4EP7A

Functional implications from the cid1 poly(u) polymerase crystal structure
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
340
structure length
319
Chain Sequence
DMSHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional implications from the cid1 poly(u) polymerase crystal structure.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
molecule keywords Poly(A) RNA polymerase protein cid1
total genus 110
structure length 319
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4ep7A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ep7A02
4MF8A 3HX0A 4IQVA 5BOMA 3OUYB 4RQ8A 3RJFA 8ICFA 9ICWA 4I2CA 3OV7A 5DBAA 4S3NA 4X4OA 5HRLA 8ICLA 2Q66A 4ATBB 2M2UA 4DOAA 1Q79A 3B0XA 4NM1A 4QZDA 4WC0A 9ICSA 9ICRA 4RQ1A 2FMPA 3WFOA 7ICHA 5J0XA 4Z6FA 4QZ8A 7ICRA 1ZQWA 8ICEA 4AT9B 9ICCA 4IG8A 5DB6A 1R8AA 4KLUA 7ICNA 5F2VO 1TFYA 2M2TA 1ZQOA 4GXIA 8ICWA 3MBYA 2GWSA 4KLEA 1R89A 3JZ0A 5CHGA 3C18A 3C5GA 4WCWA 1R8BA 5J0PA 2DR5A 4XQ7A 4WBYA 3AUOA 4RQ2A 4M0AA 3MGHA 3ISBA 5CP2A 5CB1A 1RZTA 3AU2A 2BPCA 2DRBA 4M9GA 3JPQA 8ICSA 2HHPA 5J29A 9ICTA 3OVAA 4RQ4A 3UXPA 1XSLA 5EOZA 1ZQYA 1ZQMA 2ZH2A 4PGXA 4I27A 4F5QA 4FHXA 4M5DA 4YN4A 1KDHA 1ZQBA 9ICOA 9ICHA 4MFCA 4FHWA 3L9DA 4PGYA 9ICIA 4KLOA 1ZQTA 4P4MA 4I2JA 1UETA 5J2HA 3LK9A 4PH5A 4WC1A 4WC4A 1ZQFA 4KLDA 3K75D 1ZQGA 3ISDA 3JYYA 1HUOA 4IQUA 7ICJA 4IQTA 3JPOA 4X0BA 4I2IA 1TFWA 4LZGA 1HUZA 5J2CA 3AQMA 8ICVA 4JWMA 4YCXA 1UEUA 8ICJA 4EBKA 4I2BA 5IIIA 4RT3A 1KNYA 2ZH9A 5HRHA 5J0UA 4KLSA 4FH3A 4X4PA 5HRIA 1ZQVA 4I2AA 8ICIA 5J0OA 4ATBA 7ICPA 2BCSA 5J2BA 7ICFA 3HW8A 1YLQA 3WFPA 9ICAA 4KLJA 4TUQA 1MIYA 2BCVA 8ICGA 3RJKA 1VJ7A 4O5CA 3WFRE 4M9JA 4Z6CA 1ZQHA 7ICGA 4UBCA 3RH5A 4R64A 9ICLA 1ZQSA 4UD4A 1ZJNA 4RWNA 4RPXA 1ZQUA 4M04A 1R8CA 4Z6EA 2ZHBA 2PBEA 3UPQA 1JN3A 4AT8A 1XSPA 3UXNA 2ISOA 5HRFA 3H3AA 4RQ5A 3TFRA 7ICVA 5J0TA 5J2GA 4M9LA 4I2FA 1ZQNA 4X4VA 2M2VA 3JPNA 4QZGA 4X0AA 1VFGA 3UQ0A 1MIWA 2ZH8A 4WC3A 8ICRA 1V4AA 8ICXA 3V7KA 2B51A 1NO5A 8ICAA 5DBCA 3V7JA 4PHDA 3WFSC 8ICMA 2BCUA 5BPCA 2DR9A 9ICJA 2NRKA 4XQ8A 1KEJA 3OUYA 3JPTA 9ICNA 9ICFA 4K4GA 1ZQRA 4O5EA 9ICVA 3V7LA 4X5VA 4NLNA 8ICKA 4YMOA 4AT7A 4XA5A 5J2JA 4RQ0A 4GXJA 4DO9A 4PPXA 4RQ6A 4QZCA 8ICBA 2DR7A 2DVIA 4X4RA 4XRHA 5CA7A 3V72A 4UAZA 3C2LA 1PX5A 4PGQA 1JQRA 2RFFA 4UB4A 4KLTA 4F5PA 5HRBA 3UXOA 4UB2A 1ZQPA 2PFOA 5CR0A 3PMNA 3NYBA 4PHPA 3PNCA 8ICTA 2BCQA 2PXIA 4YMMA 9ICUA 4NXZA 5J2EA 1Q78A 5DEDA 2ZH1A 7ICOA 5HRGA 5D46A 4MFAA 2DRAA 5HHIA 5J2FA 4QZFA 4KLIA 2O1PA 4AT8B 4NM2A 1ZQZA 9ICQA 5CJ7A 4NKTA 4Z6DA 4FHVA 3AQLA 9ICKA 8ICQA 4AT7B 2BPFA 4KLLA 1OU5A 4RQ3A 2PFPA 4WBZA 4KLFA 4KLGA 3UPSA 9ICGA 4EBJA 1BPDA 3RJJA 5IINA 5HC9A 2ZH3A 3WFQE 4KLQA 4UBBA 3HJ4A 4R63A 4F5OA 4M9HA 3OVBA 4RT2A 7ICIA 1F5AA 1JAJA 4XUSA 5J0YA 2ZH4A 1RPLA 1WOTA 2PFQA 1ZQLA 4QZ9A 1ZQAA 2ZH7A 4QZHA 5J0RA 2BE3A 4P2HA 4RWOA 5HRDA 7ICQA 4X4SA 4RPZA 4M9NA 4UB3A 3RJEA 5HREA 3RJGA 1BPBA 4QZBA 1BPZA 1MIVA 3HJ1A 9ICBA 4I2GA 3AQNA 4IQWA 3RH6A 8ICOA 2ISPA 5J2AA 4KLMA 1FA0A 2B56A 2BCRA 1ZQCA 4F5NA 5J0QA 1BPXA 4DOBA 5D4BA 5D49A 4RWQA 4I2EA 2ZH5A 4M2YA 3C2KA 3GDXA 4F5RA 2BPGA 4RPYA 4FH5A 4X4UA 8ICHA 7ICLA 4RWPA 5IIMA 3LQCB 4JWNA 5HR9A 3OVSA 2M2WA 5J0WA 1MQ3A 3H38A 2IHMA 1ZQJA 4I2HA 5IIOA 4UD5A 2P66A 2PFNA 4YD1A 5DB8A 1UEVA 5IIKA 4K4HA 2B4VA 1ZQKA 2ZHAA 7ICKA 9ICMA 2FMQA 4R66A 3MDCA 2I9GA 4O9MA 4PHAA 1ZQXA 5TZVA 1ZQQA 3B0YA 5IIJA 4FO6A 4P4PA 4O5KA 4WC6A 4GXKA 1ZQDA 4UAYA 3ISCA 8ICUA 1ZJMA 4YD2A 5IILA 5DDMA 4UAWA 4WC5A 5HRKA 7ICUA 3MGIA 5DKWA 2O5AA 3UQ2A 4I28A 4WC2A 1TV9A 4MF2A 5J2IA 1BPYA 2ZH6A 4K4IA 3AU6A 4KLHA 4UB5A 5DDYA 3RJHA 8ICPA 5DBBA 4QZAA 3H39A 3HWTA 4X4NA 1MQ2A 3MDAA 3C66A 4LVSA 2FMSA 3RH4A 4WC7A 1ZQEA 2DR8A 7ICMA 5DECA 3JPPA 4UB1A 3H37A 4X4QA 1JMSA 3HIYA 4TUSA 7ICSA 4PHEA 3TFSA 3RJIA 4M47A 5J2KA 9ICPA 4AT9A 4TURA 4RQ7A 3JPSA 1TVAA 1NOMA 2ID1A 4NLKA 1BPEA 5DB7A 4TUPA 4EP7A 1XSNA 5J0SA 1ZQIA 8ICNA 4QZEA 4X4TA 3AQKA 4NY8A 4I2DA 4NKUA 3JPRA 5CWRA 3C2MA 2VANA 8ICYA 2W9MA 9ICXA 5BOLA 3PMLA 4DOCA 3C5FA 4I29A 4NLZA 3OGUA 7ICTA 4P4OA 9ICEA 7ICEA 4R65A 5DB9A 4E7XA 5J2DA 8ICZA 4E80A 8ICCA 4E8FA 4LZDA 4FHPA 4QZIA 5HHHA 4LT6A 4MFFA 4FHYA 4YMNA
chains in the Genus database with same CATH superfamily
4MF8A 3MCRA 3HX0A 3OUYB 4IQVA 5BOMA 4RQ8A 3RJFA 8ICFA 9ICWA 4I2CA 3OV7A 5DBAA 4S3NA 4X4OA 5HRLA 8ICLA 4HX0A 4ATBB 2Q66A 2M2UA 4DOAA 4O69A 3NKUA 1Q79A 3B0XA 4NM1A 4QZDA 4WC0A 9ICSA 9ICRA 4RQ1A 2FMPA 2IHOA 3WFOA 7ICHA 5J0XA 4Z6FA 4QZ8A 7ICRA 1ZQWA 8ICEA 5JTGA 4OAGA 4AT9B 9ICCA 4K97A 4IG8A 5DB6A 1R8AA 4KLUA 7ICNA 5F2VO 4NXXA 1TFYA 2M2TA 1ZQOA 4GXIA 8ICWA 3MBYA 2GWSA 4KLEA 1R89A 3JZ0A 5CHGA 3C18A 4K8VA 3C5GA 4WCWA 1R8BA 5J0PA 4K9BA 2DR5A 4XQ7A 4WBYA 3AUOA 4LEYA 4RQ2A 4M0AA 3MGHA 3ISBA 5CP2A 5CB1A 1RZTA 3AU2A 2BPCA 2DRBA 4M9GA 3JPQA 8ICSA 2HHPA 5J29A 9ICTA 3OVAA 4RQ4A 3CK6A 3UXPA 1XSLA 5EOZA 1ZQYA 1ZQMA 2ZH2A 4PGXA 4I27A 4F5QA 4FHXA 4M5DA 4YN4A 1KDHA 1ZQBA 9ICOA 9ICHA 4MFCA 4FHWA 3L9DA 4PGYA 9ICIA 4KLOA 2FCLA 1ZQTA 5CFSA 4P4MA 4I2JA 1UETA 5J2HA 3LK9A 4PH5A 4WC1A 4WC4A 1ZQFA 4KLDA 3K75D 1ZQGA 3ISDA 3JYYA 1HUOA 4IQUA 7ICJA 4IQTA 4O67A 3JPOA 4X0BA 4I2IA 4KM5A 1TFWA 4LZGA 1HUZA 5J2CA 3AQMA 8ICVA 1GPJA 4JWMA 4YCXA 1UEUA 8ICJA 4EBKA 4I2BA 5IIIA 4RT3A 1KNYA 4JLZA 2ZH9A 5HRHA 5J0UA 4FH3A 4KLSA 4X4PA 5HRIA 1ZQVA 4I2AA 3ERCC 4N7RA 4ATBA 5J0OA 7ICPA 8ICIA 2BCSA 4I0UA 5J2BA 7ICFA 3HW8A 1YLQA 2IUBA 4WH5A 3WFPA 9ICAA 4KLJA 4LEWA 1MIYA 4TUQA 2BCVA 3RJKA 8ICGA 1VJ7A 4O5CA 3WFRE 2EWRA 4M9JA 4Z6CA 1ZQHA 7ICGA 4K96A 4UBCA 3RH5A 4R64A 9ICLA 1ZQSA 4K99A 4UD4A 1ZJNA 4RWNA 4RPXA 1ZQUA 4M04A 1R8CA 4Z6EA 2GAFD 2ZHBA 2PBEA 3UPQA 1JN3A 4AT8A 2HN1A 1XSPA 3UXNA 2ISOA 5HRFA 3H3AA 4RQ5A 3TFRA 7ICVA 5B3PA 5J0TA 5J2GA 4M9LA 4I2FA 1ZQNA 4NXTA 4X4VA 2M2VA 3JPNA 4QZGA 3NVOA 4X0AA 1VFGA 3UQ0A 1MIWA 2ZH8A 4WC3A 8ICRA 1V4AA 8ICXA 4K98A 2B51A 3V7KA 1NO5A 8ICAA 5DBCA 3V7JA 4PHDA 3WFSC 4OAHA 8ICMA 2BCUA 2DR9A 5BPCA 9ICJA 2NRKA 4XQ8A 1KEJA 3OUYA 3JPTA 9ICNA 9ICFA 4K4GA 1ZQRA 4O5EA 9ICVA 3V7LA 4X5VA 4NLNA 8ICKA 4YMOA 4AT7A 4OAIZ 2BBHA 3PHZA 4XA5A 5J2JA 4RQ0A 4GXJA 4DO9A 4PPXA 4LEZA 4QZCA 4RQ6A 8ICBA 2DR7A 2DVIA 4X4RA 4XRHA 2BBJA 5CA7A 3V72A 4UAZA 3C2LA 1PX5A 4PGQA 3ER9B 1JQRA 2RFFA 4UB4A 4KLTA 4F5PA 5HRBA 3UXOA 4UB2A 1ZQPA 2PFOA 5CR0A 3PMNA 3NYBA 4PHPA 3PNCA 8ICTA 2BCQA 2PXIA 4YMMA 9ICUA 4NXZA 5J2EA 1Q78A 5DEDA 2ZH1A 7ICOA 4JLXA 5HRGA 5D46A 4MFAA 2DRAA 5HHIA 3JCFA 5J2FA 4QZFA 4KLIA 2O1PA 4AT8B 4NM2A 1ZQZA 9ICQA 5CJ7A 4NKTA 4Z6DA 4FHVA 3AQLA 9ICKA 8ICQA 4AT7B 4XJEA 2BPFA 4KLLA 2GA9D 3NWIA 1OU5A 4RQ3A 2PFPA 4WBZA 4KLFA 4KLGA 3UPSA 9ICGA 4EBJA 1BPDA 3RJJA 5IINA 4EEDA 5HC9A 2ZH3A 3WFQE 4KLQA 4NXWA 4UBBA 3HJ4A 4R63A 4F5OA 3OVBA 4M9HA 4RT2A 7ICIA 1F5AA 1JAJA 4KB6A 4XUSA 5J0YA 2ZH4A 1RPLA 4EEBA 1WOTA 2PFQA 1ZQLA 4QZ9A 1ZQAA 2ZH7A 4QZHA 4WOYA 5J0RA 2BE3A 4P2HA 4RWOA 5HRDA 7ICQA 4X4SA 4RPZA 4M9NA 4UB3A 3RJEA 5HREA 3RJGA 1BPBA 4WQKA 4QZBA 4EV6A 1BPZA 1MIVA 3HJ1A 9ICBA 4I2GA 3AQNA 4IQWA 3RH6A 8ICOA 2ISPA 5J2AA 4KLMA 1FA0A 2B56A 2BCRA 1ZQCA 4F5NA 5J0QA 1BPXA 4DOBA 5D4BA 5D49A 4RWQA 4I2EA 2ZH5A 4FO1A 4M2YA 3C2KA 3GDXA 3K7DA 4F5RA 2BPGA 4RPYA 4FH5A 4X4UA 8ICHA 7ICLA 4RWPA 5IIMA 3LQCB 3ER8C 4JWNA 4EGWA 5D62A 5HR9A 3OVSA 2M2WA 5CFTA 5J0WA 1MQ3A 3H38A 2IHMA 1ZQJA 3EF2A 4I2HA 5IIOA 4UD5A 2P66A 2PFNA 4YD1A 5DB8A 1UEVA 5IIKA 4K4HA 2B4VA 1ZQKA 2ZHAA 7ICKA 9ICMA 2FMQA 4R66A 3MDCA 2I9GA 4O9MA 4PHAA 1ZQXA 5TZVA 1ZQQA 3B0YA 5IIJA 4FO6A 4P4PA 4O5KA 4WC6A 4GXKA 1ZQDA 4UAYA 3ISCA 8ICUA 1ZJMA 4YD2A 5IILA 5DDMA 4UAWA 4WC5A 5HRKA 4OAFA 7ICUA 3MGIA 4O68A 2O5AA 5DKWA 3UQ2A 4I28A 4WC2A 1TV9A 4MF2A 5D61A 5J2IA 1BPYA 2ZH6A 4K4IA 3AU6A 4KLHA 4UB5A 5DDYA 3RJHA 8ICPA 3OWGA 5DBBA 5CFUA 4QZAA 3H39A 3HWTA 4X4NA 1MQ2A 3MDAA 3C66A 4LVSA 2FMSA 3RH4A 5D63A 4WC7A 1ZQEA 2DR8A 4K9AA 7ICMA 2HN2A 5DECA 3JPPA 4UB1A 4MKPA 3H37A 4X4QA 1JMSA 3HIYA 4TUSA 7ICSA 4PHEA 3TFSA 3RJIA 4M47A 5J2KA 9ICPA 4AT9A 4TURA 4RQ7A 3JPSA 1TVAA 1NOMA 4O6AA 2ID1A 4NLKA 1BPEA 5DB7A 4TUPA 4EP7A 1XSNA 5J0SA 1ZQIA 4NXVA 8ICNA 4QZEA 5CHEA 4X4TA 3AQKA 4NY8A 4I2DA 4NKUA 3JPRA 5CWRA 3C2MA 2VANA 8ICYA 2W9MA 9ICXA 5BOLA 3PMLA 4DOCA 3C5FA 4I29A 4NLZA 3OGUA 7ICTA 4P4OA 4LEVA 5B3QA 9ICEA 7ICEA 4NXUA 4R65A 5DB9A 4E7XA 5J2DA 8ICZA 4E80A 4WQLA 4E8FA 4LZDA 8ICCA 4FHPA 4QZIA 5HHHA 4LT6A 4MFFA 4FHYA 4YMNA
chains in the Genus database with same CATH topology
4MF8A 3HX0A 3OUYB 4IQVA 5BOMA 4RQ8A 3RJFA 8ICFA 9ICWA 4I2CA 3OV7A 5DBAA 4S3NA 4X4OA 5HRLA 8ICLA 4ATBB 2Q66A 2M2UA 4DOAA 4O69A 1Q79A 3B0XA 4NM1A 4QZDA 4WC0A 9ICSA 9ICRA 4RQ1A 2FMPA 3WFOA 7ICHA 5J0XA 4Z6FA 4QZ8A 7ICRA 1ZQWA 8ICEA 4OAGA 4AT9B 9ICCA 4K97A 4IG8A 5DB6A 1R8AA 4KLUA 7ICNA 5F2VO 4NXXA 1TFYA 2M2TA 1ZQOA 4GXIA 8ICWA 3MBYA 2GWSA 4KLEA 1R89A 3JZ0A 5CHGA 3C18A 4K8VA 3C5GA 4WCWA 1R8BA 5J0PA 4K9BA 2DR5A 4XQ7A 4WBYA 3AUOA 4LEYA 4RQ2A 4M0AA 3MGHA 3ISBA 5CP2A 5CB1A 1RZTA 3AU2A 2BPCA 2DRBA 4M9GA 3JPQA 8ICSA 2HHPA 5J29A 9ICTA 3OVAA 4RQ4A 3UXPA 1XSLA 5EOZA 1ZQYA 1ZQMA 2ZH2A 4PGXA 4I27A 4F5QA 4FHXA 4M5DA 4YN4A 1KDHA 1ZQBA 9ICOA 9ICHA 4MFCA 4FHWA 3L9DA 4PGYA 9ICIA 4KLOA 1ZQTA 4P4MA 4I2JA 1UETA 5J2HA 3LK9A 4PH5A 4WC1A 4WC4A 1ZQFA 4KLDA 3K75D 1ZQGA 3ISDA 3JYYA 1HUOA 4IQUA 7ICJA 4IQTA 4O67A 3JPOA 4X0BA 4I2IA 4KM5A 1TFWA 4LZGA 1HUZA 5J2CA 3AQMA 8ICVA 4JWMA 4YCXA 1UEUA 8ICJA 4EBKA 4I2BA 5IIIA 4RT3A 1KNYA 4JLZA 2ZH9A 5HRHA 5J0UA 4FH3A 4KLSA 4X4PA 5HRIA 1ZQVA 4I2AA 8ICIA 5J0OA 4ATBA 7ICPA 2BCSA 5J2BA 7ICFA 3HW8A 1YLQA 3WFPA 9ICAA 4KLJA 4LEWA 1MIYA 4TUQA 2BCVA 3RJKA 8ICGA 1VJ7A 4O5CA 3WFRE 4M9JA 4Z6CA 1ZQHA 7ICGA 4K96A 4UBCA 3RH5A 4R64A 9ICLA 1ZQSA 4K99A 4UD4A 1ZJNA 4RWNA 4RPXA 1ZQUA 4M04A 1R8CA 4Z6EA 2ZHBA 2PBEA 3UPQA 1JN3A 4AT8A 1XSPA 3UXNA 2ISOA 5HRFA 3H3AA 4RQ5A 3TFRA 7ICVA 5J0TA 5J2GA 4M9LA 4I2FA 1ZQNA 4NXTA 4X4VA 2M2VA 3JPNA 4QZGA 4X0AA 1VFGA 3UQ0A 1MIWA 2ZH8A 4WC3A 8ICRA 1V4AA 8ICXA 4K98A 2B51A 3V7KA 1NO5A 8ICAA 5DBCA 3V7JA 4PHDA 3WFSC 4OAHA 8ICMA 2BCUA 2DR9A 5BPCA 9ICJA 2NRKA 4XQ8A 1KEJA 3OUYA 3JPTA 9ICNA 9ICFA 4K4GA 1ZQRA 4O5EA 9ICVA 3V7LA 4X5VA 4NLNA 8ICKA 4YMOA 4AT7A 4OAIZ 4XA5A 5J2JA 4RQ0A 4GXJA 4DO9A 4PPXA 4LEZA 4QZCA 4RQ6A 8ICBA 2DR7A 2DVIA 4X4RA 4XRHA 5CA7A 3V72A 4UAZA 3C2LA 1PX5A 4PGQA 1JQRA 2RFFA 4UB4A 4KLTA 4F5PA 5HRBA 3UXOA 4UB2A 1ZQPA 2PFOA 5CR0A 3PMNA 3NYBA 4PHPA 3PNCA 8ICTA 2BCQA 2PXIA 4YMMA 9ICUA 4NXZA 5J2EA 1Q78A 5DEDA 2ZH1A 7ICOA 4JLXA 5HRGA 5D46A 4MFAA 2DRAA 5HHIA 5J2FA 4QZFA 4KLIA 2O1PA 4AT8B 4NM2A 1ZQZA 9ICQA 5CJ7A 4NKTA 4Z6DA 4FHVA 3AQLA 9ICKA 8ICQA 4AT7B 2BPFA 4KLLA 1OU5A 4RQ3A 2PFPA 4WBZA 4KLFA 4KLGA 3UPSA 9ICGA 4EBJA 1BPDA 3RJJA 5IINA 5HC9A 2ZH3A 3WFQE 4KLQA 4NXWA 4UBBA 3HJ4A 4R63A 4F5OA 3OVBA 4M9HA 4RT2A 7ICIA 1F5AA 1JAJA 4KB6A 4XUSA 5J0YA 2ZH4A 1RPLA 1WOTA 2PFQA 1ZQLA 4QZ9A 1ZQAA 2ZH7A 4QZHA 4WOYA 5J0RA 2BE3A 4P2HA 4RWOA 5HRDA 7ICQA 4X4SA 4RPZA 4M9NA 4UB3A 3RJEA 5HREA 3RJGA 1BPBA 4QZBA 1BPZA 1MIVA 3HJ1A 9ICBA 4I2GA 3AQNA 4IQWA 3RH6A 8ICOA 2ISPA 5J2AA 4KLMA 1FA0A 2B56A 2BCRA 1ZQCA 4F5NA 5J0QA 1BPXA 4DOBA 5D4BA 5D49A 4RWQA 4I2EA 2ZH5A 4M2YA 3C2KA 3GDXA 4F5RA 2BPGA 4RPYA 4FH5A 4X4UA 8ICHA 7ICLA 4RWPA 5IIMA 3LQCB 4JWNA 5HR9A 3OVSA 2M2WA 5J0WA 1MQ3A 3H38A 2IHMA 1ZQJA 4I2HA 5IIOA 4UD5A 2P66A 2PFNA 4YD1A 5DB8A 1UEVA 5IIKA 4K4HA 2B4VA 1ZQKA 2ZHAA 7ICKA 9ICMA 2FMQA 4R66A 3MDCA 2I9GA 4O9MA 4PHAA 1ZQXA 5TZVA 1ZQQA 3B0YA 5IIJA 4FO6A 4P4PA 4O5KA 4WC6A 4GXKA 1ZQDA 4UAYA 3ISCA 8ICUA 1ZJMA 4YD2A 5IILA 5DDMA 4UAWA 4WC5A 5HRKA 4OAFA 7ICUA 3MGIA 4O68A 2O5AA 5DKWA 3UQ2A 4I28A 4WC2A 1TV9A 4MF2A 5J2IA 1BPYA 2ZH6A 4K4IA 3AU6A 4KLHA 4UB5A 5DDYA 3RJHA 8ICPA 5DBBA 4QZAA 3H39A 3HWTA 4X4NA 1MQ2A 3MDAA 3C66A 4LVSA 2FMSA 3RH4A 4WC7A 1ZQEA 2DR8A 4K9AA 7ICMA 5DECA 3JPPA 4UB1A 4MKPA 3H37A 4X4QA 1JMSA 3HIYA 4TUSA 7ICSA 4PHEA 3TFSA 3RJIA 4M47A 5J2KA 9ICPA 4AT9A 4TURA 4RQ7A 3JPSA 1TVAA 1NOMA 4O6AA 2ID1A 4NLKA 1BPEA 5DB7A 4TUPA 4EP7A 1XSNA 5J0SA 1ZQIA 4NXVA 8ICNA 4QZEA 4X4TA 3AQKA 4NY8A 4I2DA 4NKUA 3JPRA 5CWRA 3C2MA 2VANA 8ICYA 2W9MA 9ICXA 5BOLA 3PMLA 4DOCA 3C5FA 4I29A 4NLZA 3OGUA 7ICTA 4P4OA 4LEVA 9ICEA 7ICEA 4NXUA 4R65A 5DB9A 4E7XA 5J2DA 8ICZA 4E80A 8ICCA 4E8FA 4LZDA 4FHPA 4QZIA 5HHHA 4LT6A 4MFFA 4FHYA 4YMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MF8 A;  3HX0 A;  4IQV A;  5BOM A;  3OUY B;  4RQ8 A;  3RJF A;  8ICF A;  9ICW A;  4I2C A;  3OV7 A;  5DBA A;  4S3N A;  4X4O A;  5HRL A;  8ICL A;  2Q66 A;  4ATB B;  2M2U A;  4DOA A;  1Q79 A;  3B0X A;  4NM1 A;  4QZD A;  4WC0 A;  9ICS A;  9ICR A;  4RQ1 A;  2FMP A;  3WFO A;  7ICH A;  5J0X A;  4Z6F A;  4QZ8 A;  7ICR A;  1ZQW A;  8ICE A;  4AT9 B;  9ICC A;  4IG8 A;  5DB6 A;  1R8A A;  4KLU A;  7ICN A;  5F2V O;  1TFY A;  2M2T A;  1ZQO A;  4GXI A;  8ICW A;  3MBY A;  2GWS A;  4KLE A;  1R89 A;  3JZ0 A;  5CHG A;  3C18 A;  3C5G A;  4WCW A;  1R8B A;  5J0P A;  2DR5 A;  4XQ7 A;  4WBY A;  3AUO A;  4RQ2 A;  4M0A A;  3MGH A;  3ISB A;  5CP2 A;  5CB1 A;  1RZT A;  3AU2 A;  2BPC A;  2DRB A;  4M9G A;  3JPQ A;  8ICS A;  2HHP A;  5J29 A;  9ICT A;  3OVA A;  4RQ4 A;  3UXP A;  1XSL A;  5EOZ A;  1ZQY A;  1ZQM A;  2ZH2 A;  4PGX A;  4I27 A;  4F5Q A;  4FHX A;  4M5D A;  4YN4 A;  1KDH A;  1ZQB A;  9ICO A;  9ICH A;  4MFC A;  4FHW A;  3L9D A;  4PGY A;  9ICI A;  4KLO A;  1ZQT A;  4P4M A;  4I2J A;  1UET A;  5J2H A;  3LK9 A;  4PH5 A;  4WC1 A;  4WC4 A;  1ZQF A;  4KLD A;  3K75 D;  1ZQG A;  3ISD A;  3JYY A;  1HUO A;  4IQU A;  7ICJ A;  4IQT A;  3JPO A;  4X0B A;  4I2I A;  1TFW A;  4LZG A;  1HUZ A;  5J2C A;  3AQM A;  8ICV A;  4JWM A;  4YCX A;  1UEU A;  8ICJ A;  4EBK A;  4I2B A;  5III A;  4RT3 A;  1KNY A;  2ZH9 A;  5HRH A;  5J0U A;  4KLS A;  4FH3 A;  4X4P A;  5HRI A;  1ZQV A;  4I2A A;  8ICI A;  5J0O A;  4ATB A;  7ICP A;  2BCS A;  5J2B A;  7ICF A;  3HW8 A;  1YLQ A;  3WFP A;  9ICA A;  4KLJ A;  4TUQ A;  1MIY A;  2BCV A;  8ICG A;  3RJK A;  1VJ7 A;  4O5C A;  3WFR E;  4M9J A;  4Z6C A;  1ZQH A;  7ICG A;  4UBC A;  3RH5 A;  4R64 A;  9ICL A;  1ZQS A;  4UD4 A;  1ZJN A;  4RWN A;  4RPX A;  1ZQU A;  4M04 A;  1R8C A;  4Z6E A;  2ZHB A;  2PBE A;  3UPQ A;  1JN3 A;  4AT8 A;  1XSP A;  3UXN A;  2ISO A;  5HRF A;  3H3A A;  4RQ5 A;  3TFR A;  7ICV A;  5J0T A;  5J2G A;  4M9L A;  4I2F A;  1ZQN A;  4X4V A;  2M2V A;  3JPN A;  4QZG A;  4X0A A;  1VFG A;  3UQ0 A;  1MIW A;  2ZH8 A;  4WC3 A;  8ICR A;  1V4A A;  8ICX A;  3V7K A;  2B51 A;  1NO5 A;  8ICA A;  5DBC A;  3V7J A;  4PHD A;  3WFS C;  8ICM A;  2BCU A;  5BPC A;  2DR9 A;  9ICJ A;  2NRK A;  4XQ8 A;  1KEJ A;  3OUY A;  3JPT A;  9ICN A;  9ICF A;  4K4G A;  1ZQR A;  4O5E A;  9ICV A;  3V7L A;  4X5V A;  4NLN A;  8ICK A;  4YMO A;  4AT7 A;  4XA5 A;  5J2J A;  4RQ0 A;  4GXJ A;  4DO9 A;  4PPX A;  4RQ6 A;  4QZC A;  8ICB A;  2DR7 A;  2DVI A;  4X4R A;  4XRH A;  5CA7 A;  3V72 A;  4UAZ A;  3C2L A;  1PX5 A;  4PGQ A;  1JQR A;  2RFF A;  4UB4 A;  4KLT A;  4F5P A;  5HRB A;  3UXO A;  4UB2 A;  1ZQP A;  2PFO A;  5CR0 A;  3PMN A;  3NYB A;  4PHP A;  3PNC A;  8ICT A;  2BCQ A;  2PXI A;  4YMM A;  9ICU A;  4NXZ A;  5J2E A;  1Q78 A;  5DED A;  2ZH1 A;  7ICO A;  5HRG A;  5D46 A;  4MFA A;  2DRA A;  5HHI A;  5J2F A;  4QZF A;  4KLI A;  2O1P A;  4AT8 B;  4NM2 A;  1ZQZ A;  9ICQ A;  5CJ7 A;  4NKT A;  4Z6D A;  4FHV A;  3AQL A;  9ICK A;  8ICQ A;  4AT7 B;  2BPF A;  4KLL A;  1OU5 A;  4RQ3 A;  2PFP A;  4WBZ A;  4KLF A;  4KLG A;  3UPS A;  9ICG A;  4EBJ A;  1BPD A;  3RJJ A;  5IIN A;  5HC9 A;  2ZH3 A;  3WFQ E;  4KLQ A;  4UBB A;  3HJ4 A;  4R63 A;  4F5O A;  4M9H A;  3OVB A;  4RT2 A;  7ICI A;  1F5A A;  1JAJ A;  4XUS A;  5J0Y A;  2ZH4 A;  1RPL A;  1WOT A;  2PFQ A;  1ZQL A;  4QZ9 A;  1ZQA A;  2ZH7 A;  4QZH A;  5J0R A;  2BE3 A;  4P2H A;  4RWO A;  5HRD A;  7ICQ A;  4X4S A;  4RPZ A;  4M9N A;  4UB3 A;  3RJE A;  5HRE A;  3RJG A;  1BPB A;  4QZB A;  1BPZ A;  1MIV A;  3HJ1 A;  9ICB A;  4I2G A;  3AQN A;  4IQW A;  3RH6 A;  8ICO A;  2ISP A;  5J2A A;  4KLM A;  1FA0 A;  2B56 A;  2BCR A;  1ZQC A;  4F5N A;  5J0Q A;  1BPX A;  4DOB A;  5D4B A;  5D49 A;  4RWQ A;  4I2E A;  2ZH5 A;  4M2Y A;  3C2K A;  3GDX A;  4F5R A;  2BPG A;  4RPY A;  4FH5 A;  4X4U A;  8ICH A;  7ICL A;  4RWP A;  5IIM A;  3LQC B;  4JWN A;  5HR9 A;  3OVS A;  2M2W A;  5J0W A;  1MQ3 A;  3H38 A;  2IHM A;  1ZQJ A;  4I2H A;  5IIO A;  4UD5 A;  2P66 A;  2PFN A;  4YD1 A;  5DB8 A;  1UEV A;  5IIK A;  4K4H A;  2B4V A;  1ZQK A;  2ZHA A;  7ICK A;  9ICM A;  2FMQ A;  4R66 A;  3MDC A;  2I9G A;  4O9M A;  4PHA A;  1ZQX A;  5TZV A;  1ZQQ A;  3B0Y A;  5IIJ A;  4FO6 A;  4P4P A;  4O5K A;  4WC6 A;  4GXK A;  1ZQD A;  4UAY A;  3ISC A;  8ICU A;  1ZJM A;  4YD2 A;  5IIL A;  5DDM A;  4UAW A;  4WC5 A;  5HRK A;  7ICU A;  3MGI A;  5DKW A;  2O5A A;  3UQ2 A;  4I28 A;  4WC2 A;  1TV9 A;  4MF2 A;  5J2I A;  1BPY A;  2ZH6 A;  4K4I A;  3AU6 A;  4KLH A;  4UB5 A;  5DDY A;  3RJH A;  8ICP A;  5DBB A;  4QZA A;  3H39 A;  3HWT A;  4X4N A;  1MQ2 A;  3MDA A;  3C66 A;  4LVS A;  2FMS A;  3RH4 A;  4WC7 A;  1ZQE A;  2DR8 A;  7ICM A;  5DEC A;  3JPP A;  4UB1 A;  3H37 A;  4X4Q A;  1JMS A;  3HIY A;  4TUS A;  7ICS A;  4PHE A;  3TFS A;  3RJI A;  4M47 A;  5J2K A;  9ICP A;  4AT9 A;  4TUR A;  4RQ7 A;  3JPS A;  1TVA A;  1NOM A;  2ID1 A;  4NLK A;  1BPE A;  5DB7 A;  4TUP A;  4EP7 A;  1XSN A;  5J0S A;  1ZQI A;  8ICN A;  4QZE A;  4X4T A;  3AQK A;  4NY8 A;  4I2D A;  4NKU A;  3JPR A;  5CWR A;  3C2M A;  2VAN A;  8ICY A;  2W9M A;  9ICX A;  5BOL A;  3PML A;  4DOC A;  3C5F A;  4I29 A;  4NLZ A;  3OGU A;  7ICT A;  4P4O A;  9ICE A;  7ICE A;  4R65 A;  5DB9 A;  4E7X A;  5J2D A;  8ICZ A;  4E80 A;  8ICC A;  4E8F A;  4LZD A;  4FHP A;  4QZI A;  5HHH A;  4LT6 A;  4MFF A;  4FHY A;  4YMN A; 
#chains in the Genus database with same CATH topology
 4MF8 A;  3MCR A;  3HX0 A;  3OUY B;  4IQV A;  5BOM A;  4RQ8 A;  3RJF A;  8ICF A;  9ICW A;  4I2C A;  3OV7 A;  5DBA A;  4S3N A;  4X4O A;  5HRL A;  8ICL A;  4HX0 A;  4ATB B;  2Q66 A;  2M2U A;  4DOA A;  4O69 A;  3NKU A;  1Q79 A;  3B0X A;  4NM1 A;  4QZD A;  4WC0 A;  9ICS A;  9ICR A;  4RQ1 A;  2FMP A;  2IHO A;  3WFO A;  7ICH A;  5J0X A;  4Z6F A;  4QZ8 A;  7ICR A;  1ZQW A;  8ICE A;  5JTG A;  4OAG A;  4AT9 B;  9ICC A;  4K97 A;  4IG8 A;  5DB6 A;  1R8A A;  4KLU A;  7ICN A;  5F2V O;  4NXX A;  1TFY A;  2M2T A;  1ZQO A;  4GXI A;  8ICW A;  3MBY A;  2GWS A;  4KLE A;  1R89 A;  3JZ0 A;  5CHG A;  3C18 A;  4K8V A;  3C5G A;  4WCW A;  1R8B A;  5J0P A;  4K9B A;  2DR5 A;  4XQ7 A;  4WBY A;  3AUO A;  4LEY A;  4RQ2 A;  4M0A A;  3MGH A;  3ISB A;  5CP2 A;  5CB1 A;  1RZT A;  3AU2 A;  2BPC A;  2DRB A;  4M9G A;  3JPQ A;  8ICS A;  2HHP A;  5J29 A;  9ICT A;  3OVA A;  4RQ4 A;  3CK6 A;  3UXP A;  1XSL A;  5EOZ A;  1ZQY A;  1ZQM A;  2ZH2 A;  4PGX A;  4I27 A;  4F5Q A;  4FHX A;  4M5D A;  4YN4 A;  1KDH A;  1ZQB A;  9ICO A;  9ICH A;  4MFC A;  4FHW A;  3L9D A;  4PGY A;  9ICI A;  4KLO A;  2FCL A;  1ZQT A;  5CFS A;  4P4M A;  4I2J A;  1UET A;  5J2H A;  3LK9 A;  4PH5 A;  4WC1 A;  4WC4 A;  1ZQF A;  4KLD A;  3K75 D;  1ZQG A;  3ISD A;  3JYY A;  1HUO A;  4IQU A;  7ICJ A;  4IQT A;  4O67 A;  3JPO A;  4X0B A;  4I2I A;  4KM5 A;  1TFW A;  4LZG A;  1HUZ A;  5J2C A;  3AQM A;  8ICV A;  1GPJ A;  4JWM A;  4YCX A;  1UEU A;  8ICJ A;  4EBK A;  4I2B A;  5III A;  4RT3 A;  1KNY A;  4JLZ A;  2ZH9 A;  5HRH A;  5J0U A;  4FH3 A;  4KLS A;  4X4P A;  5HRI A;  1ZQV A;  4I2A A;  3ERC C;  4N7R A;  4ATB A;  5J0O A;  7ICP A;  8ICI A;  2BCS A;  4I0U A;  5J2B A;  7ICF A;  3HW8 A;  1YLQ A;  2IUB A;  4WH5 A;  3WFP A;  9ICA A;  4KLJ A;  4LEW A;  1MIY A;  4TUQ A;  2BCV A;  3RJK A;  8ICG A;  1VJ7 A;  4O5C A;  3WFR E;  2EWR A;  4M9J A;  4Z6C A;  1ZQH A;  7ICG A;  4K96 A;  4UBC A;  3RH5 A;  4R64 A;  9ICL A;  1ZQS A;  4K99 A;  4UD4 A;  1ZJN A;  4RWN A;  4RPX A;  1ZQU A;  4M04 A;  1R8C A;  4Z6E A;  2GAF D;  2ZHB A;  2PBE A;  3UPQ A;  1JN3 A;  4AT8 A;  2HN1 A;  1XSP A;  3UXN A;  2ISO A;  5HRF A;  3H3A A;  4RQ5 A;  3TFR A;  7ICV A;  5B3P A;  5J0T A;  5J2G A;  4M9L A;  4I2F A;  1ZQN A;  4NXT A;  4X4V A;  2M2V A;  3JPN A;  4QZG A;  3NVO A;  4X0A A;  1VFG A;  3UQ0 A;  1MIW A;  2ZH8 A;  4WC3 A;  8ICR A;  1V4A A;  8ICX A;  4K98 A;  2B51 A;  3V7K A;  1NO5 A;  8ICA A;  5DBC A;  3V7J A;  4PHD A;  3WFS C;  4OAH A;  8ICM A;  2BCU A;  2DR9 A;  5BPC A;  9ICJ A;  2NRK A;  4XQ8 A;  1KEJ A;  3OUY A;  3JPT A;  9ICN A;  9ICF A;  4K4G A;  1ZQR A;  4O5E A;  9ICV A;  3V7L A;  4X5V A;  4NLN A;  8ICK A;  4YMO A;  4AT7 A;  4OAI Z;  2BBH A;  3PHZ A;  4XA5 A;  5J2J A;  4RQ0 A;  4GXJ A;  4DO9 A;  4PPX A;  4LEZ A;  4QZC A;  4RQ6 A;  8ICB A;  2DR7 A;  2DVI A;  4X4R A;  4XRH A;  2BBJ A;  5CA7 A;  3V72 A;  4UAZ A;  3C2L A;  1PX5 A;  4PGQ A;  3ER9 B;  1JQR A;  2RFF A;  4UB4 A;  4KLT A;  4F5P A;  5HRB A;  3UXO A;  4UB2 A;  1ZQP A;  2PFO A;  5CR0 A;  3PMN A;  3NYB A;  4PHP A;  3PNC A;  8ICT A;  2BCQ A;  2PXI A;  4YMM A;  9ICU A;  4NXZ A;  5J2E A;  1Q78 A;  5DED A;  2ZH1 A;  7ICO A;  4JLX A;  5HRG A;  5D46 A;  4MFA A;  2DRA A;  5HHI A;  3JCF A;  5J2F A;  4QZF A;  4KLI A;  2O1P A;  4AT8 B;  4NM2 A;  1ZQZ A;  9ICQ A;  5CJ7 A;  4NKT A;  4Z6D A;  4FHV A;  3AQL A;  9ICK A;  8ICQ A;  4AT7 B;  4XJE A;  2BPF A;  4KLL A;  2GA9 D;  3NWI A;  1OU5 A;  4RQ3 A;  2PFP A;  4WBZ A;  4KLF A;  4KLG A;  3UPS A;  9ICG A;  4EBJ A;  1BPD A;  3RJJ A;  5IIN A;  4EED A;  5HC9 A;  2ZH3 A;  3WFQ E;  4KLQ A;  4NXW A;  4UBB A;  3HJ4 A;  4R63 A;  4F5O A;  3OVB A;  4M9H A;  4RT2 A;  7ICI A;  1F5A A;  1JAJ A;  4KB6 A;  4XUS A;  5J0Y A;  2ZH4 A;  1RPL A;  4EEB A;  1WOT A;  2PFQ A;  1ZQL A;  4QZ9 A;  1ZQA A;  2ZH7 A;  4QZH A;  4WOY A;  5J0R A;  2BE3 A;  4P2H A;  4RWO A;  5HRD A;  7ICQ A;  4X4S A;  4RPZ A;  4M9N A;  4UB3 A;  3RJE A;  5HRE A;  3RJG A;  1BPB A;  4WQK A;  4QZB A;  4EV6 A;  1BPZ A;  1MIV A;  3HJ1 A;  9ICB A;  4I2G A;  3AQN A;  4IQW A;  3RH6 A;  8ICO A;  2ISP A;  5J2A A;  4KLM A;  1FA0 A;  2B56 A;  2BCR A;  1ZQC A;  4F5N A;  5J0Q A;  1BPX A;  4DOB A;  5D4B A;  5D49 A;  4RWQ A;  4I2E A;  2ZH5 A;  4FO1 A;  4M2Y A;  3C2K A;  3GDX A;  3K7D A;  4F5R A;  2BPG A;  4RPY A;  4FH5 A;  4X4U A;  8ICH A;  7ICL A;  4RWP A;  5IIM A;  3LQC B;  3ER8 C;  4JWN A;  4EGW A;  5D62 A;  5HR9 A;  3OVS A;  2M2W A;  5CFT A;  5J0W A;  1MQ3 A;  3H38 A;  2IHM A;  1ZQJ A;  3EF2 A;  4I2H A;  5IIO A;  4UD5 A;  2P66 A;  2PFN A;  4YD1 A;  5DB8 A;  1UEV A;  5IIK A;  4K4H A;  2B4V A;  1ZQK A;  2ZHA A;  7ICK A;  9ICM A;  2FMQ A;  4R66 A;  3MDC A;  2I9G A;  4O9M A;  4PHA A;  1ZQX A;  5TZV A;  1ZQQ A;  3B0Y A;  5IIJ A;  4FO6 A;  4P4P A;  4O5K A;  4WC6 A;  4GXK A;  1ZQD A;  4UAY A;  3ISC A;  8ICU A;  1ZJM A;  4YD2 A;  5IIL A;  5DDM A;  4UAW A;  4WC5 A;  5HRK A;  4OAF A;  7ICU A;  3MGI A;  4O68 A;  2O5A A;  5DKW A;  3UQ2 A;  4I28 A;  4WC2 A;  1TV9 A;  4MF2 A;  5D61 A;  5J2I A;  1BPY A;  2ZH6 A;  4K4I A;  3AU6 A;  4KLH A;  4UB5 A;  5DDY A;  3RJH A;  8ICP A;  3OWG A;  5DBB A;  5CFU A;  4QZA A;  3H39 A;  3HWT A;  4X4N A;  1MQ2 A;  3MDA A;  3C66 A;  4LVS A;  2FMS A;  3RH4 A;  5D63 A;  4WC7 A;  1ZQE A;  2DR8 A;  4K9A A;  7ICM A;  2HN2 A;  5DEC A;  3JPP A;  4UB1 A;  4MKP A;  3H37 A;  4X4Q A;  1JMS A;  3HIY A;  4TUS A;  7ICS A;  4PHE A;  3TFS A;  3RJI A;  4M47 A;  5J2K A;  9ICP A;  4AT9 A;  4TUR A;  4RQ7 A;  3JPS A;  1TVA A;  1NOM A;  4O6A A;  2ID1 A;  4NLK A;  1BPE A;  5DB7 A;  4TUP A;  4EP7 A;  1XSN A;  5J0S A;  1ZQI A;  4NXV A;  8ICN A;  4QZE A;  5CHE A;  4X4T A;  3AQK A;  4NY8 A;  4I2D A;  4NKU A;  3JPR A;  5CWR A;  3C2M A;  2VAN A;  8ICY A;  2W9M A;  9ICX A;  5BOL A;  3PML A;  4DOC A;  3C5F A;  4I29 A;  4NLZ A;  3OGU A;  7ICT A;  4P4O A;  4LEV A;  5B3Q A;  9ICE A;  7ICE A;  4NXU A;  4R65 A;  5DB9 A;  4E7X A;  5J2D A;  8ICZ A;  4E80 A;  4WQL A;  4E8F A;  4LZD A;  8ICC A;  4FHP A;  4QZI A;  5HHH A;  4LT6 A;  4MFF A;  4FHY A;  4YMN A; 
#chains in the Genus database with same CATH homology
 4MF8 A;  3HX0 A;  3OUY B;  4IQV A;  5BOM A;  4RQ8 A;  3RJF A;  8ICF A;  9ICW A;  4I2C A;  3OV7 A;  5DBA A;  4S3N A;  4X4O A;  5HRL A;  8ICL A;  4ATB B;  2Q66 A;  2M2U A;  4DOA A;  4O69 A;  1Q79 A;  3B0X A;  4NM1 A;  4QZD A;  4WC0 A;  9ICS A;  9ICR A;  4RQ1 A;  2FMP A;  3WFO A;  7ICH A;  5J0X A;  4Z6F A;  4QZ8 A;  7ICR A;  1ZQW A;  8ICE A;  4OAG A;  4AT9 B;  9ICC A;  4K97 A;  4IG8 A;  5DB6 A;  1R8A A;  4KLU A;  7ICN A;  5F2V O;  4NXX A;  1TFY A;  2M2T A;  1ZQO A;  4GXI A;  8ICW A;  3MBY A;  2GWS A;  4KLE A;  1R89 A;  3JZ0 A;  5CHG A;  3C18 A;  4K8V A;  3C5G A;  4WCW A;  1R8B A;  5J0P A;  4K9B A;  2DR5 A;  4XQ7 A;  4WBY A;  3AUO A;  4LEY A;  4RQ2 A;  4M0A A;  3MGH A;  3ISB A;  5CP2 A;  5CB1 A;  1RZT A;  3AU2 A;  2BPC A;  2DRB A;  4M9G A;  3JPQ A;  8ICS A;  2HHP A;  5J29 A;  9ICT A;  3OVA A;  4RQ4 A;  3UXP A;  1XSL A;  5EOZ A;  1ZQY A;  1ZQM A;  2ZH2 A;  4PGX A;  4I27 A;  4F5Q A;  4FHX A;  4M5D A;  4YN4 A;  1KDH A;  1ZQB A;  9ICO A;  9ICH A;  4MFC A;  4FHW A;  3L9D A;  4PGY A;  9ICI A;  4KLO A;  1ZQT A;  4P4M A;  4I2J A;  1UET A;  5J2H A;  3LK9 A;  4PH5 A;  4WC1 A;  4WC4 A;  1ZQF A;  4KLD A;  3K75 D;  1ZQG A;  3ISD A;  3JYY A;  1HUO A;  4IQU A;  7ICJ A;  4IQT A;  4O67 A;  3JPO A;  4X0B A;  4I2I A;  4KM5 A;  1TFW A;  4LZG A;  1HUZ A;  5J2C A;  3AQM A;  8ICV A;  4JWM A;  4YCX A;  1UEU A;  8ICJ A;  4EBK A;  4I2B A;  5III A;  4RT3 A;  1KNY A;  4JLZ A;  2ZH9 A;  5HRH A;  5J0U A;  4FH3 A;  4KLS A;  4X4P A;  5HRI A;  1ZQV A;  4I2A A;  8ICI A;  5J0O A;  4ATB A;  7ICP A;  2BCS A;  5J2B A;  7ICF A;  3HW8 A;  1YLQ A;  3WFP A;  9ICA A;  4KLJ A;  4LEW A;  1MIY A;  4TUQ A;  2BCV A;  3RJK A;  8ICG A;  1VJ7 A;  4O5C A;  3WFR E;  4M9J A;  4Z6C A;  1ZQH A;  7ICG A;  4K96 A;  4UBC A;  3RH5 A;  4R64 A;  9ICL A;  1ZQS A;  4K99 A;  4UD4 A;  1ZJN A;  4RWN A;  4RPX A;  1ZQU A;  4M04 A;  1R8C A;  4Z6E A;  2ZHB A;  2PBE A;  3UPQ A;  1JN3 A;  4AT8 A;  1XSP A;  3UXN A;  2ISO A;  5HRF A;  3H3A A;  4RQ5 A;  3TFR A;  7ICV A;  5J0T A;  5J2G A;  4M9L A;  4I2F A;  1ZQN A;  4NXT A;  4X4V A;  2M2V A;  3JPN A;  4QZG A;  4X0A A;  1VFG A;  3UQ0 A;  1MIW A;  2ZH8 A;  4WC3 A;  8ICR A;  1V4A A;  8ICX A;  4K98 A;  2B51 A;  3V7K A;  1NO5 A;  8ICA A;  5DBC A;  3V7J A;  4PHD A;  3WFS C;  4OAH A;  8ICM A;  2BCU A;  2DR9 A;  5BPC A;  9ICJ A;  2NRK A;  4XQ8 A;  1KEJ A;  3OUY A;  3JPT A;  9ICN A;  9ICF A;  4K4G A;  1ZQR A;  4O5E A;  9ICV A;  3V7L A;  4X5V A;  4NLN A;  8ICK A;  4YMO A;  4AT7 A;  4OAI Z;  4XA5 A;  5J2J A;  4RQ0 A;  4GXJ A;  4DO9 A;  4PPX A;  4LEZ A;  4QZC A;  4RQ6 A;  8ICB A;  2DR7 A;  2DVI A;  4X4R A;  4XRH A;  5CA7 A;  3V72 A;  4UAZ A;  3C2L A;  1PX5 A;  4PGQ A;  1JQR A;  2RFF A;  4UB4 A;  4KLT A;  4F5P A;  5HRB A;  3UXO A;  4UB2 A;  1ZQP A;  2PFO A;  5CR0 A;  3PMN A;  3NYB A;  4PHP A;  3PNC A;  8ICT A;  2BCQ A;  2PXI A;  4YMM A;  9ICU A;  4NXZ A;  5J2E A;  1Q78 A;  5DED A;  2ZH1 A;  7ICO A;  4JLX A;  5HRG A;  5D46 A;  4MFA A;  2DRA A;  5HHI A;  5J2F A;  4QZF A;  4KLI A;  2O1P A;  4AT8 B;  4NM2 A;  1ZQZ A;  9ICQ A;  5CJ7 A;  4NKT A;  4Z6D A;  4FHV A;  3AQL A;  9ICK A;  8ICQ A;  4AT7 B;  2BPF A;  4KLL A;  1OU5 A;  4RQ3 A;  2PFP A;  4WBZ A;  4KLF A;  4KLG A;  3UPS A;  9ICG A;  4EBJ A;  1BPD A;  3RJJ A;  5IIN A;  5HC9 A;  2ZH3 A;  3WFQ E;  4KLQ A;  4NXW A;  4UBB A;  3HJ4 A;  4R63 A;  4F5O A;  3OVB A;  4M9H A;  4RT2 A;  7ICI A;  1F5A A;  1JAJ A;  4KB6 A;  4XUS A;  5J0Y A;  2ZH4 A;  1RPL A;  1WOT A;  2PFQ A;  1ZQL A;  4QZ9 A;  1ZQA A;  2ZH7 A;  4QZH A;  4WOY A;  5J0R A;  2BE3 A;  4P2H A;  4RWO A;  5HRD A;  7ICQ A;  4X4S A;  4RPZ A;  4M9N A;  4UB3 A;  3RJE A;  5HRE A;  3RJG A;  1BPB A;  4QZB A;  1BPZ A;  1MIV A;  3HJ1 A;  9ICB A;  4I2G A;  3AQN A;  4IQW A;  3RH6 A;  8ICO A;  2ISP A;  5J2A A;  4KLM A;  1FA0 A;  2B56 A;  2BCR A;  1ZQC A;  4F5N A;  5J0Q A;  1BPX A;  4DOB A;  5D4B A;  5D49 A;  4RWQ A;  4I2E A;  2ZH5 A;  4M2Y A;  3C2K A;  3GDX A;  4F5R A;  2BPG A;  4RPY A;  4FH5 A;  4X4U A;  8ICH A;  7ICL A;  4RWP A;  5IIM A;  3LQC B;  4JWN A;  5HR9 A;  3OVS A;  2M2W A;  5J0W A;  1MQ3 A;  3H38 A;  2IHM A;  1ZQJ A;  4I2H A;  5IIO A;  4UD5 A;  2P66 A;  2PFN A;  4YD1 A;  5DB8 A;  1UEV A;  5IIK A;  4K4H A;  2B4V A;  1ZQK A;  2ZHA A;  7ICK A;  9ICM A;  2FMQ A;  4R66 A;  3MDC A;  2I9G A;  4O9M A;  4PHA A;  1ZQX A;  5TZV A;  1ZQQ A;  3B0Y A;  5IIJ A;  4FO6 A;  4P4P A;  4O5K A;  4WC6 A;  4GXK A;  1ZQD A;  4UAY A;  3ISC A;  8ICU A;  1ZJM A;  4YD2 A;  5IIL A;  5DDM A;  4UAW A;  4WC5 A;  5HRK A;  4OAF A;  7ICU A;  3MGI A;  4O68 A;  2O5A A;  5DKW A;  3UQ2 A;  4I28 A;  4WC2 A;  1TV9 A;  4MF2 A;  5J2I A;  1BPY A;  2ZH6 A;  4K4I A;  3AU6 A;  4KLH A;  4UB5 A;  5DDY A;  3RJH A;  8ICP A;  5DBB A;  4QZA A;  3H39 A;  3HWT A;  4X4N A;  1MQ2 A;  3MDA A;  3C66 A;  4LVS A;  2FMS A;  3RH4 A;  4WC7 A;  1ZQE A;  2DR8 A;  4K9A A;  7ICM A;  5DEC A;  3JPP A;  4UB1 A;  4MKP A;  3H37 A;  4X4Q A;  1JMS A;  3HIY A;  4TUS A;  7ICS A;  4PHE A;  3TFS A;  3RJI A;  4M47 A;  5J2K A;  9ICP A;  4AT9 A;  4TUR A;  4RQ7 A;  3JPS A;  1TVA A;  1NOM A;  4O6A A;  2ID1 A;  4NLK A;  1BPE A;  5DB7 A;  4TUP A;  4EP7 A;  1XSN A;  5J0S A;  1ZQI A;  4NXV A;  8ICN A;  4QZE A;  4X4T A;  3AQK A;  4NY8 A;  4I2D A;  4NKU A;  3JPR A;  5CWR A;  3C2M A;  2VAN A;  8ICY A;  2W9M A;  9ICX A;  5BOL A;  3PML A;  4DOC A;  3C5F A;  4I29 A;  4NLZ A;  3OGU A;  7ICT A;  4P4O A;  4LEV A;  9ICE A;  7ICE A;  4NXU A;  4R65 A;  5DB9 A;  4E7X A;  5J2D A;  8ICZ A;  4E80 A;  8ICC A;  4E8F A;  4LZD A;  4FHP A;  4QZI A;  5HHH A;  4LT6 A;  4MFF A;  4FHY A;  4YMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...