;  2FMQ A;  1Q78 A;  3RJK A;  4QZD A;  3AQM A;  4WC2 A;  4IQW A;  3AQN A;  8ICV A;  5BPC A;  5DKW A;  4AT8 B;  1JMS A;  3C66 A;  4IQU A;  7ICG A;  4MF2 A;  5HRL A;  2B56 A;  1RZT A;  2ZHA A;  4X0B A;  4M9J A;  4I29 A;  5IIL A;  3WFS C;  1F5A A;  2B51 A;  2ISO A;  3JPP A;  3LK9 A;  7ICT A;  9ICI A;  4TUR A;  2M2V A;  4AT8 A;  1ZQM A;  9ICE A;  4YN4 A;  5IIJ A;  3JPN A;  1MQ2 A;  4FHW A;  4LEZ A;  4WC4 A;  3UXP A;  4X4T A;  2BE3 A;  4X4S A;  8ICK A;  5HRG A;  2ZH5 A;  2NRK A;  4X4Q A;  4PHP A;  7ICR A;  5CP2 A;  5HRK A;  4UAY A;  3AU6 A;  9ICM A;  3HIY A;  5HRE A;  1ZQO A;  3RJH A;  5DBA A;  3AUO A;  2ZH8 A;  4OAG A;  1R8B A;  3ISD A;  5J0O A;  4PHE A;  4RQ1 A;  4I2A A;  8ICC A;  5J2F A;  4I2E A;  8ICZ A;  1BPZ A;  4XUS A;  1OU5 A;  4UB2 A;  8ICH A;  4TUS A;  4XRH A;  3L9D A;  5J2A A;  4R64 A;  4M0A A;  5J0P A;  2BPF A;  1ZQK A;  7ICE A;  4MF8 A;  4K4I A;  5IIO A;  4NM1 A;  3MDC A;  9ICC A;  4K96 A;  3H3A A;  4RWP A;  1PX5 A;  4M9N A;  5J0U A;  1ZQZ A;  3RH5 A;  2BCR A;  3PML A;  3RH4 A;  4PHA A;  3V7L A;  5J2C A;  4M9L A;  5CA7 A;  5DEC A;  5CB1 A;  1ZQW A;  3JPQ A;  4K4G A;  4KLJ A;  8ICM A;  4YCX A;  2ZH9 A;  2FMS A;  4RQ8 A;  3WFQ E;  4YD1 A;  4UB4 A;  7ICO A;  1HUO A;  4RQ2 A;  1MIY A;  2DVI A;  4IQT A;  4QZA A;  8ICW A;  3C2L A;  1TV9 A;  3WFO A;  8ICS A;  7ICU A;  8ICN A;  3WFP A;  4FHV A;  4LZG A;  8ICB A;  5J0W A;  1ZQV A;  4QZI A;  5HHI A;  1VJ7 A;  1XSP A;  1BPX A;  4RWO A;  3TFS A;  8ICA A;  4P4O A;  3JZ0 A;  4KLG A;  4LT6 A;  1HUZ A;  3RJG A;  3UQ0 A;  1KNY A;  4WCW A;  4I2B A;  9ICA A;  4X5V A;  4NKT A;  9ICW A;  1ZQL A;  1ZJN A;  4OAI Z;  4KLM A;  3JPR A;  7ICV A;  4X4V A;  5F2V O;  3OUY B;  5III A;  5DB9 A;  4EP7 A;  1TFW A;  2M2U A;  4KLQ A;  4K97 A;  4K99 A;  7ICJ A;  4M5D A;  5J0Q A;  3UPS A;  4FH3 A;  2ZH2 A;  4QZ9 A;  4QZB A;  5J2D A;  4I27 A;  4WOY A;  1ZQX A;  4LEW A;  4O69 A;  3C2M A;  5HC9 A;  2FMP A;  4KLO A;  4PH5 A;  9ICB A;  4GXK A;  4WBY A;  4NXZ A;  8ICT A;  1XSN A;  7ICS A;  3RJF A;  5J0R A;  5J2E A;  1ZQT A;  4NXV A;  1V4A A;  4X4P A;  9ICF A;  8ICG A;  4Z6D A;  9ICX A;  3H38 A;  5J2G A;  1UEU A;  4I2F A;  4EBJ A;  3OV7 A;  5IIK A;  4KLH A;  1ZQJ A;  4UBC A;  1JN3 A;  5DDY A;  1ZQE A;  2PFQ A;  9ICN A;  1Q79 A;  4Z6C A;  4FH5 A;  4MFF A;  2DR7 A;  1RPL A;  5DB8 A;  2O1P A;  2PXI A;  9ICV A;  5D46 A;  8ICU A;  4UD5 A;  5TZV A;  4KM5 A;  5D4B A;  8ICP A;  4F5R A;  4YD2 A;  4RQ7 A;  3V7J A;  4PHD A;  2I9G A;  8ICJ A;  3B0Y A;  5CHG A;  5DED A;  2PFO A;  3RJE A;  3HWT A;  4XQ7 A;  2ZH7 A;  5HRF A;  4KLU A;  1ZQB A;  3HX0 A;  4RQ3 A;  4RQ0 A;  2DRA A;  4Z6E A;  4KB6 A;  4O5K A;  1ZQA A;  3AQK A;  3LQC B;  3K75 D;  1ZQU A;  2ZHB A;  4WC5 A;  4RWQ A;  4K98 A;  1ZQS A;  2GWS A;  9ICU A;  1MIV A;  3WFR E;  8ICI A;  8ICR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...